1RUI3

Rhinovirus 14 mutant s1223g complexed with antiviral compound win 52084
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 37
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rui300
1AR92 5BNOB 1RB8G 5CFDB 2RR11 2RR12 5CFCB 1TME1 1TME2 1QJX2 1QJX1 1VBD2 1VBD1 1EV13 1K5MC 1PVC1 2MEV3 1VBE3 4GMP0 4EJRA 5JZGC 2RS13 3VBSA 4CDQC 4FTBA 1AR72 2RMU2 2RMU1 1HRI3 1RUG2 4RHV2 1AR83 2HWF1 4RS5C 1RUI3 4PDWA 3VBOB 4AEDC 1BEV1 1QJY2 1BBT1 4Y4YA 2HWD3 4YVWA 4QPIB 1RUE2 1RUE1 3DPRA 4LLFA 1K5MB 3ZFFA 2QQPA 5C8CA 4FSJA 1H8TC 1QJU3 5JZGB 1TMF1 2ZAHA 4CDQB 1FPN2 1FPN1 1B35C 1M06G 1ZBE3 3VBHA 1OOPA 2WZR3 1RMU3 1V9U2 4YVSC 4N43C 3HAGA 5J96B 1RVF3 1SMVA 4JGYC 1ND2A 1POV3 4RS5B 3NAPC 4AEDB 4Q4W3 4CDWC 5L7OA 5BNPA 1ZBA1 1ZBA2 1R1A2 1R1A1 1AL23 1C8M2 1C8M1 3S6PA 2RS53 4FTEA 2GSYA 1X33A 1H8TB 1PO22 1PO21 2TBVA 1EAH3 4CEYC 5GKAC 1FOD3 1B35B 2RM23 4Q4Y2 4SBVA 5C9AC 2ZZQA 5BNNC 4Y5Z0 4GH4C 4YVSB 4IV1A 4N43B 1AR61 2R062 4JGYB 3NAPB 4QPGA 2WFF2 2WFF1 4CDWB 1VAKA 3TN93 1AL0G 3ZFGC 4CDXA 4IV3A 1VBA1 1NA1C 4JGZA 1PO12 4Q4V3 1RUJ3 1VBC1 3CJIC 4CEYB 4WM7C 2BPA2 3ZXAC 3VBUA 5ACA2 5C9AB 2R041 5BNNB 1R083 1D4M3 4GH4B 2WS91 3VDDA 3VBSC 1NG0A 5FMOS 4CEWC 3ZFGB 3J8F2 1VRH3 3J8F1 1NCQA 4N53A 4PDWC 1NA1B 1COV2 1GFF2 1COV1 5A32A 1MEC2 1MEC1 1VBB2 3JB4C 4YVWC 1AR91 3CJIB 4WM7B 3JBG3 3DPRC 2RS33 3ZFEA 3FBMA 1F2NA 1EV11 1EV12 2MEV2 3ZFFC 5C8CC 2HWB3 2IZWA 2PLV1 2PLV2 1RUH3 2RS12 3VBSB 1AR71 5C4WA 5ABJA 1RUG1 4RQPC 2HWC1 1HRI1 1HRI2 2HWC2 1AYM1 1AYM2 1FMD2 1FMD1 1OOPC 4RR3A 4CEWB 5BNOA 1RUD1 1RUD2 4RHV1 1HRV3 1AUYA 1TME3 1VBD3 1PVC3 1AR81 1AR82 1ND2C 4PDWB 1RUI2 1QJY1 1CJDA 5L7OC 1C8NA 4YVWB 2HWD1 2HWD2 3DPRB 2RMU3 3ZFFB 5C8CB 2R072 2R071 1QJU2 5FMOL 1BMV1 1BMV2 5J98B 2HWF3 5D8AA 1Z7S2 1Z7S1 4RQPB 1BEV3 1BBT3 1OOPB 1V9U1 3VBFA 1RUE3 1HXS1 1HXS2 4IV1C 1R093 1AYN1 1AYN2 3JD73 2GH8A 1ND2B 2HWE3 5L7OB 1TMF3 1FPN3 1AL21 1AL22 4GB32 4GB31 1ND3C 2RS52 2RS51 4JGZC 5FOJB 1NY71 1NY72 1POV0 1EAH1 1EAH2 1FOD1 1FOD2 4Z92B 4Q4Y1 4AEDA 1ASJ3 2RM21 2RM22 2WWSA 3VBUC 4CDUC 1IHMA 4IV1B 5A33A 2R061 3VDDC 3VBRC 5AC93 2FZ2A 1H8TA 1PIV1 1PIV2 1NCQC 1ND3B 4N53C 4FTSA 1NOVA 1PO11 4JGZB 2X5IA 3IDEA 1QQP2 1QQP1 4YVSA 3VBFC 1AR63 1RUJ2 4JGYA 4WM8A 5K0UA 1RUC1 1RUC2 1MQTA 5ACA1 3VBUB 1NCRA 4CDUB 3VDDB 5C4WC 3VBRB 1VBA3 4RR3C 1VBC3 1RUF2 1RUF1 5LK7B 1A6CA 1NCQB 1VRH1 1VRH2 4N53B 2R043 1VBB1 5C9AA 1HQNA 2WS93 3VBFB 1RHI3 3JBG2 1W39A 2RS32 5DDJ3 2MEV1 1QJZA 2XBO3 1VBE1 1VBE2 4Q4X3 2HWB2 2RS11 4GMP3 3J8F3 5C4WB 5D8AC 3VBHC 1MEC3 4RR3B 1AR93 2RR13 4WM7A 5CFDA 1DDLA 1F8VA 2VQ0A 5CFCA 1QJX3 1HRV1 1HRV2 2BBVA 2ZTNA 1RUI1 1PVC2 1VB2A 5BNPC 1X36A 1CD3G 2PLV3 1AR73 1RUG3 2HWC3 1AYM3 1FMD3 4CEWA 1QJU1 1RUD3 4RHV3 4BCUA 2WLPA 2HWF2 4NWVA 3VBOA 5D8AB 1QJY3 3VBHB 1ZBE1 1ZBE2 1BEV2 1BBT2 2WZR1 2WZR2 1RMU2 1RMU1 4QPIA 1R091 1R092 1RVF2 1RVF1 1K5MA 1POV1 3JD72 3JD71 4QPGC 4Q4W1 4Q4W2 5BNPB 2HWE2 2HWE1 2R073 5JZGA 2BUKA 1TMF2 4CDQA 4CDXC 1Z7S3 2Y26A 4IV3C 1OHFA 4RQPA 1V9U3 2FZ1A 1HXS3 2X5IC 1AYN3 4RS5A 4WM8C 5K0UC 3LOBA 1MQTC 1ZBA3 1ASJ1 1ASJ2 1R1A3 1NCRC 1C8M3 4RFT0 5A33B 4GB33 4QPGB 5AC91 5AC92 1PO23 4NWWA 2BFUS 1B35A 3TN92 3TN91 4Q4Y3 4CDXB 4IV3B 3M8LA 3JB8A 2DF7A 1WCDJ 4Q4V2 4Q4V1 2X5IB 4N43A 1RUJ1 2R063 1AR62 1PGW1 1PGW2 3NAPA 3ZFEC 2WFF3 4WM8B 5K0UB 4CDWA 1MQTB 1R081 1R082 1D4M1 1D4M2 1NCRB 1PIV3 1PGL2 1PGL1 1VB4A 5ABJC 1HX6A 1ND3A 1VBA2 1PO13 1QQP3 4CEYA 1VBC2 5BNOC 5CFDC 5CFCC 2XPJA 1RUC3 5ACA3 5A32B 5BNNA 2R042 4GH4A 4CDUA 2WS92 1RHI1 1RHI2 3JBG1 3VBRA 3ZFEB 2RS31 1OPOA 5DDJ1 5DDJ2 2XBO2 2XBO1 1RUF3 2HWB1 4Q4X2 4Q4X1 3ZFGA 1RUH2 1RUH1 4GMP1 2BFUL 5ABJB 1COV3 1E57A 1NA1A 3VBOC 1VBB3 4QPIC 3CJIA
chains in the Genus database with same CATH superfamily
1JBCA 2WNUA 5HBAA 4XUQA 4B7KA 1XSRA 2P3JA 1F35A 3KT7A 5FZOB 1U12A 1PNFA 1EV13 4Y33A 4AYUA 4A6SA 1W6MB 3H7JA 2IXHA 4EJRA 1GZCA 1DYPA 3I97A 5FV3A 2RS13 4UW5A 2EAKA 5F5CA 2OUJA 4CDQC 1TVGA 1AR72 2A1XA 4QHOA 5KXBA 3SITA 3BVCA 1RUG2 4P02B 3KQRA 3N7KA 1JZ3A 1ZZ9A 4LOSA 4QX0A 1CX1A 3PVNA 3SCGA 1ZRFA 4RHV2 4URTA 3TEZA 5IFPA 5LWBA 3HJRA 4D0QA 2UURA 5F1RA 4Y4RA 4GWMA 1BBT1 1ZRCA 1RC6A 2F6BA 2HWD3 4Y4YA 3LQCA 4QPIB 1RUE1 2C1FA 5C5UA 2O0OA 3GHNA 1ULDA 4YFWA 1K5MB 4IESA 3ZFFA 1H9PA 2PHUA 5LB6A 3C7EA 1TE1B 2GAUA 3R05A 1KFUL 1W0NA 2ZX2A 3T2TA 5JPMB 2C24A 2CWSA 4BM8A 1STMA 3H1WA 4OZXA 4H3WA 3VBHA 4F3JA 4M00A 5BXXA 4YM0A 3ZN5A 1CONA 2FHRA 2OIIA 2WA3A 3J7NA 4AI1A 2CV6A 2WR9A 4R9CA 2LALA 3ZYRA 3HAGA 4XJUA 4BMBA 3J9SA 1SMVA 5FBZA 4LKEA 1GKBA 4RS5B 1YJLA 1W9FA 3LDRA 4JQRA 4MADA 4Q4W3 5A6YA 4Y20B 1ZBA1 1R1A2 3H7YA 4OMDA 5LY1A 4XE9A 1C1LA 4CU7A 2FMDA 5T52A 5FY5A 3S6PA 2ZOEB 3RZMA 5FYZA 1NAEA 4FTEA 4XJ8A 5FPLA 4I09A 2GSYA 5FZ6A 4EV0A 1X33A 2W95A 4HANA 2VY0A 3TB0A 1PO21 2TBVA 3WT3A 3ZSEA 2XLGA 1PMHX 1B35B 2QQIA 2DVDA 5CU1A 5FZ4A 2ZGRA 2D40A 2C9AA 4HKOA 4AFBA 5J1XA 1KD7A 5LZ6A 3LA2A 4DXRA 3MPBA 2A75A 4S2FA 1W2UA 1O4TA 2CU5A 4Y5Z0 3UYJA 1CIYA 2VXRA 2NYYA 4LA3A 1DQ0A 4BLIA 3HT1A 4BH9A 3AC0A 2L9LA 3Q8CA 2VTXJ 4MXWB 3UKVA 4QX7A 4E2SA 3NAPB 1KXGA 2DTYA 1CAVB 4YG6A 4EN9B 1LAJA 3A0KA 5FKBA 1W2AX 2ZPXA 4QMAA 3ZFGC 2YFZA 4JC1A 4URAA 5FY8A 1J3RA 4JRLA 1WUVA 4GJYA 2Z4FA 1DIWA 1GWKA 4HT1T 3VKMA 1WMFA 1PO12 4Q4V3 5FFOC 3GM8A 1VBC1 2OS2A 4K3UA 3T0AA 3ZN4A 4LHKA 3QH7A 3UK9A 3M3CA 3PUAA 4A45A 2D6MA 4QX2A 2BPA2 4KNCA 1CPMA 2QVSB 2VXJA 4XCAA 3RZKA 3RZGA 1U5XA 1YRZA 3WD5A 2TUNA 2O14A 1H4GA 2GU9A 2XH6A 3G6JB 5C9AB 5KHHA 5BNNB 1R083 3I2IA 1UPSA 4GH4B 1H2LA 3NW4A 3THDA 3KCXA 3J7LA 4TWTA 2V5DA 4BWOA 3VBSC 5JMCA 2CHHA 3WF0A 5JSRA 2DU0A 3VD4A 5KHGA 2VTXA 1ZX5A 2W52A 5DQ0A 1IS5A 1OKQA 3WG4A 4KWUA 5A1LA 2HEYF 1HQLA 3HN3A 3PU3A 3S57A 5FZ1A 4ZXEA 3MZHA 1XYOA 2VW2A 3J8F1 4IW3A 3WNNA 4EROA 4PDWC 4KL1A 1NA1B 1COV1 2PQSA 3I3DA 1SLAA 1MEC1 2Y6HA 5A32A 3TEYA 4KG0A 3VZOA 2AEZA 4YVWC 4ARYA 2AR6A 2WNUB 3WQ0A 2I45A 4FOVA 1FI2A 2K0GA 1UWWA 2WN2A 3W20A 1YQ5A 4P9WA 5FZHA 5JSOA 2YBKA 4HG6B 3FJSA 2HH9A 2MEV2 3ALQA 4OCTA 1CZSA 4ZPIA 1D2QA 2HWB3 3PUSA 2ZMLA 3P3NA 2R6QA 1AHSA 3WG3A 1OA2A 1AR71 2XOMA 4LHLA 4CCEA 4HN0A 4ASKA 4Z1VA 2BVVA 3ATGA 1OLQA 3QCWA 1RUG1 3NJXA 4Y24A 2HWC2 5D1IA 1AYM2 1HN0A 1D2SA 3EO6A 5A3MA 4C1XA 5K8SA 5FBJA 1RUD1 1D0GA 2XL9A 4G9SB 3AYEA 4MH0E 4RHV1 5EQUA 3ZSKA 3LDBA 4Z8BA 3ST7A 5BNQA 5JXHA 4LNVA 3RZLA 1AR81 4WVMA 5FXVA 2QQVA 4LKDA 2X05A 3HIFA 3WZ1A 5FO9B 1O8PA 1UOJA 3HQUA 2VOKA 4P5HA 1BLZA 1O5UA 2J1VA 1QOSA 1RINA 4FPKA 1LU2A 3ZYHA 4Y26A 4DS0A 3I2HA 1VE0A 3NNFA 2VW1A 3I2DA 2XJSA 3ZFFB 4I30A 4S2GA 5F5IA 2R072 1OH4A 2VW0A 4BHPA 5FYCA 1XYNA 1ZVFA 2OX0A 3B02A 3WSOA 1HB4A 4A6OA 3T09A 4N8MA 2OQ7A 5F3CA 2XLAA 3RNSA 4CCMA 4DZGA 1NXD1 1Z7S1 3D6EA 4AE2A 4QX8A 4DINB 3FHIB 5H9QA 5IYYA 1TG7A 1WGPA 1UAIA 1VR3A 3ZXEA 4I2OA 1HXS1 1EP0A 1H8VA 1XXNA 2GC0A 3THPA 1R093 2Q8EA 1NKGA 2WO7A 2D6OX 4PQ9A 2ATFA 5DUUA 2GH8A 1S0BA 3K4ZA 4AHZA 1DQ1A 1W6NA 2VUCA 4IEWA 1S1AA 1XE0A 1JODA 2EIGA 4I01A 5EJ3A 1TMF3 3ZXGA 1QEXA 3IIAA 4XEZA 4AEKA 3WG2A 1AL22 1AXKA 3T3YA 4GB32 3ZXDA 2DBNA 5CG9A 2RS52 4OFGA 1JXNA 1D7PM 2N7GA 3OYWB 4U36A 1W8ZA 3CJXA 3LGRA 4RSUA 1Y3TA 3D5OA 5FOJB 1VALA 3KV4A 3SCHA 3HBZA 5FYSA 3CZJA 2GP3A 2IXKA 2VO5A 5GALA 3GZUC 1ASJ3 2RM22 2VUDA 1MS4A 4AEDA 3BTXA 2WWSA 3AKRA 2VMHA 3I2GA 5IVFA 4Z07A 4DUWA 3H3UA 3DGTA 3N36A 2WNVA 3WINE 1Z78A 2UWCA 3VDDC 1ENSA 2VPVA 3ZPYA 1JUHA 4HN1A 2JDHA 5FZ8A 3DN7A 3QH6A 4GA9A 3OTFA 3SEEA 4UF0B 4UOJA 1H8TA 1VRBA 1PIV2 3BB6A 4A4AA 5C3QA 2R1BA 3WNLA 3WUCA 3RMYA 1SDWA 3OJBA 1ND3B 2XGXA 4NUBA 2V4AA 4CU6A 4XF3A 1PO11 3ZYFA 4LBQB 1QQP1 1GP5A 4QT6A 1G9AA 3VBFC 1RUJ2 3WW2A 4XFBA 3VKLA 2BQPA 4OUEA 1RUC2 4YW1A 4E8CA 4HXCA 3PVOA 4AEMA 5FLJA 4M3CF 1UMZA 4G4FA 2DYCA 3C3VA 3L9JT 1LOEA 1EUTA 2P5BA 3EQEA 4NE9A 3MEPA 2VC9A 3WP4A 1QMJA 2XJUA 1YWKA 3GXUA 3MIEA 2IFWA 2W1WA 5FUNA 1ZZ6A 2VQTA 3W9AA 4WVWA 4YSFA 1LHUA 1RUF2 5F9TA 5JR2A 2NM1A 1DQ5A 2DVFA 1RJ8A 1ULGA 5FOBB 1X7NA 1VRH2 5IK5A 3GALA 1RUOA 5GLTA 2Q30A 4I0WB 2ETEA 1HQNA 4TLFA 2DVBA 4NPRA 1XNCA 1JYIA 2Q0AA 2JICA 4NAOA 3LKJA 2VCCA 1O4ZA 3JBG2 1VMHA 2ZEWA 2WL1A 2RS32 2MEV1 3N7LA 2JG9A 1VBE1 5FP3A 3BUCA 4JRAA 3O1RA 2JXAA 1JU3A 1UY0A 4E4SA 3ORJA 4WZCA 3OY8B 3GF6A 4UI9L 2BYVE 2UU8A 2W68A 4DXSA 5JXJA 4JKLA 5D8AC 4OQ8A 4QB1A 4KGGA 1GP6A 3AZXA 3VB9A 2LTNA 5FY4A 1V00A 2VZUA 4YNIA 1PK6A 3GNEA 1WA4A 2ZGQA 4BISA 2RR13 3EXUA 3GJBA 4WM7A 1V70A 2GALA 4YZ5A 1F8VA 2BOJA 1WLDA 2ZTNA 5FWJA 3RJRA 4UYBA 1AXYA 4WVMB 1JOBA 5FAXA 1V6LA 3KS7A 4BQXA 1QXJA 1OH3A 1KJLA 2IWGB 3NV2A 3UKNA 1L7QA 4M0NA 4E9KA 2O8OA 2HWC3 4INDA 1CJPA 1AYM3 1LHWA 4QQ2A 2KA3A 2ZACA 3VD3A 5JWPA 2PQQA 2VG9A 2ZCWA 4P9IA 4AVTA 2VOXA 4CEWA 1PMJX 3AMMA 5A6QA 3MFCA 1CAXA 2XHNA 4LR4A 3JQXA 3MDPA 4CVUA 2ERFA 3SMHA 4QGMA 2VGDA 1SLTA 1KFXL 5I93A 1QJY3 4XMAA 1GQGA 1ZBE2 3VHNA 1UX7A 4QAWA 1AX1A 4COWA 4XUOA 3USUA 3WR0A 3POEA 2WZR1 5CKMA 3DYPA 2R1DA 1C57A 3RGBA 2JDAA 4BQ1A 1US2A 1PX3A 1NZCA 1OQ1A 3TAYA 4CXYA 5FZMA 3Q8BA 1GOGA 2V5YA 5JPNB 2Q8OA 3AYCA 4QPGC 4CP0A 3ASIA 4YGDA 2HWE2 2R073 1DGLA 3R0RA 5JZGA 4W50A 3WNOA 1TQ5A 1E5HA 2WA4A 5HV4A 3IKWA 2O1QA 4CDXC 3ZKUA 1LTEA 1LHNA 4M3CA 2Q1MA 1UIKA 4BJ0A 5A6XA 1ZZBA 2E7QA 1BHGA 2OT7A 1OC1A 1SFPA 2Y6JA 2ET1A 5J48A 5KHKA 3USSA 4ZU4A 3ITQA 4HBNA 2EAAA 1DGWX 1WLCA 4YM2A 2ZGOA 3CQOA 5LA1A 3TNPB 2E26A 1W8NA 3DV8A 1E5RA 2AACA 2JE7A 2XJQA 3DKQA 2RG4A 2WNVB 4GB33 5E6HA 2F17A 2GDFA 4P5YA 1NLRA 2ARXA 4YZ1A 2P2KA 1WCQA 3TWIA 3OCPA 5JAXA 4A44A 5CAZA 1JZ6A 2SBAA 1ENXA 3OG2A 4R8HA 1S2BA 1LGCA 2ZX4A 1H6YA 4N7UA 1OF4A 2BFUS 3J4UH 3P1IA 2UYAA 3M2MA 3TN91 3I2KA 1LHVA 2PHLA 3CU7A 3POBA 4DY5A 4JTNA 2DF7A 2XWJB 5CKQA 3ZYJB 4FFFA 3ZYPA 4N43A 1RUJ1 1A8DA 5DZGA 4AHWA 2R063 1AR62 5I91A 1BQPA 2VMCA 3IZOA 3LPFA 2PHDA 1LEMA 3LEMA 4EZ4A 1J59A 4Q27A 2B46X 1PIV3 1PGL1 5T5OA 5A7SA 4XDQA 3DL3A 2WQ8A 2VZTA 4A3ZA 3NJVA 4NIHA 3NJYA 4MYEA 4Q29A 1WCUA 4I0BA 1W28A 1VBA2 4RGGA 3EHKA 3TYJA 2C0ZA 4GD4A 1F31A 4CEYA 1S0DA 2JX9A 1N1TA 2YC2A 1OVPA 1UIJA 4CYDA 2JDZA 1URXA 3B9IA 3O14A 4FOYA 2FD8A 2AENA 1UF2C 1RUC3 3GGLA 3IDCB 3POIA 1XC6A 4KWJA 5ACA3 4LTAA 3T30A 2KM2A 4I02A 2R042 2VBPA 4CDUA 5C3PA 5CA6A 2WS92 1VAVA 3KD4A 4HVOA 2VL4A 3JBG1 3PIJA 3WX5A 4JDOA 2WQZC 3I3EA 4LA2A 3I2OA 3ZFEB 5HCHA 2RS31 4ZY9A 1OPOA 4HOOA 4IGPA 4IEYA 5DDJ2 4BZ4A 4BXSV 2XBO2 3MLJA 5KXEA 3F95A 3HNBM 1W8HA 2QKDA 2WJSA 2ORZA 1RUF3 1UL9A 4H55A 1BVVA 2PHFA 4Q4X1 2DVGA 1CPNA 1RUH2 2A70A 1GZWA 1PZ9A 3D0SA 2YU1A 4GMP1 1G9FA 1BCXA 4YW5A 4YFZA 2EA7A 3NMBA 1EUUA 4OVEA 1W90A 1NLQA 4PBOA 4NOTA 3M70A 2VTFA 4QB2A 4BMEA 5FZIA 3FUOA 4QPIC 1PK6B 4A41A 1AR92 1RB8G 4OI0A 1MZFA 1LOBA 3D3AA 4LUMA 1QJX1 1VBD1 4BLJA 1K5MC 4JCKA 1MS3A 4GMP0 1ODMA 3BOWA 1DFQA 2W94A 1CVNA 4NIIA 4AOCA 3JCIA 3MO4A 1L7RA 5A7NA 4LHSA 4FTBA 1E5IA 1HN1A 2A6WA 1HRI3 3OPZA 4XXAA 3NNMA 4QQLA 3WF1A 4EN6B 2ZX0A 1RXGA 1UW8A 1UX6A 3EB7A 4QDRA 5FJHA 4MGQA 1G9DA 4YZ2A 4QKNA 4XVHA 4BIFA 2CDOA 1CAXB 3G7DA 3KF3A 4AI9A 1O3QA 4RA0A 1S55A 3WDXA 2Y8KA 1RUI3 1T6BX 2ORXA 3MICA 4RS5C 4Y3OA 1U0AA 4A7YA 4Z2AA 1QJFA 2VU9A 4Q0UA 1LESA 3Q9OA 4Q5OA 4XBQA 3USUB 2R7EB 1LNSA 3S7IA 1CAWA 1J1TA 1RUE2 3A7QA 4D7TA 2XVLA 4Y1ZA 3E6BA 5A3NA 4LLFA 2NLRA 1YXWA 2WWJA 5FREA 4BQWA 4AAXA 2JE8A 4TYSA 4MGTA 3WOGA 1OQEA 1RJ7A 5FPAA 2BOIA 5JZGB 4NAMA 4CTEA 1UY3A 1UOGA 2OW4A 2UWBA 1B35C 1ZZCA 2W0XA 4O7XA 1UY1A 2W1SA 5DUVA 4YARA 4E4ZA 1YFYA 5AFEA 1R1ZA 1ZBE3 1W8OA 2QQJA 1DHKB 4M3CB 4XC9A 5CFDB 5LBCA 1OI6A 4AVCA 1Y7BA 4O9GA 5J96B 4UFMA 4AGGA 2FBEA 3POYA 1BXHA 1B09A 2XJVA 4Q1RA 1POV3 4YGCA 5C3RA 3SQOA 3NAPC 1I5ZA 3GYDA 5L7OA 1J83A 2Z2SB 5BNPA 3MPPG 1ZBA2 1LCLA 4ATEA 5EV7A 2FDJA 4BQ3A 1C8M1 5KR7A 1LOFA 5CG8A 4LBJA 4GXLA 2GC2A 4FPOB 2O8QA 1PO22 4IETA 1EAH3 2A73B 4CSWA 1V6KA 1FOD3 1DP0A 2J22A 2PELA 4FPYA 2WZ8A 3OBZA 4N9HA 4PLNA 1CN1A 3AZWA 4R52A 4CP1A 1UNBA 2X10A 4D8MA 1N3QA 4SBVA 1OBNA 2FCVA 5C9AC 2ZZQA 5BNNC 3GBFA 4GH4C 4YVSB 3RRDA 2CGNA 4N43B 4N9IA 2BP6A 1AR61 1VIWB 4LUKA 5JOZA 4MZUA 2R0FA 4NHKA 3O1UA 4JGYB 3NWKA 1S4CA 2WT0A 2WFF1 1ULFA 2ARCA 1K42A 2Y60A 2W87A 2IVJA 3NV3A 5JXIA 5CIRA 3POFA 1YQ2A 2RV9A 1O8SA 5HXMA 4B1LA 1AL0G 3IN9A 2VMDA 3C7OA 4IV3A 2NQYA 3ZVXA 5J36A 1VBA1 4B8EA 1NA1C 2QFEA 4LIVA 1JOJA 4QWNA 5F2WA 4FI9A 3CIHA 3VKNA 3VZKA 2K2SA 4OHZA 2XJPA 3IAPA 4CEYB 2WNUC 2ZGSA 4AWDA 5A7WA 3V0BA 3ZXAC 1UMHA 5F5QA 5FPUA 1G8WA 3MFAA 3WQ7A 2RJKA 4XYXA 3AX4A 5FY0A 2R041 2JDMA 5ERLA 3PMEA 2WS91 4IEXA 4P9XA 4WV8A 4AQTA 2A71A 2LRPA 3NKGA 2Y6GA 2ZGTA 4UFKA 3H42B 1NG0A 3QOPA 2BJSA 2J7MA 2BBAA 3K48A 3OGVA 4HKWA 4KWKA 1H4HA 4ZZ8A 3VUOA 5HCFA 1I3HA 4Q0SA 5FMOS 2X09A 2ZHKA 4J1XA 4XPVA 4XJZA 3I59A 3J8F2 1GZWB 1K3IA 1NCQA 3KWVA 3R4DB 2F4LA 3LWCA 1COV2 2HYKA 1MEC2 3V0AA 3ME2A 3Q8AA 1AR91 4COYA 1JYNA 2F4PA 4FPGA 3ZXKA 2YHJA 2G19A 5FY7A 2P6CA 2W5FA 3PUIA 5EHDA 1PZ7A 3FBMA 4QX3A 2BU9A 1EV11 3ZFFC 4AQ6A 1GZTA 5LW9A 2PLV1 3PHMA 5A3OA 2NZ9A 4FP2A 1RUH3 2DCKA 2JKXA 2Q4SA 4IE5A 3VL8A 2G9FA 1SQ4A 5ABJA 4CUBA 2ZGNA 5T5JA 5A3LA 3CF6E 4Q0QA 4BQYA 4EWDA 1WW5A 1FMD1 2PTMA 4NO4A 1WA6X 4MSVA 2GNDA 4RGKA 5I0DA 3PU8A 3OD4A 1UU6A 3GBGA 2A5ZA 1V0AA 4K1ZA 5BNOA 1JZ4A 1RUD2 4IGQA 1ZZ7A 1HRV3 4QGLA 4QKBA 1RITA 4HETA 5G05L 4B7EA 1AR82 4XFCA 4A2UA 2ZMKA 1OLMA 1KQRA 1CJDA 1LR5A 1O3TA 5IK4A 2E63A 2YC0A 3ZXFA 5FPZA 2HWD1 1CAWB 2Y38A 3ZLIA 3H50A 3DYOA 5LATA 2DU1A 2G1MA 3PJQA 2CGPA 2J1AA 3A4UA 2YFUA 1QJU2 4CCCA 1NE4A 2A6YA 5I8YA 3HR9A 4NIAA 1XJAA 1Z7S2 5IT6A 4S2DA 4RQPB 4W4ZA 4Y22A 1BBT3 1OA4A 3IPVA 4NRMA 4D3WA 1RUE3 1DCSA 1HXS2 4JKMA 4L0PA 3ELNA 2VR4A 1QNWA 3R4SA 4L9BA 2Y0OA 1WLWA 1AYN1 4Y1YA 2B7YA 3DYMA 3JD73 2A6XA 3WQBA 3H8RA 2BTVC 2IXIA 5LA9A 5IATA 5L7OB 2DCYA 1X82A 2R30A 1T6GC 4IXLA 2J1UA 2PHTA 3LA7A 3S0MA 1GQPA 5LRSA 2DUQA 1YIPA 1ND3C 2LUWA 2WYSA 3ACIA 1H0BA 4LE4A 4JZRA 4RL7A 2VOVA 3U78A 3FMGA 4P08A 1W6QA 3NV4A 5IAVA 4D7SA 5APAA 5EJ1B 1NY71 2JB4A 3VZJA 5F37A 4Z92B 1YQ8A 5IHRA 1NT0A 3BIWE 2IXCA 3OGJA 1VP6A 4YM1A 1G9BA 5FK8A 4Q1PA 4GWNA 4C8DA 5CADA 1G7YA 1Y43B 3K46A 3HVDA 1TNRA 3WEZA 3K2OA 4LBOA 2FDFA 3PL0A 1HLCA 1O7FA 3ZX7A 1QU0A 1YJKA 2JD4A 5AC93 3B93A 5LEKA 3LFIA 3PDQA 2V09A 1X9PA 2P17A 3QACA 4IEQA 4R9AA 3U11A 5GZDA 5I8TA 1WMXA 3B7MA 1CAUA 3U14A 4FCAA 4FTSA 2JDPA 1YQ6A 4UFIA 3ZN6A 1K12A 4ASLA 3KT1A 2WFPA 4FFHA 1Q3EA 1QQP2 1SFYA 2BEOA 1ULEA 2VECA 1DF0A 1AJOA 3SHRA 1V6IA 3HT2A 5EP9A 2ZHLA 4CP9B 2XQXA 4XACA 4XJWA 3V0BB 1YFWA 1QH7A 2AZ5A 4WM8A 4EN0A 3EYPA 2BNNA 1CZVA 3E6DA 1QXPA 2PHRA 2W39A 1V6OA 4IERA 2VUAA 3SCFA 3U4SA 2RHPA 4KH9A 3ZSMA 3AZVA 3CZUA 3VBRB 5FZDA 5A1FA 1JYXA 5FZ0A 3RZJA 4AL9A 2TEPA 2VUJA 3PNAA 2XONA 1VBC3 3ILNA 4Y1VA 2CNAA 2W47A 4E4HA 2E51A 3UT0A 3PTRB 2KR2A 1W3XA 5LK7B 3KB5A 4UAPA 2CWMA 1A6CA 1S2KA 4HKLA 1KEXA 3RJ2X 1NCQB 3VDCA 4E27A 1TEIA 5CVRA 5BV6A 1EPZA 4QB6A 1RHI3 4BXFA 2D43A 1JZ7A 4PF1A 4F7ZA 3HBKA 4UFHA 5B2GB 1F15A 1W39A 2E9QA 3RZZA 4NRPA 1QJZA 3ILRA 4XZUG 1LHOA 1VBE2 1XNAA 4HK9A 5CISA 4N7IA 5ISLA 2ARBA 3L2YA 2YV8A 4XF9A 2P34A 1G6NA 3J8F3 3GCWA 1U5IA 3UJOA 3ES4A 1HQWA 1MEC3 3ETPA 3B69A 2ZMNA 4DEVA 3BOPA 5JDBA 4AGVA 3S5QA 3HOBA 2VZPA 3LIGA 2Z42A 4QPYA 4DRVA 1PVC2 4LXLA 1DU3D 1GICA 2TNFA 1NYWA 1X36A 2CGOA 1CD3G 3AFKA 4A7KA 3DF0A 2DFBA 1A34A 1AR73 5IVYA 3KMHA 3RYKA 1O4YA 2FDHA 2A3WA 2WAAA 1OFSA 3MV11 1X8EA 1RUG3 4BK5A 3WW4A 4O9EA 4ZZ5A 4ZXKA 5E8AA 5HI0A 3I54A 3LD8A 5FZBA 1MACA 4Q8LA 2Q8DA 1QJU1 2D44A 3BPSA 1CZTA 1RUD3 3QD6A 2QQOA 2GC1A 4RHV3 4IQPA 2DUPA 3E5QA 3OBAA 2JENA 4NIDA 2VBBA 2HWF2 2J1EA 2VCAA 2XUMA 1AX2A 4W6YA 3VBHB 2VCBA 1N1VA 1BEV2 5BY5A 3H8UA 3OUJA 2WZR2 1RMU1 1XU2A 2E31A 2V73A 2VZSA 3ZYIB 4O65A 2WNVC 1DGRA 1R091 1RVF1 5A7QA 5EIYB 3GZAA 4AEJA 3OEBA 1G9CA 4FPEA 2VULA 3K3NA 1ST8A 4C0HA 3I2JA 1YI7A 1XNBA 3Q8EA 3U10A 3M7AA 1JOPA 4MV2A 3WNMA 1UYZA 5T5PA 3KV6A 1Q43A 4B4PA 4H7LA 1Z7S3 2Y26A 1AJKA 1OHFA 1W8TA 3NNJA 2ENRA 3K3OA 5CNAA 3FL7A 1N3OA 3M3IA 2LS6A 2FZ1A 1HXS3 4ET7A 1W6QB 5G04L 5T5LA 4BE3A 3WP6A 4CU8A 3JQWA 5D2AA 2EF6A 1UU5A 5HV0A 3JUUA 1QNYA 5J3UA 5FKCA 2E32A 1ASJ1 1R1A3 5JI9A 4M01A 4AI3A 4EE2A 3N9MA 2R0HA 2A7AA 2JDKA 5H9RA 4CCNA 1OPMA 2HLEA 2D5FA 3B9CA 2WBKA 1QHDA 5H9SA 1C1FA 3ZO0B 1ENRA 1GR3A 1VJ2A 2UY8A 1JHNA 3NNLA 4FFGA 5EWSA 2FCUA 4UBGA 2VZVA 3AZYA 1A3KA 5JMOA 1QKQA 3TN92 1CAUB 4XAEA 3M8LA 4LK7A 1QWRA 4BIOA 4B4QA 2P3YA 5BUVA 2A6VA 1WCDJ 1ZNPA 4P9JA 1XSQA 2QBXA 3AFGA 1OXCA 3WF2A 3M3OA 4WVVA 4YW6A 5FYYA 5B4NA 3ZFEC 4XOGA 4WM8B 4CDWA 1PM7A 5JIUA 4K9SA 5FK7A 4HMZA 1FV2A 1D4M1 1PGL2 4XILA 5FO7B 3UGGA 3RYRA 4OUSA 2WUHA 3VLBB 4AI8A 4M4RA 5A3UA 5IVEA 1W9WA 1VB4A 2WYFA 5K4LA 4E2QA 3VGIA 1GOFA 1KDMA 3AMPA 1PO13 2AGSA 4YG3A 5C3OA 1WWYA 1QQP3 3C8XA 4ITCA 1PK6C 2C6SA 4KBBA 4H7MA 1H6XA 5J7MA 3LF7A 2SLIA 1REDA 4R9BA 2BGPA 3UJQA 4K6BA 5A32B 4EN8B 2ILMA 1NQJA 1LRHA 2DFCA 4YGEA 2PFWA 1JYCA 2JG8A 5H9PA 4NPMA 4PI0A 1YYNA 1SFNA 2PYTA 3VDBA 4M0HA 1YIFA 3W59A 1VMFA 1PX4A 4WBBA 1JW6A 4XXPA 1MS9A 4AFAA 3ETQA 4FQZA 4GWIA 3DEMA 4NHMA 4OZOA 2D97A 2HJIA 4XMIA 4LKSA 4Q4X2 4CXXA 3WDWA 1J3QA 2BFUL 2OYZA 2GN3A 3TOJA 1E57A 1SPPA 1XU1A 3OD0A 4AQ2A 1HB3A 4NPLA 5L73A 3CJIA 4JHTA 4L11A 1W6OA 3VBFA 2AC1A 2RR11 3THTA 1TME1 3WHTA 1XYPA 1QJX2 1VBD2 1O91A 2P37A 1PVC1 5AVAA 2MEV3 2UY9A 5A3PA 1VBE3 5AVPA 1LGNA 4QM8A 4FQ4A 3OPWA 5JZGC 1RTVA 1XQNA 2QQKA 4Q2FA 2UWAA 5JUVA 4XQDA 1CR7A 1W3VA 4CUAA 3U0ZA 4XF4A 2RMU1 5A3TA 1DLLA 5ANQA 3HQXA 3K4DA 3N35A 2DCTA 1W6PA 1H2NA 1W04A 4LBKA 3RPQA 4AW7A 5KBFA 2LW8A 3AYAA 3I8TA 3SC7X 3H8OA 1UYPA 5DUWA 2J1TA 2EALA 3O5SA 4MUVA 5FWEA 4Q8KA 5C7GA 5LK5A 2HWF1 2YC4A 4M3CE 5A7PA 3E1F1 4FT8A 4FVVA 2XWBB 3N3HA 3ZIWA 3BIEA 1BEV1 5FXWA 1W0OA 5A3WA 3RWKX 4B3NA 3ZKYA 2YYOA 1YHFA 3DPRA 4OQ9A 4XABA 2D98A 5FUPA 1W0PA 3F2ZA 3DXTA 4PIZA 4QU1A 5SV5A 1W6NB 5C8CA 2WO3A 4FSJA 4J1WA 4OI1A 4YW3A 3IWZA 1YO8A 2QZ3A 2ZAHA 3QBQA 1FPN1 2BZDA 4IEUA 4NJ4A 2WZEA 2XJTA 4Q0VA 1VAMA 3IDBB 5HCAA 4BK4A 1M06G 3MF9A 1LOAA 1OOPA 1UU4A 1W2NA 3H0OA 4LOTA 2QQNA 2WZR3 1GWMA 2YU2A 3BTYA 1V9U2 5BPXA 5FTTC 4YVSC 2JEMA 3U4XA 5LA0A 2FDGA 4N43C 3ENRA 3T1LA 3AP4A 3B94A 4JGYC 1ND2A 2MNGA 3HN1A 3KGZA 5JOYA 3WXPA 4AEDB 3WNKA 3FZ3A 4XDPA 2IUWA 2C5DA 4ISRA 4BU2A 1AL23 4JKKA 1QH6A 2FDKA 1C8M2 1UYYA 1PM4A 2WDBA 5KC5A 2D6PA 1N47A 2RS53 3MYXA 1QDCA 4BQ5A 3LB9A 2OKXA 3SKVA 2Y34A 4DEQA 4OHYA 1YUDA 3RWNA 1H8TB 1PMIA 3FBYA 4CEYC 5FO8B 1W05A 1I5PA 3FE5A 4FPJA 2HKXA 2RM23 4Q4Y2 1LODA 4LULA 3S7EA 1WBFA 1MVQA 3ABZA 1N1SA 1ULPA 3UETA 4IV1A 4P14A 4XF1A 3OGRA 4FXGB 3O1PA 4NMIA 1ACCA 3AKSA 4QPGA 3SKJE 4K8FA 2WFF2 1WCKA 3V65A 4CDWB 3C2UA 4KG8A 5LBFA 1VAKA 5FZAA 4COUA 1PNGA 4OHWA 3TN93 3D82A 3PLQA 2J42A 2W92A 5FPBA 4CDXA 4CUCA 4F83A 3BPZA 5DMYA 3MW2A 3E97A 1OUSA 4JGZA 2RJLA 4UT5A 2VCMA 4C0BA 1FNYA 3BN6A 1RUJ3 2DV9A 4OYUA 2J1SA 2X8KA 5L9VA 1HB2A 5E1RA 5F7UA 1QOTA 2JDNA 1MS1A 1F9KA 4FAGA 4KU7A 5FPVA 3VBUA 1IPKA 1UCXA 2Z69A 1X50A 1C3HA 2VAUA 2XVGA 2DUOA 1EY2A 2JDUA 3URFA 1QJEA 5GZGA 2JG8B 2WT1A 3MW4A 4JDNA 5IWFA 3H3ZA 1SBDA 2D5HA 2JG9B 1SLIA 5KXCA 3BALA 4DIQA 4JHZA 4ZU5A 1JYWA 4HSJA 3FWEA 4TTGA 2XXZA 1VRH3 2RDQA 4MXVA 1Q8QA 5FZEA 4N53A 5FQ0A 3GZTB 4PF5A 2HBTA 1GFF2 1A8MA 2YY1A 1VBB2 2OUHA 1UY2A 3JB4C 1IG0A 4W65A 3CJIB 3WDUA 4WM7B 3JBG3 1W2OA 1WW6A 1IGOA 5L9BA 2RS33 3ZIXA 3IT8A 4PLOA 1F2NA 1EV12 2QJVA 5FYIA 4UW3A 4QQOA 2R16A 1VMJA 2IZWA 2PLV2 3KLSA 5FZFA 1OQDA 4L99A 5KHJA 2RS12 4V2VA 5C4WA 5L36A 4ONUA 3VDAA 1OD5A 4CXWA 4RQPC 1HRI1 4EWEA 4RR3A 4E8DA 1FMD2 3HQRA 4XURA 4YW7A 4H2AA 4CEWB 1W6PB 2ZJCA 1MZ6A 2YDEA 4ZU7A 1HIXA 1GYKA 4QDQA 1DGWA 5F3EA 1VBD3 1NUKA 3ZMNA 3ILFA 2VZRA 2C4XA 4LIUA 1H2KA 1GU3A 3A21A 5L7OC 1TNFA 2IXJA 1CIWA 4A7ZA 3S5AA 1C8NA 2NMNA 2HWD2 1C28A 1IG3A 3H3LA 5LRRA 1L7LA 2ZX1A 3AM2A 4BA6A 3AZZA 3MIGA 2B42B 4XFFA 3DPRB 3IB3A 5IUQA 3CKHA 3SISA 3ZM8A 1GANA 4Z2WA 4LK6A 3BCWA 3B01A 4PT6A 5C8CB 3S30A 1KITA 1F5JA 2WWUA 2D3RA 3APBA 4XZPA 1JUIA 5FMOL 2EXJA 2QTWB 1H2MA 4P00B 2YROA 3MIFA 4O61A 4XQ4A 1HKDA 4I0AA 4ZONA 5J98B 1BMV1 3CLPA 5DUXA 1UZZA 1QXRA 4PCRA 4XUPA 1OOPB 3VD9A 3PJYA 1V9U1 3VZMA 1W9SA 2ZGMA 2D7FA 1JS9A 3O7OA 4ORFA 5IJRA 3VZLA 3KHCA 1AYN2 3V64A 5GM0A 5DAXA 3T2OA 2VBDA 3ON7A 1ND2B 1U5ZA 2EICA 2HWE3 3BI3A 2ZZJA 1UO9A 2RDRA 2FCTA 4DO0A 1J84A 2GNTA 3E5UA 5FPXA 1D4VB 5A6ZA 1TZOA 3W21A 2ZABA 4MGZE 3X29B 1APNA 1WMDA 5TSWA 2GC3A 3WV6A 3Q8FA 1QY4A 1C5HA 3LFMA 1OSGA 4MO3M 1NY72 1POV0 5JSPA 4RD7A 4FPHA 1EAH1 2ZXQA 1XB9A 4IDZA 1PHMA 1FOD1 4UWDA 4BYYA 4D6QA 4DUVA 5IVVA 4Q4Y1 2VZOA 1I9RA 5F5AA 2GMMA 4QD2A 3RZHA 3ZYGA 2QQMA 2ES3A 3POSA 3ZR6A 3AKPA 1UXZA 4NRQA 4IV1B 5A33A 4HPKA 2D3SA 4RYDA 1ZM1A 2W9XA 3OEAA 5LASA 3VBRC 2VH9A 4CCDA 1GBGA 3PVEA 2XVKA 3VHPA 1O5LA 1DYKA 4QU2A 1HDKA 1POQA 1H1AA 4IEZA 4AVSA 5HPOA 4CU9A 5CB7A 1FYUA 2VMFA 1QOOA 1YFUA 3U37A 1MR5A 1NCQC 2IVIB 1WCSA 4Y5TA 3IMNA 2E53A 5FUIA 3WDYA 4D6RA 5JOXA 1NOVA 5DABA 4CRQA 4XFIA 4JGZB 1O3RA 2X5IA 5DAPA 1DYOA 1AR63 4K40A 1GNZA 4OUMA 2HEWF 4NVPA 1NLSA 3KCYA 1Q8PA 3ZSJA 3BU0A 1PGSA 5K0UA 1MQTA 3J7MA 3VBUB 2B9UA 4P9LA 5T3NA 4K7JA 1NCRA 1NXMA 2GZWA 3SXWA 4CDUB 1JU4A 2D6KA 3O0WA 4MOAA 4AG4A 1SDDB 4DPNA 2XL7A 5LBBA 3WDVA 2JKBA 4LQRA 5JR7B 4F8AA 3T2QA 1VBA3 2IXLA 5LEJA 2EXHA 4AXOA 1S0IA 2QUOA 3AL6A 5GZEA 2X53S 4GAZA 4XQWA 1LEDA 2YBSA 4JAAA 2E33A 4CPBD 3NSTA 3HWJA 3I2FA 4LMFA 4KI5M 4OHXA 4N53B 5FQ0B 3THCA 4S2HA 4ASMB 1W9TA 1VBB1 2A3XA 2R043 2XLFA 2YXSA 5C9AA 5FDBA 2CYFA 3LEKA 2WS93 3HPNA 3LOIA 4AVVA 1YNAA 4HONA 4KGQA 4B4RA 2EXIA 5FP8A 1W8WA 4UXAA 3NVCA 2W2IA 2XBO3 1OLME 5DDJ3 5T50A 3T0BA 1UZVA 2NPIA 2HWB2 4ATFA 2RS11 3AMNA 5C70A 3OF1A 4AFMA 5C4WB 5C5TA 3KV5A 3AKTA 1Y9GA 3CL1A 3VBHC 1ENQA 4XIOA 4LBQD 4RR3B 5GLUA 5JXGA 1AR93 2ZGPA 2P1BA 3WLUA 4COVA 3I3MA 3GZEA 3RI8A 5CFDA 5CBLA 1DDLA 5EJZB 2VNGA 1Y4WA 5JIAA 2MPFA 5CFCA 1HRV1 2BBVA 3FC0A 1F4HA 2XDVA 5J37A 1I6XA 1HJGA 5GZCA 1GOHA 2PLV3 3A22A 5GLWA 2PAMA 4C1WA 1DZRA 4R4ZA 2UYBA 3K51A 4MVTA 3ZPOA 1FT9A 4AFDA 4XHBA 1VLNA 1W8UA 5IFTA 2AUYA 5HCBA 1FMD3 2QDNA 5DXDA 3RVHA 3PUHA 4XFHA 4D94A 4XJ9A 1T2XA 2A3YA 4XJAA 4WZFA 3T4VA 2VVEA 5FLHA 1W2TA 4P9GA 4YM3A 1Q8SA 2VMGA 3PVBB 3VBOA 4IE6A 1D0HA 4YG0A 4XTMA 1DLCA 3NV1A 1GMMA 4CA9A 1K45A 4CCKA 4NIGA 4AVAA 2ZA9A 1RMU2 4MHUA 2CDPA 3CBNA 4QXBA 5DAVA 1R092 1RVF2 3JD71 3JU9A 2HEVF 2GP5A 4NROA 4Q4W1 5BNPB 4GZ9A 4AHXA 2Y64A 4GIQA 3BYWA 1XOYA 1TMF2 2BUKA 4CDQA 4HVRA 1FNZA 1AXZA 1ZREA 4FP3A 5CKNA 2E7AA 5IVBA 4KBZA 2YUEA 1G86A 2E7TA 1JH5A 4Q26A 4QDSA 5JOWA 3PURA 2OVUA 3I7DA 4LPLA 2D3PA 4ES9A 4LE3A 5IK7A 3SLIA 3VD5A 3TNQA 1AYN3 3NKTA 2ZEYA 3IMMA 3FUQA 5EZWA 4CUGA 4WM8C 2Q8CA 3TEWA 3LOBA 1KGYA 3J7HA 1ZBA3 4ZS3A 1ASJ2 1FV3A 1REFA 1DQ6A 1YCIA 3B3QE 3WW3A 3WW1A 4YW2A 4L97A 2BW8A 3T4HB 4FPLA 5A33B 4QXHA 4HPKB 1Q8VA 3OYWA 3VHRA 3DCQA 1R64A 5AC91 1PO23 2VZ1A 4ZS2A 4D7YA 4BB3A 4FAHA 4HSLA 2ZKNA 1IS3A 3CEWA 5EFUA 1SG3A 2PMWB 3PMSA 1OA3A 5JI7A 4IV3B 3WNXA 4CPBA 2XKPA 4CP2A 4KWLA 3MBWA 3MUY1 4FXKB 4Q4V1 2X5IB 5BYNA 2G4IA 3P3PA 5FIXA 3I4IA 4YWAA 2IFRA 5A7WB 2XUEA 1PGW1 1JYVA 2Q1FA 5C71A 3AJYA 2YBPA 3C7FA 3KVAA 1W8FA 5K0UB 1MQTB 1IKQA 2VOTA 3QLQA 4QM9A 3I3BA 4UF0A 3SH5A 1R081 4MGSA 1D4M2 4XFAA 1NCRB 1SCRA 3SH3A 5CZKA 2P4EA 1NQDA 2VM9A 1WW7A 3IM0A 1J58A 1ND3A 4LO6B 2YZ4A 1XBFA 1ZZ8A 2WSUA 3RDIA 1BJQA 4LT5A 4LBQA 1UYXA 1Y9MA 1UPIA 3AB0A 5DPNA 4EZHA 4LO8A 3VL9A 3I59B 3O0VA 3WVJA 5T54A 2XHKA 1JTZX 2XPJA 3JXSA 3MI8A 4QQPA 1WW4A 4IEPA 4HVQA 3V0AB 4HLTA 1SCSA 1J3PA 1EPWA 3KGLA 3DECA 3W58A 3P5BA 2CL2A 1GQHA 4L8QA 5E88A 1RHI1 2GN7A 3AVRA 3ES1A 2YMZA 3KQ4B 4GKXA 4BOWA 2GH2A 3SNMA 2BNOA 2LM3A 3VZNA 2B9VA 1FX5A 4RFRB 3LAGA 5ANNA 3ZXLA 3POJA 2VZQA 3CHXA 2HWB1 2Y6FA 3MIDA 1QDOA 2VMIA 3ZFGA 5F32A 5ABJB 4HL0A 3OOXA 3N7MA 1COV3 4UW6A 4Z82A 3O1TA 1UMIA 3MLLA 4IE4A 5BNOB 1WMEA 1FAYA 3HD8B 1MZ5A 1LJ7A 1AZDA 2RR12 4MGIE 2ZHMA 5FYHA 1TME2 2A6ZA 5SV8A 3U07A 5CFCB 2ID4A 1IPJA 1M4WA 1WLTA 5EYXA 1RXFA 3UV9A 2EIEA 5DG1A 1JZ8A 1Q5OA 3VBSA 4JTOA 3OY8A 1XNTA 1JZ5A 3VV1A 2RMU2 5IW0A 2Q1ZB 3K77A 5KWRA 2VMEA 1UZ0A 2WRAA 2OPKA 2I07B 1ZYBA 1AR83 1DZTA 1DQ2A 4PDWA 3VBOB 2WNEA 1W06A 1YQCA 4AEDC 4D6SA 4Y22B 5AFBA 1QJY2 2BGCA 3IPVB 3LE0A 3LEGA 4LORA 5F39A 3ZMOA 5FZCA 4YVWA 1NZIA 2Z79A 1SLLA 1KJRA 3RMXA 1GUIA 1VPHA 1YLLA 2EIBA 2RE9A 5FZGA 4DY3A 4DUXA 4HZFA 2VVFA 2QQPA 5EPAA 4PHZA 5KC6A 1GV9A 1H8TC 1QJU3 1TMF1 4CDQB 1FPN2 2RVAA 2WAOA 3D4KA 4ES8A 3VN4A 1RL3A 2P6HA 3FLRA 4XDOA 2ZS6B 4UBHA 5FP7A 1S0JA 1RMU3 1ZA7A 3MIHA 1UKRA 1S0CA 3E6CC 1Q56A 2JDYA 2V72A 1ZRRA 2EXKA 1RVF3 2W3JA 2HYXA 4GWJA 3RSJA 3ZR5A 5IVCA 1XE7A 3LSEA 3EJKA 4YPJA 3OGSA 4B29A 1BYHA 1UOFA 3LEIA 4CDWC 2D6LX 1R1A1 5FXXA 3ZXJA 2VNRA 3B00A 2XR4A 1MS5A 5FZ3A 1UXXX 5FLIA 5JCTA 1UY4A 2W08A 1GNHA 4W6XA 4RGAA 2CTVA 3RYPA 1IZ3A 1FATA 3M4FA 1YC61 2WZPP 3O0XA 5GKAC 3WF4A 1OLRA 2KXLA 1Z0HA 2R32A 1SLCA 2CSGA 4MGKE 1LENA 4XCBA 3ZN6B 5I8SA 3NO8A 1EYBA 1O6UA 4QGNA 4Y5SA 2B5HA 2G9GA 5EYYA 4UW4A 1V6MA 3NJZA 2OA2A 3NQHA 2JG8C 4LITA 1DG6A 4UFJA 2R062 4HFSA 4FO9A 4IEOA 4IE0A 3D0JA 1RUNA 3W5MA 2JG9C 3LA3A 5EXOA 3U75A 4BQ2A 4LBNA 4CZSA 1REEA 1IQDC 1HV0A 2NN8A 3C7GA 3IDAA 3LCPA 3WG1A 4MGYE 5A1AA 3RQ0A 5DAQA 1BK0A 1O59A 4DRRA 1WKYA 2BRTA 1GSLA 4EYUA 2ADDA 3M3QA 2WSVA 3TBDA 3AMQA 3OB8A 3CJIC 4JV4A 4WM7C 5LCWL 5I0TA 2YGMA 3FLTA 4NHLA 2OQ6A 1UQXA 3MIBA 4EN7B 1MS8A 2K9ZA 4XW3A 5ACA2 2C9KA 1D4M3 2WNOA 1MPXA 1LULA 3MV01 5FP4A 2W46A 2ET7A 3T2PA 2DCJA 2Q5TA 3VDDA 1F4AA 2JIJA 5FMBA 4DMIA 4E4DX 3AP7A 3VKFC 1QIQA 3MLKA 4SLIA 3CDZB 4DNYA 2XQRA 4QKDA 1N1YA 4CEWC 5J09A 4XAAA 1W03A 3ACLA 3AVSA 3ZFGB 3KHBA 5F8PA 3OUHA 2XB6C 2YG0A 3J26N 5C8WA 1UN1A 1QGLA 1YFXA 4LBLA 4YGBA 3NRUA 1S0FA 4PJYA 1ONAA 5FYBA 5L19A 3KCCA 2JD9A 1LOGA 3P6BA 4L2NA 1XNDA 2RDNA 2VVDA 2VZ3A 2ZGLA 4Y1XA 2W91A 1X9TA 5FY9A 3DPRC 4P9YA 3UGHA 2H6BA 1CWPA 3N9LA 3ZFEA 1KDKA 3RFRA 5F6KA 1AX0A 1CQ9A 5C8CC 1J1LA 2YGLA 3BU7A 1UKGA 4BPZA 3GDBA 3RG0A 2MHFA 4YYOA 4OHVA 1NX9A 2ZAAA 3C7HA 2ARAA 4J25A 4QQHA 4V1PA 1LECA 3VBSB 2RDSA 4FPCA 1NE6A 4ZHNA 3WP5A 1HRI2 2HWC1 4KQ7A 1AYM1 1BK1A 1OOPC 5FYTA 5FXZA 1UD1A 4XBNA 2E6VA 4BQ4A 4DOUA 2GMPA 2Y0IA 2H0BA 1AUYA 4TN7A 1TME3 1JHJA 3R6SA 4MG2A 3ZDSA 1JI6A 1PVC3 4OI4A 2VE1A 1ND2C 3LIHA 4PDWB 3ZOIA 1RUI2 2WC2A 2ZGKA 1QJY1 3IIIA 3N9PA 4CCLA 3M1HA 2WABA 1LOCA 4FFIA 4QHBA 3AKQA 4YVWB 4AFCA 5M0TA 4CCJA 2VNVA 4D69A 3N9OA 1SBEA 2WN3A 4NHXA 1O3SA 4LLOA 2RMU3 3OGGA 2PHXA 4K8RB 1HJFA 1IQAA 3WQ1A 4A42A 1XE8A 1ZRDA 4PBPA 4X6RB 2R071 4NN0A 5DAWA 5F2SA 2WO2A 2D6NA 2HBUA 2NP0A 1BMV2 2DBIA 5FZ7A 1E5SA 2HWF3 3A0NA 4K20A 2WLQA 3GCXA 5C3SA 1BVP1 5D8AA 2BWCA 1AVBA 2K46A 5KHIA 1BEV3 2VQAA 4R9DA 4V2WA 5FY1A 5KXDA 2ZX3A 3GJAA 1RYYA 1ZRIA 2CAVA 1U5YA 2I2SA 2W1UA 3OSDA 4IV1C 2VD7A 3T1MA 3KF5A 2XKOA 3AYDA 3N9NA 4OMCA 3FHQA 4TSVA 2YB7A 3AP5A 3EMRA 5IAXA 5I0RA 4AI0A 5K7PA 2ADEA 2WO1A 3L2HA 5JVVA 1FPN3 1ODNA 1AL21 4FOWA 4XTPA 3UKTA 3VD7A 4DFSA 2BV4A 3POWA 4GB31 2AH2A 3AXDA 3MW3A 4YW4A 1LU1A 1SLBA 2RS51 3NL1A 4LO7A 4QHZA 3DUIA 1MVEA 4JGZC 5FZKA 3O1MA 4AI2A 2PXJA 4IGOA 3K4AA 2DWRA 1DGRN 3HEIA 1EAH2 1I1EA 2BERA 2ZHNA 4WVZA 1FOD2 1C4RA 1H1MA 3KM5A 3O12A 2GMEA 4OI2A 3RS6A 2RM21 1KS4A 3VBUC 2EIDA 4CDUC 4PIYA 1IHMA 1HV1A 2FMYA 1P8JA 4H14A 3KV9A 4KMQA 1X8MA 2R061 4NR1A 2DURA 2W1QA 3GBWA 4TLGA 4TXWA 2QDRA 2FZ2A 4PIXA 2VJXA 5HXVA 3R4UA 3WY6A 3I49A 2BGOA 1PIV1 1A78A 1SBFA 1WZXA 2IC1A 3FFZA 5IVJA 3ZDVA 4N53C 4PLMA 4LKFA 3O1SA 3IDEA 1ULOA 3GHMA 4YVSA 5E89A 5T55A 2WQ4A 1XNKA 3SEPA 5FYMA 3HNYM 3MGUA 4JGYA 5A80A 4AF9A 5FRAA 1RUC1 3FFQA 5ACA1 4IUGA 3T0DA 1WBLA 1SHWB 4MHRA 4DXZA 4GKYA 4AR2A 2YPJA 3AL5A 4XHXA 2G9ZA 3ACHA 4I3GA 1YEWA 4LJHA 3VDDB 4JVAA 4TZDA 5C4WC 2X29A 1DBNA 5GLVA 4J6GA 2R49A 5I0SA 1GNYA 2XMLA 4RR3C 3ECQA 3BTZA 3TEXA 3UL2A 1OKOA 3HNMA 4XFGA 1RUF1 3CO2A 4XETA 4ISQA 4RN5A 1MZEA 4R4XA 3O1VA 1OT5A 1S0EA 4NHYA 1VRH1 2QNKA 5F6LB 1SPPB 2QQWA 3LZZA 2BDRA 3PIGA 4K1YA 3VBFB 4BDVB 1W6OB 4GALA 4XIKA 4AZZA 1LB2A 4MX3A 2ZEZA 1DZQA 5LBEA 4LBMA 4PI2A 1MS0A 1ALYA 3AJZA 4ARXA 2CAUA 2BWAA 2LROA 2WINB 3UGFA 2OXBA 4QPWA 1H30A 2QE3A 4XBLA 3WHUA 4IL7A 4QXKA 5FYVA 4Q4X3 3H1YA 1Y9QA 1QF3A 3K75B 4GMP3 1V6NA 4META 4AGRA 4QXCA 4AVBA 4FOQA 3KSCA 3OBRA 4X8PA 2PAEA 3AXEA 2CY6A 5I0UA 5FJKA 2OPWA 3E5XA 3N4MA 1GLHA 2QZ2A 1S2EA 1YI9A 4M4PA 4QX5A 4LEJA 4KU8A 3OPTA 4YZ4A 1BZWA 5F3IA 2VQ0A 5FZOA 1S0GA 1QJX3 1HRV2 1JN2P 1LKNA 2VQUA 3RI9A 3VHOA 1RUI1 2PA7A 1W6MA 2JE9A 2EVXA 3A23A 1VB2A 4JDMA 4N90A 5DG2A 2I74A 4JQTA 3IBMA 1OD3A 1SACA 5BNPC 3BKZA 4LHNA 1LOFC 1K5JA 1IPSA 5C6CA 4DXTA 3IAQA 3OBTA 1GZ9A 3NNGA 3CNAA 1UZYA 2ZBJA 3M3EA 2WT2A 4MLOA 3T08A 2GNBA 3WUDA 4LO4B 2B39A 3AP9A 2RJ2A 2PAKA 1JYTA 5FZLA 1WD4A 4BCUA 2OZ6A 2PN5A 2WLPA 3B5LB 3MF6A 3BODA 3ACFA 1LGBA 2AYHA 4ZKTB 4NWVA 2KD7A 4XUNA 5D8AB 2DCZA 2BNMA 1ZBE1 3N9QA 3KZ4C 2JECA 1F5FA 3WF3A 1IKPA 1BBT2 2Z5WA 4QPIA 5DZEA 4EWAA 2ZKLA 2D93A 1KS5A 5GLZA 2AREA 3FN9A 4LO5B 1K5MA 1POV1 2VNOA 2QQUA 3JD72 2Y33A 4Q4W2 2HWE1 3PUQA 2JJ6A 2DTWA 4GJZA 2FDIA 5CYYA 4AHYA 3PTYA 1ULCA 4IV3C 4L92A 4AQSA 4B1MA 5JLVA 4RQPA 3OUIA 2Y6KA 1OF3A 1IS6A 3V56A 1V9U3 3ZYBA 2GNMA 3JZVA 2X5IC 5FMCA 3CMGA 4COZA 5IK8A 1UZWA 4DQAA 2C26A 4C90A 3W5NA 3AP6A 4UFLA 5DZFA 2ZGUA 4RS5A 3LPGA 3U1XA 5K0UC 2FQPA 2B45X 1KRIA 2OZJA 1US3A 1MQTC 4Y20A 3FX3A 1N3PA 1UOBA 3ZSLA 2BVBA 1NCRC 1C8M3 4RFT0 3H8XA 4X6QB 4QKFA 5LA2A 4OULA 1H9WA 2H0VA 4AAPA 1OVSA 1OUXA 1GWLA 5L9RA 3BGAA 3FHAA 4QPGB 4PQQA 5FZ9A 4FPFA 5AC92 5K9YA 3MHZA 4GULA 3UESA 3H1MA 1PVXA 1XRUA 2B4KA 1OMIA 2PHWA 2B8MA 4NWWA 3TRSB 3O1OA 4FBFA 1B35A 5B4XA 3EBRA 4EQVA 4Q4Y3 5GJ6A 4CCOA 4HK8A 1Q8OA 3WDTA 4CDXB 5FR3A 4IE7A 1JZ2A 1H1IA 3SH4A 3JB8A 3DKWA 4C91A 3KVBA 4U2AA 4Q4V2 3BTAA 1FXZA 1RGSA 1OURA 3DXUA 2XG3A 4XUTA 5FP9A 3ROUA 1L3JA 2V4VA 4K21A 4CE8A 2XJRA 5CEHA 5A7OA 2P3IA 3D8CA 4MXWA 1PGW2 1HB1A 1RIRA 3NAPA 2WFF3 4Y1UA 4AK3A 3MUZ1 3H9AA 1CAVA 3LSDA 5C33A 3INAA 2QCSB 1R082 1BKZA 1IS4A 1WD3A 2QQLA 4GQ7A 4XF0A 3I3QA 1HW5A 3FLPA 4DB5A 3UNPA 4I3PA 2DVAA 5FMDA 1CX4A 1HX6A 4W8JA 5ABJC 4A3XA 2AEYA 3WCSA 2JIGA 3WP3A 2Y6LA 3VKOA 3ACGA 1XPWA 1VBC2 5BNOC 2NMOA 5LY2A 5E16A 5CFDC 4OLLA 1DQ4A 1IOAA 4CP9A 5CFCC 2JB8A 2DDUA 3LDKA 5DN2A 1OFNA 5A70A 4YRDA 2YPDA 1SEFA 2J1RA 2WKKA 2WIIB 5BNNA 1V6JA 2VOWA 3WCRA 4GH4A 4X8NA 1JMUB 1GP4A 3AK0A 5GZFA 5F3GA 3AMHA 1RHI2 4QX1A 3HMYA 1CGPA 5FYUA 3VBRA 2ZEXA 3N7JA 3KT4A 4G3YC 1W99A 1PZ8A 5DDJ1 3POGA 5D21A 2XBO1 1ZA4A 3WNPA 4IEVA 1RUH1 4YLZA 1SZBA 4Q0PA 2P3KA 5FCCA 3VBOC 1NA1A 1VBB3 2H6CA 4JX0A 1W9YA 4W6WA 1C5IA 1CESA 4E2GA 2JWPA 1AF9A 4YZ3A
chains in the Genus database with same CATH topology
1JBCA 2WNUA 5HBAA 4B7KA 2P3JA 3KT7A 1U12A 1PNFA 1EV13 4AYUA 1W6MB 3H7JA 2IXHA 4EJRA 1GZCA 1DYPA 2RS13 4UW5A 2EAKA 2OUJA 4CDQC 1AR72 5KXBA 3SITA 1RUG2 3KQRA 3N7KA 1ZZ9A 3PVNA 3SCGA 1ZRFA 4RHV2 4URTA 2UURA 5F1RA 4GWMA 1BBT1 1ZRCA 1RC6A 2F6BA 2HWD3 4Y4YA 4QPIB 1RUE1 2C1FA 2O0OA 3GHNA 1ULDA 4YFWA 1K5MB 4IESA 3ZFFA 1H9PA 2PHUA 1TE1B 2GAUA 3R05A 1KFUL 3T2TA 2ZX2A 5JPMB 2CWSA 4BM8A 3H1WA 4OZXA 4H3WA 3VBHA 4F3JA 4M00A 5BXXA 4YM0A 3ZN5A 1CONA 2FHRA 2OIIA 2WA3A 4AI1A 2CV6A 4R9CA 2LALA 3ZYRA 3HAGA 4XJUA 4BMBA 3J9SA 1SMVA 5FBZA 4RS5B 1GKBA 1YJLA 4JQRA 4Q4W3 4Y20B 1ZBA1 1R1A2 3H7YA 4XE9A 1C1LA 2FMDA 5T52A 3S6PA 2ZOEB 4FTEA 4XJ8A 4I09A 2GSYA 4EV0A 1X33A 4HANA 2VY0A 3TB0A 1PO21 2TBVA 3WT3A 3ZSEA 2XLGA 1B35B 2DVDA 5CU1A 2ZGRA 2D40A 2C9AA 4HKOA 4AFBA 1KD7A 3LA2A 3MPBA 2A75A 4S2FA 1W2UA 1O4TA 4Y5Z0 2VXRA 2NYYA 4LA3A 1DQ0A 4BLIA 3HT1A 4BH9A 4MXWB 3UKVA 4E2SA 3NAPB 1KXGA 2DTYA 1CAVB 4YG6A 4EN9B 3A0KA 2ZPXA 4QMAA 3ZFGC 4JC1A 1J3RA 4JRLA 1WUVA 1DIWA 4HT1T 3VKMA 1WMFA 1PO12 4Q4V3 5FFOC 1VBC1 4K3UA 3ZN4A 4LHKA 3QH7A 3UK9A 3M3CA 2D6MA 2BPA2 4KNCA 1CPMA 2QVSB 1U5XA 1YRZA 3WD5A 2TUNA 1H4GA 2GU9A 2XH6A 3G6JB 5C9AB 5KHHA 5BNNB 1R083 1UPSA 4GH4B 1H2LA 3NW4A 5JMCA 3KCXA 4TWTA 4BWOA 5JSRA 3VBSC 2DU0A 5KHGA 1ZX5A 2W52A 1IS5A 1OKQA 3WG4A 2HEYF 1HQLA 3MZHA 1XYOA 2VW2A 3J8F1 4EROA 4PDWC 4KL1A 1NA1B 1COV1 5A32A 1SLAA 1MEC1 4KG0A 3VZOA 4YVWC 2AR6A 2WNUB 3WQ0A 2I45A 4FOVA 1FI2A 2K0GA 5JSOA 4P9WA 3FJSA 2MEV2 3ALQA 1D2QA 2HWB3 2ZMLA 3P3NA 2R6QA 1AHSA 3WG3A 1OA2A 1AR71 4LHLA 4HN0A 4Z1VA 2BVVA 3ATGA 1OLQA 3QCWA 1RUG1 4Y24A 5D1IA 2HWC2 1AYM2 1D2SA 3EO6A 5A3MA 4C1XA 5K8SA 1RUD1 1D0GA 2XL9A 4G9SB 3AYEA 4MH0E 4RHV1 3ZSKA 4Z8BA 5BNQA 3ST7A 4LNVA 1AR81 4WVMA 3HIFA 3WZ1A 5FO9B 4P5HA 2VOKA 1O5UA 1QOSA 1RINA 4FPKA 1LU2A 4Y26A 4DS0A 2VW1A 3I2DA 2XJSA 3ZFFB 4I30A 4S2GA 2R072 2VW0A 4BHPA 1XYNA 1ZVFA 3B02A 4AG4A 2XLAA 3RNSA 4DZGA 1NXD1 1Z7S1 3D6EA 4AE2A 4DINB 3FHIB 5H9QA 1WGPA 1UAIA 1VR3A 3ZXEA 4I2OA 1HXS1 1EP0A 1H8VA 1XXNA 2GC0A 3THPA 1R093 2D6OX 4PQ9A 2ATFA 5DUUA 2GH8A 1S0BA 4AHZA 1DQ1A 1W6NA 4IEWA 1S1AA 2EIGA 4I01A 5EJ3A 1TMF3 3ZXGA 4AEKA 3IIAA 4XEZA 3WG2A 1AL22 1AXKA 4GB32 3ZXDA 5CG9A 2RS52 4OFGA 1JXNA 2N7GA 3OYWB 4U36A 3LGRA 3CJXA 4RSUA 5FOJB 1Y3TA 3D5OA 1VALA 3SCHA 3HBZA 2IXKA 5GALA 4AEDA 3GZUC 1ASJ3 2RM22 1MS4A 2WWSA 3AKRA 2VMHA 4Z07A 3H3UA 3DGTA 3N36A 2WNVA 3WINE 1Z78A 2UWCA 3VDDC 1ENSA 2VPVA 3ZPYA 1JUHA 4HN1A 3DN7A 3QH6A 4GA9A 3OTFA 1H8TA 1PIV2 3BB6A 2R1BA 3WUCA 3RMYA 1SDWA 3OJBA 1ND3B 2XGXA 4XF3A 1PO11 4LBQB 1QQP1 4QT6A 1G9AA 3VBFC 1RUJ2 3WW2A 4XFBA 3VKLA 2BQPA 1RUC2 4YW1A 3PVOA 4AEMA 5FLJA 4M3CF 1UMZA 4G4FA 2DYCA 3C3VA 3L9JT 1LOEA 3EQEA 3MEPA 3WP4A 1QMJA 2XJUA 1YWKA 3MIEA 2IFWA 3W9AA 1ZZ6A 4WVWA 4YSFA 1LHUA 1RUF2 5F9TA 2NM1A 1DQ5A 2DVFA 1RJ8A 1ULGA 5FOBB 1X7NA 1VRH2 5IK5A 3GALA 1RUOA 5GLTA 2Q30A 4I0WB 2ETEA 1HQNA 4TLFA 2DVBA 4NPRA 1XNCA 1JYIA 2Q0AA 2JICA 3LKJA 1O4ZA 3JBG2 2WL1A 2RS32 2MEV1 3N7LA 2JG9A 1VBE1 4JRAA 2JXAA 4E4SA 4WZCA 3OY8B 3GF6A 2BYVE 2UU8A 2W68A 5D8AC 4KGGA 3AZXA 2LTNA 1V00A 4YNIA 1PK6A 3GNEA 1WA4A 2ZGQA 2RR13 3EXUA 4WM7A 1V70A 2GALA 4YZ5A 1F8VA 1WLDA 2ZTNA 3RJRA 1AXYA 4WVMB 5FAXA 1V6LA 3KS7A 1QXJA 1KJLA 2IWGB 3NV2A 3UKNA 4M0NA 4E9KA 2O8OA 2HWC3 4INDA 1CJPA 1AYM3 1LHWA 4QQ2A 2KA3A 2ZACA 5JWPA 2PQQA 2VG9A 2ZCWA 4P9IA 4AVTA 2VOXA 4CEWA 3AMMA 3MFCA 1CAXA 4LR4A 3JQXA 3MDPA 2ERFA 3SMHA 4QGMA 2VGDA 1SLTA 1KFXL 5I93A 1QJY3 4XMAA 1GQGA 1ZBE2 3VHNA 4COWA 1AX1A 3USUA 2WZR1 2R1DA 1C57A 4BQ1A 1NZCA 1OQ1A 3TAYA 5JPNB 2V5YA 2Q8OA 3AYCA 4QPGC 4CP0A 3ASIA 4YGDA 2HWE2 2R073 1DGLA 3R0RA 5JZGA 1TQ5A 2WA4A 3IKWA 2O1QA 4CDXC 1LTEA 1LHNA 4M3CA 2Q1MA 1UIKA 1ZZBA 2E7QA 2ET1A 5J48A 5KHKA 3USSA 4ZU4A 4HBNA 2EAAA 1DGWX 1WLCA 4YM2A 2ZGOA 3TNPB 3DV8A 2JE7A 2XJQA 2WNVB 4GB33 2GDFA 1NLRA 2ARXA 4YZ1A 2P2KA 3TWIA 3OCPA 5JAXA 5CAZA 2SBAA 1ENXA 4R8HA 1S2BA 1LGCA 2ZX4A 4N7UA 2BFUS 3J4UH 2UYAA 3M2MA 3TN91 1LHVA 2PHLA 3CU7A 4DY5A 4JTNA 2DF7A 2XWJB 3ZYJB 3ZYPA 4N43A 1RUJ1 1A8DA 5DZGA 4AHWA 2R063 1AR62 5I91A 1BQPA 2PHDA 1LEMA 1J59A 4Q27A 2B46X 1PIV3 1PGL1 5T5OA 4XDQA 3DL3A 4MYEA 4Q29A 4I0BA 1VBA2 4RGGA 3EHKA 3TYJA 2C0ZA 1F31A 4CEYA 1S0DA 2JX9A 1N1TA 1UIJA 4CYDA 2JDZA 1URXA 3B9IA 3O14A 4FOYA 2AENA 1UF2C 1RUC3 3IDCB 5ACA3 4KWJA 4LTAA 2KM2A 4I02A 2R042 4CDUA 5CA6A 2WS92 1VAVA 3KD4A 4HVOA 3JBG1 3WX5A 4JDOA 2WQZC 4LA2A 3ZFEB 2RS31 1OPOA 4IEYA 5DDJ2 4BZ4A 5KXEA 2XBO2 3MLJA 2QKDA 2WJSA 1RUF3 1UL9A 4H55A 1BVVA 2PHFA 4Q4X1 2DVGA 1CPNA 1RUH2 2A70A 1GZWA 1PZ9A 3D0SA 4GMP1 4YW5A 1G9FA 1BCXA 4YFZA 2EA7A 4OVEA 4PBOA 4NOTA 3M70A 4BMEA 3FUOA 4QPIC 1PK6B 1AR92 1RB8G 4OI0A 1MZFA 1LOBA 4LUMA 1QJX1 1VBD1 4BLJA 1K5MC 4JCKA 1MS3A 4GMP0 3BOWA 1DFQA 1CVNA 3JCIA 4FTBA 2A6WA 1HRI3 3OPZA 4XXAA 4EN6B 4QQLA 2ZX0A 1UW8A 1UX6A 1G9DA 4YZ2A 4BIFA 1CAXB 3G7DA 1O3QA 4RA0A 1S55A 3WDXA 4RS5C 1RUI3 3MICA 1U0AA 4A7YA 2VU9A 4Q0UA 1LESA 3Q9OA 4XBQA 3USUB 3WR0A 3S7IA 1CAWA 1J1TA 1RUE2 4D7TA 2XVLA 4Y1ZA 3E6BA 4LLFA 2NLRA 1YXWA 5FREA 4TYSA 3WOGA 1OQEA 1RJ7A 5JZGB 4CTEA 2UWBA 2OW4A 2W0XA 5DUVA 1B35C 1ZZCA 4YARA 5AFEA 4E4ZA 1YFYA 1R1ZA 1ZBE3 4M3CB 1DHKB 5CFDB 1OI6A 4AVCA 1Y7BA 4O9GA 5J96B 4AGGA 2FBEA 3POYA 1BXHA 1B09A 2XJVA 4Q1RA 1POV3 4YGCA 3NAPC 1I5ZA 3GYDA 5L7OA 2Z2SB 5BNPA 3MPPG 1ZBA2 1LCLA 4ATEA 5EV7A 1C8M1 1LOFA 5CG8A 4LBJA 4GXLA 2GC2A 4FPOB 2O8QA 1PO22 4IETA 1EAH3 2A73B 1V6KA 1FOD3 2PELA 4FPYA 4N9HA 4PLNA 1CN1A 3AZWA 4R52A 4CP1A 1N3QA 4SBVA 5C9AC 2ZZQA 5BNNC 3GBFA 4GH4C 4YVSB 3RRDA 2CGNA 4N43B 4N9IA 1AR61 1VIWB 4LUKA 5JOZA 4MZUA 2R0FA 4NHKA 4JGYB 3NWKA 2WT0A 2WFF1 1ULFA 3NV3A 5CIRA 1AL0G 3IN9A 4IV3A 2NQYA 3ZVXA 5J36A 1VBA1 4B8EA 1NA1C 2QFEA 1JOJA 3VKNA 3VZKA 2K2SA 4OHZA 2XJPA 4CEYB 2WNUC 2ZGSA 4AWDA 3V0BA 3ZXAC 5F5QA 1G8WA 3MFAA 3WQ7A 2RJKA 4XYXA 3AX4A 2R041 3PMEA 2WS91 4IEXA 4P9XA 4WV8A 4AQTA 2A71A 3NKGA 2ZGTA 1NG0A 3QOPA 3VUOA 3K48A 4HKWA 4KWKA 1H4HA 5HCFA 1I3HA 4Q0SA 5FMOS 2ZHKA 4J1XA 4XPVA 4XJZA 3I59A 3J8F2 1GZWB 1NCQA 3R4DB 3LWCA 1COV2 2HYKA 1MEC2 3V0AA 3ME2A 1AR91 4COYA 2F4PA 4FPGA 3ZXKA 2YHJA 1PZ7A 3FBMA 1EV11 3ZFFC 4AQ6A 2PLV1 3PHMA 2NZ9A 4FP2A 1RUH3 2DCKA 2Q4SA 3VL8A 2G9FA 1SQ4A 5ABJA 5A3LA 2ZGNA 5T5JA 3CF6E 4Q0QA 4EWDA 1WW5A 1FMD1 2PTMA 4NO4A 4MSVA 2GNDA 4K1ZA 3OD4A 1UU6A 3GBGA 2A5ZA 5BNOA 1RUD2 1ZZ7A 1HRV3 4QGLA 1RITA 4HETA 4B7EA 1AR82 4XFCA 4A2UA 2ZMKA 1KQRA 1CJDA 1LR5A 1O3TA 5IK4A 2E63A 2YC0A 3ZXFA 5FPZA 2HWD1 1CAWB 2Y38A 3H50A 2DU1A 3PJQA 2CGPA 3A4UA 1QJU2 1NE4A 2A6YA 5I8YA 3HR9A 1Z7S2 5IT6A 4S2DA 4RQPB 4Y22A 1BBT3 1OA4A 3IPVA 4D3WA 1RUE3 1HXS2 3ELNA 1QNWA 3R4SA 4L9BA 2Y0OA 1WLWA 1AYN1 4Y1YA 2B7YA 3JD73 2A6XA 2BTVC 2IXIA 5L7OB 2DCYA 1X82A 2R30A 1T6GC 4IXLA 2PHTA 3LA7A 3S0MA 5LRSA 2DUQA 1YIPA 1ND3C 2LUWA 1H0BA 4LE4A 4RL7A 2VOVA 3FMGA 4D7SA 1W6QA 3NV4A 1NY71 3VZJA 4Z92B 3BIWE 2IXCA 3OGJA 1VP6A 4YM1A 1G9BA 4Q1PA 4GWNA 5CADA 1G7YA 1Y43B 1TNRA 4LBOA 1HLCA 1O7FA 3ZX7A 1QU0A 1YJKA 2JD4A 5AC93 3B93A 5LEKA 2V09A 2P17A 3QACA 4IEQA 4R9AA 3U11A 5GZDA 5I8TA 3B7MA 1CAUA 4FCAA 4FTSA 3ZN6A 4ASLA 3KT1A 2WFPA 1Q3EA 1QQP2 1SFYA 2BEOA 1ULEA 2VECA 1DF0A 1AJOA 3SHRA 1V6IA 3HT2A 2ZHLA 3V0BB 4XJWA 1YFWA 1QH7A 2AZ5A 4WM8A 4EN0A 2BNNA 3E6DA 1QXPA 2PHRA 2W39A 1V6OA 4IERA 2VUAA 3SCFA 2RHPA 4KH9A 3ZSMA 3AZVA 3VBRB 2TEPA 2VUJA 3PNAA 1VBC3 3ILNA 4Y1VA 2CNAA 2E51A 5LK7B 3KB5A 1A6CA 1S2KA 2CWMA 4HKLA 3RJ2X 1NCQB 4E27A 1TEIA 5CVRA 5BV6A 1EPZA 1RHI3 2D43A 4F7ZA 5B2GB 1W39A 3RZZA 2E9QA 1QJZA 3ILRA 1LHOA 1VBE2 4HK9A 4N7IA 2ARBA 3L2YA 2YV8A 4XF9A 2P34A 1G6NA 3J8F3 1U5IA 3UJOA 3ES4A 1HQWA 1MEC3 3B69A 2ZMNA 3BOPA 5JDBA 4AGVA 4QPYA 2Z42A 4DRVA 1PVC2 1DU3D 2TNFA 1GICA 1NYWA 1X36A 2CGOA 1CD3G 3AFKA 4A7KA 3DF0A 2DFBA 1AR73 3RYKA 3KMHA 1O4YA 2A3WA 1OFSA 1X8EA 1RUG3 3WW4A 4O9EA 4ZXKA 5E8AA 5HI0A 3I54A 1MACA 4Q8LA 1QJU1 2D44A 1RUD3 3QD6A 4RHV3 2GC1A 4IQPA 2DUPA 3E5QA 2JENA 2HWF2 2XUMA 1AX2A 4W6YA 3VBHB 1N1VA 1BEV2 5BY5A 3H8UA 2WZR2 1RMU1 1XU2A 2V73A 3ZYIB 2WNVC 1DGRA 1R091 1RVF1 3GZAA 4AEJA 1G9CA 4FPEA 2VULA 4C0HA 1YI7A 1XNBA 3U10A 3M7AA 4MV2A 5T5PA 1Q43A 4B4PA 4H7LA 1Z7S3 2Y26A 1AJKA 1OHFA 2ENRA 5CNAA 1N3OA 3M3IA 2FZ1A 1HXS3 1W6QB 5T5LA 4BE3A 3WP6A 3JQWA 2EF6A 1UU5A 3JUUA 1QNYA 5J3UA 1ASJ1 1R1A3 5JI9A 4M01A 4AI3A 2R0HA 2A7AA 5H9RA 1OPMA 2D5FA 3B9CA 1QHDA 5H9SA 1C1FA 3ZO0B 1ENRA 1GR3A 1VJ2A 2UY8A 1JHNA 5EWSA 4UBGA 3AZYA 1A3KA 1QKQA 3TN92 1CAUB 3M8LA 1QWRA 4BIOA 4B4QA 5BUVA 2A6VA 1WCDJ 1ZNPA 4P9JA 3AFGA 3M3OA 4WVVA 3ZFEC 4XOGA 4WM8B 4CDWA 1PM7A 5JIUA 4K9SA 4HMZA 1FV2A 1D4M1 1PGL2 4XILA 5FO7B 4AI8A 3RYRA 4OUSA 3VLBB 1VB4A 4E2QA 3VGIA 1KDMA 3AMPA 1PO13 2AGSA 4YG3A 1QQP3 4ITCA 1PK6C 4KBBA 4H7MA 5J7MA 2SLIA 1REDA 4R9BA 3UJQA 4K6BA 5A32B 4EN8B 2ILMA 1NQJA 1LRHA 2DFCA 4YGEA 2PFWA 1JYCA 2JG8A 5H9PA 1YYNA 1SFNA 2PYTA 4M0HA 1YIFA 3W59A 4WBBA 4AFAA 1JW6A 4XXPA 1MS9A 3ETQA 4FQZA 4NHMA 2D97A 2HJIA 4XMIA 4Q4X2 3WDWA 1J3QA 2BFUL 2OYZA 2GN3A 3TOJA 1E57A 1XU1A 3OD0A 4AQ2A 5L73A 3CJIA 3VBFA 4L11A 1W6OA 2RR11 3THTA 1TME1 3WHTA 1XYPA 1QJX2 2P37A 1O91A 1VBD2 1PVC1 5AVAA 2MEV3 2UY9A 1VBE3 5AVPA 1LGNA 4QM8A 4FQ4A 5JZGC 1RTVA 1XQNA 4Q2FA 2UWAA 4XQDA 1CR7A 3U0ZA 4XF4A 2RMU1 1DLLA 3HQXA 3N35A 2DCTA 1W6PA 1H2NA 5KBFA 4LBKA 3RPQA 4AW7A 3I8TA 3AYAA 5DUWA 2EALA 3O5SA 4MUVA 4Q8KA 5LK5A 2HWF1 4M3CE 4FT8A 4FVVA 2XWBB 3N3HA 3ZIWA 1BEV1 1W0OA 4B3NA 2YYOA 1YHFA 3DPRA 2D98A 1W0PA 4PIZA 5SV5A 1W6NB 5C8CA 4FSJA 4J1WA 4OI1A 4YW3A 3IWZA 1YO8A 2QZ3A 2ZAHA 3QBQA 1FPN1 4IEUA 2XJTA 4Q0VA 1VAMA 3IDBB 5HCAA 1M06G 3MF9A 1LOAA 1OOPA 1UU4A 3H0OA 2WZR3 1V9U2 5BPXA 5FTTC 4YVSC 2JEMA 3U4XA 4N43C 3ENRA 3T1LA 3AP4A 3B94A 4JGYC 1ND2A 2MNGA 3HN1A 3KGZA 5JOYA 3WXPA 4AEDB 3FZ3A 2C5DA 4ISRA 1AL23 1QH6A 1C8M2 5KC5A 2D6PA 1N47A 2RS53 3MYXA 1QDCA 3LB9A 4OHYA 1YUDA 1H8TB 1PMIA 3FBYA 4CEYC 5FO8B 3FE5A 4FPJA 2HKXA 2RM23 4Q4Y2 1LODA 4LULA 3S7EA 1WBFA 1MVQA 1N1SA 4IV1A 4P14A 4XF1A 4FXGB 3AKSA 4QPGA 4K8FA 2WFF2 1WCKA 3V65A 4CDWB 3C2UA 4KG8A 1VAKA 4COUA 1PNGA 4OHWA 3TN93 3D82A 3PLQA 4CDXA 4F83A 3BPZA 3MW2A 3E97A 4JGZA 2RJLA 4C0BA 1FNYA 1RUJ3 2DV9A 2X8KA 5E1RA 1QOTA 4FAGA 1MS1A 1F9KA 4KU7A 3VBUA 1IPKA 1UCXA 2Z69A 1X50A 1C3HA 2XVGA 2DUOA 1EY2A 3URFA 5GZGA 2JG8B 2WT1A 3MW4A 4JDNA 3H3ZA 1SBDA 2D5HA 2JG9B 1SLIA 5KXCA 3BALA 4ZU5A 4HSJA 3FWEA 1VRH3 4MXVA 1Q8QA 5FQ0A 4N53A 3GZTB 4PF5A 1GFF2 1A8MA 2YY1A 1VBB2 2OUHA 3JB4C 4W65A 3CJIB 3WDUA 4WM7B 3JBG3 1WW6A 1IGOA 2RS33 3ZIXA 3IT8A 4PLOA 1F2NA 1EV12 2QJVA 4UW3A 4QQOA 2R16A 2IZWA 2PLV2 3KLSA 1OQDA 4L99A 5KHJA 2RS12 5C4WA 5L36A