1RUI1

Rhinovirus 14 mutant s1223g complexed with antiviral compound win 52084
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rui100
2MEV3 2GH8A 1RMU2 3VBUC 1PIV1 1RVF1 4PDWA 2RS31 1C8M3 1VBE2 1D4M3 1EAH3 1VBA1 1RUI3 3VBHC 3VBOB 1RUC3 1K5MC 2Y26A 1PO12 4Q4Y2 2HWB1 1AYN2 3LOBA 3JD72 4NWVA 2RS53 1PO11 3JB8A 3M8LA 1RUF3 1OOPA 1H8TC 2WS93 4CDXB 1NCRA 2HWE1 3J8F1 1AR91 2RMU1 1C8NA 1NA1C 4CEWC 4Y4YA 1RUJ1 2PLV3 1ZBE1 1AR82 1HQNA 4IV3C 1ASJ1 4Q4X3 4GH4C 1PGL1 4PDWB 4JGYA 4N53A 4CDWA 1NY71 5AC93 3TN91 1NA1B 2RR13 4YVWC 5LK7B 1NG0A 2MEV1 4GMP3 4RR3A 4CDUC 2WFF2 5C4WA 1HRV1 4QPIC 1C8M1 5C8CA 1VBC2 4RHV2 1V9U2 4GB33 1HXS2 1ND3A 4YVSA 4WM8C 1OOPB 2R042 3DPRC 5L7OA 2BFUL 4RQPC 1POV1 4WM7A 4GMP0 4Z92B 1TME3 4RS5C 2RM22 3S6PA 1MQTA 1RB8G 5BNNA 1MEC3 2HWC3 5D8AA 5FOJB 1RUH3 1EV12 4IV1C 1RUG1 4Q4V3 5BNOA 1BBT1 2ZZQA 2WZR3 5CFDC 1AL22 1CD3G 1RUE2 4CDWB 2PLV1 1PO22 4Q4W2 2HWF2 1X33A 2R071 4RR3B 4Q4X1 3NAPB 5DDJ1 5C4WB 4N43A 2ZAHA 1QJU3 1RUD3 1QJX1 5K0UA 2FZ2A 1AL21 5C8CB 1WCDJ 1ZBA1 3VDDA 2RS12 4Q4Y3 1FMD2 4LLFA 4GMP1 1PIV2 4YVSB 3JD73 1AR63 3VBOC 1Z7S1 1R1A3 2RS32 2R061 1FOD3 5J96B 2WLPA 4FSJA 4AEDA 5ACA2 1MQTB 2HWB2 2XBO3 5D8AB 1VBD2 4CDXC 5BNOB 5ACA1 1TME1 1AYM3 1VAKA 1BEV3 3VBRA 1FPN3 2BFUS 1NCQA 1QJY1 1MEC1 2HWC1 1H8TA 5BNPC 1AR83 1AR73 1VBD1 1ND2A 2HWE2 3J8F2 2VQ0A 1AR92 2RMU2 5C9AA 3CJIA 5JZGA 4N43B 2WZR1 5K0UB 3ZFGA 1VRH3 1W39A 1DDLA 2ZTNA 1RUJ2 2WFF3 4PDWC 1ZBE2 3VDDB 5BNPB 1ASJ2 1M06G 3JBG3 1PGL2 1QJU1 1RUD1 1SMVA 1VBC3 4RHV3 1V9U3 1NY72 1HRI3 3TN92 2MEV2 4AEDB 1QQP1 1AR61 1HRV2 5CFCA 1R1A1 1C8M2 1R091 2HWD3 1FOD1 1D4M2 1OOPC 1PVC1 2TBVA 4CDQA 5A33A 1TMF3 3VBRB 4WM8A 3VBFA 2FZ1A 2XBO1 1NCQB 1D4M1 1EAH1 1R083 4JGZA 1NOVA 1RUI1 1RUC1 1ND2B 1VB4A 4QPGA 1PGW1 1IHMA 1AYM1 1CJDA 2BUKA 5C9AB 1BEV1 1F8VA 3CJIB 1FPN1 5JZGB 2BBVA 1PO23 3ZFGB 4Q4W3 2HWF3 4NWWA 1VBB3 2RS51 2WWSA 1AR71 1NCRB 1RUG2 1BBT2 1RUF1 4JGYC 4N53C 4CDWC 2WS91 4RR3C 1VRH1 3NAPC 3VBSA 5C4WC 3ZFEA 1B35A 1COV3 1PIV3 2PLV2 5C8CC 1RHI3 1RVF3 2R072 4CEYA 2QQPA 4Q4X2 3JBG1 5DDJ2 1QJX2 1VBA3 1ND3C 4YVSC 1ZBA2 4JGYB 1RMU3 4N53B 1HRI1 5A33B 2RR12 2DF7A 1E57A 5L7OC 2HWB3 3ZFFA 4WM7C 1VBE3 5J98B 3HAGA 1Z7S2 3VBFB 2HWD1 2R062 2X5IA 1PO13 4SBVA 5AC91 4JGZB 1MQTC 2RR11 1TMF1 5ABJA 5D8AC 1ND3B 1A6CA 1AYN3 3TN93 3VBUA 5BNOC 2BPA2 2HWE3 3J8F3 5L7OB 2XPJA 1R081 4WM7B 4GB31 3VBHA 1TME2 1K5MA 2IZWA 1QJY2 1MEC2 1ZBE3 2HWC2 5BNNB 1VBB1 3VBSB 4N43C 4Q4V2 1ASJ3 3ZFEB 1B35B 5K0UC 3ZXAC 4CEYB 4BCUA 3VDDC 1AL0G 2WZR2 1RUH1 4Q4V1 1COV1 1RHI1 1HRV3 3ZFFB 1QJU2 1RUD2 4AEDC 1NA1A 4CEWA 1RMU1 2X5IB 1QQP2 5ABJB 1VBE1 4IV3A 3VBUB 1AR62 4GH4A 1R1A2 1POV3 1R092 1BMV2 1FOD2 3VBRC 1HXS3 1PVC2 4Q4Y1 1NCQC 3VBHB 5A32A 2R043 4YVWA 1K5MB 1AYN1 4CDUA 5FMOL 3JD71 1ND2C 3IDEA 1BMV1 4QPIA 1RUG3 2XBO2 5C9AC 1EAH2 3CJIC 1BBT3 1RUI2 1GFF2 1RUC2 2RM23 5JZGC 1PGW2 3ZFGC 1AYM2 1BEV2 1POV0 1FPN2 1NCRC 1EV13 1H8TB 3DPRA 2RS52 4RQPA 1AR72 2R073 5DDJ3 1RUF2 1QJX3 1AL23 4RS5A 1RUE3 1ZBA3 2WS92 1AR81 1VRH2 4CEWB 3NAPA 5GKAC 4IV1A 5CFCC 1Z7S3 3JBG2 4RFT0 2R063 4CDQC 4IV3B 4GH4B 2RS13 1FMD3 5CFDA 2WFF1 1QJZA 1HRI2 3VBFC 2RS33 1HX6A 5A32B 4YVWB 4JGZC 4CDUB 1VBC1 5CFCB 4RHV1 1V9U1 2HWD2 4QPGC 4QPIB 1HXS1 5ACA3 5AC92 4CDQB 1TMF2 4Y5Z0 2R041 3JB4C 4FTBA 1QJY3 4EJRA 4WM8B 3VBOA 1VBD3 2GSYA 3FBMA 1R082 3DPRB 4GB32 2RM21 4RQPB 5FMOS 5BNNC 4QPGB 1OHFA 3VBSC 4RS5B 1EV11 3ZFEC 1B35C 1AR93 2RMU3 4CEYC 1VBB2 4FTSA 4IV1B 4CDXA 1VB2A 1RUE1 4FTEA 1RUJ3 1AUYA 1OPOA 1X36A 1PO21 1RUH2 4Q4W1 2HWF1 3ZFFC 5CFDB 5BNPA 1QQP3 1COV2 1F2NA 1RHI2 1RVF2 1R093 2X5IC 1PVC3 2RS11 1FMD1 1VBA2 5ABJC
chains in the Genus database with same CATH superfamily
4LBMA 2W0XA 1S0EA 3VBUC 3EB7A 1LTEA 2I2SA 3M3QA 4CXYA 4Y1YA 5T3NA 3AB0A 1V6JA 2I07B 2QDNA 4L9BA 1RUI3 3VBHC 4JDNA 3VBOB 4AGRA 2Y26A 2VBDA 3B3QE 3IKWA 1PO12 1F15A 3M3CA 1LODA 1Y43B 1ZZ7A 3PU3A 3CL1A 4QKBA 2DU0A 4O7XA 1KD7A 3A7QA 3VN4A 1N1SA 1S1AA 2HWB1 1W03A 3ZFEB 3MLKA 5C6CA 3TEZA 3AC0A 4HKWA 1MS8A 4QKNA 2WR9A 2HEYF 2PMWB 2GH2A 4LKFA 3U75A 1RUF3 1X8MA 2GP5A 5EJ3A 1GP6A 1E5IA 1UX6A 2EF6A 3I2KA 3PUQA 1FV3A 2WS93 5FMBA 2AYHA 5ANNA 4H55A 1QMJA 3SH5A 3VGIA 1DZTA 2TEPA 3U07A 1NCRA 1YFXA 1Y3TA 1AR91 2ZGUA 4UW5A 5CZKA 3RDIA 4ET7A 3C2UA 2B9VA 4OZOA 5L19A 3POEA 5FZOA 4X6QB 5BNQA 1OF4A 1VPHA 1I5ZA 2QQMA 2LUWA 4NRQA 4UFJA 3C3VA 4PF1A 4URTA 1ZBE1 1AR82 5M0TA 2R7EB 2Y33A 2JDAA 2ZHMA 3O7OA 4JQTA 4CP1A 4RFRB 4E4SA 4OULA 3HT2A 4KWUA 4Q4X3 5H9SA 1OQEA 4HN1A 1PGL1 1QWRA 4BM8A 3SITA 4NE9A 2J1VA 5FYMA 2WNEA 2HEWF 5LA9A 1GMMA 4N53A 2OS2A 3OOXA 1LU2A 1LNSA 4CDWA 2FDFA 4YRDA 1NA1B 1HQWA 4CDUC 1MZFA 1X50A 3P3NA 2YBPA 5A7SA 2V73A 3RG0A 1Y9QA 4RGAA 1C8M1 3I54A 1DZRA 1VMHA 1DF0A 1QY4A 2Q1MA 2VL4A 3BB6A 3H1YA 3Q8BA 4CXXA 5A70A 3SHRA 2FCVA 3C8XA 1ULEA 4FPFA 1ND3A 3AZXA 1C4RA 2DVAA 4A2UA 1UY3A 1OOPB 4J1WA 2VOVA 1XSQA 5LEKA 1GQHA 2E26A 2E9QA 3BPZA 4NAOA 3WQ1A 1UZ0A 2WT0A 3DPRC 4RD7A 5L7OA 2BFUL 4MUVA 4RQPC 1POV1 4WM7A 4DINB 5FLJA 4GMP0 1W8NA 2VPVA 4P02B 3UETA 5JXJA 2Y6FA 4Z92B 5FO8B 3M3IA 4QPWA 1TME3 1BKZA 2IFWA 2WAAA 3H3UA 2VMDA 3JXSA 4RS5C 3WEZA 3S6PA 5FXWA 3WNPA 5B4NA 1U5YA 1RB8G 5DG2A 2AENA 4O61A 5D8AA 4JCKA 5BNNA 5CKQA 5FOJB 4IV1C 2VCAA 1PK6A 4XOGA 1BBT1 3PUAA 3HR9A 1XYNA 2CL2A 4HVRA 2HBUA 5F6LB 1UYXA 5L9VA 1G7YA 2VUDA 2VJXA 4IEZA 5CG9A 1LOFA 1OUXA 2EIEA 3PUHA 3ZDVA 4W6XA 2PLV1 5JPMB 1H9PA 3T2PA 1C1FA 4Q4W2 4QU1A 1AZDA 3TOJA 4LHLA 4XUPA 5DDJ1 4N43A 1LGBA 2VO5A 2ZAHA 1AL21 4QX8A 2D7FA 2QTWB 2RDRA 1WCDJ 4E2QA 1KS5A 1DCSA 2A70A 3RZMA 2YC2A 3SMHA 3THTA 4NN0A 3BTYA 3VD7A 1FXZA 3U10A 5JSPA 1PIV2 3POFA 4YVSB 2BV4A 5CA6A 1QXRA 4RYDA 2WN3A 1J3QA 2JE7A 3ON7A 2R061 1PM4A 1FOD3 4LO4B 4QDSA 5FZ9A 3WVJA 5C70A 1XB9A 3PMSA 5EWSA 4DXRA 1IS4A 3GGLA 5IHRA 1OLQA 2OQ7A 5I8TA 3MV01 2GNBA 3P5BA 4AEDA 4FVVA 4P9GA 5K7PA 2WO3A 1XU2A 5I93A 3FC0A 3NO8A 4SLIA 2ZXQA 5J09A 1MQTB 5LBEA 3WINE 2RDNA 2ZA9A 4K40A 4AF9A 2D93A 3I3MA 2A6WA 2WQ8A 4WVMA 4CCKA 2XL7A 3MIBA 1Q8OA 3NNMA 5FYHA 5GZDA 3VBRA 1FPN3 3ALQA 1RXGA 2B9UA 4YLZA 3LGRA 1IKPA 2J1AA 1KITA 3PVNA 1QJY1 3VDBA 1H8TA 4FBFA 1AR83 5JOZA 4KG0A 3MFAA 5HCFA 2HWE2 4DO0A 2WRAA 1ENSA 1OA3A 4D8MA 4TTGA 4K8RB 4AQ2A 2TNFA 5LBCA 4LBOA 2WYSA 4FT8A 2PHXA 2WZR1 5K0UB 5EP9A 2ADEA 1VRH3 3DEMA 2ERFA 3VV1A 3ZKYA 1W6NB 3BN6A 4HK9A 1FAYA 4LBKA 3R6SA 1DDLA 4PDWC 1S2EA 2XKPA 3AXDA 1OVPA 2Y0IA 4Q27A 1YFUA 2P2KA 3JBG3 1NQJA 1BK0A 3WG2A 1QJU1 3AP7A 1IZ3A 3K77A 3O14A 5JCTA 5LZ6A 1S0CA 4GWNA 2XH6A 4QX1A 3OG2A 2GMMA 1J84A 1SFYA 1W9TA 2PAMA 1UX7A 3ETQA 5JXIA 2VCCA 1UPIA 4BQYA 2MEV2 3RPQA 1OI6A 1BLZA 1QQP1 1D7PM 1SLTA 4R8HA 1OA4A 2XMLA 3BGAA 2V4AA 3HVDA 3NKGA 4FOQA 4XEZA 2HWD3 4GIQA 3GZAA 1D4M2 3JU9A 3KCXA 4CDQA 3LOIA 5A33A 4QB2A 3B7MA 1LB2A 2DBNA 3QBQA 3WNNA 1TMF3 2XVLA 4C90A 5FO9B 2VNGA 1SQ4A 2Z42A 4COYA 2WZPP 4OI1A 1NXD1 5I8YA 3ZR5A 2B8MA 3GBGA 2XBO1 1NCQB 1V0AA 3CU7A 1XNDA 3LIGA 5T5JA 3AZWA 3UT0A 1NOVA 1RUI1 2PN5A 2ZZJA 4UAPA 1CX1A 1ND2B 4C1WA 4N7IA 4RL7A 4FPJA 1L7LA 1PGW1 3DL3A 3BKZA 1AYM1 3KSCA 4GKXA 4Y1UA 5C9AB 1F8VA 3CJIB 5JZGB 2BBVA 3MIGA 5GZEA 2C5DA 3AVRA 1XXNA 4Q4W3 1AX1A 3CQOA 4NHYA 3WUDA 3L2YA 3T1LA 4JHTA 4EN0A 1RUF1 4V2VA 4AVCA 5I0UA 5HXVA 2WS91 4D6RA 2XJTA 1KS4A 1US2A 1UW8A 1W0OA 2J1TA 1ZZ6A 3G7DA 3QH7A 1C28A 5DAQA 4COZA 2PHRA 4HVOA 1JUHA 1PIV3 3AKQA 2AZ5A 3ZPYA 1UXXX 1QEXA 1RJ8A 2BW8A 2EALA 4XZUG 2YUEA 2R072 2YC0A 5FYSA 4LT5A 4QT6A 2WSVA 3WQ0A 4AVVA 1VBA3 4FFIA 1ZBA2 4CU6A 5KR7A 5A1LA 1DQ6A 3X29B 4N9IA 1S4CA 1NUKA 4JKLA 5DUXA 1JZ6A 1I5PA 2RR12 1UYPA 3GBWA 2OIIA 2NZ9A 2ZX0A 2WZ8A 3OTFA 2Z2SB 3WLUA 2RJ2A 2NYYA 4XBQA 1D0HA 1DGWA 1UZZA 4NUBA 5J98B 3RFRA 1O3QA 3WY6A 3E6DA 2GAUA 1VMJA 3AM2A 4SBVA 2X05A 3WF2A 4B1LA 3NNLA 3H7YA 4F7ZA 3A22A 3AKPA 5EPAA 2FDGA 4A41A 5LA0A 2VQTA 3SC7X 1AYN3 2MPFA 1JS9A 3VBUA 1G6NA 1WZXA 5BNOC 3MO4A 4B4RA 5L73A 2OPWA 3UGGA 2HWE3 5BXXA 4YWAA 2FMYA 5DABA 5A7QA 2IC1A 2RHPA 3WNKA 4M01A 1W8ZA 3GZUC 4OLLA 4Y22A 3VBHA 1W6MB 5IAXA 1NAEA 3MW4A 2Z79A 5IVFA 3HQXA 2XJQA 3CHXA 5A3LA 3MV11 3APBA 5FPAA 4NIAA 3HN3A 4QXCA 1JYNA 2IZWA 2JG8A 5T50A 1MEC2 2HWC2 2YPJA 1CVNA 2ZGSA 4LK7A 2YBSA 5FYZA 1PGSA 1ACCA 2CDPA 2OW4A 1IKQA 3VL9A 3VZKA 1N1YA 2WAOA 3BTAA 1REEA 4N7UA 1S0FA 4HFSA 5E8AA 5SV8A 3VDDC 1S55A 3I7DA 1MR5A 2J42A 3T2QA 4KU8A 2CDOA 1COV1 2ZHLA 4NAMA 4OI2A 2Y38A 1Y9GA 2VTXJ 1TQ5A 2YY1A 1YWKA 4BOWA 1RUD2 5FYTA 3SQOA 4YARA 2AACA 1GUIA 2P5BA 2X5IB 3O1OA 4I0BA 2YFZA 5JDBA 2LALA 2J1SA 3MIEA 5ABJB 2IVJA 3OBZA 1OC1A 4ATEA 3RMYA 4M4RA 3LAGA 4CCLA 3GM8A 1R092 1EYBA 5ERLA 5F5IA 1HXS3 1LOGA 4MGIE 1E5RA 3VKFC 3ZXLA 1M4WA 3QACA 3GALA 3L9JT 4LUKA 4UI9L 2VUJA 5A32A 2R043 1ZZ9A 5F2WA 1BMV1 4CDUA 3S57A 1LEDA 2E7QA 1CN1A 1SG3A 1CZSA 4AHZA 1YCIA 1Z0HA 4QGLA 2ZBJA 2C24A 1GKBA 3W58A 4LK6A 1QOOA 1HV1A 2ZMKA 1S0JA 3DKQA 5FYIA 3B9IA 4CU8A 3ZFGC 1PNFA 5HPOA 3CLPA 4LBNA 1NCRC 3MHZA 2GN7A 1KEXA 3EYPA 3N7JA 1GNZA 2HJIA 4OCTA 1QOTA 4P00B 1UPSA 4U2AA 2C4XA 2D3SA 3DPRA 2VMFA 4RQPA 2R073 3FJSA 4PBPA 1ULGA 3MW3A 3OBAA 3HNMA 1OD5A 4RS5A 5K9YA 4BIOA 3ZYPA 1RUE3 2VXRA 1ZBA3 1DGRN 1VE0A 4GA9A 1AR81 3CNAA 3CBNA 5T52A 4FOYA 4CEWB 1GNHA 1HKDA 2VMHA 2WUHA 4AYUA 2R49A 2JG9C 1SLLA 4IV1A 4RSUA 2XJRA 5KC5A 5GLZA 1QH6A 2VZ1A 4QKDA 2KA3A 1JYVA 1YI7A 3CJXA 4IV3B 1SACA 2RS13 3HT1A 3OJBA 1W28A 5DAWA 4PF5A 5FKBA 3POYA 3SXWA 4CCDA 3CZJA 5FQ0A 2BU9A 1YIPA 2O0OA 4XXPA 3BPSA 5FFOC 3VBFC 4DUVA 3I2FA 2NN8A 1HX6A 4QHOA 5E16A 3WT3A 3WW4A 5J1XA 4MYEA 2BNOA 3S5QA 2B4KA 2XDVA 2MHFA 3AJZA 2Q5TA 3H0OA 4GWMA 4NIIA 3BU7A 4QPGC 2Y34A 4BPZA 4J6GA 4QPIB 5FLIA 1LHWA 5ACA3 5JR2A 1E5SA 3LFIA 5AC92 3SKVA 3NJYA 4ASMB 3I2JA 2PHFA 4CXWA 3OPTA 3JB4C 2TUNA 2AR6A 3E97A 3MF9A 1W8TA 5FIXA 4NO4A 4UF0A 4YFWA 1WLCA 4HPKA 2AEYA 5JIAA 4YM3A 3IDAA 2OUJA 1ULDA 2ZHKA 2HLEA 4LO6B 3OUJA 1EP0A 3M3OA 5DUUA 2ZEXA 4LHKA 3AYAA 3O1PA 2NMNA 5C33A 4P08A 1C1LA 5FMOS 3RWNA 3NSTA 5BNNC 2R6QA 3NJZA 2DVDA 1UOFA 3KHBA 1ZNPA 1PK6C 1B35C 2JD4A 1UY2A 3HNYM 1SDDB 4GJYA 4QXBA 3THCA 4AEJA 4QGNA 4DRVA 1AR93 4XUNA 1FYUA 4AHWA 1NE4A 4I3GA 4HVQA 4WZCA 5A6XA 4NJ4A 4BQ4A 1VBB2 2C6SA 5KHKA 1MS3A 2WYFA 2FMDA 2I74A 2ZAAA 1ZM1A 1S2KA 4XIOA 3NWKA 2JDMA 1RITA 3E5UA 3VZMA 1QKQA 3SKJE 2QZ3A 2WWJA 5FZCA 4PLOA 1RUH2 1NZCA 4Q4W1 5JOXA 4K8FA 5CFDB 5A1AA 3M3EA 1RHI2 1RVF2 4QQPA 1JYXA 1R093 2EVXA 3Q9OA 4LBQA 4JRLA 1RUNA 3HD8B 5F5CA 2HEVF 3N9QA 1E5HA 3FLTA 3MIFA 2QUOA 2ZCWA 1PIV1 5IVBA 1ONAA 4PDWA 2Y0OA 1C8M3 5FZIA 2UU8A 4LHSA 3N9LA 5FYUA 3NRUA 1VBE2 4BYYA 1VBA1 1K5MC 3B01A 4AI1A 2YG0A 5F5QA 5FUIA 4B7KA 4Q4Y2 2YB7A 4JDOA 3CMGA 4NVPA 5FUPA 3E5XA 1K3IA 4C91A 4DMIA 4NHKA 2WSUA 1KDMA 2BP6A 4XF0A 4FOWA 2WN2A 2DYCA 3JQWA 5FP7A 4KQ7A 1K5JA 3JD72 3BALA 4NWVA 1YEWA 2Q8CA 4XDOA 3THPA 3WP5A 3OUHA 5I0RA 2C0ZA 1X82A 1GOGA 1CZTA 3I3DA 1ZZ8A 2P34A 3V65A 1H8TC 2JKXA 3LA3A 4J25A 3MDPA 4YGDA 3FE5A 5ANQA 1J83A 2SLIA 1PMIA 4E9KA 2PQSA 2HWE1 4Q0PA 4EZ4A 4FP3A 3LEIA 2ZX3A 5A80A 3T0AA 4QU2A 1XYOA 5LATA 1QF3A 4ES8A 4MLOA 4COVA 2VZRA 1BK1A 1NA1C 1QOSA 2X09A 4XAAA 5HCHA 4NHXA 3D0SA 4YG6A 2XOMA 1QXPA 4Y4YA 3URFA 4MXWB 2PLV3 3BOPA 3I3BA 4ASKA 1H9WA 4AEKA 3MICA 3LZZA 2CWMA 2OZ6A 3AP4A 3NQHA 2Q1ZB 4AQ6A 1YQ5A 4A7YA 1XYPA 1QNYA 4YGCA 4HONA 1GWLA 3U11A 2P4EA 4JV4A 1LU1A 4L2NA 3ES1A 5AC93 1CONA 2ZX1A 3AMHA 3QD6A 3TBDA 1NG0A 1UAIA 1US3A 1LOAA 2MEV1 2X53S 4CCOA 3H8XA 3LKJA 1UKRA 5BPXA 4MX3A 2BNMA 4Y5SA 1YLLA 5JLVA 3BTXA 1HB2A 5A3TA 2IVIB 3U78A 5FZEA 1HB3A 1K45A 4AK3A 3HWJA 1V9U2 1MPXA 1WCSA 1UL9A 3PUIA 2Y60A 4HN0A 3BIWE 2X8KA 5F39A 2BGPA 3K4AA 1CZVA 2AGSA 4Q0VA 4R9BA 1CIYA 1UD1A 5FWJA 2A73B 2PHWA 2VOWA 5A7WB 5JVVA 4AR2A 2WNOA 1BCXA 3ZXEA 1MACA 2WNVA 3ZYRA 5T5PA 2K2SA 4QD2A 2QNKA 3AVSA 1RUH3 1EV12 1YQCA 5LBFA 3WW3A 2W91A 5I8SA 1FNYA 4FPCA 4Q4V3 5BNOA 2VMGA 2ZZQA 3H1WA 2XG3A 3ZXJA 3EO6A 4QQOA 4QM8A 2Z5WA 4E2GA 1H1MA 1SBDA 2W46A 3RJ2X 3KMHA 1L7QA 2ETEA 3USUA 4K9SA 1XC6A 3IDBB 5AFEA 2WZR3 2RJLA 1OVSA 4XE9A 5LW9A 2VECA 4XQ4A 4EN8B 2W3JA 2AREA 1KGYA 5DG1A 4CDWB 3VD5A 1LOEA 4PIYA 4YW4A 2BDRA 1X33A 2R071 2W2IA 2XONA 3NAPB 5JIUA 1XPWA 5A7PA 5FWEA 1XSRA 4YZ5A 1QJU3 1FATA 2D40A 4YW5A 3EBRA 4JTOA 2A71A 4FFGA 3ATGA 1ZBA1 1L3JA 2VBBA 3NNFA 5HI0A 2YFUA 3VDDA 4Q4Y3 1H4GA 1AJOA 4JHZA 1PX4A 3C7GA 4GMP1 5LCWL 3RYRA 3JD73 2RS32 4JC1A 3JZVA 2A3WA 1UY4A 1P8JA 5F7UA 1XNAA 3H7JA 2CGNA 4E8DA 4XUQA 3LEGA 3PJQA 2XJPA 3I3EA 3F95A 5BUVA 4YZ2A 2WC2A 2A6XA 2XVGA 4ISQA 3VZJA 5T5LA 3WUCA 3RSJA 2BGOA 4YG3A 2XBO3 4DFSA 4XIKA 5D8AB 5ISLA 5KHHA 3ACGA 2EXKA 5IVJA 2VCMA 1VBD2 2JE9A 3TEXA 4CDXC 3EJKA 1JYWA 5ACA1 5EQUA 1QIQA 1AYM3 1W6PA 1MS5A 1VAKA 1YHFA 2PXJA 4S2FA 1A78A 5F9TA 3V0AA 1UU4A 2JG8C 4MV2A 1GYKA 3UL2A 2ZACA 4H3WA 4IDZA 3VHOA 4D7SA 2X10A 4R9AA 1MEC1 1XNCA 2HWC1 2SBAA 4M3CA 4FCAA 5KWRA 4W8JA 3J8F2 5IWFA 2VQ0A 1PNGA 2VW1A 3B69A 2X29A 3QOPA 2WNUC 5EJ1B 1SCRA 3ZDSA 4DXZA 5JSOA 2CGPA 2JXAA 5F3CA 4N43B 1CAWA 2IXJA 4MADA 2RVAA 2NMOA 1MVEA 2C26A 3ZFGA 3H8OA 2WA3A 1JZ7A 1RUJ2 3K3NA 2A1XA 1BYHA 1I1EA 3DUIA 4YYOA 3PL0A 2YZ4A 1ASJ2 4XDQA 1X8EA 2H6CA 1RUD1 2CY6A 4BU2A 4UFHA 4PIZA 5C3PA 1V9U3 4KWLA 3AYEA 3C7FA 3IB3A 3KGZA 1NY72 3POIA 1W3VA 4IXLA 4QGMA 4UW6A 4XCBA 1V6KA 4AEDB 2EA7A 4EN6B 4PHZA 1GR3A 4AI2A 5FZ8A 4IEUA 2JG9A 5A7OA 3KHCA 1JHNA 1R091 3WF3A 4QX5A 2DV9A 4AFMA 3TNPB 4FP2A 1DQ1A 2W5FA 5FZ7A 1R64A 2ZGQA 4Y3OA 5A7NA 3T1MA 1CQ9A 2J7MA 4FXKB 4V1PA 3ZN4A 4P9IA 4BLJA 5KXDA 3RZKA 4WVMB 3HBZA 4XTPA 2UWAA 5AFBA 3MGUA 1S0GA 3VBRB 1YFYA 4LPLA 4WM8A 3VBFA 4JKMA 4BQXA 3UGFA 4UBGA 1YRZA 2E31A 4QPGA 4HKOA 1CJDA 2ORZA 4R9CA 4IL7A 3LIHA 2JB8A 2YDEA 2EAAA 3N7LA 3WW2A 2Y6KA 1UF2C 3OGRA 1I3HA 4DY3A 5CEHA 3ACIA 4NWWA 1WA6X 3WP4A 5EFUA 1RUG2 4Y1XA 2WO2A 1Q8QA 3NJXA 3BOWA 4LO7A 2K46A 4C0HA 4CUAA 3BI3A 4CUGA 4QHZA 4RR3C 5I0DA 2JDPA 2W92A 1HJFA 3KV5A 3VHRA 5C4WC 2QZ2A 1B35A 1COV3 1IGOA 1TEIA 4V2WA 5C8CC 2VZOA 3LSEA 1H4HA 4M00A 3ZO0B 4ZY9A 1QJX2 4YW7A 1HIXA 2VMEA 3WZ1A 4JGYB 4NPRA 4XF1A 1WMXA 1JN2P 2DVFA 4HBNA 4MVTA 5A33B 1DQ4A 4A44A 2ZPXA 1E57A 1BVVA 3AL5A 2VY0A 4L0PA 2ZGOA 3RQ0A 1Z7S2 3JCIA 3NNGA 4FPYA 4KH9A 4QAWA 1W04A 3WQ7A 4A3XA 4B8EA 3VD9A 1WKYA 1PO13 3K46A 1HDKA 4XJZA 5AC91 1YQ6A 4QKFA 4FI9A 4GD4A 4MHRA 5FZ3A 4KWJA 3K2OA 1JI6A 1A6CA 3KCYA 4MZUA 1VALA 2IXCA 1UYYA 4ARXA 4OQ8A 3RYPA 2P37A 4AI0A 1IPKA 2OPKA 5CKMA 3OPWA 3J8F3 1BHGA 4OYUA 4COWA 1VIWB 4EWDA 1VAVA 1CAUB 2ZGPA 1K5MA 2LTNA 1AX2A 4N90A 3POWA 1K12A 4LMFA 2G9ZA 3ITQA 4YW6A 3WDVA 3J7LA 4ASLA 1ZRFA 4JVAA 4BA6A 5K8SA 1S0DA 3WDUA 2C9KA 1UO9A 1VBB1 3KV6A 2EICA 1XJAA 1ASJ3 1QXJA 2JWPA 4BDVB 1QGLA 4HANA 4LA3A 3ZXAC 5IFPA 3ILNA 4K7JA 4IE0A 4JQRA 3ETPA 1GLHA 3E6CC 3J7NA 5T54A 4BXFA 4XF3A 1AL0G 3FUOA 4FQ4A 3O1SA 1IOAA 1RUH1 2CHHA 1OQ1A 1U12A 2ZGTA 4Q0UA 4FAHA 4YFZA 3TWIA 4Q4V1 3WSOA 2BVBA 2BZDA 5F37A 4L99A 3BODA 3N9MA 4DEQA 2PA7A 3WF1A 1KFXL 1RHI1 4E4DX 4DUXA 4XAEA 2P3KA 5J48A 1XOYA 5E6HA 4M0NA 5I0SA 1U0AA 5A3OA 3POBA 1ULCA 1NA1A 2PHUA 2VH9A 4LULA 5L9RA 4IE5A 4XZPA 1RYYA 4MHUA 2DUQA 2XKOA 2E51A 3FFQA 5FZBA 1FNZA 3KT4A 2ZS6B 4F83A 3E5QA 5HXMA 1VBE1 3RVHA 3VBUB 4K21A 1AR62 4WVWA 1R1A2 5FXZA 5GZGA 2GNDA 2VR4A 3I2DA 4HK8A 2ZHNA 2FBEA 1PVC2 1RL3A 3OEAA 4LKEA 4PQ9A 4Q4Y1 5L9BA 3UNPA 3D3AA 3LEKA 3KB5A 3LF7A 4UFKA 4OUSA 4Y22B 2GC0A 1W6QA 5LY2A 4UT5A 2LRPA 4KL1A 3VBHB 3WDXA 3IWZA 1O8PA 3WV6A 2D6OX 3B93A 3JD71 4CU7A 4ISRA 5FO7B 4F8AA 1DQ0A 2YROA 2RE9A 2BERA 1RUG3 2WZEA 3GYDA 3IDEA 4ZKTB 1EAH2 1OLME 3NNJA 5CISA 5JMCA 4B1MA 1RUC2 2WJSA 5I91A 4WBBA 1W6OA 2ZKLA 2P6CA 1BEV2 1H1IA 1POV0 3D82A 3KVAA 3TYJA 5LASA 3VKMA 1X7NA 2W08A 5FZGA 1W90A 1IS5A 3BYWA 1JZ2A 3ACHA 3SCFA 4E4HA 3SNMA 4Z8BA 3W21A 2RS52 3EMRA 1AR72 5TSWA 4IEVA 1O4YA 3WG3A 2R0FA 1QJX3 5FP4A 1NYWA 1D0GA 3Q8FA 3ZN6A 3AKSA 4G9SB 1DLCA 1OBNA 2VMIA 3R0RA 4I09A 4QDRA 4LNVA 5F3GA 1G9AA 4MO3M 3AP6A 4ZU4A 3T09A 2K0GA 2V4VA 1ZRIA 2ZJCA 3TNQA 5EYXA 3N9NA 5CBLA 5GKAC 4Y1VA 4B4PA 3O1RA 4PJYA 3ENRA 4PLMA 1Z7S3 3V56A 4AQTA 1KRIA 3ELNA 1AXKA 1GP5A 1UOJA 3GJAA 3ZYHA 1YFWA 2JDHA 3WNLA 1QJZA 1OSGA 2JIJA 1HRI2 1ZX5A 4IEYA 4CVUA 1W2TA 5FK8A 5LWBA 3KVBA 1LENA 5A32B 1AHSA 4TSVA 4JGZC 4CDUB 2Q8DA 1ULPA 4E27A 5CFCB 1V9U1 1JW6A 4XBLA 1VR3A 1SPPA 2W39A 1F9KA 4BXSV 5LRRA 2EIBA 3MI8A 3SLIA 2D5FA 4Q0QA 1QDCA 3GBFA 3OEBA 4W6YA 2VUCA 3TAYA 4GALA 3ASIA 5F3EA 3H42B 2XJVA 5IAVA 3WG4A 5LEJA 1R082 3DPRB 2WNVC 1GP4A 4GB32 3VDAA 3ZSMA 1TZOA 4RQPB 1LECA 1D2QA 1QHDA 3ZSKA 2CGOA 3ABZA 1I9RA 4ZU7A 3VBSC 4RS5B 1EV11 3ZFEC 4D6SA 3GF6A 4IEXA 5D21A 4LIVA 2G9GA 3MBWA 4AHXA 4CEYC 4EYUA 1LOBA 2BOIA 2VZQA 3DECA 4IV1B 4XFIA 3M4FA 3F2ZA 4CDXA 1RTVA 3WQBA 5JR7B 2VUAA 4KU7A 1SDWA 2D98A 4YSFA 4NOTA 3DYOA 4LXLA 4FTEA 1AUYA 3RGBA 2ENRA 1WCUA 1A34A 2YYOA 3UKVA 4LO5B 3LWCA 2VOKA 3ZFFC 4LKDA 3ZX7A 3WNOA 2G4IA 5J7MA 2VNOA 1MS1A 3D4KA 2XLGA 4G4FA 4BQWA 1GQPA 2ARAA 4I0AA 1HB1A 5EXOA 4CPBD 3VD4A 2WNUA 3RZLA 1IPSA 1PVC3 2OZJA 3S7IA 5FY5A 1HB4A 4LORA 2NP0A 4C0BA 4WVZA 2MEV3 1RMU2 1JZ8A 2CNAA 4LR4A 1KXGA 1JZ4A 2C9AA 1X9PA 4LBLA 2RS31 4OFGA 3T4HB 4KGGA 3UK9A 4B3NA 4HETA 5FTTC 1D4VB 3T2OA 1D4M3 1EAH3 1MZEA 1PMHX 4CP2A 4AXOA 2WINB 1J58A 2DFCA 1F5JA 2YC4A 4HPKB 4UF0B 2XB6C 1RUC3 4BQ2A 3JQXA 2J1RA 5E88A 2QQUA 4HKLA 4M0HA 3VZNA 4QX3A 2VAUA 3BVCA 1GWKA 1KQRA 5IYYA 1TE1B 4A45A 4ZHNA 2VXJA 3S30A 3WP3A 3ZXKA 2A6YA 1GZWA 4W50A 5EHDA 4EROA 4JAAA 4NMIA 4CCJA 4DZGA 1Q8PA 1ZRRA 2RS53 1PO11 3JB8A 1GSLA 3M8LA 5SV5A 2A6VA 2ADDA 4WZFA 5EV7A 4DOUA 2I45A 2XR4A 4XC9A 2QVSB 5JI7A 1BQPA 1TVGA 2J1EA 3BIEA 4COUA 2JECA 4AG4A 3FLPA 2YXSA 4XQDA 2YGMA 3J8F1 1URXA 3ROUA 4CUBA 3KS7A 5JWPA 1H8VA 4AFAA 3BU0A 5DZEA 1J59A 1UNBA 2BNNA 4Y20A 4BMEA 4L8QA 3WXPA 2W94A 1VMFA 4QHBA 4B4QA 4YGBA 5FRAA 3V0BB 3DXTA 2RG4A 5CG8A 1SZBA 4A6SA 3J26N 4N9HA 3RS6A 1RUJ1 3AMMA 3I4IA 2QQKA 2VZTA 2AH2A 5D1IA 3N7MA 4YNIA 5LA2A 1RXFA 4CCCA 1HV0A 3P6BA 3R4DB 4I2OA 1ASJ1 4LITA 4GH4C 5FMCA 4CPBA 5IVEA 3U0ZA 4PDWB 4CCNA 4XETA 3ZN5A 2QQWA 3WHTA 5KXCA 4WVVA 4XHBA 1F4HA 4AGVA 1NY71 2O14A 4QQLA 2RR13 4YVWC 5CKNA 4GMP3 4RR3A 5LK7B 2E32A 1H2NA 3PVBB 4UYBA 5C4WA 2VZPA 1REDA 3PVEA 3I59A 3O0WA 5CAZA 4RA0A 5C8CA 3N4MA 3H9AA 4LUMA 3QLQA 5FBJA 2XQXA 4HT1T 3OGVA 1GNYA 4LBQD 4GB33 4YGEA 3UV9A 1QJEA 4PQQA 5CB7A 2D43A 1O6UA 3J9SA 2ZEYA 2CYFA 4D0QA 3PIGA 4WM8C 1SCSA 3VHNA 5FXXA 3LQCA 3K4DA 2IXIA 2XUEA 2Q1FA 3DKWA 3IIAA 1OLRA 5BYNA 3WNMA 4BK4A 4HZFA 3FBYA 4E8CA 4A4AA 3H1MA 3PUSA 4Z1VA 3N9PA 4YZ4A 1BZWA 2W52A 4OHXA 4F3JA 3MLJA 2RM22 4ZS3A 4M3CF 4HG6B 3OB8A 4NIHA 2AEZA 5FP8A 1UMZA 2YV8A 1DU3D 4FFFA 1UCXA 4QM9A 1JTZX 1MEC3 2HWC3 4O9GA 4OHZA 5H9RA 1ZRDA 1V6OA 1RUG1 2WT2A 4NPLA 4YPJA 3ZYGA 4IE7A 2PAEA 5DXDA 1OMIA 4XJ8A 5C3OA 2DUPA 2Q4SA 1HLCA 4AVTA 3OD4A 2YU1A 3Q8AA 2LS6A 3W5MA 3W59A 4S2HA 3WNXA 1AL22 1CD3G 3IPVA 2JX9A 4LTAA 3WP6A 3ZYFA 3WCRA 1PO22 3LA7A 4EWEA 1OFSA 1O7FA 4K1YA 3FFZA 3KQRA 1DBNA 5GJ6A 2Z4FA 2DFBA 2R1DA 1RUD3 1W2NA 1QJX1 1W8WA 2FZ2A 2KXLA 1XQNA 4H2AA 4MXVA 4ARYA 1H2KA 2D97A 1LAJA 1TNFA 5A6QA 3TEWA 2ARCA 5DPNA 1PHMA 2WQ4A 1FMD2 2XHKA 4KMQA 4BMBA 4URAA 3H3ZA 3T08A 3FWEA 3ECQA 4K3UA 4OVEA 3NV2A 3M70A 4TWTA 3MIHA 3R4UA 3MZHA 3VBOC 3ZMOA 1Z7S1 5FCCA 2GDFA 2D44A 1SHWB 3WOGA 5J96B 1NKGA 3LPFA 2WLPA 1DQ5A 4DPNA 5DN2A 1MZ5A 4YM1A 1OXCA 2K9ZA 1XE7A 1WLTA 2H0BA 3I8TA 5EYYA 4NIDA 3B9CA 2ES3A 1V6LA 1XRUA 2VVEA 3A21A 3W20A 3VB9A 1J3PA 4DB5A 1PZ7A 2XVKA 1UMIA 4CTEA 3HBKA 1TG7A 2O1QA 3A0KA 4FPGA 5HCBA 4EN9B 1JYCA 5IK4A 4LLOA 2HYKA 5JOWA 5A3PA 1DYOA 1KFUL 5BNOB 3KWVA 1DLLA 2DDUA 2BVVA 4YZ1A 4KWKA 4P9WA 4NROA 2GC2A 2A7AA 4GXLA 4Q1RA 3R05A 4XPVA 2BFUS 4PCRA 1DYKA 1EPWA 1PZ9A 5JAXA 4YZ3A 3KQ4B 2CTVA 5HV4A 3DF0A 1VRBA 1UU5A 2RMU2 4CP9B 4I02A 3WHUA 2VE1A 2VVDA 4INDA 3D5OA 1A8MA 4TLGA 1W39A 2ZTNA 3NW4A 3ZVXA 2JIGA 3B5LB 3VDDB 4CE8A 1O4ZA 3AK0A 2VD7A 5BNPB 1O91A 3KCCA 1JMUB 2YGLA 4IETA 4MG2A 2CU5A 1SMVA 5KBFA 1NX9A 1XNKA 2P3JA 4IGOA 3ZOIA 1WUVA 4CU9A 1N47A 3OY8A 3TN92 5FOBB 3EHKA 1GZ9A 3H3LA 3IIIA 4XQWA 4DXTA 2H0VA 4QPYA 2E7AA 1IPJA 3IAQA 1AR61 1HRV2 3MUZ1 1R1A1 4IQPA 1CAVA 1JU3A 2VC9A 3T2TA 4FQZA 1OOPC 1PVC1 1BVP1 1ZZBA 4QX7A 3SH3A 2QDRA 1ODMA 3RYKA 5FPVA 4NR1A 1YXWA 5FY7A 1WW7A 4X6RB 4YM0A 1ZRCA 1W6PB 1ENQA 2BWAA 5IATA 3V0AB 4HXCA 4MGTA 4AI9A 4KBZA 2FZ1A 1F4AA 1T6GC 4IERA 5FJHA 2FDHA 3PURA 5FZAA 2JEMA 1D4M1 1EAH1 4UFMA 4M3CB 2NQYA 2DCJA 4JGZA 3VZOA 5I0TA 1GU3A 1RUC1 3AXEA 4LJHA 1VB4A 2CWSA 2GNMA 1YJKA 2MNGA 1IHMA 2HKXA 2W95A 1SLIA 2BUKA 1BEV1 5A3WA 4DQAA 3IAPA 2J1UA 4D3WA 4YW1A 2B7YA 5J3UA 1CAWB 1BJQA 3L2HA 1PO23 2EXIA 2WO7A 3GNEA 3ZFGB 1VBB3 2RS51 4UFLA 1AR71 3J7HA 1NCRB 3LB9A 4KNCA 3RI9A 4OUMA 3O1VA 1CWPA 4ZS2A 3AKTA 4JGYC 1C5IA 3ZSLA 5FZOB 5DUVA 2RJKA 3K4ZA 3SCGA 3ES4A 2KD7A 4XABA 5H9PA 1CJPA 3TB0A 4A6OA 3UKNA 4TLFA 5FYCA 2JDUA 3VBSA 4ITCA 3ZFEA 5F1RA 2WIIB 3T3YA 3GHMA 1RHI3 1RVF3 3OSDA 4CEYA 2QQPA 4Q4X2 4ZZ8A 2QBXA 3DV8A 4U36A 1QU0A 2JG9B 2R32A 4KG8A 3ZXGA 1WW4A 4YVSC 4N53B 3OCPA 3NL1A 4AHYA 1HRI1 5GZCA 2Q30A 2Q8EA 4Q1PA 2ZABA 1VAMA 3ZM8A 2OA2A 3ZFFA 5KC6A 1F5FA 1VBE3 1N3OA 2OQ6A 3VBFB 3M2MA 5C8WA 3CF6E 3OYWA 3HOBA 4LHNA 3INAA 4GWIA 2XJSA 1MQTC 2NPIA 2RR11 3LDBA 1ND3B 2ZGKA 1O3TA 1JOPA 2WL1A 5FPXA 2VQAA 1JBCA 3ZIWA 4DNYA 4ATFA 1OH3A 3GHNA 5L7OB 1R081 4WM7B 1S0IA 4GB31 3GJBA 1OKQA 2GNTA 4I30A 2WLQA 1TME2 4HSJA 5FKCA 3O0XA 1CAXA 2V09A 4OMDA 1W99A 3POJA 1STMA 3A0NA 2W1QA 5BNNB 4Y1ZA 2Q8OA 5T5OA 5FDBA 5F6KA 3ORJA 2XGXA 3T0BA 1SLBA 3AZVA 1PK6B 1B35B 3GZTB 4XILA 5K0UC 2CSGA 5LK5A 1JH5A 5CU1A 5DQ0A 1U5IA 5G05L 2Y6JA 4MXWA 1J1LA 1FV2A 2WO1A 2XQRA 3FX3A 3I2HA 2JDYA 4PI0A 1IS3A 3MYXA 1IS6A 1OH4A 4AFBA 1HRV3 2DCTA 5LBBA 1LOCA 4RGKA 3PTRB 3GDBA 3AP9A 2ET7A 4W4ZA 3W5NA 2GALA 3RZGA 3FN9A 3PU8A 3H8RA 1RMU1 2BBAA 4BJ0A 2VCBA 3ZLIA 2VVFA 1IQDC 1W8HA 5GZFA 4XW3A 1LGCA 4QX0A 5J36A 1CESA 3HEIA 3LDRA 4XMAA 1ZA7A 3ME2A 4GH4A 3UYJA 1JYIA 5CNAA 4XFCA 1D2SA 3RWKX 1FOD2 1HN1A 3EXUA 1YI9A 1NCQC 2PFWA 4IESA 5LA1A 4YVWA 1K5MB 2LW8A 2IXKA 2XWJB 3T0DA 5FMOL 1UU6A 2FCUA 1ND2C 4AFDA 2FDJA 5A7WA 2IFRA 3AJYA 5C9AC 3CJIC 2W47A 2PHDA 2PHLA 2ZEWA 4FPOB 2DCKA 5JZGC 2XHNA 4XTMA 2F4PA 4JDMA 2VULA 5IUQA 4KI5M 1FPN2 3U1XA 1EV13 4X8NA 1GZTA 2GC3A 3WDWA 1LHOA 2VGDA 3K3OA 1H8TB 5A6ZA 1DG6A 2B45X 3ZMNA 4A42A 4C8DA 2JD9A 1JOJA 3QH6A 5IW0A 4AAPA 3AYCA 1W9YA 2Y64A 4IEOA 4B7EA 4FFHA 5DMYA 4XF9A 5IFTA 2HH9A 4R52A 4Y33A 1APNA 4Q8KA 1VRH2 2PQQA 4OMCA 5FP9A 3WF0A 3KGLA 3I2OA 1JU4A 1ZZCA 3NAPA 3VD3A 5CFCC 4EZHA 1KDKA 3WG1A 4JZRA 4BQ1A 1XE8A 3JBG2 4A7ZA 3BCWA 4QB1A 2OX0A 2ILMA 3C7HA 2ID4A 1PVXA 4K6BA 3E6BA 1Y4WA 5EIYB 4PT6A 2A3YA 1WA4A 3PNAA 1KJLA 1LESA 2RS33 4UW4A 1W6QB 1UOGA 1A3KA 1WCQA 3HMYA 2FCTA 2HWD2 2IXLA 4AVSA 1C5HA 1YIFA 1JYTA 1HN0A 1UIKA 2ARXA 2DBIA 4CDQB 4EN7B 5C7GA 5FZHA 1TMF2 1W6OB 3IN9A 1FT9A 3G6JB 2WABA 3WW1A 4XFBA 3K51A 1ENRA 4EJRA 4OZXA 2KR2A 2PHTA 3AZYA 4H7MA 4CZSA 3VBOA 3E1F1 3OGGA 1VBD3 2E7TA 2ZGNA 3HPNA 4E4ZA 5JI9A 2UYBA 2EXJA 2GSYA 1NLRA 3FBMA 3TRSB 4A7KA 1RINA 2RM21 5JOYA 1J3RA 2QQJA 4XFAA 1OHFA 1UKGA 5FZKA 5KHIA 3ZN6B 1PM7A 2PYTA 2VG9A 1IQAA 1XNBA 2JB4A 1RUOA 4A3ZA 2RV9A 2ZX4A 2BQPA 4UXAA 2YHJA 4NRPA 1OF3A 2WFPA 5FUNA 4Q29A 1WLDA 2BWCA 2VZVA 4IGPA 2O8QA 5CADA 3AP5A 3S7EA 5C5TA 1ZREA 1RUJ3 2BGCA 1PO21 4OHVA 1SBFA 4CCMA 2DU1A 1O3RA 4META 5KHJA 2CAVA 2P17A 1O4TA 4KGQA 3KZ4C 2X5IC 1R1ZA 4H7LA 5B2GB 1WBLA 3T30A 4D69A 2DTWA 3O12A 4N8MA 3R4SA 2YBKA 1C57A 1FMD1 1VBA2 1DGLA 4Q0SA 5FZDA 3SEPA 4Z2AA 5ABJC 1HW5A 1SPPB 2GH8A 3ZSEA 4XVHA 2ET1A 5J37A 4BE3A 1RVF1 3OGSA 3MIDA 5JXHA 1QDOA 4B29A 4M4PA 1H2LA 1ZVFA 4LQRA 3FHIB 1JUIA 5JPNB 3LSDA 4IEWA 4AOCA 1DGWX 1JODA 3OPZA 3ZPOA 2HBTA 2ZGRA 5FBZA 5H9QA 5IK5A 1JXNA 2VW0A 4I3PA 3GCWA 1EY2A 1UOBA 3S0MA 1K42A 1OQDA 2FDIA 1OPMA 3KV4A 2H6BA 1AYN2 3LOBA 2L9LA 2E53A 3N3HA 4L11A 5KHGA 1ENXA 3M7AA 5E1RA 3NV4A 1FI2A 1OOPA 1SBEA 3AMPA 3GZEA 1I6XA 1DYPA 3DN7A 1MVQA 2W1WA 3GXUA 4L92A 2DURA 1LR5A 3NVCA 4CDXB 4XYXA 2FD8A 5FY4A 4LE3A 5FZLA 3CIHA 2Y6GA 3B00A 2VW2A 3NV3A 2GMPA 2JG8B 2RMU1 2D3RA 3EQEA 5DZFA 5AVAA 3DGTA 1C8NA 3KF5A 4RN5A 2W1UA 1H1AA 5FPBA 4CEWC 3U4XA 4CYDA 3SISA 5C3RA 1CX4A 4FXGB 2WNUB 2HYXA 4GKYA 4FPHA 4MOAA 1DZQA 2D3PA 1HQNA 3IM0A 2Y6LA 1RC6A 5FZ0A 4IV3C 4XFHA 4EWAA 1GWMA 5FZMA 4UBHA 4YW3A 3ILFA 4LO8A 3J4UH 5APAA 3ZYBA 5CYYA 3AL6A 3DYPA 4JGYA 2BRTA 1JOBA 4QMAA 2F17A 1WGPA 1F35A 4KBBA 3TN91 4BWOA 2E33A 2W1SA 5FR3A 4TYSA 2WFF2 1SFPA 4QXHA 5LY1A 2DVBA 2ATFA 4MSVA 1HRV1 1XU1A 4QPIC 4GWJA 4EQVA 1UN1A 1HQLA 3KT7A 4AFCA 1OD3A 5C3SA 2IUWA 2UWBA 2VOTA 3IT8A 1GZWB 2G19A 1VBC2 4MGSA 2Q0AA 4RHV2 4OI0A 3D8CA 1OFNA 3LD8A 4LBJA 1HXS2 2B42B 1N1TA 1YNAA 4YVSA 4AW7A 1UZYA 3CO2A 2PELA 4XDPA 5FREA 3WDYA 2WKKA 1LHVA 2VU9A 4X8PA 4Q5OA 3U37A 1J1TA 2R042 1SLCA 2VBPA 4XCAA 2UY9A 5FYBA 3FUQA 3RRDA 2ZX2A 4QDQA 2LROA 1G9CA 2XJUA 1WBFA 5LB6A 4QQ2A 1AXZA 1CAUA 1MS4A 3RNSA 1CPNA 1Y7BA 1HJGA 2GU9A 3PVOA 4Y20B 1PMJX 3HQUA 1CR7A 1MQTA 4OHYA 1H2MA 1F31A 2V5YA 2W87A 3DCQA 3DYMA 3LFMA 4CRQA 1X9TA 1AX0A 1H0BA 1RGSA 3HN1A 2A6ZA 5DAVA 2XUMA 2UYAA 1ALYA 1W06A 3CZUA 1O5UA 2JDZA 1SEFA 2WQZC 3NJVA 4FO9A 4IGQA 4P9YA 1ST8A 3ILRA 5EZWA 2UWCA 3O0VA 5FXVA 3ZYJB 5CFDC 4MGYE 3A23A 1RUE2 4QX2A 4YW2A 4OI4A 3VHPA 4R4ZA 2KM2A 1CIWA 4LKSA 4CP0A 5EJZB 1DIWA 1Y9MA 2HWF2 4RR3B 1LHNA 4Q4X1 5HV0A 4UWDA 5C4WB 5K0UA 3I59B 3OGJA 4ZXKA 5GLVA 5C8CB 1W6NA 4FOVA 2RS12 2CAUA 1WW6A 2EXHA 4LLFA 1V6MA 5FQ0B 1O5LA 1LJ7A 1AR63 4XUOA 1R1A3 2DWRA 2QJVA 3PJYA 2V5DA 5E89A 3KLSA 4UW3A 1VP6A 1WCKA 3AFGA 3D0JA 4I0WB 5DAXA 5IVVA 2ZKNA 4Q26A 5KXBA 3VLBB 4FSJA 2XL9A 5ACA2 2P3YA 3OUIA 4QB6A 5C71A 3VKOA 1YC61 2WA4A 4Y5TA 1WD4A 2HWB2 3RZZA 2R16A 5JUVA 3ZIXA 3ZSJA 4BK5A 4ZXEA 2DTYA 3J7MA 1O8SA 1G86A 1TME1 2JJ6A 3I97A 1OUSA 5FMDA 1BEV3 5A3MA 1N1VA 2D6LX 2OYZA 3ZXDA 4HLTA 1NCQA 2JDNA 5BNPC 3S5AA 3KF3A 2RDSA 3IPVB 3WR0A 3LE0A 1AR73 1LEMA 1ND2A 1VBD1 2UURA 3OBRA 1CGPA 1AR92 4XUTA 1NE6A 2G1MA 5C9AA 4JKKA 3CJIA 2BYVE 4Y24A 1NZIA 1KJRA 2A3XA 5IJRA 1VLNA 3MW2A 4H14A 4W6WA 1OA2A 1GICA 5JZGA 1YUDA 3QCWA 4XJWA 1DQ2A 3N35A 1UZVA 1OURA 3FZ3A 1NLQA 2UY8A 4XJUA 1UY0A 4BISA 3N9OA 3PMEA 1Q8SA 2WFF3 1ZBE2 1W8OA 4Q8LA 3CDZB 4AWDA 1M06G 2F6BA 2A5ZA 3IZOA 4NHLA 4AEMA 1PGL2 5FZ4A 1VBC3 3U4SA 4RHV3 1RIRA 3OF1A 4LBQB 1ZYBA 3K48A 1AVBA 3POGA 4UOJA 5GALA 4OQ9A 2RDQA 1HRI3 1GOHA 2P6HA 3WF4A 1UYZA 3FHAA 5A6YA 4IE6A 2D6PA 2ZEZA 1LGNA 3THDA 3VDCA 3LPGA 4XJAA 3I2GA 5CFCA 2YPDA 1RJ7A 1C8M2 4XACA 1FOD1 2W9XA 2IXHA 2TBVA 3W9AA 3UJOA 1G9FA 1S0BA 5F8PA 1Z78A 4MH0E 3T4VA 1WW5A 1IG3A 2B46X 2BEOA 1V70A 1BXHA 2OVUA 5JMOA 5A1FA 3MPPG 4DY5A 4RGGA 2E6VA 3RZJA 4TN7A 4ZU5A 2Z69A 5FPUA 5D2AA 4BQ3A 1R083 4K1ZA 1LCLA 3GCXA 2ZGMA 2GC1A 4BZ4A 1H30A 3O5SA 3UESA 2AUYA 3K75B 4QXKA 4XHXA 4AZZA 2OKXA 1FPN1 2DCZA 2P3IA 3DXUA 3PIJA 4NRMA 3KM5A 2VNVA 4O65A 3AX4A 4HSLA 3SEEA 3VKLA 4D6QA 2XXZA 3O1MA 3RZHA 2HWF3 3USSA 1WWYA 2WWSA 4ONUA 4Z07A 5FV3A 3OD0A 3MF6A 1BBT2 1W6MA 2ZOEB 4O9EA 4P9JA 4IEPA 1W2UA 3HJRA 1OLMA 4R9DA 4NIGA 2D5HA 2ZMNA 1QH7A 4N53C 5GLTA 4CDWC 4Z2WA 2QQLA 4ZONA 1ULFA 1GZCA 1OT5A 2R30A 1VRH1 3NAPC 5KXEA 2QKDA 3KD4A 3NMBA 2D6KA 2GZWA 2PLV2 3C7EA 3POSA 1GANA 3OY8B 1LKNA 3WDTA 4BH9A 2C1FA 4XXAA 4ES9A 3JBG1 2OT7A 4P5HA 5DDJ2 2Y8KA 2FDKA 4Z82A 4BQ5A 4AAXA 4LE4A 4D94A 4MGKE 5IVCA 4IE4A 1EUUA 1CAVB 1ND3C 5FK7A 1RMU3 2JDKA 4PIXA 3P1IA 5IT6A 5BV6A 2DF7A 2PAKA 3PTYA 3AMQA 1WMEA 2JE8A 3VL8A 4AE2A 5L7OC 2HWB3 4S2DA 3ACLA 4WM7C 2N7GA 1T2XA 2E63A 4GZ9A 4FPLA 3HAGA 4XURA 1W9WA 3SCHA 5FP3A 4P5YA 2HWD1 3ZXFA 4DS0A 1G8WA 2R062 2X5IA 1AF9A 1DP0A 3H8UA 4GJZA 5JXGA 1UZWA 4XJ9A 4JGZB 3P3PA 4XMIA 1YO8A 4M3CE 3N7KA 2FQPA 1TMF1 5F3IA 5D8AC 5K4LA 5ABJA 4Y26A 1UY1A 1W05A 3SH4A 1W0PA 3I49A 5C3QA 3ACFA 1MZ6A 1FX5A 1AXYA 5FZ1A 2BPA2 4XF4A 1B09A 2QQIA 1NLSA 1UWWA 2XPJA 2V72A 1L7RA 3I2IA 2P1BA 2G9FA 2VTFA 1LOFC 5DAPA 2AC1A 4P9LA 1YJLA 2WNVB 1NT0A 1C3HA 1Q8VA 1GV9A 1REFA 1W8UA 3IDCB 1DGRA 4GAZA 4HL0A 1QJY2 3LEMA 1ZBE3 4LIUA 5HCAA 2OXBA 1Q43A 3VBSB 3V64A 4N43C 1H6YA 2VOXA 2PTMA 2YMZA 4LOTA 1WMDA 4FPKA 2VM9A 1U5XA 2DVGA 2ZGLA 4Q4V2 5FY8A 3WD5A 4DIQA 1O3SA 3V0BA 4ZPIA 4CEYB 3HQRA 3MPBA 4BCUA 4HMZA 4BB3A 3USUB 4TZDA 2DCYA 4IW3A 2WZR2 1GQGA 2QQOA 2WWUA 3VKNA 2VZUA 3A4UA 1JHJA 1ULOA 1PZ8A 4D7TA 1VJ2A 4AL9A 4Q2FA 3ZFFB 4OUEA 4QWNA 3PLQA 1QJU2 5C5UA 1QJFA 5L36A 3CKHA 1GBGA 4AEDC 5HBAA 3Q8EA 4CEWA 4LA2A 3AYDA 4QQHA 4AI8A 3OYWB 1YQ8A 1QNWA 4JRAA 5FJKA 1EUTA 1WD3A 4NPMA 3B94A 3ZKUA 2F4LA 1G9DA 1WMFA 1QQP2 4L97A 1U5ZA 1W2OA 3LCPA 4IV3A 4D7YA 4AI3A 1POV3 4OHWA 1SLAA 4XFGA 4C1XA 1O59A 1BMV2 2O8OA 4GQ7A 4CSWA 2VTXA 3VBRC 1SFNA 4BLIA 4CUCA 3M1HA 1JZ5A 5AVPA 2NM1A 3AZZA 5F5AA 3MUY1 3OBTA 2D6MA 4PLNA 1AYN1 2VMCA 1GOFA 1W0NA 1CAXB 2QQNA 2GN3A 3FHQA 2A75A 4HOOA 4ORFA 5A3NA 4MGQA 3IBMA 2XBO2 2J22A 4QPIA 4S2GA 4AGGA 1UXZA 2WDBA 1BBT3 1W8FA 4I01A 4DUWA 1DHKB 1RUI2 5GLWA 1GFF2 1ODNA 1OKOA 2ARBA 2RM23 3I3QA 5FZFA 5JSRA 1PGW2 1TNRA 4K20A 5B4XA 1AYM2 2W68A 3HIFA 1LRHA 3U14A 4CA9A 3HNBM 3CEWA 2ORXA 3AMNA 4IUGA 4YM2A 1YQ2A 5IVYA 4P9XA 4DXSA 2EAKA 4NHMA 5FYVA 1Q56A 5LRSA 3AKRA 5DDJ3 3NKTA 3FL7A 1Q5OA 1RUF2 2LM3A 2QCSB 2ZMLA 1AL23 1LULA 1W9SA 3KT1A 4DRRA 1V6IA 3BTZA 2QFEA 2WS92 3ZYIB 4XBNA 3MLLA 5FYYA 1XE0A 3AFKA 3D6EA 4W65A 3B02A 4LEJA 2VQUA 1JZ3A 3RI8A 1LHUA 1UQXA 1POQA 2EIGA 4WV8A 3UKTA 5DUWA 4JX0A 3WX5A 4AVBA 3ZR6A 4RFT0 2R063 4EV0A 4CDQC 4AVAA 2FHRA 5A3UA 4GH4B 1FMD3 5FPLA 3TEYA 3MFCA 1V6NA 5CFDA 2GMEA 2WFF1 3LA2A 3WCSA 3Q8CA 3ST7A 2BOJA 5FZ6A 3PDQA 2VNRA 4YVWB 4XFFA 4FAGA 2GP3A 2OUHA 1VBC1 2Y6HA 2VZ3A 2JICA 4RHV1 3IMNA 5FY1A 3MEPA 1W2AX 4ZZ5A 1H6XA 1XNTA 5GLUA 4BIFA 1HXS1 4PBOA 4R4XA 4E2SA 3BUCA 4JTNA 4GULA 1S2BA 1MS9A 2YU2A 1CPMA 5G04L 5IK8A 2XLFA 4EE2A 1N3PA 1V00A 2B39A 2R041 4Y5Z0 4IEQA 5BY5A 4FTBA 4J1XA 2D6NA 1QJY3 1N3QA 1NXMA 1ZA4A 3KV9A 4WM8B 3NV1A 4Y4RA 2VZSA 3IMMA 4UFIA 1T6BX 3VUOA 5F32A 3UJQA 5CVRA 1UMHA 2R0HA 5IK7A 2QE3A 1YYNA 2BJSA 4QPGB 2QQVA 1UIJA 1W3XA 1IG0A 5GM0A 4MGZE 2B5HA 4LOSA 1MS0A 3H50A 1Q3EA 1DFQA 2IWGB 2DUOA 3FLRA 2RMU3 3LDKA 4CP9A 1AJKA 4PI2A 2JENA 1WLWA 4FPEA 3PHMA 4TXWA 5F2SA 3O1TA 1EPZA 4FTSA 2CV6A 4CCEA 4DEVA 5CIRA 1A8DA 3JUUA 1VB2A 4BHPA 1RUE1 2XLAA 5FY0A 3RMXA 3N36A 1PX3A 1OPOA 1NQDA 1X36A 2HWF1 5DZGA 2EIDA 5FLHA 5FAXA 5BNPA 3C7OA 4AQSA 1QQP3 2BTVC 1COV2 2R1BA 2XWBB 1F2NA 5FY9A 3UGHA 3VZLA 2NLRA 2WT1A 4G3YC 4YG0A 2JKBA 3FMGA 1XBFA 3RJRA 4P14A 1W9FA 1G9BA 3O1UA 2RS11 2WBKA 3TN93 5T55A 5FPZA
chains in the Genus database with same CATH topology
4LBMA 2W0XA 1S0EA 3VBUC 1LTEA 2I2SA 3M3QA 4Y1YA 5T3NA 3AB0A 1V6JA 2I07B 2QDNA 4L9BA 1RUI3 3VBHC 4JDNA 3VBOB 4AGRA 2Y26A 3B3QE 3IKWA 1PO12 3M3CA 1LODA 1Y43B 1ZZ7A 3CL1A 2DU0A 1KD7A 3VN4A 1N1SA 1S1AA 2HWB1 5C6CA 3MLKA 4HKWA 1MS8A 2HEYF 2GH2A 1RUF3 1X8MA 5EJ3A 1UX6A 2EF6A 1FV3A 2WS93 2AYHA 4H55A 1QMJA 3SH5A 3VGIA 1DZTA 2TEPA 3U07A 1NCRA 1YFXA 1Y3TA 1AR91 2ZGUA 4UW5A 3RDIA 3C2UA 5L19A 4X6QB 5BNQA 1I5ZA 2LUWA 3C3VA 4URTA 1ZBE1 1AR82 3O7OA 2ZHMA 4CP1A 4E4SA 4OULA 3HT2A 4Q4X3 5H9SA 1OQEA 4HN1A 1PGL1 1QWRA 4BM8A 3SITA 2WNEA 2HEWF 4N53A 4CDWA 1LU2A 4YRDA 1NA1B 1HQWA 4CDUC 1MZFA 1X50A 3P3NA 2V73A 3RG0A 1Y9QA 4RGAA 1C8M1 3I54A 1DZRA 3H1YA 1DF0A 1QY4A 2Q1MA 3BB6A 3SHRA 1ULEA 4FPFA 1ND3A 3AZXA 1C4RA 2DVAA 4A2UA 1OOPB 4J1WA 2VOVA 5LEKA 1GQHA 3BPZA 2E9QA 3WQ1A 2WT0A 4RD7A 3DPRC 5L7OA 2BFUL 4MUVA 4RQPC 1POV1 4WM7A 4DINB 5FLJA 4GMP0 2VPVA 4Z92B 5FO8B 3M3IA 1TME3 1BKZA 2IFWA 3H3UA 4RS5C 3S6PA 1U5YA 1RB8G 5DG2A 2AENA 5D8AA 5BNNA 4JCKA 5FOJB 4IV1C 1PK6A 4XOGA 1BBT1 3HR9A 1XYNA 2CL2A 4HVRA 5F6LB 1G7YA 4IEZA 5CG9A 1LOFA 4W6XA 2PLV1 5JPMB 1H9PA 1C1FA 4Q4W2 1AZDA 3TOJA 4LHLA 5DDJ1 4N43A 1LGBA 2ZAHA 1AL21 2D7FA 4E2QA 1WCDJ 1KS5A 2A70A 3THTA 3SMHA 4NN0A 1FXZA 3U10A 5JSPA 1PIV2 4YVSB 5CA6A 1QXRA 1J3QA 2JE7A 2R061 1FOD3 4LO4B 3WVJA 3PMSA 5EWSA 1IS4A 1OLQA 5I8TA 2GNBA 4AEDA 4FVVA 4P9GA 5K7PA 1XU2A 5I93A 3FC0A 3NO8A 4SLIA 5J09A 1MQTB 3WINE 2ZA9A 4K40A 4AF9A 2D93A 2A6WA 4WVMA 2XL7A 3MIBA 1Q8OA 5GZDA 3VBRA 1FPN3 3ALQA 4YLZA 2B9UA 3LGRA 1IKPA 1KITA 3PVNA 1QJY1 1H8TA 4FBFA 1AR83 5JOZA 4KG0A 3MFAA 5HCFA 2HWE2 1ENSA 1OA3A 4AQ2A 2TNFA 4LBOA 4FT8A 2PHXA 2WZR1 5K0UB 1VRH3 2ERFA 3VV1A 1W6NB 4HK9A 3R6SA 1FAYA 4LBKA 1DDLA 4PDWC 2XKPA 3AXDA 2Y0IA 4Q27A 1YFUA 2P2KA 3JBG3 1NQJA 3WG2A 1QJU1 3AP7A 1IZ3A 3O14A 5JCTA 1S0CA 4GWNA 2XH6A 2GMMA 1SFYA 2PAMA 3ETQA 1UPIA 2MEV2 3RPQA 1OI6A 1QQP1 1SLTA 4R8HA 1OA4A 3NKGA 4XEZA 4FOQA 2HWD3 4GIQA 3GZAA 1D4M2 3JU9A 3KCXA 4CDQA 3LOIA 5A33A 3B7MA 1LB2A 3QBQA 1TMF3 2XVLA 4C90A 5FO9B 2VNGA 1SQ4A 2Z42A 4COYA 2WZPP 4OI1A 1NXD1 5I8YA 2B8MA 3GBGA 2XBO1 1NCQB 3CU7A 1XNDA 5T5JA 3AZWA 1NOVA 1RUI1 2PN5A 2ZZJA 1ND2B 4C1WA 4N7IA 4RL7A 4FPJA 1PGW1 3DL3A 1AYM1 3KSCA 4GKXA 4Y1UA 5C9AB 1F8VA 3CJIB 5JZGB 2BBVA 3MIGA 5GZEA 2C5DA 1XXNA 4Q4W3 1AX1A 3WUDA 3L2YA 3T1LA 4EN0A 1RUF1 4AVCA 5I0UA 5HXVA 2WS91 2XJTA 1KS4A 1UW8A 1W0OA 1ZZ6A 3G7DA 3QH7A 1C28A 4COZA 2PHRA 4HVOA 1JUHA 1PIV3 3AKQA 2AZ5A 3ZPYA 1RJ8A 2BW8A 2EALA 2YUEA 2R072 2YC0A 4LT5A 4QT6A 2WSVA 3WQ0A 4AVVA 1VBA3 1ZBA2 1DQ6A 3X29B 4N9IA 5DUXA 2RR12 3GBWA 2OIIA 2NZ9A 2ZX0A 3WLUA 3OTFA 2Z2SB 4XBQA 2NYYA 1O3QA 1D0HA 1DGWA 1UZZA 5J98B 3WY6A 3E6DA 2GAUA 3AM2A 4SBVA 3H7YA 3AKPA 1AYN3 2MPFA 3VBUA 1G6NA 5BNOC 4B4RA 5L73A 2HWE3 5BXXA 2FMYA 2IC1A 2RHPA 4M01A 3GZUC 4OLLA 4Y22A 3VBHA 1W6MB 3MW4A 2Z79A 3HQXA 2XJQA 5A3LA 3APBA 2IZWA 2JG8A 5T50A 1MEC2 2HWC2 2YPJA 1CVNA 2ZGSA 1PGSA 2OW4A 1IKQA 3VZKA 1N1YA 3BTAA 1REEA 4N7UA 1S0FA 4HFSA 5E8AA 5SV8A 3VDDC 1S55A 3I7DA 1MR5A 4KU8A 1COV1 2ZHLA 4OI2A 2Y38A 1TQ5A 2YY1A 1YWKA 4BOWA 1RUD2 4YARA 2X5IB 4I0BA 5JDBA 2LALA 3MIEA 5ABJB 4ATEA 3RMYA 3LAGA 1R092 1EYBA 1HXS3 1LOGA 4MGIE 3VKFC 3ZXLA 1M4WA 3QACA 3GALA 3L9JT 4LUKA 2VUJA 5A32A 2R043 1ZZ9A 4CDUA 1LEDA 2E7QA 1CN1A 4AHZA 1YCIA 1Z0HA 4QGLA 2ZBJA 3W58A 1GKBA 1QOOA 1HV1A 2ZMKA 1S0JA 3B9IA 3ZFGC 1PNFA 3CLPA 4LBNA 1NCRC 2GN7A 3N7JA 1GNZA 2HJIA 4U2AA 1QOTA 1UPSA 2D3SA 3DPRA 4RQPA 2R073 3FJSA 4PBPA 1ULGA 3MW3A 1OD5A 4RS5A 5K9YA 4BIOA 3ZYPA 1RUE3 2VXRA 1ZBA3 1DGRN 4GA9A 1AR81 3CNAA 5T52A 4FOYA 4CEWB 1GNHA 1HKDA 2VMHA 4AYUA 2R49A 2JG9C 1SLLA 4IV1A 4RSUA 2XJRA 5KC5A 5GLZA 1QH6A 2KA3A 1YI7A 3CJXA 4IV3B 1SACA 2RS13 3HT1A 3OJBA 4PF5A 3POYA 3SXWA 5FQ0A 1YIPA 2O0OA 4XXPA 5FFOC 3VBFC 5E16A 2NN8A 1HX6A 3WT3A 3WW4A 4MYEA 2BNOA 3AJZA 2MHFA 4GWMA 2Q5TA 3H0OA 3BU7A 4QPGC 4BPZA 4J6GA 4QPIB 5FLIA 1LHWA 5ACA3 5AC92 4ASMB 2PHFA 3JB4C 2TUNA 2AR6A 3E97A 3MF9A 4NO4A 4YFWA 1WLCA 4HPKA 5JIAA 4YM3A 2OUJA 1ULDA 2ZHKA 4LO6B 1EP0A 3M3OA 5DUUA 4LHKA 3AYAA 2NMNA 5C33A 5FMOS 1C1LA 5BNNC 3RWNA 3NSTA 2R6QA 3NJZA 2DVDA 1ZNPA 1PK6C 1B35C 2JD4A 4AEJA 4DRVA 4QGNA 1AR93 1FYUA 4AHWA 1NE4A 4I3GA 4HVQA 4WZCA 1VBB2 5KHKA 1MS3A 2FMDA 2I74A 2ZAAA 1ZM1A 1S2KA 4XIOA 3NWKA 1RITA 3E5UA 3VZMA 1QKQA 2QZ3A 4PLOA 1RUH2 1NZCA 4Q4W1 5JOXA 4K8FA 5CFDB 3M3EA 1RHI2 1RVF2 4QQPA 1R093 2EVXA 3Q9OA 4LBQA 4JRLA 1RUNA 3HD8B 2HEVF 3FLTA 3MIFA 2QUOA 2ZCWA 1PIV1 1ONAA 4PDWA 2Y0OA 1C8M3 2UU8A 1VBE2 4BYYA 1VBA1 1K5MC 3B01A 4AI1A 5F5QA 4B7KA 4Q4Y2 4JDOA 4NVPA 4C91A 3E5XA 4DMIA 4NHKA 2WSUA 1KDMA 4XF0A 4FOWA 2DYCA 3JQWA 4KQ7A 3JD72 3BALA 4NWVA 3THPA 3WP5A 5I0RA 2C0ZA 1X82A 1ZZ8A 2P34A 3V65A 1H8TC 3LA3A 4YGDA 3MDPA 3FE5A 2SLIA 4E9KA 1PMIA 2HWE1 4Q0PA 4FP3A 2ZX3A 4QU2A 1XYOA 4ES8A 1QF3A 4MLOA 1BK1A 1NA1C 1QOSA 3D0SA 4YG6A 1QXPA 4Y4YA 3URFA 4MXWB 2PLV3 3BOPA 1H9WA 4AEKA 3MICA 3LZZA 2CWMA 2OZ6A 3AP4A 4AQ6A 2Q1ZB 4A7YA 1XYPA 1QNYA 4YGCA 3U11A 4JV4A 1LU1A 4L2NA 3ES1A 5AC93 1CONA 2ZX1A 3AMHA 3QD6A 3TBDA 1NG0A 1UAIA 2MEV1 1LOAA 2X53S 3LKJA 1UKRA 5BPXA 4MX3A 2BNMA 5JLVA 1YLLA 4AK3A 3HWJA 1V9U2 1WCSA 1UL9A 4HN0A 3BIWE 2X8KA 2AGSA 4Q0VA 4R9BA 1UD1A 2A73B 2PHWA 2VOWA 5JVVA 1BCXA 3ZXEA 1MACA 2WNVA 3ZYRA 5T5PA 2K2SA 4QD2A 2QNKA 1RUH3 1EV12 3WW3A 5I8SA 1FNYA 4FPCA 4Q4V3 5BNOA 2VMGA 2ZZQA 3H1WA 2XG3A 3ZXJA 3EO6A 4QQOA 4QM8A 2Z5WA 4E2GA 1H1MA 1SBDA 3RJ2X 3KMHA 2ETEA 3USUA 4K9SA 3IDBB 5AFEA 2WZR3 2RJLA 4XE9A 2VECA 4XQ4A 4EN8B 2AREA 4CDWB 5DG1A 1LOEA 4PIYA 4YW4A 1X33A 2R071 5JIUA 3NAPB 4YZ5A 1QJU3 1FATA 2D40A 4YW5A 3EBRA 4JTOA 2A71A 3ATGA 1ZBA1 1L3JA 5HI0A 3VDDA 4Q4Y3 1H4GA 1AJOA 4GMP1 3RYRA 3JD73 2RS32 4JC1A 3JZVA 2A3WA 3H7JA 2CGNA 3PJQA 2XJPA 5BUVA 4YZ2A 2WC2A 2A6XA 2XVGA 4ISQA 3VZJA 5T5LA 3WUCA 3RSJA 4YG3A 2XBO3 4DFSA 4XIKA 5D8AB 5KHHA 2EXKA 1VBD2 2JE9A 4CDXC 3EJKA 5ACA1 1W6PA 1AYM3 1MS5A 1VAKA 1YHFA 4S2FA 5F9TA 1A78A 3V0AA 1UU4A 2JG8C 4MV2A 1GYKA 3UL2A 2ZACA 4H3WA 3VHOA 4D7SA 4R9AA 1MEC1 1XNCA 2HWC1 2SBAA 4M3CA 4FCAA 5KWRA 3J8F2 2VQ0A 1PNGA 2VW1A 3B69A 2X29A 3QOPA 2WNUC 2CGPA 1SCRA 3ZDSA 5JSOA 2JXAA 4N43B 1CAWA 2IXJA 3ZFGA 2NMOA 1MVEA 2WA3A 1RUJ2 1BYHA 1I1EA 3DUIA 4YYOA 2YZ4A 1ASJ2 4XDQA 1X8EA 2H6CA 1RUD1 2CY6A 4PIZA 1V9U3 4KWLA 3AYEA 3KGZA 1NY72 4IXLA 4QGMA 4UW6A 1V6KA 4AEDB 2EA7A 4EN6B 1GR3A 4AI2A 4IEUA 2JG9A 1JHNA 1R091 4QX5A 2DV9A 4AFMA 3TNPB 4FP2A 1DQ1A 2ZGQA 3T1MA 5KXDA 1CQ9A 4FXKB 4V1PA 3ZN4A 4BLJA 4P9IA 4WVMB 3HBZA 4XTPA 2UWAA 5AFBA 3MGUA 1S0GA 3VBRB 1YFYA 4WM8A 3VBFA 4UBGA 1YRZA 4QPGA 4HKOA 1CJDA 4R9CA 4IL7A 2YDEA 2EAAA 3N7LA 3WW2A 1UF2C 1I3HA 4DY3A 4NWWA 3WP4A 5EFUA 1RUG2 4Y1XA 1Q8QA 3BOWA 4LO7A 4C0HA 4RR3C 3VHRA 5C4WC 2QZ2A 1B35A 1COV3 1IGOA 1TEIA 5C8CC 3LSEA 1H4HA 4M00A 3ZO0B 1QJX2 1HIXA 3WZ1A 4JGYB 4NPRA 4XF1A 1JN2P 2DVFA 4HBNA 4MVTA 5A33B 1DQ4A 2ZPXA 1E57A 1BVVA 2VY0A 2ZGOA 3RQ0A 1Z7S2 3JCIA 4KH9A 4FPYA 3WQ7A 4A3XA 4B8EA 1PO13 1HDKA 4XJZA 5AC91 4KWJA 1A6CA 3KCYA 4MZUA 1VALA 2IXCA 3RYPA 2P37A 4AI0A 1IPKA 2OPKA 3J8F3 4COWA 1VIWB 4EWDA 1VAVA 1CAUB 2ZGPA 1K5MA 2LTNA 1AX2A 4N90A 3POWA 3WDVA 1ZRFA 4ASLA 4JVAA 4BA6A 5K8SA 1S0DA 3WDUA 1VBB1 1ASJ3 1QXJA 1QGLA 4HANA 4LA3A 3ZXAC 3ILNA 4K7JA 4JQRA 1GLHA 3E6CC 5T54A 4XF3A 1AL0G 3FUOA 4FQ4A 1IOAA 1RUH1 2ZGTA 1OQ1A 1U12A 4Q0UA 4FAHA 4YFZA 3TWIA 4Q4V1 2BVBA 4L99A 3BODA 4E4DX 2PA7A 1KFXL 1RHI1 2P3KA 5J48A 5I0SA 4M0NA 1U0AA 1ULCA 1NA1A 2PHUA 2VH9A 4LULA 4XZPA 2DUQA 2XKOA 2E51A 3FFQA 1FNZA 3KT4A 2ZS6B 4F83A 3E5QA 1VBE1 3VBUB 4K21A 1AR62 4WVWA 1R1A2 5GZGA 2GNDA 3I2DA 4HK8A 2ZHNA 2FBEA 1PVC2 1RL3A 4PQ9A 4Q4Y1 3KB5A 4OUSA 4Y22B 2GC0A 1W6QA 3VBHB 3WDXA 4KL1A 3IWZA 3WV6A 2D6OX 3B93A 3JD71 4ISRA 5FO7B 4F8AA 1DQ0A 2YROA 2RE9A 3IDEA 1RUG3 3GYDA 4ZKTB 1BMV1 1EAH2 5JMCA 1RUC2 2WJSA 5I91A 4WBBA 1W6OA 2ZKLA 1BEV2 1H1IA 1POV0 3D82A 3TYJA 3VKMA 1X7NA 2W08A 1IS5A 3SCFA 4Z8BA 3SNMA 2RS52 1AR72 5TSWA 4IEVA 1O4YA 3WG3A 2R0FA 1QJX3 1NYWA 1D0GA 3ZN6A 3AKSA 4G9SB 3R0RA 4I09A 2VMIA 4LNVA 1G9AA 3AP6A 4ZU4A 2K0GA 2ZJCA 3TNQA 5CBLA 5EYXA 5GKAC 4Y1VA 4B4PA 4PJYA 3ENRA 4PLMA 1Z7S3 3V56A 4AQTA 1KRIA 3ELNA 1AXKA 1YFWA 1QJZA 1OSGA 4IEYA 1HRI2 1ZX5A 1LENA 5A32B 1AHSA 4TSVA 4JGZC 4CDUB 4E27A 5CFCB 1V9U1 1JW6A 4XBLA 1VR3A 2W39A 1F9KA 5LRRA 3SLIA 3MI8A 2D5FA 4Q0QA 1QDCA 3GBFA 4W6YA 3TAYA 4GALA 3ASIA 2XJVA 3WG4A 5LEJA 1R082 3DPRB 2WNVC 4GB32 3ZSMA 4RQPB 1LECA 1D2QA 1QHDA 3ZSKA 2CGOA 1I9RA 4ZU7A 3VBSC 4RS5B 1EV11 3ZFEC 3GF6A 4IEXA 2G9GA 4AHXA 4CEYC 1LOBA 4IV1B 4XFIA 3M4FA 4CDXA 1RTVA 5JR7B 2VUAA 4KU7A 1SDWA 2D98A 4YSFA 4NOTA 4FTEA 1AUYA 2ENRA 2YYOA 3UKVA 4LO5B 3LWCA 2VOKA 3ZFFC 5J7MA 3ZX7A 2G4IA 2VNOA 1MS1A 3D4KA 2XLGA 4G4FA 4I0AA 5EXOA 2WNUA 1PVC3 2OZJA 3S7IA 2NP0A 4C0BA 4WVZA 2MEV3 1RMU2 2CNAA 4LR4A 1KXGA 2C9AA 4LBLA 2RS31 4OFGA 3UK9A 4KGGA 4B3NA 4HETA 5FTTC 1D4VB 1D4M3 1EAH3 1MZEA 4CP2A 4AXOA 2WINB 1J58A 2DFCA 1F5JA 4HPKB 2XB6C 1RUC3 3JQXA 5E88A 4HKLA 4M0HA 3VZNA 1KQRA 1TE1B 3S30A 3WP3A 3ZXKA 2A6YA 1GZWA 4EROA 4JAAA 4DZGA 1Q8PA 1ZRRA 2RS53 1PO11 3JB8A 1GSLA 3M8LA 5SV5A 2A6VA 4DOUA 4WZFA 5EV7A 2I45A 5JI7A 2QVSB 1BQPA 4COUA 2JECA 4AG4A 3FLPA 2YXSA 4XQDA 2YGMA 3J8F1 1URXA 3ROUA 3KS7A 5JWPA 1H8VA 4AFAA 1J59A 5DZEA 2BNNA 4Y20A 4BMEA 4L8QA 3WXPA 4QHBA 4B4QA 4YGBA 5FRAA 3V0BB 5CG8A 3J26N 4N9HA 3RS6A 1RUJ1 3AMMA 3I4IA 4DXZA 5D1IA 2AH2A 3N7MA 4YNIA 1HV0A 3R4DB 4I2OA 1ASJ1 4GH4C 3U0ZA 4PDWB 4XETA 3ZN5A 3WHTA 5KXCA 4WVVA 4XHBA 4AGVA 1NY71 4QQLA 2RR13 4YVWC 5LK7B 4GMP3 4RR3A 1H2NA 3PVBB 5C4WA 1REDA 3PVEA 3I59A 3O0WA 5CAZA 4RA0A 5C8CA 3N4MA 3H9AA 4LUMA 3QLQA 4HT1T 4LBQD 4YGEA 4GB33 3UV9A 5CB7A 2D43A 3J9SA 2CYFA 4WM8C 1SCSA 3VHNA 2IXIA 3DKWA 3IIAA 1OLRA 5BYNA 4HZFA 3FBYA 4Z1VA 3H1MA 4YZ4A 1BZWA 2W52A 4OHXA 4F3JA 3MLJA 2RM22 4M3CF 1UMZA 2YV8A 1DU3D 4QM9A 1UCXA 1JTZX 1MEC3 2HWC3 4O9GA 4OHZA 5H9RA 1ZRDA 1V6OA 1RUG1 2WT2A 3ZYGA 5DXDA 2PAEA 1OMIA 4XJ8A 2DUPA 2Q4SA 1HLCA 4AVTA 3OD4A 3W59A 4S2HA 3WNXA 1AL22 1CD3G 3IPVA 2JX9A 4LTAA 3WP6A 3WCRA 1PO22 3LA7A 4EWEA 1OFSA 1O7FA 4K1YA 3FFZA 3KQRA 1DBNA 5GJ6A 2DFBA 2R1DA 1RUD3 1QJX1 2FZ2A 2KXLA 1XQNA 4MXVA 1H2KA 2D97A 1TNFA 1PHMA 2WQ4A 1FMD2 2XHKA 4BMBA 3H3ZA 3FWEA 3ECQA 4K3UA 4OVEA 3NV2A 3M70A 4TWTA 3MIHA 3R4UA 3MZHA 3VBOC 3ZMOA 1Z7S1 5FCCA 2GDFA 2D44A 3WOGA 5J96B 2WLPA 1DQ5A 4DPNA 1MZ5A 4YM1A 2K9ZA 1XE7A 1WLTA 2H0BA 3I8TA 5EYYA 3B9CA 2ES3A 1V6LA 1XRUA 2VVEA 4DB5A 1J3PA 1PZ7A 2XVKA 4CTEA 2O1QA 3A0KA 4FPGA 5HCBA 4EN9B 1JYCA 5IK4A 4LLOA 2HYKA 5JOWA 1KFUL 5BNOB 1DLLA 4YZ1A 2BVVA 4KWKA 4P9WA 2GC2A 2A7AA 4GXLA 4Q1RA 3R05A