1RUI3

Rhinovirus 14 mutant s1223g complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rui300
2GH8A 3VBUB 4Q4V3 1CJDA 4IV3A 3JBG3 5GKAC 1NA1B 4FSJA 3VBOC 1PO23 3JD73 1HXS3 4Q4V2 5A33B 1MEC3 1ZBE3 1H8TA 2BFUL 1RHI3 1QJX3 3JD72 1HXS2 1QJY3 4CDQA 5C8CC 1RMU1 1MEC2 1ZBE2 1VRH1 1POV3 1B35C 1QJX2 1RHI2 1QJY2 2HWF2 4N53B 1BBT3 3J8F1 1BEV3 4IV3B 1ND2C 1R083 1VBC1 4CEWC 4Q4X1 1BBT2 1BEV2 1R082 1NCQA 5CFCA 1MQTC 1PVC1 5D8AC 4CDQB 1A6CA 1NCRC 1AR62 4Q4V1 5FMOL 1PO12 5K0UA 3ZFEA 1RB8G 2RR13 4YVSA 2HWE3 1PO21 3JD71 1HXS1 1MEC1 1NG0A 1ZBE1 2RR12 2HWE2 1RHI1 2RS13 1QJX1 4SBVA 5LK7B 1QJY1 4RS5C 2HWF1 3JB8A 4IV1A 5L7OB 1X36A 1POV1 2RS12 5BNPA 4N43A 2X5IB 2FZ1A 1BMV2 4NWWA 1DDLA 4WM8C 1BBT1 1BEV1 1R081 2WLPA 3VBHC 3VBSC 3VBRC 1F8VA 1C8M3 1AR61 5C8CA 4N53A 1PO11 1C8M2 1B35A 1VBE3 1RVF3 3VDDB 4CDWB 4YVWB 5BNPB 4N43B 2WWSA 1ASJ3 1VBE2 1ND2A 2RR11 1RVF2 2HWE1 2ZAHA 2WFF3 4CEWA 4RHV2 3VBOB 1ASJ2 2R063 2RS11 2WFF2 1MQTA 5CFDC 3ZFGC 5D8AA 2GSYA 2R062 1NCRA 4NWVA 4CDUC 4RR3C 1Z7S3 5C9AC 2QQPA 1NCQC 1PIV3 1AR73 5C4WB 3VBFB 1Z7S2 4CEWB 1C8M1 2WZR3 1NOVA 1PIV2 4RQPA 1AR72 4RS5A 2WZR2 1ZBA3 1VBE1 5J98B 1RVF1 1PGW2 3ZFEC 1NCRB 4WM8A 5BNNC 4RHV1 1ZBA2 1ASJ1 1K5MB 3VBHA 2WFF1 4WM7C 4QPIB 3VBSA 1OHFA 3VBRA 2R061 2XBO3 1EV12 2MEV3 4Q4Y3 4RS5B 1AR93 5ABJC 1D4M3 2XBO2 4CDXC 1RUJ3 1F2NA 3DPRB 2MEV2 4Q4Y2 1AR92 1Z7S1 4LLFA 3TN93 1AUYA 1D4M2 3JBG2 4WM8B 2HWD3 1PIV1 1E57A 1PO22 3VBHB 1AR71 1VAKA 3TN92 1QJZA 2HWD2 2WZR1 5CFDA 3VBRB 2ZTNA 1TMF3 3ZFGA 1PGW1 1EAH3 1ZBA1 1TMF2 2Y26A 1OOPC 4CDUA 3ZFFC 4Z92B 4RR3A 1EAH2 5BNOA 5C9AA 1FPN3 1W39A 1EV11 2IZWA 1H8TB 4FTEA 1AYM3 1RUE3 3ZXAC 2BFUS 1VB4A 2XBO1 1RUH3 2RS33 2VQ0A 5CFDB 1ND3C 2MEV1 1AYM2 4Q4Y1 1AR91 1RUE2 3ZFGB 4CEYC 1D4M1 3JBG1 2RS32 3M8LA 5BNNA 5FOJB 1HX6A 2RM23 1AL0G 3TN91 4GH4C 2HWD1 1VB2A 4WM7A 1TME3 2RM22 5CFCB 1NCQB 4RQPC 1VBA3 4PDWC 1TME2 1TMF1 4Y5Z0 1HQNA 1VBA2 1OPOA 1V9U3 1EAH1 5ABJA 2BPA2 4CDXA 5K0UB 1V9U2 3ZFEB 4YVSB 5BNNB 1AYN3 4AEDC 1HRI3 5ACA3 2RMU3 2XPJA 1AYM1 1AYN2 1HRI2 1RUE1 3VBUC 5ACA2 2RMU2 4IV1B 2RS31 5JZGC 1QQP3 1X33A 1M06G 5ABJB 1OOPA 3ZFFA 2RM21 1QQP2 2BUKA 5AC93 1TME1 1FOD3 4RFT0 2ZZQA 1VBA1 5AC92 5C8CB 1FOD2 1RUI3 1RUD3 1B35B 1ND3A 1RUF3 4EJRA 1V9U1 4CEYA 5J96B 4JGYC 1RUI2 5BNOC 1RUD2 1RUF2 4JGZC 1ND2B 1OOPB 3ZFFB 4GH4A 1AYN1 2TBVA 1HRI1 2RS53 5ACA1 2RMU1 1VBD3 1RUG3 4PDWA 1MQTB 2RS52 1VBD2 5D8AB 5A32A 1RUG2 1QQP1 4GMP3 4Q4W3 4CEYB 2HWB3 4Q4W2 5AC91 4AEDA 1FOD1 5L7OC 2BBVA 1NY72 2HWB2 3VBUA 4RQPB 1RUI1 1SMVA 5JZGA 1RUD1 1FMD3 1RUF1 1NA1A 5A33A 5A32B 2FZ2A 3S6PA 1FMD2 1RUJ2 4Q4X3 1PGL2 1POV0 2RS51 3VBSB 4AEDB 1VBD1 3HAGA 1RUG1 4CDWC 4YVWC 5JZGB 4JGYA 4GMP1 4Q4W1 1AR83 1AL23 4JGZA 1NY71 2HWB1 1AR82 3FBMA 1AL22 1FPN2 2HWF3 1WCDJ 1R1A3 1RUH2 1FMD1 1RUJ1 3IDEA 1C8NA 1PGL1 4CDUB 5C4WC 1R1A2 4JGYB 3VBFC 4RR3B 1GFF2 2R073 5BNOB 5C9AB 4JGZB 2WS93 1AR63 5L7OA 2R072 1PO13 2WS92 2X5IA 4QPGC 1K5MC 3NAPC 3CJIC 1RUC3 5FMOS 1AR81 2PLV3 4QPIC 1AL21 1FPN1 1RUC2 4WM7B 2PLV2 1RUH1 2R043 1HRV3 3VDDA 4CDWA 4YVWA 1NA1C 3DPRC 4FTBA 1R1A1 2R042 1HRV2 1COV3 4CDXB 5DDJ3 3VBOA 1R093 2R071 1COV2 2WS91 5DDJ2 2DF7A 1R092 4GB33 4N53C 1VBB3 4Y4YA 4IV3C 4GB32 1VBB2 4RHV3 2HWC3 1RUC1 5C4WA 2PLV1 3VBFA 1H8TC 1QJU3 4CDQC 2HWC2 1BMV1 1QJU2 2R041 1HRV1 4GMP0 4QPGA 1ND3B 1K5MA 3NAPA 1COV1 3CJIA 4QPIA 1CD3G 5DDJ1 3JB4C 5CFCC 1R091 4BCUA 4GH4B 1RMU3 4FTSA 2X5IC 1VRH3 4GB31 1VBB1 4PDWB 1RMU2 3LOBA 1IHMA 1VRH2 5K0UC 3DPRA 3J8F3 4YVSC 1VBC3 4QPGB 2HWC1 3J8F2 3NAPB 3CJIB 1EV13 1VBC2 1QJU1 1PVC3 4Q4X2 4IV1C 3VDDC 5BNPC 4N43C 1PVC2
chains in the Genus database with same CATH superfamily
1QDOA 2GH8A 4G4FA 4KGGA 1TNRA 1CPMA 2ET7A 2VVDA 5FZKA 3WUCA 3PVNA 5GKAC 4AI1A 4D6RA 2A73B 5I8YA 3I2KA 4I0BA 1EUUA 1DG6A 2ZGLA 3VBOC 1PO23 5A33B 3PJYA 3KV4A 5IK5A 5CZKA 5GZFA 3MEPA 1DBNA 1G9FA 1JUHA 3BOWA 3JQWA 4FOYA 5JXGA 3VDBA 3AYEA 1APNA 4QB6A 2YU1A 3OCPA 5CNAA 4LIUA 3WP5A 3ZM8A 5C8CC 2WKKA 4TZDA 2HEYF 1VRH1 1JMUB 3K4ZA 3ORJA 3VKOA 2KR2A 5TSWA 2HWF2 3ZSEA 1ZYBA 4V1PA 3UGHA 4RA0A 5FYMA 1UXZA 2WQZC 4B8EA 4FBFA 5JSOA 2YZ4A 5F9TA 2EAAA 1UX7A 3PUQA 4LHSA 3WG3A 1FT9A 2VQTA 1J3QA 5CFCA 2Z2SB 2D44A 1CWPA 1CAWB 4TWTA 1UAIA 5I0DA 1IKPA 1W6OB 1ENSA 3X29B 4TXWA 3T2OA 1A6CA 1XNDA 3AMHA 5EFUA 1QHDA 1PK6A 3KQ4B 5A3LA 1I9RA 5HBAA 3WDXA 5J37A 4COVA 1J58A 3JD71 4IE6A 2QJVA 3WW2A 5A3MA 5IYYA 1MEC1 1NG0A 4E8DA 1ZBE1 3NWKA 3P6BA 4XTMA 4MG2A 2DTWA 1QJX1 2J7MA 1SLLA 1OI6A 4HANA 4ZPIA 1RJ7A 3POFA 4AYUA 2G9FA 3V0AB 4IV1A 5L7OB 1VMFA 1X36A 1POV1 2E7TA 1ULPA 2B46X 3BPSA 4N43A 1QOSA 1F4AA 5FY4A 3CQOA 2VE1A 1PX4A 2JEMA 1WZXA 4NWWA 1UW8A 2XJRA 4WM8C 1BEV1 3FHIB 2WABA 3MIDA 1R081 2B9UA 3ZLIA 1DGWX 1QF3A 3RYRA 4NR1A 2UYBA 3OTFA 2GC0A 2PHTA 1EYBA 3N7JA 4FFFA 3I8TA 4JKMA 1F8VA 1C8M3 2R32A 2XXZA 1H4HA 3LZZA 2E31A 4OUEA 4CPBA 2XJTA 5C8CA 3HQRA 3KSCA 1C8M2 4DZGA 4BLJA 2JIJA 3U11A 3RYKA 2ZOEB 4N43B 3UESA 1Y43B 3O1TA 4E2QA 1GNZA 3MIEA 1ZZ8A 1KGYA 2W68A 2ZAHA 3UJQA 3B5LB 1LOEA 4P9IA 3VBOB 3WDYA 2QE3A 3E5XA 1VMHA 5CFDC 3ZR6A 5JOWA 3ZFGC 1LB2A 3OYWA 4HLTA 3ZSLA 4UI9L 5H9QA 1HQLA 3ZXFA 2BVBA 3MV01 5FYBA 5HXVA 4CDUC 5IVJA 4ATFA 3VKFC 4YFWA 5LA1A 1A34A 4K6BA 2VZTA 3FWEA 4LO7A 3N4MA 3O1UA 4IEVA 4QHZA 2A6XA 2VD7A 2XL7A 4K1YA 1OQEA 3LE0A 1NOVA 1N1VA 2YY1A 4DXRA 4LIVA 1YXWA 4MGYE 1BYHA 1CZTA 1VBE1 1LOFC 2DYCA 4XC9A 2YFZA 2ZBJA 1UXXX 5HPOA 1DGRN 4WM8A 3BTAA 4RN5A 4RSUA 3TBDA 1UYXA 3POBA 1UZZA 3ZVXA 2D6PA 4QPIB 3AKPA 1S0EA 2ZKNA 4XMIA 5GLTA 1X9TA 1OF4A 4JTOA 2HEVF 1PZ8A 2ZABA 1SACA 5GLUA 5GZGA 4CUGA 3NL1A 3AMPA 4DXSA 3NNMA 2XL9A 1UYPA 1AX2A 4PJYA 4CDXC 2O0OA 3DPRB 4Q8KA 1SLAA 1W8FA 2VUDA 4WM8B 1OKOA 4W65A 3TN93 3WW4A 5GZEA 5DABA 4L11A 4XF0A 1PIV1 1JU3A 1AR71 1GNHA 1VAKA 2ILMA 3APBA 4K9SA 4PF5A 5CIRA 1QJZA 3HEIA 3TN92 5KXBA 1B09A 3IBMA 2PAEA 4KU8A 5CFDA 5HV4A 4QXBA 1TMF3 3ZFGA 2R1DA 5JOXA 1I1EA 1PMIA 1W9SA 3KCCA 5FYZA 4F7ZA 1TMF2 5F3IA 2D40A 2O1QA 3B93A 4QX2A 1OOPC 1O3SA 4CDUA 2R1BA 5T5LA 4ZU7A 1ENRA 5ANNA 2EIBA 2BNMA 2MPFA 5H9SA 3OY8B 5T5OA 4LBNA 4XABA 1XU2A 5KC5A 2BOIA 1FPN3 4PIZA 5IAVA 1EV11 2IZWA 2BGPA 3N9MA 1YWKA 5CEHA 1J59A 4A44A 2V5YA 1AYM3 5T3NA 3TWIA 5J3UA 3MPPG 3ZXAC 2BFUS 2PN5A 2XBO1 5CFDB 2YHJA 4A7ZA 5HCHA 2OZJA 5FWEA 2MEV1 1AYM2 3ZFGB 2V5DA 1LOFA 5FKBA 2FDJA 3RRDA 1OVSA 4XEZA 1T6GC 4NJ4A 1RYYA 3QD6A 5FZBA 4IQPA 2QZ3A 1AL0G 3FLTA 4CU8A 4OMCA 2UWAA 3TEXA 2HWD1 3USUA 4Y20A 1AX0A 1QJEA 1TME3 3O14A 4A45A 5BY5A 3N9QA 4Z2AA 5M0TA 1Y4WA 3C2UA 1VBA3 4PDWC 1IPKA 3Q9OA 3AKTA 1FI2A 1TME2 3WLUA 1KQRA 2WNUC 2IC1A 4CCKA 5JXJA 4LKSA 2UYAA 2ZX3A 3GCXA 1VBA2 3JCIA 3PURA 4CRQA 3SH4A 1EAH1 4CDXA 1MR5A 4H3WA 4AR2A 1C1FA 1URXA 1CAXA 2H0VA 3AMQA 4JKLA 4Y1ZA 4BISA 5A3UA 1LOCA 1HRI3 2JDNA 5ACA3 3OGVA 2MNGA 2RMU3 3NJYA 1S0BA 2UWCA 4W6WA 4Y20B 2XPJA 2BV4A 1HRI2 2XKOA 3VBUC 3S7EA 5ACA2 3BODA 1JBCA 3R4DB 2RMU2 2IXJA 2QVSB 2Z69A 4M3CE 4OZXA 1UOFA 2NZ9A 4JKKA 4XETA 5DZEA 3WP4A 3J7LA 2W87A 3FZ3A 5KR7A 2KA3A 2FD8A 2XB6C 1QQP3 2D3RA 2HYKA 1X33A 2YMZA 1DZQA 3CZJA 3J26N 3NV4A 3T3YA 1OOPA 2WIIB 4L2NA 2RM21 4HKLA 5HV0A 4RGKA 3ZKUA 1QQP2 3NNLA 3DL3A 1QXPA 4LA3A 5AC93 2BP6A 3RS6A 3T30A 5KBFA 4CUBA 2D6LX 4RFT0 5A6ZA 3OBAA 5FJKA 2XLFA 1IG0A 4L92A 4DFSA 1VMJA 3OG2A 4P08A 2VQAA 5AC92 3NJVA 1XE8A 1UIJA 3TRSB 1X8EA 1CAVA 3ZN5A 2A3YA 1IS4A 4LBJA 4GULA 2ZZJA 1RUF3 2EXKA 4B4QA 2D6NA 3B3QE 4EJRA 5J48A 4BWOA 1YO8A 4E4ZA 4BA6A 2K0GA 1E5IA 2C26A 1RUF2 2ARXA 2OX0A 4JGZC 1NXD1 1S0DA 3H9AA 4MGQA 1OOPB 2CY6A 4QPWA 2OW4A 1KD7A 4QDRA 4JV4A 2RS53 4KI5M 3AYCA 3O0WA 4N9HA 5A3NA 1W2NA 4PDWA 2RS52 3OD4A 2WNUA 1UKRA 1DHKB 4YZ2A 5FV3A 1CAVB 4UXAA 4KMQA 5L73A 3CF6E 2CWMA 2ZACA 1C1LA 1AZDA 3DXUA 4CP1A 1X8MA 2ARAA 4R9AA 4LKFA 2QQOA 2RJ2A 4YG6A 2HWB3 3AJZA 1CVNA 4V2VA 1E5SA 1MZ5A 4Q0UA 5LK5A 1STMA 2HWB2 4NRPA 1SCSA 3PVEA 3AJYA 4MYEA 4OVEA 4WV8A 5A7WA 2WBKA 3VBUA 1SFNA 1WCKA 4XW3A 1SMVA 4NMIA 1RUD1 5J1XA 4QX0A 1KEXA 2KM2A 1NA1A 3PMEA 4S2FA 4B4RA 1JZ6A 1FYUA 1QMJA 1W0NA 2JB4A 2VECA 2YBPA 4QX5A 4Y1YA 5KWRA 3IMMA 2Q8OA 1UZWA 2ZKLA 1NX9A 1OMIA 4I30A 1POV0 2XWBB 2ZHNA 3AK0A 2ID4A 2CU5A 5DUWA 3RZKA 3BPZA 4FOQA 1JZ2A 3DEMA 1US2A 1UN1A 2WLQA 4Q29A 4W6YA 5FZCA 5LY1A 2PAKA 4ARXA 2VUAA 3ZKYA 1XYNA 2JD9A 4GD4A 4CCLA 5A7WB 4U36A 5B4NA 2ZA9A 2OZ6A 4HT1T 1QWRA 2PHFA 1GYKA 2OQ6A 4P02B 1KFUL 3IMNA 3T2PA 4ARYA 2EF6A 1JYTA 1ZM1A 4FO9A 5LA2A 1AL23 4I09A 4JGZA 4W50A 3M3EA 5IK7A 3B94A 5FPAA 1UMIA 1UMZA 2J1VA 2QQVA 1AL22 1WW5A 3O0XA 4ZZ8A 2A6YA 3AFGA 2XHKA 3POSA 2I74A 2WN3A 1GANA 4W4ZA 5FUPA 1FMD1 3J7HA 2F17A 3PDQA 2GAUA 2BWCA 3E1F1 1NYWA 3VBFC 1HB2A 3OUJA 5C9AB 1WW6A 2W92A 2WL1A 4JGZB 4UWDA 5EYYA 5C71A 1C3HA 4BXSV 2ZEZA 1W6NB 2C4XA 1ZX5A 2A6VA 1F5JA 3JU9A 3M7AA 1XOYA 4QPYA 1BHGA 1PO13 3PVBB 3ZXGA 4XFBA 2QQWA 3WDWA 1LESA 3RZLA 3HBKA 3GZAA 4QPGC 5JI9A 1F15A 5LW9A 4IGPA 2ZGUA 3IPVA 2Q30A 3OOXA 4OHVA 2VW0A 4QB2A 4AGRA 4E8CA 2VR4A 5GLWA 1QU0A 1OFSA 1I3HA 2PLV3 5JDBA 2ZGSA 1FPN1 3D82A 4EWDA 1TVGA 4PHZA 4WM7B 4OHYA 1PZ7A 2JE8A 2PLV2 4FAHA 4PI0A 2XLGA 1J83A 3ABZA 4QQOA 4M3CA 3LWCA 3VDDA 5F37A 2WNVB 3I3EA 3KCYA 4FXGB 1YFXA 2VTXA 5A7OA 1LEMA 4G9SB 3D8CA 1RUNA 2JDUA 3KF5A 4IE4A 4OHXA 4R9DA 4C1WA 1YQCA 4CCDA 1SDWA 5IAXA 3S30A 4FPEA 2R071 4Q1RA 4Z1VA 3I2GA 2W3JA 3JQXA 4LA2A 4LK6A 5FZEA 1DYPA 3BVCA 5FY5A 2PHRA 5FUIA 3RNSA 3WZ1A 4JVAA 3LAGA 4M3CB 4RL7A 3HR9A 4QQ2A 2VMFA 4AQSA 2SLIA 2JD4A 5FQ0A 1XNCA 3GJBA 1KFXL 1RUC1 1N1YA 3VBFA 3BI3A 5CG8A 2GN7A 1JOPA 4XACA 4XFIA 5BPXA 4YG0A 3RJRA 3GHNA 4R52A 4BMEA 4FPKA 3IIAA 4LHNA 2K9ZA 2XVGA 1LGBA 1WMEA 5FYCA 2L9LA 4FPCA 4Q0VA 4TLGA 4QPGA 1ND3B 2OUHA 5ISLA 1NKGA 2N7GA 2W2IA 2DUOA 5A3TA 4XF3A 2WWJA 1DIWA 4MUVA 2R16A 4BLIA 4Z07A 5FQ0B 3W58A 3ZR5A 1H8VA 4DRRA 1MACA 3CBNA 1YJKA 5AVAA 5DG1A 4GH4B 2PQSA 3LEIA 5DAVA 4QXCA 2RJKA 3ES1A 5IVVA 4DRVA 4FTSA 2VMDA 1OH4A 2X5IC 1VRH3 5FZ3A 1UY0A 2WT1A 4ZXEA 1HIXA 1VBB1 3RZGA 4CUCA 2ZGQA 1VRH2 5K0UC 4AI3A 5FZIA 4EROA 1GZTA 2JB8A 1K12A 2ADDA 5GLZA 3ZYRA 3VZMA 3UKVA 2W1WA 2VUCA 4QPGB 2X53S 4Q0SA 3D4KA 3FUQA 2AGSA 1QIQA 4XXAA 2G4IA 5JSRA 5BUVA 5A7QA 2ERFA 3GHMA 2JKXA 1QJU1 1DGRA 3ZDVA 4S2GA 4DY3A 4IDZA 4CZSA 2GC3A 5HCBA 5AFBA 1VE0A 1HN0A 4AXOA 3QACA 2CYFA 4FI9A 2VTFA 3MW4A 1ZRFA 2GU9A 3PU3A 4IGOA 3RI9A 3AB0A 3RJ2X 2HKXA 4ONUA 4YW7A 3JD73 3EYPA 3WG4A 1MEC3 4NPRA 1V6JA 1ZBE3 4FP2A 3N35A 1XJAA 1QJX3 1AF9A 3JD72 1SQ4A 2O8OA 2WJSA 2YGMA 4TYSA 4KG8A 3HBZA 5GZDA 1MEC2 1JXNA 1ZBE2 1LEDA 4G3YC 2AZ5A 1JTZX 1POV3 1B35C 1QJFA 1QJX2 2GNBA 2LS6A 2YDEA 3K46A 3MFAA 4B3NA 5GZCA 2W1QA 5FY1A 4NRQA 1WBLA 2WSVA 4FPGA 1BEV3 1LENA 1DYOA 4ORFA 1BLZA 1ND2C 1R083 1O59A 1CX1A 1S0CA 1OA2A 1VBC1 2D97A 4YW5A 4CEWC 1U5YA 5FOBB 3MO4A 1BEV2 4UBHA 1NZIA 2GMMA 5C3OA 2B39A 4XZUG 1R082 1GOHA 4XF9A 1QDCA 1MQTC 2BNNA 3VL8A 4MO3M 3CU7A 2A3XA 4B7KA 1WLTA 4HOOA 3E6DA 4XJ9A 4EN0A 5K0UA 1CIWA 1FATA 1O6UA 3T1MA 4XIOA 2DFCA 3ZFEA 1RB8G 1QEXA 3T0AA 1S4CA 1HXS1 2NYYA 2Y34A 2ZHKA 1FXZA 2QBXA 1H6YA 5F6LB 5F5CA 1RHI1 1FV2A 5LK7B 1QJY1 2WT0A 1O5UA 1GZCA 1QKQA 2GC2A 2XVKA 4N8MA 5DAPA 2YC4A 3OGJA 4JAAA 3WNNA 3I2OA 1IPJA 2E32A 2X5IB 4MGKE 1BMV2 3WUDA 1UF2C 4YZ4A 1NAEA 5DZFA 3W5MA 1BBT1 3NSTA 1UZVA 1S55A 2UU8A 3HIFA 2UY9A 4GKXA 2WLPA 3VBHC 3MZHA 5IVEA 4OHWA 5BV6A 3HPNA 2KXLA 3TB0A 2DVBA 3VBSC 1JS9A 4AVCA 2ZGRA 1JZ4A 1SEFA 1V6OA 2IXCA 2DUPA 2OQ7A 3R4UA 4P9XA 3T0BA 3WDVA 1PO11 2LUWA 3OGGA 1B35A 3EXUA 3WQ7A 3MIBA 2BEOA 1VBE3 4OFGA 2Y6KA 3NV1A 5DAWA 1Y9MA 2ZMNA 4YVWB 3BCWA 1YQ2A 2ZX2A 1G7YA 1NLSA 3MUY1 1W06A 3HMYA 2JDZA 1VBE2 4PLOA 1ND2A 1WD3A 2HWE1 3RVHA 4YWAA 5CBLA 3AP9A 1JYNA 4CEWA 2IXIA 4FQZA 1H9WA 4ZY9A 3GZUC 2XWJB 5AVPA 4UFMA 3Q8CA 1MQTA 4LORA 1Q8QA 5FO8B 3H1WA 2VW2A 1H0BA 3KD4A 5I0SA 3BTXA 4RFRB 2IVJA 4SLIA 1YIPA 4NWVA 4MHUA 3WOGA 3RMYA 1UWWA 3M3QA 3BN6A 5CB7A 1UNBA 4BXFA 1NQJA 3WG1A 3TNQA 2FCUA 3MF9A 3BYWA 4NE9A 3PMSA 1CJPA 1ULOA 1Q3EA 3LIGA 1PIV3 3LDBA 4C1XA 1DQ2A 5LA0A 3HJRA 1AR73 3AVRA 4FFHA 4CP9A 1ULFA 4CEWB 4CA9A 1W9TA 1TNFA 4WZCA 4QX7A 1PIV2 2JG9B 5GALA 1FNYA 1AR72 2BVVA 4RQPA 5KHHA 3ZO0B 5F1RA 3WV6A 3BTYA 1AVBA 4KWUA 4AGGA 5C33A 4D69A 5EV7A 3LDKA 1CAUB 1RVF1 3N7KA 4MADA 1YCIA 2Q8CA 3FHQA 4AEJA 5GLVA 1GOGA 4A6SA 1WWYA 2R0FA 2VMHA 4WVMA 4XBNA 1K5MB 2BTVC 1PVXA 4LBQB 3VBHA 2WFF1 1U5IA 4XPVA 3VBSA 1O3RA 2R061 1SG3A 4CUAA 4CP9B 1ZZ6A 4C0BA 2XBO3 1EV12 1GP4A 1LU2A 5FUNA 1OA4A 2MEV3 5DXDA 3ALQA 3LFMA 3CDZB 2XBO2 4QD2A 1RUJ3 1F2NA 2PELA 4NVPA 5FMDA 4NPMA 3VHPA 1W6QA 1JOBA 4YARA 4P5YA 2MEV2 2Y0IA 1PMJX 5FIXA 3GBGA 1IOAA 1SZBA 3T4HB 3NV3A 4YGDA 2HWD3 5KXCA 2BDRA 4WVMB 1OSGA 4LQRA 3SKJE 3SXWA 1PO22 1BK0A 4QB1A 4UF0A 4YM0A 3HT1A 3VBHB 3MYXA 1WCSA 2CWSA 2Y6LA 2HWD2 4I0WB 2AR6A 1PX3A 1MVQA 2ZTNA 5CVRA 1O4YA 4CCOA 3VD4A 4CCMA 3VDCA 2W08A 4HETA 4UFLA 1LHVA 2BYVE 2ATFA 1EAH3 1ZREA 5FCCA 3PUHA 5I8TA 1WLDA 1SBFA 1UQXA 1NT0A 4INDA 4OYUA 2GNDA 2FMYA 1LHNA 3ZFFC 4QX1A 1JUIA 1EAH2 3LD8A 4QU2A 4XDOA 1W6QB 4IW3A 2VZQA 1CESA 2Y6FA 3N36A 5FYYA 3ZYGA 4AVBA 2ENRA 4XCAA 3WF0A 1SLCA 2GALA 4LNVA 1J1LA 2XQXA 4S2DA 2AEZA 4UF0B 3DKWA 1VB4A 3LSDA 1RUH3 4EE2A 1S0GA 2VQ0A 3ZN6A 4XYXA 5FZ7A 1SLTA 3HD8B 4Q4Y1 1AR91 1VP6A 1JH5A 1REDA 1DZRA 5FZOA 3THPA 3VB9A 4E4HA 5BNOA 2RM23 1DCSA 4H55A 4AHYA 2P17A 3N9LA 3EO6A 4LKEA 4ZU5A 4NIAA 1VB2A 2WDBA 5EWSA 2RM22 1VLNA 4CTEA 3GM8A 3LCPA 5CFCB 1Q43A 4FAGA 1D2QA 5IFPA 1UCXA 4TTGA 3FFQA 1JYVA 2DDUA 5FMCA 4CSWA 5HCAA 1O7FA 5K8SA 1YQ5A 4L99A 1HQNA 1BVP1 3AM2A 3BTZA 1OD3A 2JDHA 1OPOA 3K2OA 4UW3A 5JOYA 2CAUA 3T0DA 2BPA2 1PK6B 4D6SA 2YBKA 3IAQA 3ZXEA 5LA9A 1GP6A 1YNAA 5FO9B 2B42B 2D5HA 5JMCA 1X82A 4O61A 5ANQA 4OI2A 5FZOB 4NIIA 2C5DA 2DFBA 1WCUA 5JAXA 3CNAA 5IK4A 3RFRA 4UW5A 2FDFA 3ZXDA 4J25A 4K20A 5T54A 5C7GA 1H2LA 3POYA 2AENA 4D7SA 2GMPA 1H1AA 4GWJA 4FCAA 4IEPA 5LASA 3H3ZA 2RS31 3I54A 4IV1B 1LNSA 3WQ1A 4BQYA 4K7JA 5FXZA 2YU2A 2A5ZA 3MGUA 1M06G 1XXNA 1DGWA 4CXWA 3ITQA 1BZWA 3A23A 4XUOA 3ZFFA 2VCBA 1QXRA 3B9IA 5L9RA 2BUKA 3TEWA 3U1XA 2MHFA 5FPZA 1V6IA 2OVUA 2ZZQA 3LA3A 1N1TA 2F4LA 5K4LA 2ZX1A 3H0OA 4QGNA 3NMBA 4AVAA 2X05A 5C8CB 3Q8AA 3IZOA 4HL0A 2DU0A 4ZS3A 3NW4A 4HK9A 3TEZA 1RUD3 1QH7A 4EWEA 2ZHMA 3HT2A 1V9U1 2VXJA 1O3QA 4JGYC 1FX5A 5BNOC 4XMAA 1RUD2 4Q26A 4J6GA 2W47A 4QKDA 4IEZA 3VZOA 3ZFFB 1W2UA 4MVTA 1AYN1 4GWNA 2TBVA 2WWUA 1ZRDA 3WG2A 4DINB 3CZUA 4XAAA 5IVYA 2JDYA 1OA3A 5LBFA 3SCFA 2CSGA 2WZEA 1ZZBA 4DUXA 2JDAA 2ARBA 3OYWB 1O5LA 3T4VA 1H30A 2WRAA 1AHSA 1S0IA 4K8RB 5EPAA 2SBAA 2ZPXA 3WVJA 1LRHA 2DV9A 3RGBA 1ALYA 4BQWA 2ZHLA 2VY0A 2YG0A 3KV9A 4E27A 4QX3A 2EVXA 2AUYA 2WQ4A 3WINE 2O14A 2OYZA 1FOD1 4YG3A 2K2SA 3AL5A 3CHXA 3IDCB 2BERA 2UURA 3MLKA 1ACCA 1QOOA 1YFUA 2H6CA 1D2SA 1BVVA 5FK7A 1RUI1 4YW4A 4O7XA 5I0RA 5K9YA 1FMD3 1QNYA 4BH9A 1E5HA 1G6NA 3ETQA 2VZPA 4COZA 3PU8A 3LFIA 1UOBA 3ZIWA 1V0AA 2X10A 3QOPA 3U4XA 1UU4A 3S6PA 1DQ4A 1FMD2 2FZ2A 3NKGA 4Q4X3 1Y3TA 4HPKA 3FN9A 3KMHA 4JHTA 2E53A 5CYYA 2OS2A 2I2SA 2OUJA 5A6YA 2NMNA 2H0BA 3WF4A 5KHGA 3KZ4C 3ZSMA 1IG3A 1RUG1 3H8UA 4CDWC 4R9BA 4CCEA 1TE1B 5FFOC 1H1IA 2W46A 4FXKB 3RYPA 1I5PA 4CU6A 3I3BA 4XUTA 3MW2A 2QQLA 4JGYA 3NRUA 1ZZ7A 4Q4W1 5EJZB 2WO1A 4P5HA 4Q1PA 5G04L 4MHRA 4BDVB 1MS5A 5L19A 1NY71 3VHRA 3D0JA 3GDBA 3VV1A 3ZIXA 5JOZA 2PYTA 4HPKB 4KWKA 3BUCA 1IKQA 1ST8A 1J84A 4GIQA 3TEYA 1FPN2 1QGLA 2CNAA 1Q56A 4MGSA 2JX9A 2AC1A 5JLVA 1H2KA 1S1AA 2HJIA 1IS5A 4HFSA 3IDEA 2WN2A 1RUJ1 3O5SA 5FZLA 1C8NA 3E6CC 3LEGA 4H14A 3J7MA 1HB3A 2VCCA 3PUIA 3VN4A 3DV8A 4CDUB 3LPGA 5C4WC 5JPMB 4JGYB 3CIHA 3N9PA 2R073 1DF0A 4QQPA 5BNOB 4CU9A 2P2KA 1W6PA 5FXXA 1AR63 5FYTA 2YROA 2VPVA 4XUNA 3SNMA 4KGQA 2R072 3EMRA 5C6CA 3FBYA 1OBNA 4BMBA 1GQHA 2WO2A 2Q1ZB 1YJLA 5A7NA 3ZYIB 1UPSA 2VCAA 4NN0A 1OUSA 2GDFA 3AYAA 2W1UA 4XFGA 3BU0A 1RUC3 5FMOS 1A8DA 1DQ0A 1CR7A 2VO5A 4GWIA 3WF1A 5CKNA 2V4VA 1YLLA 2DVGA 2P3JA 2Q0AA 1RUC2 2VZUA 1GKBA 3USUB 3Q8FA 1KJLA 1XU1A 4BIOA 3GYDA 1TG7A 2HYXA 1EPWA 2DWRA 2VTXJ 5IJRA 1DU3D 1W6PB 1RUH1 4CDWA 2Q1MA 2C9KA 4XURA 5IT6A 1NA1C 4O9GA 4DO0A 3VHNA 4ISQA 2WA4A 4AI2A 4CE8A 1R1A1 1DQ1A 4CDXB 4GWMA 5F3GA 3KHBA 4AQTA 2JKBA 1UOJA 5IVFA 1KITA 2J1SA 3GBWA 3WHUA 1CAXB 2BNOA 3SQOA 3AYDA 1ZNPA 4PQ9A 2CAVA 2EA7A 5B2GB 2J1EA 4O9EA 3ILFA 4N53C 1VBB3 3J7NA 3NNGA 3ZSKA 1UZ0A 3VGIA 1LGCA 3NJZA 3OBRA 1OC1A 1JHJA 1GWKA 2VMEA 2ZAAA 1VBB2 4Y22A 4RHV3 3S5QA 1CZVA 3GF6A 4OI1A 3L2HA 1L7RA 5EZWA 5C4WA 1H8TC 1LOAA 1OQDA 4KWLA 3KQRA 1QJU3 2C6SA 4OLLA 3ZX7A 3O1RA 3T1LA 1DP0A 3VZNA 2WINB 4K3UA 5H9PA 1O4TA 1QJU2 1L7LA 1ULCA 2R041 3ATGA 4GMP0 4M4PA 1XSRA 4S2HA 3WNKA 3RDIA 3PIGA 1RTVA 3U37A 1YI9A 3ROUA 5AFEA 1GICA 3MIHA 4GJZA 3ASIA 1C5IA 1H1MA 1JU4A 3IDAA 2PTMA 5FZ6A 4A3ZA 1UY1A 1ULGA 2VZ1A 3H8XA 4BCUA 4ISRA 2XJQA 4Y1UA 2YFUA 4A7YA 4AQ6A 5JWPA 4ZU4A 1S2EA 1RUOA 1ULEA 2WA3A 4KQ7A 4P00B 1F9KA 5CKQA 3CLPA 4AVTA 1UO9A 2IVIB 5L9VA 4GB31 3VZJA 2RE9A 3SEEA 3MW3A 3C7FA 4PDWB 1K3IA 2VAUA 1AX1A 2VZVA 1WA6X 3LOBA 5DUUA 3RSJA 2WNUB 1IHMA 1WD4A 4AEKA 5IHRA 3FMGA 5JIUA 2D7FA 4DEVA 3B01A 4YVSC 3DXTA 4IL7A 1VBC3 4NHYA 1KS5A 1H9PA 2GC1A 3INAA 2OXBA 1ULDA 2A1XA 1JOJA 1SFPA 1I5ZA 1VBC2 2O8QA 5I8SA 1WLWA 4DEQA 1RGSA 4AZZA 4ATEA 1AJKA 3PJQA 3CL1A 4Q27A 2ZGKA 3ETPA 3VDDC 3VL9A 5BNPC 4N53A 5DAXA 1W8WA 3KCXA 3VBUB 2NP0A 3L9JT 4LK7A 4LO6B 1LCLA 4XBQA 4ES9A 5T52A 3H8OA 3JBG3 3MHZA 4DUWA 4XHBA 3ZMNA 4BZ4A 1NA1B 2ZGPA 3AZXA 1XNBA 1HXS3 3EBRA 4EZ4A 2D3PA 2C9AA 4LE4A 1W03A 2XJSA 4PBOA 5HXMA 1H8TA 2BFUL 1RHI3 3I59A 2GP5A 1HXS2 1QJY3 2VH9A 3ME2A 5EXOA 3H8RA 3DN7A 1RHI2 3TAYA 1QJY2 3C7EA 3Q8BA 3C8XA 2FDIA 4N53B 2W0XA 1BBT3 2Q5TA 2R7EB 1LGNA 2P34A 3J8F1 4HN1A 2J1AA 4OHZA 4COWA 1HN1A 1Z78A 5FP8A 3FJSA 4A6OA 5F5QA 3DYMA 4D6QA 4Q4X1 1BBT2 3ACGA 3RZMA 1W9FA 3I2JA 3VDAA 3ST7A 1NCQA 4AVSA 5DUXA 1JYIA 2VZSA 3WHTA 1PVC1 4Y5SA 1L7QA 4URTA 4GALA 3VD3A 4LBLA 5D8AC 4K1ZA 3NV2A 1UY3A 3ACHA 1NCRC 3A21A 4LBQD 1KDMA 4YW2A 2FDHA 4Q4V1 2K46A 4PIXA 1PO12 2B8MA 1NLRA 2X8KA 3LGRA 4K40A 4LBMA 3AC0A 5FMOL 3UT0A 5A6XA 2VBDA 3NNJA 4WBBA 3ZDSA 4YVSA 2HWE3 5C5UA 4MLOA 4AE2A 2RG4A 1DYKA 2JXAA 4H2AA 4XOGA 4HVQA 5J36A 2HWE2 4AHWA 4NAOA 1K5JA 1GNYA 4AVVA 1OXCA 5FZ4A 1XBFA 4QHBA 5BNPA 2FZ1A 4C0HA 2AREA 1YRZA 4X8PA 1DDLA 4BPZA 4HONA 2JDMA 5DQ0A 1LHOA 1WBFA 5LZ6A 3IPVB 3U14A 5LRRA 4MXWA 2Y38A 4JX0A 2TNFA 2XGXA 1LECA 1WMFA 1GLHA 4HKWA 3VBRC 4AL9A 3K51A 1YQ6A 4HSJA 3MDPA 3QH7A 1AR61 3QBQA 4IXLA 1EP0A 4J1WA 4JDMA 4AG4A 3EHKA 5H9RA 1F31A 4OUSA 3TNPB 1LTEA 5FK8A 2XJVA 3IT8A 1SLIA 4QM8A 5IFTA 1RVF3 3VDDB 4BQXA 3V0BA 5DPNA 3NKTA 4QT6A 5BNPB 5APAA 1NUKA 2RR11 1RVF2 2WFF3 4BK5A 4NIDA 2QQMA 3GGLA 4LJHA 4UYBA 5FRAA 2R063 2RS11 1SLBA 2WFF2 1TEIA 4UW6A 3ZYPA 3AXEA 4EV0A 2IFRA 1XNAA 2FQPA 2DCKA 5D8AA 2R062 2VNGA 4BE3A 1OT5A 1HV0A 1NCRA 1SHWB 3S0MA 3G6JB 2VQUA 2Y6JA 4RR3C 4IEQA 3TOJA 5LWBA 2JE7A 4CU7A 2DCJA 3M1HA 5FPUA 5A3OA 1MS8A 3VBFB 1KS4A 3WNMA 1H2MA 1V6MA 4DB5A 3DYPA 1GWMA 1JN2P 3OUHA 2P37A 4QGLA 3POIA 2DCZA 4LO4B 3ZFEC 2VBBA 1NCRB 5BNNC 2E7QA 4RHV1 2D6OX 4FPLA 1ASJ1 4L9BA 5L36A 2QUOA 2GMEA 2AH2A 1LKNA 1ENQA 1OHFA 1PMHX 5FBJA 3VBRA 1T6BX 4YZ1A 2WZ8A 5FLJA 1OF3A 4AFCA 1RITA 2A70A 2ARCA 3WCRA 2DURA 3MI8A 4Q4Y3 1AR93 4LKDA 5ABJC 1CONA 5A80A 1CQ9A 4AEMA 3RG0A 1XB9A 4K21A 3I97A 4Q4Y2 2E26A 1AR92 1PM4A 3IN9A 1Z7S1 5DUVA 5KHIA 1AUYA 2FCTA 3DGTA 4MOAA 4X6RB 4CPBD 5A1LA 5J09A 2Q4SA 1E57A 5DN2A 1W3XA 4MSVA 2RVAA 3RZHA 3FUOA 1W8ZA 2WZR1 4OCTA 3LQCA 3VBRB 4HXCA 1C57A 1F35A 1PGW1 1AXKA 1J3PA 2YB7A 1ZBA1 1Q8VA 4P9JA 2CHHA 1QY4A 1WUVA 2VUJA 5FZGA 5C5TA 4META 1W8OA 5FP9A 4AF9A 1OURA 3PLQA 2VG9A 2VOWA 2H6BA 2EIEA 2LRPA 3KGLA 2LTNA 2Y6GA 4RR3A 1IZ3A 4OQ8A 2G9ZA 3KT7A 4XE9A 1VIWB 5A1FA 4GKYA 4M00A 3H3LA 4MGZE 3WSOA 4BQ2A 4FTEA 2ZMLA 4FQ4A 1LJ7A 5IW0A 5A3PA 1PZ9A 1W05A 2DBIA 1YEWA 2B45X 4R9CA 4CCJA 1W8NA 2RS33 1ZZCA 4GQ7A 1W99A 3AKSA 2VNOA 1D4M1 2JDPA 3JBG1 1A3KA 2RS32 2W91A 4QGMA 5BNNA 1JZ5A 1HX6A 3AZZA 2ZX4A 2IXKA 5F2SA 3FX3A 4DNYA 2CGNA 2FDGA 2QNKA 3E6BA 3F2ZA 3U10A 3WP3A 2C24A 1BKZA 1QOTA 2GNTA 4I2OA 4XUQA 2DUQA 4DUVA 4Y4RA 5F3CA 4RQPC 1GQPA 4LOSA 4ZONA 1E5RA 4XJ8A 2PAMA 3E5QA 4HK8A 4Y5Z0 4C91A 1V9U3 5ABJA 1JZ8A 3ZXLA 2AYHA 4AFBA 1DLLA 1W8HA 1OPMA 1UYZA 3GALA 3OPTA 3P1IA 5EHDA 5FZ8A 4AAXA 2EXJA 4D3WA 5K0UB 1W6MA 1D0HA 1GMMA 1V9U2 1UZYA 4LR4A 4XVHA 1GZWA 2JJ6A 4QXKA 4FPFA 3FL7A 2ET1A 3ZFEB 1AYN3 5JIAA 5BNNB 2Q1FA 2XKPA 1CX4A 2JIGA 2YPJA 3DYOA 2VU9A 1GV9A 5JPNB 1OKQA 2JG8C 3WQBA 2A3WA 4BU2A 1AYN2 1MS1A 1RUE1 4BYYA 4CP2A 4EYUA 1JI6A 5SV8A 1C28A 2BZDA 4XXPA 1Q5OA 4IETA 4QAWA 2YXSA 2XG3A 3VLBB 3OUIA 4YRDA 5FY0A 5ABJB 1O3TA 5C3PA 1QNWA 2ORZA 4COUA 3VUOA 3MIFA 4GAZA 1W6MB 4MGTA 2WFPA 4RYDA 2BJSA 1U12A 1UD1A 1FOD3 1BJQA 4FPJA 4R8HA 4X8NA 1WLCA 4IEUA 3RPQA 3LEMA 2W1SA 4BQ5A 4AW7A 4K8FA 3BB6A 4HN0A 4KH9A 2ZCWA 1FOD2 1RUI3 5G05L 2PFWA 2ZEWA 1FNZA 3OD0A 4ZZ5A 3FLPA 1B35B 2QFEA 5B4XA 3AP4A 3S7IA 4PBPA 3N9OA 1RUI2 3OEAA 5J96B 4DXZA 3C7OA 3THCA 4NHXA 3AP6A 4PLNA 1RC6A 1OUXA 4XAEA 1ND2B 2F4PA 3R6SA 1HB4A 4DPNA 4NIHA 1N47A 2CDPA 4M01A 4QKNA 1CN1A 1ZVFA 2P1BA 4P14A 1HKDA 4QWNA 3SH5A 3WEZA 2B5HA 1RUG3 1MQTB 5IWFA 3EJKA 4XDPA 1G8WA 5FZDA 4YSFA 2D6KA 3GZEA 4EN8B 1RUG2 2PHLA 4COYA 4BQ1A 4PIYA 4CP0A 3HNMA 4Q4W3 3WF3A 4A42A 3W21A 3WDUA 2VGDA 3I3QA 3T2QA 4LUKA 4Q4W2 3THDA 1S2KA 3B02A 1SBEA 5L7OC 2BBVA 4QQHA 2IXLA 1NY72 1N3PA 2JG8A 1LHUA 4DQAA 4PT6A 1POQA 2QQNA 4RQPB 2VMGA 3HN3A 2QDNA 5T5JA 1X7NA 3A0NA 4RGAA 4NAMA 2W9XA 5A33A 3I3MA 3BKZA 1XE7A 5D2AA 3UL2A 1RUJ2 1S0JA 3A0KA 1ONAA 4DMIA 1W9YA 3O0VA 2Q8EA 1G9AA 1TQ5A 3G7DA 1OLRA 2R49A 5JUVA 3VBSB 4XILA 1VBD1 2ZJCA 1NE6A 1DGLA 2JG8B 3I3DA 3KB5A 4IE5A 4IE0A 4A3XA 4XJZA 2OT7A 4DY5A 2NM1A 1WA4A 1LU1A 3IDBB 1LOGA 5F6KA 4GMP1 3DF0A 3N3HA 3QLQA 4XFHA 4YNIA 3WNOA 1CAWA 2VL4A 3JZVA 2AACA 3PIJA 4DS0A 1W6OA 1JYCA 3LSEA 3B7MA 5LCWL 1JZ3A 1VAVA 3RZJA 4M0HA 4L0PA 4DOUA 3IWZA 2HWF3 3OEBA 4IEWA 2VOKA 2E9QA 1LAJA 2WYSA 4JDNA 3I49A 1F5FA 1D0GA 3K75B 4YM1A 1FAYA 3LEKA 1OD5A 2VOXA 1YI7A 4B4PA 1WCDJ 3E5UA 1IS6A 1R1A3 1RUH2 4AHZA 3AKQA 4FPHA 5F7UA 1J1TA 2VZOA 2XJPA 2YC2A 3HNBM 3RMXA 2CGPA 1PGL1 2OPWA 1KDKA 1R1A2 2VJXA 3UETA 5JMOA 4QHOA 1J3RA 2ZX0A 4WVVA 3D6EA 5FYSA 3HOBA 4LE3A 1OH3A 3V0AA 1Q8PA 3HQUA 5L7OA 3KLSA 3MICA 3ES4A 2I07B 2QQJA 3IKWA 3VD5A 2DCYA 4E9KA 4TN7A 4Y5TA 5FY7A 1Y7BA 4F3JA 5FP4A 3AP5A 3UJOA 3ZN6B 4IERA 3PUAA 2IWGB 3J4UH 4FOWA 4OI4A 5IVBA 4Y33A 5KXEA 5BYNA 5JR2A 5BXXA 5FZ9A 3VZKA 4RD7A 1AR81 4QPIC 2D6MA 3O1VA 2YV8A 5FY9A 1EPZA 1HLCA 3OGSA 1Q8OA 1CPNA 5SV5A 3M4FA 1IQAA 2EXIA 4IE7A 3K3OA 3H50A 1UMHA 2D93A 3H1MA 2R043 1S2BA 3SISA 4JCKA 5A6QA 4UBGA 4LUMA 3DPRC 4JRLA 4FTBA 1HQWA 1XYPA 2YPDA 3A4UA 2XVLA 2R042 4Y24A 2VC9A 3H1YA 4Z8BA 3D3AA 3DKQA 3VBOA 4BM8A 4UT5A 4BHPA 4TLFA 4XQDA 3HNYM 3KGZA 1W2TA 2WS91 3K48A 2QKDA 4YFZA 3RQ0A 5DMYA 2DF7A 2WNEA 2R0HA 1W2OA 4GB33 5FP3A 2PA7A 3POGA 3WP6A 4IESA 5FTTC 1DQ6A 4H7MA 2V72A 4Y4YA 4IV3C 4QQLA 2OKXA 1LULA 2Z42A 4GB32 1U0AA 1NXMA 3IAPA 3OBZA 4P9YA 3H7YA 4ASLA 2B4KA 1YUDA 1UIKA 3AMNA 5T50A 5F2WA 2E6VA 4XFAA 4CDQC 2VW1A 4XHXA 5FKCA 5FZAA 2FDKA 3JUUA 4KL1A 2P3IA 1BMV1 3M3CA 3GBFA 1O91A 3AZWA 1PNGA 2P4EA 4Q2FA 3C3VA 1HRV1 1LHWA 5JXHA 1V6KA 1JHNA 3RZZA 3T09A 3O1PA 1MS9A 4NRMA 2UWBA 2QCSB 4Y1XA 2P3KA 2CGOA 1COV1 3WD5A 2FBEA 3LA7A 2GH2A 4QPIA 1CD3G 5DDJ1 2NLRA 1R091 2XLAA 5CAZA 4L8QA 5E88A 4B1LA 2FMDA 5C3SA 3DUIA 4V2WA 5CU1A 2ZGTA 2EIDA 5FAXA 3M70A 1W3VA 2D43A 2XOMA 3NQHA 3O12A 4GXLA 3WR0A 2ADEA 3DPRA 1RXFA 3J8F3 2W39A 3WNXA 4FPYA 1MZ6A 3MLLA 1KRIA 1YQ8A 2HWC1 2JENA 3A22A 3J8F2 2VVEA 4Q8LA 2ZS6B 5FDBA 4Y26A 4YW3A 1AJOA 1V00A 4OUMA 3SKVA 1G9BA 1PVC3 4Q4X2 4ASKA 4N7IA 3LOIA 3BGAA 3SLIA 1UYYA 4LHKA 1PVC2 5EJ3A 3R0RA 4Q4V3 1CJDA 2XDVA 5F3EA 4IV3A 3W59A 1V70A 5A7SA 3KS7A 5FMBA 4EN7B 3JXSA 3F95A 3C7GA 4FSJA 2W5FA 3OY8A 1ZRRA 2VZ3A 4Q4V2 2KD7A 5A3WA 3PHMA 1WKYA 3LF7A 3R4SA 4WVZA 4AFDA 3MUZ1 4EN6B 3PVOA 3POJA 4EZHA 5FYUA 4CDQA 1RMU1 4XFFA 1TZOA 1VAMA 2A7AA 3VD7A 4N90A 1MPXA 3I4IA 4BQ4A 1GU3A 1LODA 4C8DA 1V6NA 4LO8A 3VZLA 3D0SA 2YC0A 2RJLA 4N9IA 5LRSA 5KHJA 4KWJA 3ACIA 1UY4A 4IV3B 3W9AA 3RI8A 4MH0E 1MZFA 4KBBA 1GR3A 4LBOA 4GA9A 3ECQA 3WDTA 1GP5A 1OVPA 2A71A 2BGCA 2ORXA 4XF1A 3ZPYA 2Z79A 1HV1A 2J1TA 4OMDA 4QDSA 1WGPA 2WT2A 2WZPP 5LBCA 4CDQB 5FZ0A 3V56A 1R64A 1AR62 4NHKA 2BU9A 2FHRA 5I0UA 1F4HA 4YGBA 1UKGA 1RL3A 3ZSJA 1D7PM 3FLRA 2V73A 2XONA 4ZHNA 2VBPA 2RR13 4Y1VA 5I0TA 3LA2A 4MX3A 5L9BA 1PO21 1CZSA 2VMIA 1HJFA 2BQPA 4BJ0A 3P3NA 2RR12 2RS13 2G1MA 4SBVA 3ZN4A 1G9CA 4DIQA 4PF1A 4ZS2A 4RS5C 2HWF1 2XJUA 3JB8A 4UFIA 2TUNA 1YIFA 5FXVA 4BOWA 2RS12 1X50A 1GQGA 3PTRB 1W2AX 4C90A 5E16A 3K4AA 2WNOA 4A7KA 3BU7A 5FZ1A 1JZ7A 1WW7A 5F32A 1ZA7A 3L2YA 5GM0A 4E2SA 1ZA4A 3M3OA 2QQUA 2HH9A 4CXXA 1O4ZA 4YZ3A 4URAA 1DLCA 2WO3A 2J42A 3KWVA 2BRTA 2PXJA 1L3JA 1RINA 1C4RA 4LPLA 1LOBA 3ZMOA 3V65A 3M2MA 2RDRA 3CJXA 2B9VA 4AI0A 3OB8A 3ON7A 1ZZ9A 1NQDA 4CDWB 1US3A 3QH6A 4Q0PA 5E1RA 3SHRA 1GZ9A 3R05A 2WWSA 4H7LA 2RDSA 1R1ZA 1ASJ3 5FZMA 1H6XA 1ENXA 3CEWA 2DCTA 2CDOA 4PI2A 2RDQA 4RHV2 3O1OA 4IEXA 2IXHA 3NNFA 3WNPA 1ASJ2 1XE0A 2VXRA 4YW1A 2D98A 5FR3A 5EIYB 5F5AA 4B7EA 4P9LA 4JHZA 2Y33A 5EYXA 4AFAA 3E97A 2G9GA 2XHNA 2GSYA 2D3SA 5FP7A 4OI0A 5LBBA 1DQ5A 2PMWB 2AEYA 2P6HA 1IQDC 3ZYHA 1Z7S3 3O7OA 5LEKA 4NROA 5C9AC 4Y22B 2QQPA 1NCQC 4I3PA 5C4WB 4B29A 1Z7S2 5DZGA 4KNCA 5LEJA 2QDRA 4J1XA 1C8M1 4W6XA 2EIGA 3I7DA 2WZR3 5C3RA 5FLIA 1VPHA 5HI0A 2Z5WA 2Y6HA 4RS5A 4QX8A 3UGFA 4O65A 2WZR2 1ZBA3 5J98B 3VKLA 4PLMA 2DTYA 2NQYA 1PGW2 5DG2A 4D7YA 2Y8KA 2VZRA 2UY8A 3UKTA 2VMCA 3ZPOA 1ZBA2 2CL2A 2WR9A 5CADA 4MZUA 4NO4A 2E63A 4WM7C 2FCVA 3KVBA 4IUGA 3N7LA 2RDNA 3GCWA 1UY2A 3N7MA 4YLZA 2BBAA 3BOPA 2WNVC 3A7QA 1G86A 1MS4A 2G19A 2V4AA 1K45A 2ZGOA 4RS5B 3OSDA 1D4M3 5IUQA 3OBTA 1RJ8A 1GWLA 4LLOA 4XBLA 2ZEYA 3UYJA 2VNRA 1OLME 4LLFA 1WW4A 2ES3A 1D4M2 2XUMA 3JBG2 1OLQA 4YM3A 3BIEA 4BB3A 1W04A 2BW8A 5EQUA 3P3PA 1SCRA 4UFKA 3T08A 2ZEXA 1YFWA 4LEJA 4XIKA 2E7AA 2IFWA 3H7JA 2TEPA 3LKJA 3PL0A 3U78A 5FPBA 2HBTA 4I02A 3WF2A 4PQQA 4E2GA 1A78A 1U5XA 1PNFA 1BK1A 5JR7B 2Y26A 4B1MA 1HJGA 4F83A 3ZOIA 4Z92B 2W52A 1WCQA 1UPIA 3PNAA 5C9AA 1I6XA 5I91A 3H42B 2YYOA 1W6NA 1W39A 3SC7X 4LO5B 1H8TB 3HVDA 1DZTA 3I59B 1W8TA 1RUE3 1JW6A 1ODNA 1W8UA 1XNKA 3GXUA 4AHXA 1G9DA 3THTA 5F39A 4XJAA 1GSLA 2R6QA 4Y3OA 1ND3C 3P5BA 3Q8EA 4HKOA 1RUE2 2XUEA 4CEYC 1KJRA 3NO8A 4E4SA 4JC1A 3M8LA 3CKHA 1BCXA 4XUPA 4WVWA 5FOJB 2GN3A 3LB9A 4NHLA 3WY6A 3TN91 3VHOA 3MLJA 4GH4C 3UV9A 4WM7A 4OQ9A 4XQ4A 1T2XA 5E8AA 2J1UA 3MV11 4LTAA 4QKBA 1NCQB 5FZFA 2ZGNA 4I01A 3VKMA 3UGGA 2WNVA 4U2AA 1TMF1 3VKNA 1YYNA 2QTWB 2Y0OA 3BALA 1MS3A 4MXVA 1GUIA 4XFCA 3FC0A 1NE4A 3AMMA 4HG6B 2WC2A 3U4SA 4BIFA 3V64A 3AZYA 1H4GA 1BXHA 2B7YA 1OQ1A 3OJBA 4FFIA 1Q8SA 2PHUA 4YVSB 4QM9A 2EALA 4F8AA 1JYXA 4JZRA 4AEDC 4Q0QA 4D8MA 1CGPA 4YGEA 2LM3A 4QKFA 3GZTB 1IGOA 3FHAA 5KHKA 1N3OA 2ZMKA 4GZ9A 4R4XA 1AYM1 3IB3A 3POWA 2WAAA 3ZXKA 4W8JA 3T2TA 4BK4A 5FREA 3CMGA 4LHLA 3SEPA 2RV9A 5JZGC 1H2NA 2BOJA 2VNVA 1OFNA 3PUSA 5D1IA 4IGQA 4TSVA 3SITA 3U75A 2RHPA 4Z82A 3AP7A 3WX5A 4MGIE 1REEA 3BIWE 5FLHA 5A1AA 3ACLA 3H3UA 2LROA 4FPOB 5E89A 4LULA 3W5NA 4P9GA 3EB7A 4P9WA 3FFZA 1HW5A 5E6HA 4MXWB 5FYVA 1TME1 2HEWF 5C8WA 3AFKA 4FOVA 2JICA 4HMZA 3N9NA 3LPFA 3MIGA 1VBA1 5IVCA 1O8SA 1GBGA 2XR4A 1WMDA 3B9CA 5T55A 2DBNA 2WO7A 3AKRA 3J9SA 1ND3A 5FXWA 5ERLA 4CEYA 3U07A 5BNQA 3V0BB 2JE9A 5JVVA 1JODA 3KM5A 3NJXA 5D21A 2VCMA 4CVUA 1DFQA 1UU6A 2I45A 4YZ5A 3KHCA 2WQ8A 1YC61 1WMXA 4GH4A 2WAOA 1HRI1 4ITCA 1IPSA 4AWDA 5ACA1 2RMU1 4OZOA 5F8PA 1VBD3 3GNEA 3K4DA 1D4VB 4FT8A 1GOFA 1W9WA 5F5IA 2IUWA 2HBUA 4HBNA 3MFCA 1VBD2 3KVAA 5IATA 5D8AB 3VD9A 5A32A 4UFJA 2ZGMA 1QQP1 1CIYA 4GMP3 3HQXA 3U0ZA 5I93A 3C7HA 2DVAA 2DVDA 2VULA 4XCBA 4CEYB 5KC6A 4WZFA 1W90A 1AXZA 1ZRIA 4D0QA 3OF1A 5AC91 4AEDA 4XJUA 3OGRA 4HSLA 4AAPA 1AXYA 1EY2A 1QXJA 5FPXA 4X6QB 3WW3A 2HLEA 2EXHA 3FE5A 4UW4A 3AXDA 2EICA 2C0ZA 4LXLA 4NIGA 3QCWA 5JZGA 2Y64A 2YUEA 1MZEA 1RUF1 2PQQA 3WNLA 3KT4A 4KG0A 5HCFA 5A32B 1OLMA 1XNTA 1UX6A 1VRBA 2NPIA 3UKNA 4Z2WA 2JECA 4OULA 2XQRA 1PGL2 2RS51 4YGCA 1N1SA 3IM0A 2NN8A 3WXPA 4AEDB 4EWAA 3HAGA 3S57A 3KV5A 2CV6A 5EJ1B 1ODMA 4KBZA 2XMLA 4YVWC 4IEOA 2VVFA 4NUBA 4AFMA 1SBDA 3AZVA 3AL6A 1RXGA 2W95A 5FPLA 2E51A 5JZGB 1RIRA 4QU1A 5C3QA 1AR83 5DAQA 3UNPA 3ZYJB 2P5BA 5CKMA 3MPBA 4XZPA 4CCNA 4CYDA 2HWB1 2X29A 4XJWA 4D94A 1XPWA 1MVEA 1AR82 3CO2A 3FBMA 5FY8A 5FZHA 4XQWA 3POEA 4ASMB 2ETEA 1SDDB 4QXHA 3WCSA 4D7TA 5IK8A 2F6BA 4YYOA 3ILRA 2JDKA 1EUTA 5GJ6A 2OA2A 5EP9A 4DXTA 2E33A 4MV2A 1X9PA 1P8JA 3LDRA 2YGLA 4UOJA 4HVOA 3SH3A 2D5FA 3USSA 2Y60A 3OPWA 2VOTA 3I2FA 4XTPA 4RR3B 1GFF2 3WW1A 4M3CF 4NHMA 4ZKTB 2WS93 5FPVA 3ILNA 4ZXKA 2JG9C 3GJAA 3SCHA 2YBSA 4CXYA 4FFGA 3OPZA 3I2DA 2VOVA 1HB1A 3MF6A 3UK9A 5FWJA 4QDQA 2WS92 2X5IA 3K77A 2PHWA 3KF3A 1N3QA 1PM7A 2A75A 1XQNA 4AOCA 1V6LA 3RWNA 5FYIA 3DCQA 5JI7A 4N7UA 1K5MC 3NAPC 1VALA 1VJ2A 1PGSA 1UL9A 3CJIC 2A6WA 1YHFA 1AL21 4JRAA 3URFA 2X09A 2QZ2A 4NPLA 3K3NA 4YM2A 1NLQA 5FJHA 1K42A 3I2HA 1W0PA 1W0OA 4QMAA 1XC6A 4AK3A 2DU1A 1HRV3 2Z4FA 2LW8A 4HZFA 4YVWA 5FYHA 4RGGA 3B69A 1LR5A 2CTVA 1HRV2 1U5ZA 1Y9QA 3B00A 1COV3 1PHMA 3ENRA 1XYOA 5C70A 2JWPA 1SPPA 4JQRA 2ZXQA 4JQTA 5DDJ3 4LITA 3SCGA 2DVFA 1R093 1GZWB 1COV2 2WYFA 4AI8A 3W20A 1FV3A 1UU5A 2NMOA 1O8PA 1SFYA 5DDJ2 2PHDA 5LY2A 3M3IA 5LBEA 1R092 4Q5OA 3NVCA 4ET7A 4LT5A 3TYJA 4LBKA 2QQKA 1VR3A 4UFHA 1REFA 4UAPA 4XF4A 4AGVA 1JYWA 3KT1A 4LOTA 3LIHA 5CA6A 4E4DX 4FP3A 4LMFA 4A2UA 1IS3A 1XSQA 2HWC3 2PHXA 2PLV1 3MBWA 2XH6A 3AX4A 2GNMA 1SPPB 1XRUA 3HN1A 4ES8A 4JDOA 2HWC2 4I0AA 2J22A 2GP3A 2JG9A 4PCRA 3I2IA 3ACFA 1QH6A 2GZWA 2W94A 5A7PA 3O1MA 2OIIA 5A70A 1CAUA 5LATA 2R30A 4GJYA 2P6CA 1ZRCA 4EQVA 5FO7B 1NZCA 3PTYA 4BQ3A 4YPJA 4AI9A 3ZXJA 4AQ2A 5JCTA 3WT3A 1C5HA 1K5MA 2VM9A 3NAPA 4LBQA 3DECA 1KXGA 3CJIA 4A4AA 2C1FA 4R4ZA 3WQ0A 3HWJA 3EQEA 4NOTA 3JB4C 4A41A 5CFCC 3S5AA 5JXIA 4IEYA 5T5PA 5FBZA 1M4WA 5LB6A 5JSPA 1RMU3 1Z0HA 2EAKA 2WUHA 3KV6A 4FVVA 2P3YA 3ZYBA 3SMHA 4M4RA 3AVSA 1RMU2 2WSUA 1PK6C 2Q8DA 1W28A 2LALA 2J1RA 3ELNA 1BQPA 1Y9GA 3D5OA 3ZYFA 1S0FA 2V09A 4CCCA 1MS0A 1A8MA 2BGOA 2QQIA 3O1SA 4EN9B 3RWKX 3NAPB 4M0NA 5K7PA 3CJIB 1YFYA 4XDQA 4L97A 4I3GA 1EV13 1UOGA 5CG9A 4JTNA 4YW6A 5CISA 5KXDA 2OPKA 1HDKA 3IIIA 4IV1C 4KU7A 2A6ZA 2BWAA 4N43C 5J7MA 4HVRA
chains in the Genus database with same CATH topology
1QDOA 2GH8A 4G4FA 4KGGA 1TNRA 1CPMA 2ET7A 2VVDA 5I8YA 3WUCA 3PVNA 5GKAC 4AI1A 2A73B 4I0BA 1DG6A 2ZGLA 3VBOC 1PO23 5A33B 3PJYA 5IK5A 5GZFA 3MEPA 1DBNA 1G9FA 1JUHA 3BOWA 3JQWA 4FOYA 3AYEA 1APNA 5CNAA 3OCPA 3WP5A 5C8CC 2WKKA 4TZDA 2HEYF 1VRH1 3VKOA 5TSWA 2HWF2 3ZSEA 1ZYBA 4V1PA 5JSOA 4RA0A 2WQZC 4B8EA 4FBFA 2YZ4A 5F9TA 2EAAA 3WG3A 1FT9A 1J3QA 5CFCA 2Z2SB 2D44A 1CAWB 4TWTA 1UAIA 1IKPA 1W6OB 1ENSA 3X29B 1A6CA 1XNDA 3AMHA 5EFUA 1QHDA 1PK6A 5A3LA 1I9RA 5HBAA 3WDXA 5J37A 4COVA 1J58A 3JD71 2QJVA 3WW2A 5A3MA 1MEC1 1NG0A 1ZBE1 3NWKA 4XTMA 2DTWA 1QJX1 4HANA 1SLLA 1OI6A 4AYUA 1RJ7A 2G9FA 3V0AB 4IV1A 5L7OB 1X36A 1POV1 2E7TA 2B46X 4N43A 1QOSA 2JEMA 4NWWA 1UW8A 2XJRA 4WM8C 1BEV1 3FHIB 3MIDA 1R081 2B9UA 1DGWX 1QF3A 3RYRA 4NR1A 2UYBA 3OTFA 2GC0A 2PHTA 1EYBA 3N7JA 3I8TA 1F8VA 1C8M3 2R32A 1H4HA 3LZZA 2XJTA 5C8CA 3KSCA 1C8M2 4DZGA 4BLJA 3U11A 3RYKA 2ZOEB 4N43B 1Y43B 4E2QA 1GNZA 3MIEA 1ZZ8A 2W68A 2ZAHA 3UJQA 3B5LB 1LOEA 4P9IA 3VBOB 3WDYA 2QE3A 3E5XA 5CFDC 5JOWA 3ZFGC 1LB2A 3OYWA 4HLTA 3ZSLA 5H9QA 1HQLA 3ZXFA 2BVBA 5HXVA 4CDUC 4ATFA 3VKFC 4YFWA 4K6BA 3FWEA 4LO7A 3N4MA 4IEVA 2A6XA 2XL7A 4K1YA 1OQEA 1NOVA 1N1VA 2YY1A 1YXWA 4MGYE 1BYHA 1VBE1 1LOFC 2DYCA 2ZBJA 1DGRN 4WM8A 3BTAA 3TBDA 4RSUA 1UZZA 3ZVXA 2D6PA 4QPIB 3AKPA 1S0EA 2ZKNA 4XMIA 5GLTA 4JTOA 2HEVF 1PZ8A 2ZABA 1SACA 5GLUA 5GZGA 3NL1A 3AMPA 2XL9A 1AX2A 4PJYA 4CDXC 2O0OA 3DPRB 4Q8KA 1SLAA 3TN93 4WM8B 3WW4A 4W65A 5GZEA 4L11A 4XF0A 1PIV1 4E2GA 1AR71 1GNHA 1VAKA 2ILMA 3APBA 4K9SA 4PF5A 5CIRA 1QJZA 3TN92 5KXBA 1B09A 3IBMA 2PAEA 4KU8A 5CFDA 1TMF3 3ZFGA 2R1DA 5JOXA 1I1EA 1PMIA 3KCCA 4F7ZA 1TMF2 2D40A 2O1QA 3B93A 1OOPC 1O3SA 4CDUA 2R1BA 5T5LA 4ZU7A 1ENRA 5BNOA 2MPFA 2BNMA 5H9SA 5T5OA 3OY8B 4LBNA 5KC5A 1XU2A 1FPN3 4PIZA 1EV11 2IZWA 1YWKA 1J59A 2V5YA 1AYM3 5T3NA 3TWIA 5J3UA 3MPPG 3ZXAC 2BFUS 2PN5A 2XBO1 5CFDB 2YHJA 4A7ZA 2OZJA 2MEV1 1AYM2 3ZFGB 1LOFA 3RRDA 4XEZA 1T6GC 3QD6A 4IQPA 2QZ3A 1AL0G 3FLTA 2UWAA 2HWD1 3USUA 4Y20A 1AX0A 1TME3 5BY5A 3O14A 3C2UA 1VBA3 4PDWC 1IPKA 3Q9OA 3AKTA 1FI2A 1TME2 3WLUA 1KQRA 2WNUC 2IC1A 2UYAA 2ZX3A 3JCIA 1VBA2 4CRQA 3SH4A 1EAH1 4CDXA 1MR5A 4H3WA 1C1FA 1URXA 1CAXA 2H0VA 3AMQA 4Y1ZA 1LOCA 1HRI3 5ACA3 2MNGA 2RMU3 1S0BA 2UWCA 4W6WA 4Y20B 2XPJA 1HRI2 2XKOA 3VBUC 3S7EA 5ACA2 3BODA 1JBCA 3R4DB 2RMU2 2IXJA 2QVSB 2Z69A 4M3CE 4OZXA 2NZ9A 4XETA 5DZEA 3WP4A 3FZ3A 2KA3A 2XB6C 1QQP3 2D3RA 2HYKA 1X33A 2YMZA 1DZQA 3J26N 3NV4A 1OOPA 2WIIB 4L2NA 2RM21 4HKLA 1QQP2 3DL3A 1QXPA 4LA3A 5AC93 3RS6A 5KBFA 2D6LX 4RFT0 2XLFA 4L92A 4DFSA 2VQAA 5AC92 1XE8A 1UIJA 3TRSB 1X8EA 1CAVA 3ZN5A 2A3YA 1IS4A 4LBJA 4GULA 2ZZJA 1RUF3 2EXKA 4B4QA 2D6NA 3B3QE 4EJRA 5J48A 4BWOA 1YO8A 4E4ZA 4BA6A 2K0GA 1RUF2 2ARXA 4JGZC 1NXD1 1S0DA 3H9AA 1OOPB 2CY6A 2OW4A 1KD7A 4JV4A 2RS53 3AYCA 3O0WA 4N9HA 4PDWA 2RS52 3OD4A 2WNUA 1UKRA 1DHKB 4YZ2A 1CAVB 4UXAA 5L73A 3CF6E 2CWMA 2ZACA 1C1LA 1AZDA 4CP1A 1X8MA 4R9AA 4YG6A 2HWB3 3AJZA 1CVNA 1MZ5A 4Q0UA 5LK5A 2HWB2 1SCSA 3PVEA 3AJYA 4MYEA 4OVEA 4WV8A 3VBUA 1SFNA 1WCKA 4XW3A 1SMVA 1RUD1 4B4RA 2KM2A 1NA1A 3PMEA 4S2FA 1FYUA 1QMJA 4QX5A 5KWRA 2VECA 4Y1YA 2Q8OA 2ZKLA 1OMIA 4I30A 1POV0 2XWBB 2ZHNA 3AK0A 5DUWA 3BPZA 4FOQA 1UN1A 2WLQA 4Q29A 4W6YA 2PAKA 2VUAA 1XYNA 4U36A 2ZA9A 2OZ6A 4HT1T 1QWRA 2PHFA 1GYKA 1KFUL 3IMNA 2EF6A 1ZM1A 4FO9A 1AL23 4I09A 4JGZA 3M3EA 5IK7A 3B94A 1UMZA 1AL22 1WW5A 3O0XA 2A6YA 3AFGA 2XHKA 3POSA 2I74A 1GANA 1FMD1 2GAUA 2BWCA 1NYWA 3VBFC 5C9AB 1WW6A 2WL1A 4JGZB 5EYYA 1C3HA 1W6NB 1ZX5A 2A6VA 1F5JA 3JU9A 3M7AA 4QPYA 1PO13 3PVBB 3ZXGA 4XFBA 3WDWA 1LESA 3GZAA 4QPGC 5JI9A 2ZGUA 3IPVA 2Q30A 4OHVA 2VW0A 4AGRA 5GLWA 1QU0A 1OFSA 1I3HA 2PLV3 5JDBA 2ZGSA 1FPN1 3D82A 4EWDA 4WM7B 4OHYA 1PZ7A 2PLV2 4FAHA 2XLGA 4QQOA 4M3CA 3LWCA 3VDDA 2WNVB 3KCYA 4FXGB 1YFXA 1LEMA 4G9SB 3D8CA 1RUNA 4OHXA 4R9DA 4C1WA 1SDWA 3S30A 4FPEA 2R071 4Q1RA 4Z1VA 3JQXA 4LA2A 1DYPA 3WZ1A 2PHRA 3RNSA 4JVAA 3LAGA 4M3CB 4RL7A 3HR9A 4QQ2A 4AQSA 2SLIA 2JD4A 5FQ0A 1XNCA 1KFXL 1RUC1 1N1YA 3VBFA 5CG8A 2GN7A 4XFIA 5BPXA 4YG0A 3RJRA 3GHNA 4R52A 4BMEA 4FPKA 3IIAA 4LHNA 2K9ZA 2XVGA 1LGBA 1WMEA 4FPCA 4Q0VA 4QPGA 1ND3B 2OUHA 2N7GA 2DUOA 4XF3A 1DIWA 4MUVA 2R16A 4BLIA 4Z07A 5FQ0B 3W58A 4DRRA 1H8VA 1MACA 1YJKA 5AVAA 5DG1A 4GH4B 2RJKA 3ES1A 4DRVA 4FTSA 2X5IC 1VRH3 2WT1A 1HIXA 1VBB1 2ZGQA 1VRH2 5K0UC 4AI3A 4EROA 5GLZA 3ZYRA 3VZMA 3UKVA 4QPGB 2X53S 4Q0SA 3D4KA 3FUQA 2AGSA 4XXAA 2G4IA 5JSRA 5BUVA 2ERFA 3GHMA 1QJU1 1DGRA 4S2GA 4DY3A 4CZSA 2GC3A 5HCBA 5AFBA 4AXOA 3QACA 2CYFA 3MW4A 1ZRFA 2GU9A 3RI9A 3AB0A 3RJ2X 2HKXA 4ONUA 3JD73 3WG4A 1MEC3 4NPRA 1V6JA 1ZBE3 4FP2A 3N35A 1QJX3 1AF9A 3JD72 1SQ4A 2O8OA 2WJSA 2YGMA 4TYSA 4KG8A 3HBZA 5GZDA 1MEC2 1JXNA 1ZBE2 1LEDA 4G3YC 2AZ5A 1JTZX 1POV3 1B35C 1QJX2 2GNBA 2YDEA 3MFAA 4B3NA 5GZCA 1WBLA 2WSVA 4FPGA 1BEV3 1LENA 4ORFA 1ND2C 1R083 1S0CA 1OA2A 1VBC1 2D97A 4YW5A 4CEWC 1U5YA 5FOBB 1BEV2 4UBHA 2GMMA 2B39A 1R082 4XF9A 1QDCA 1MQTC 2BNNA 3VL8A 3CU7A 2A3XA 4B7KA 1WLTA 3E6DA 4XJ9A 4EN0A 5K0UA 1CIWA 1FATA 3T1MA 4XIOA 2DFCA 3ZFEA 1RB8G 1HXS1 2NYYA 2ZHKA 1FXZA 5F6LB 1RHI1 1FV2A 5LK7B 1QJY1 2WT0A 1O5UA 1GZCA 1QKQA 2GC2A 2XVKA 3OGJA 4JAAA 1IPJA 2X5IB 4MGKE 1BMV2 3WUDA 1UF2C 4YZ4A 5DZFA 1BBT1 3NSTA 3HIFA 1S55A 2UU8A 2UY9A 4GKXA 2WLPA 3VBHC 3MZHA 4OHWA 5BV6A 3TB0A 2KXLA 2DVBA 3VBSC 4AVCA 2ZGRA 1SEFA 1V6OA 2IXCA 2DUPA 3R4UA 4P9XA 3WDVA 1PO11 2LUWA 3OGGA 1B35A 3EXUA 3WQ7A 3MIBA 2BEOA 1VBE3 4OFGA 3NV1A 2ZMNA 4YVWB 3BCWA 2ZX2A 1G7YA 1NLSA 3HMYA 2JDZA 1VBE2 4PLOA 1ND2A 1WD3A 2HWE1 5CBLA 3AP9A 4CEWA 2IXIA 4FQZA 1H9WA 3GZUC 2XWJB 5AVPA 1MQTA 1Q8QA 5FO8B 3H1WA 2VW2A 1H0BA 3KD4A 5I0SA 4SLIA 1YIPA 4NWVA 3WOGA 3RMYA 3M3QA 5CB7A 1NQJA 3WG1A 3TNQA 3MF9A 3PMSA 1CJPA 1Q3EA 4C1XA 1PIV3 1DQ2A 1AR73 1ULFA 4CEWB 1TNFA 4WZCA 1PIV2 2JG9B 5GALA 1FNYA 1AR72 2BVVA 4RQPA 5KHHA 3ZO0B 5F1RA 3WV6A 1AVBA 5C33A 4AGGA 4D69A 5EV7A 1CAUB 1RVF1 3N7KA 1YCIA 4AEJA 5GLVA 2R0FA 2VMHA 4WVMA 4XBNA 1K5MB 2BTVC 1PVXA 4LBQB 3VBHA 2WFF1 1U5IA 4XPVA 3VBSA 1O3RA 2R061 1ZZ6A 4C0BA 2XBO3 1EV12 1LU2A 1OA4A 2MEV3 5DXDA 3ALQA 2XBO2 4QD2A 1RUJ3 1F2NA 2PELA 4NVPA 3VHPA 1W6QA 4YARA 2MEV2 2Y0IA 3GBGA 1IOAA 3NV3A 4YGDA 2HWD3 5KXCA 4WVMB 1OSGA 3SXWA 1PO22 3VBHB 4YM0A 3HT1A 3MYXA 1WCSA 2CWSA 2HWD2 4I0WB 2AR6A 1MVQA 2ZTNA 5CVRA 1O4YA 2W08A 4HETA 1LHVA 2BYVE 2ATFA 1EAH3 1ZREA 5FCCA 5I8TA 1WLDA 1SBFA 4INDA 2GNDA 2FMYA 1LHNA 3ZFFC 1JUIA 1EAH2 4QU2A 1W6QB 4AVBA 1CESA 3N36A 3ZYGA 2ENRA 1SLCA 2GALA 4LNVA 1J1LA 4S2DA 3DKWA 1VB4A 3LSDA 1RUH3 1S0GA 2VQ0A 3ZN6A 4XYXA 1SLTA 3HD8B 4Q4Y1 1AR91 1VP6A 1JH5A 1REDA 1DZRA 3THPA 2RM23 4H55A 4AHYA 2P17A 4ZU5A 3EO6A 1VB2A 5EWSA 2RM22 1VLNA 4CTEA 3LCPA 5CFCB 1Q43A 4FAGA 1D2QA 1UCXA 3FFQA 5HCAA 1O7FA 5K8SA 4L99A 1HQNA 1BVP1 3AM2A 4UW3A 1OPOA 2BPA2 5JOYA 2CAUA 1PK6B 3ZXEA 5FO9B 1YNAA 2B42B 2D5HA 5JMCA 1X82A 4OI2A 2C5DA 2DFBA 5JAXA 3CNAA 5IK4A 4UW5A 3ZXDA 5T54A 4K20A 1H2LA 3POYA 2AENA 4D7SA 2GMPA 1H1AA 4FCAA 4IEPA 3H3ZA 2RS31 3I54A 4IV1B 3WQ1A 4K7JA 2A5ZA 3MGUA 1M06G 1XXNA 1DGWA 1BZWA 3ZFFA 1QXRA 3B9IA 2BUKA 2MHFA 5FPZA 1V6IA 2OVUA 2ZZQA 3LA3A 1N1TA 2ZX1A 3H0OA 4QGNA 4AVAA 5C8CB 4HL0A 2DU0A 3NW4A 4HK9A 1RUD3 1QH7A 4EWEA 2ZHMA 3HT2A 1V9U1 1O3QA 4JGYC 1FX5A 5BNOC 4XMAA 1RUD2 4Q26A 4J6GA 4IEZA 3VZOA 3ZFFB 1W2UA 4MVTA 1AYN1 4GWNA 2TBVA 1ZRDA 3WG2A 4DINB 1OA3A 3SCFA 1ZZBA 2ARBA 3OYWB 1O5LA 1H30A 1AHSA 1S0IA 2SBAA 2ZPXA 3WVJA 1LRHA 2DV9A 1ALYA 2ZHLA 2VY0A 4E27A 2EVXA 2AUYA 2WQ4A 3WINE 2OYZA 1FOD1 4YG3A 2K2SA 3IDCB 2UURA 3MLKA 1QOOA 1YFUA 2H6CA 1D2SA 1BVVA 1RUI1 4YW4A 5I0RA 5K9YA 1FMD3 1QNYA 4BH9A 1G6NA 3ETQA 4COZA 3ZIWA 3U4XA 3QOPA 2FZ2A 1UU4A 3S6PA 1DQ4A 1FMD2 3NKGA 4Q4X3 1Y3TA 4HPKA 3KMHA 2E53A 2I2SA 2OUJA 2NMNA 2H0BA 5KHGA 3KZ4C 3ZSMA 1RUG1 3H8UA 4CDWC 4R9BA 1TE1B 5FFOC 1H1IA 4FXKB 3RYPA 3MW2A 4JGYA 4Q4W1 1ZZ7A 4P5HA 4Q1PA 1MS5A 5L19A 1NY71 3VHRA 3D0JA 3VV1A 3ZIXA 5JOZA 2PYTA 4HPKB 4KWKA 1IKQA 4GIQA 1FPN2 1QGLA 2CNAA 1Q56A 2JX9A 5JLVA 1H2KA 1S1AA 2HJIA 1IS5A 4HFSA 3IDEA 3E6CC 1RUJ1 3O5SA 1C8NA 4H14A 3VN4A 3DV8A 4CDUB 5C4WC 5JPMB 4JGYB 2R073 1DF0A 4QQPA 5BNOB 2P2KA 1W6PA 1AR63 2YROA 2VPVA 3SNMA 4KGQA 2R072 5C6CA 3FBYA 4BMBA 1GQHA 2Q1ZB 1YJLA 3ZYIB 1UPSA 4NN0A 2GDFA 3AYAA 4XFGA 1RUC3 5FMOS 1A8DA 1DQ0A 1CR7A 1YLLA 2DVGA 2P3JA 2Q0AA 1RUC2 3USUB 1GKBA 4BIOA 1KJLA 1XU1A 3GYDA 1EPWA 2DWRA 1DU3D 1W6PB 1RUH1 4CDWA 2Q1MA 5IT6A 1NA1C 4O9GA 3VHNA 4ISQA 2WA4A 4AI2A 1R1A1 1DQ1A 4CDXB 4GWMA 4AQTA 2JKBA 1KITA 3GBWA 3WHUA 1CAXB 2BNOA 3AYDA 1ZNPA 4PQ9A 2CAVA 2EA7A 5B2GB 4O9EA 3ILFA 4N53C 1VBB3 3ZSKA 3VGIA 1LGCA 3NJZA 3OBRA 2ZAAA 1VBB2 4Y22A 4RHV3 3GF6A 4OI1A 3L2HA 5EZWA 5C4WA 1H8TC 1LOAA 1OQDA 4KWLA 3KQRA 1QJU3 4OLLA 3ZX7A 3T1LA 3VZNA 2WINB 4K3UA 5H9PA 1O4TA 1QJU2 1ULCA 2R041 3ATGA 4GMP0 4S2HA 3RDIA 1RTVA 1YI9A 3ROUA 5AFEA 1GICA 3MIHA 3ASIA 1C5IA 1H1MA 2PTMA 1ULGA 4BCUA 4ISRA 2XJQA 4Y1UA 4AQ6A 4A7YA 5JWPA 5KXDA 4ZU4A 1RUOA 1ULEA 2WA3A 4KQ7A 1F9KA 3CLPA 4AVTA 4GB31 3VZJA 2RE9A 3MW3A 4PDWB 1AX1A 3LOBA 5DUUA 3RSJA 2WNUB 1IHMA 1WD4A 4AEKA 3FMGA 5JIUA 2D7FA 3B01A 4YVSC 4IL7A 1VBC3 1KS5A 1H9PA 2GC1A 3INAA 1ULDA 1JOJA 1I5ZA 1VBC2 2O8QA 5I8SA 1WLWA 1RGSA 4ATEA 1AJKA 3PJQA 3CL1A 4Q27A 2ZGKA 3VDDC 3VL9A 5BNPC 4N53A 3KCXA 3VBUB 2NP0A 3L9JT 4LO6B 1LCLA 4XBQA 4ES9A 5T52A 3JBG3 4XHBA 3ZMNA 4BZ4A 1NA1B 2ZGPA 3AZXA 1XNBA 1HXS3 3EBRA 2D3PA 2C9AA 4LE4A 4PBOA 2XJSA 1H8TA 2BFUL 1RHI3 3I59A 2VH9A 1HXS2 1QJY3 3ME2A 5EXOA 3DN7A 1RHI2 3TAYA 1QJY2 4N53B 2W0XA 1BBT3 2Q5TA 3J8F1 1LGNA 2P34A 4COWA 4HN1A 4OHZA 1Z78A 3FJSA 5F5QA 4Q4X1 1BBT2 3ST7A 1NCQA 4AVSA 5DUXA 1JYIA 3WHTA 1PVC1 4URTA 4GALA 4LBLA 5D8AC 4K1ZA 3NV2A 1NCRC 4LBQD 1KDMA 4YW2A 4Q4V1 4PIXA 1PO12 2B8MA 1NLRA 2X8KA 3LGRA 4K40A 4LBMA 5FMOL 4WBBA 3ZDSA 4YVSA 2HWE3 4MLOA 4AE2A 1DYKA 2JXAA 4XOGA 4HVQA 5J36A 2HWE2 4AHWA 4AVVA 4QHBA 5BNPA 2FZ1A 4C0HA 2AREA 1YRZA 4X8PA 1DDLA 4BPZA 1LHOA 1WBFA 3IPVB 5LRRA 4MXWA 2Y38A 2TNFA 2XGXA 1LECA 1WMFA 1GLHA 4HKWA 3VBRC 3K51A 4HSJA 3MDPA 3QH7A 1AR61 3QBQA 4IXLA 1EP0A 4J1WA 4JDMA 4AG4A 3EHKA 5H9RA 1F31A 4OUSA 3TNPB 1LTEA 2XJVA 3IT8A 1SLIA 4QM8A 1RVF3 3VDDB 3V0BA 5BNPB 3NKTA 4QT6A 2RR11 1RVF2 2WFF3 5FRAA 2R063 2RS11 1SLBA 2WFF2 1TEIA 4UW6A 3ZYPA 3AXEA 4EV0A 2IFRA 2FQPA 2DCKA 5D8AA 2R062 2VNGA 4BE3A 1HV0A 1NCRA 3S0MA 3G6JB 4RR3C 4IEQA 3TOJA 2JE7A 2DCJA 3M1HA 1MS8A 3VBFB 1KS4A 1H2MA 1V6MA 4DB5A 1JN2P 2P37A 4QGLA 2DCZA 4LO4B 3ZFEC 1NCRB 5BNNC 2E7QA 4RHV1 2D6OX 4FPLA 1ASJ1 4L9BA 5L36A 2QUOA 2GMEA 2AH2A 1LKNA 1ENQA 1OHFA 3VBRA 4YZ1A 5FLJA 4AFCA 1RITA 2A70A