1RUJ1

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj100
1BBT2 1BBT3 5L7OA 3JB4C 1RUH1 3DPRA 4RS5C 1NCRB 2RR13 1IHMA 1AR71 3CJIC 4CEYC 2R071 1MEC2 1ZBA1 1FOD1 2X5IC 1PVC2 1PVC3 2WS93 2WS92 2GSYA 4GH4A 3ZFGC 1A6CA 1PIV2 1PIV3 4QPIC 3VDDC 4RS5B 1RUH2 1RUH3 1RUD2 5BNNA 4CEYB 3CJIB 1AR73 2R072 2R073 4WM7C 4RR3A 2FZ1A 5JZGC 5FMOS 1ZBA3 4YVSC 1EAH2 1EAH3 1HRV1 5J96B 3ZFGB 1VBB1 1HXS2 1PGW1 2HWF2 3S6PA 4QPIB 5LK7B 5C8CA 3VDDB 5A32A 1ND3C 1POV1 4CDXC 3FBMA 1AR62 4QPGA 4WM7B 4FTBA 1D4M1 4CEWC 4Y5Z0 5ACA1 5JZGB 1VBC1 4JGZA 4YVSB 4Q4Y2 1HRV2 1HRV3 4AEDC 1RHI2 1MQTC 1VBB3 3CJIA 1PGW2 1QJY2 5L7OC 4Q4V1 1ND3B 1QJZA 2RS31 4CDXB 1POV3 1C8NA 2X5IA 3ZFGA 1D4M3 2FZ2A 5ACA3 1R081 1VBC3 1POV0 1RMU1 4GH4C 4AEDB 1MQTB 1ND2A 4CDWC 5C9AA 5L7OB 1QQP2 1QQP3 1RUE2 4Q4V2 1B35A 4Q4V3 1VBE1 2RS32 2RS33 3DPRB 3VBRA 1CJDA 3ZFEC 2RS11 4Q4W1 2DF7A 1BMV1 1R1A2 4RR3C 4WM8A 4FSJA 2PLV1 1PO12 1PO13 5CFDC 4GH4B 2R041 1ND3A 3JD71 5A33A 1AYM2 1AYM3 4CDXA 1VBA1 4CDWB 3NAPC 2HWC1 4CEWA 1C8M2 5C8CC 1RB8G 1VBE3 3ZFEB 4QPGC 2RS12 2IZWA 2RS13 4Q4W3 1VB4A 1BMV2 2HWB1 4RR3B 5DDJ1 1AR91 4JGYA 2RMU1 1AR81 4JGZC 2ZZQA 5CFDB 1H8TA 2R043 3JD72 3JD73 5BNOC 3IDEA 2RR12 1VBA2 1VBA3 4EJRA 2HWC2 2HWC3 5C8CB 1VRH1 5A32B 3VBOA 1AUYA 4QPGB 2HWB2 2HWB3 3VBSC 4FTSA 1AR92 1AR93 5DDJ3 1HX6A 4CDWA 4JGZB 2RMU3 1AR83 3JBG1 3VBFC 4IV3C 3LOBA 4BCUA 3ZFEA 1ND2C 1AR72 2WFF1 4Y4YA 5C9AC 4RHV1 2Y26A 5ABJA 1VRH2 1VRH3 1B35C 1SMVA 3VBHA 1RVF1 3VBRC 1ZBA2 2X5IB 1FOD2 1FOD3 4N53C 5CFDA 1Z7S1 1AYN1 4RQPC 3VBSB 1VB2A 4CDUA 4WM8C 2R061 1VAKA 3NAPA 1QJU1 3JBG3 4IV3B 1ND2B 1TMF1 5C9AB 2WFF3 4RHV3 1B35B 3VBRB 1RVF2 1ASJ1 1RVF3 2BUKA 1NY71 1NA1A 1Z7S3 3VBUA 5BNOA 1VBB2 4WM8B 2R063 4JGYC 5FMOL 1QJU2 1QJU3 1AL0G 1H8TC 5A33B 1DDLA 1COV1 1TMF2 1TMF3 3HAGA 3VBSA 1FPN1 4CEWB 1HRI1 1D4M2 2QQPA 3VBOC 5ACA2 2RS51 1VBC2 1ASJ2 1ASJ3 3VBFA 1NY72 1V9U1 4IV3A 3JB8A 4NWWA 4JGYB 1OHFA 1H8TB 1ZBE1 1CD3G 1COV2 1COV3 1AL21 4N53A 4PDWA 4RQPA 2HWE1 2WZR1 5ABJC 1FPN2 1FPN3 1HRI2 1HRI3 3VBOB 5BNPA 1R082 1R083 2RS53 3VBHC 1RUJ1 1V9U3 2MEV1 1RMU2 1RMU3 4RFT0 4CDUC 2BFUS 1NCQC 1RUC1 1ZBE2 1ZBE3 1VBE2 1EV11 1AL22 1AL23 1F2NA 4Q4W2 5AC91 1K5MA 2HWE2 2HWE3 2WZR2 2WZR3 2XBO1 5ABJB 1RUG1 4NWVA 2PLV2 2PLV3 3VBHB 1R091 1OOPC 1RUJ3 2MEV2 2MEV3 1NA1C 4Q4X1 2R042 3VBUC 4GMP1 1OPOA 3ZFFA 4CDUB 1E57A 5D8AC 5J98B 1MEC1 3NAPB 1VBD1 1RUC3 5K0UA 3TN91 1EV13 5AC93 2XBO2 1PO21 2XBO3 5DDJ2 1RUG2 1RUG3 2RMU2 1AR82 1HQNA 1OOPB 1R093 1R092 1NA1B 2GH8A 4Q4X2 4Q4X3 3VBUB 5BNOB 1RUD1 4GMP3 5D8AB 1MEC3 4YVWC 1VBD2 1VBD3 2VQ0A 3M8LA 4CDQA 3TN92 3TN93 4GMP0 1EAH1 4PDWC 5C4WA 1X36A 1PO22 1HXS1 1PO23 4Z92B 5BNPC 2HWF1 1NCQA 4LLFA 3VBFB 5FOJB 1FMD1 3JBG2 5GKAC 1RUD3 1AR61 1RUI1 5CFCA 4IV1A 2WFF2 4YVWB 4RHV2 2TBVA 1OOPA 4Q4Y1 4N53B 3ZXAC 4PDWB 3J8F1 1Z7S2 4RQPB 1RHI1 1AYN2 1AYN3 1K5MC 1NCRA 1HXS3 1PGL1 2BPA2 5BNPB 5D8AA 1M06G 2R062 2HWF3 1QJY1 1NG0A 1FMD2 1FMD3 2ZAHA 1W39A 1AR63 1RUI2 1RUI3 3ZFFC 2RM21 2XPJA 1GFF2 1RUF1 5K0UC 2HWD1 4N43C 4Q4Y3 3J8F2 3J8F3 1K5MB 1RHI3 4RS5A 4CEYA 1PGL2 1QJY3 1QQP1 4YVWA 1RUE1 2ZTNA 3DPRC 3ZFFB 2RM22 2RM23 1F8VA 1R1A1 1RUF2 1RUF3 5K0UB 1WCDJ 1X33A 1PO11 4CDQC 4N43B 2RS52 4QPIA 2HWD2 2HWD3 1V9U2 3VDDA 1AYM1 5C4WC 4WM7A 1BEV1 1QJX1 1C8M1 1RUE3 4SBVA 5JZGA 4FTEA 2WLPA 4GB31 5BNNC 4YVSA 5CFCC 4IV1C 1TME1 1R1A3 4CDQB 1BBT1 1RUJ2 5C4WB 1NOVA 2RR11 1NCRC 1BEV2 1BEV3 1NCQB 1QJX2 1QJX3 1C8M3 1RUC2 5BNNB 4GB32 4GB33 4N43A 5CFCB 1EV12 2BBVA 2WS91 1PVC1 4IV1B 2BFUL 2WWSA 1TME2 1TME3 1MQTA 4AEDA 5AC92 1PIV1
chains in the Genus database with same CATH superfamily
1S55A 1WW5A 4AE2A 3IKWA 1PX3A 1O59A 2ZABA 4YYOA 4FFGA 1TNFA 2VTXJ 5A70A 5I0TA 2RR13 1XB9A 4OI2A 3CJIC 1UYXA 3SKJE 1OH4A 1W8NA 3ZVXA 5HCBA 4CP0A 5FKCA 4J1XA 1JZ5A 2VW1A 4MSVA 5FYCA 1VJ2A 3LB9A 4YG0A 2E26A 1QY4A 1PVC2 2WS93 2JDYA 3AKSA 3WR0A 2A73B 1REDA 1WMFA 2VGDA 4JKKA 1UZVA 4QGNA 1LENA 1RC6A 2RJKA 2Y6LA 4GWMA 4QDRA 1PIV2 5A3MA 1LOAA 3IIAA 2VPVA 2UU8A 3IT8A 3ZN4A 3EHKA 3X29B 3BPSA 1HV1A 4MXVA 4FPGA 5BNNA 3E1F1 2XHKA 1AR73 2D7FA 3WW4A 2R073 2EF6A 2ZEZA 1I9RA 2ES3A 3O14A 4NJ4A 5LB6A 4RR3A 5FPXA 2B39A 4AXOA 1Q56A 1OF4A 3HIFA 2HYKA 1N1TA 5BNQA 4OHYA 3T30A 3K77A 5FLHA 4OUEA 3RS6A 4QX8A 4Y5TA 3ACFA 1UY2A 2ZGPA 3PDQA 3I2IA 1HXS2 2QCSB 2JWPA 2VOXA 2TEPA 2GDFA 2NPIA 2XLAA 3UESA 2YPJA 4M3CF 4XW3A 3DF0A 4QPIB 1A8MA 4NPLA 4BB3A 2RDSA 3WNXA 2EVXA 3MLJA 2XKPA 1V6OA 1XE8A 4D3WA 2J1RA 2BJSA 4CDXC 3CZUA 3FBMA 1CPMA 3LEIA 1W6NB 4PF1A 3ZYRA 4CU8A 1IS6A 1AF9A 5GLTA 3GBGA 2ZOEB 4RD7A 4CEWC 2FDGA 5FP7A 3QH7A 2EIGA 4XPVA 3RPQA 3RQ0A 3KT4A 3H0OA 4Q29A 3TNPB 4BXFA 1IKQA 2VL4A 5FJKA 1HLCA 3ROUA 2W92A 3V64A 1HRV3 2F4LA 5EYYA 2XJSA 3T2TA 4NVPA 4XTMA 3CJIA 4FOVA 3F2ZA 3J9SA 4CCKA 5A3WA 5GZFA 3ZLIA 4S2FA 1TZOA 1KGYA 1LOEA 5DAWA 1QJY2 2K0GA 2P2KA 1IS4A 1BZWA 4Q4V1 1ND3B 4GQ7A 3T0DA 4O9EA 1GU3A 1POV3 4IETA 3ZYHA 1C8NA 1DBNA 1OD3A 4XJ8A 3EJKA 4JRLA 1UX7A 2C1FA 1BVVA 2C9KA 4RL7A 2JDKA 1DLLA 1ODNA 4FBFA 2VO5A 1R081 3BGAA 4QB6A 1NXD1 1UMIA 1VBC3 5F6KA 4JAAA 4QXKA 4NAOA 3FC0A 4Y5SA 4FPFA 1RMU1 1WCSA 1W0OA 5JPNB 3AVSA 2R6QA 3RDIA 5IHRA 2AEZA 2W2IA 4LITA 3ME2A 2YC2A 5FZ6A 1QOSA 1RJ8A 5KHIA 3GHMA 2HBTA 1CR7A 1WZXA 3I54A 4X6QB 4XUOA 3FLPA 1HN0A 1RUE2 3SCHA 2A6YA 1B35A 1QDOA 2W1WA 2ZGRA 3N9MA 4I0BA 2RS33 3KT1A 4BH9A 5C3QA 1C4RA 1PMIA 1GQHA 2IXHA 2Q8EA 4A6SA 2DU0A 2RS11 2O8OA 5F3GA 2R0FA 3SC7X 4N90A 1DIWA 4UOJA 4LBKA 4LOTA 4W6YA 3U75A 2D97A 3I3BA 3POWA 5A33A 5B2GB 1OQEA 4CDXA 3BYWA 3DCQA 3PMEA 3AL6A 4A45A 4LXLA 4AFAA 1YNAA 1CJPA 3NAPC 4B3NA 4CEWA 1C8M2 1VBE3 4XF1A 4QM9A 3ZFEB 2NN8A 4BQ1A 1WLCA 4JCKA 1VB4A 2JDAA 4LBQA 1ZM1A 2HWB1 1ZRCA 4RR3B 1AR91 4B29A 4LUKA 2CDPA 2YC4A 4Q26A 2RMU1 1AR81 3U07A 3OD0A 2VMHA 2Q4SA 4BIOA 2ZZQA 4DMIA 4BK4A 5FZBA 2R043 3ZYIB 5BNOC 3BB6A 2P34A 1VBA3 4QX5A 2ILMA 1US2A 4EJRA 2ZACA 3LFMA 1WLTA 2HWC2 3VD7A 3GM8A 4XMAA 2YU2A 4AHYA 1XSRA 1DG6A 1OA4A 1OSGA 1WCKA 4Q5OA 5EPAA 1UF2C 4NPMA 3LKJA 2WRAA 3ZSKA 5F2SA 3NV1A 1JU3A 1HB1A 1OLME 3H7YA 5LA1A 3KHCA 4FTSA 2D44A 5DDJ3 3ZYFA 1I1EA 4B4QA 5DUWA 5KXEA 3BKZA 2RDRA 3C7GA 4QWNA 3CBNA 4GZ9A 2JKBA 4QM8A 4PBPA 1OXCA 3KD4A 2SLIA 3CO2A 1V6KA 3EB7A 4AI1A 4ASLA 4XXPA 5FZHA 4HN0A 4EYUA 1UOBA 2ETEA 2AYHA 4RHV1 2OIIA 2Y26A 3HR9A 1VRH3 1SLAA 3INAA 4IEWA 1PVXA 1MZFA 1SMVA 2P3YA 2E9QA 1ZBA2 1GICA 1MVQA 2CWMA 4GWIA 2R0HA 4MADA 1GP5A 2R16A 4A3ZA 2Q5TA 1OH3A 3VHOA 1UY0A 3H50A 3CDZB 1F31A 1TEIA 2P3JA 2TNFA 3NAPA 4IE0A 2WT1A 3JBG3 1CIWA 4IV3B 4TN7A 1A8DA 4K7JA 3RZKA 5CG9A 1PGSA 1LGNA 1QOOA 1TMF1 2WAAA 5JR2A 1GOFA 2WFF3 2FBEA 3KWVA 1GUIA 3IDBB 3PUSA 1B35B 2WQ4A 3Q8AA 4BWOA 3C8XA 3I2FA 3O12A 1WMXA 3V65A 1RVF3 1CESA 4Q2FA 1NY71 1CZVA 4HVQA 3KV4A 3RRDA 3TB0A 5LA9A 5BNOA 1K3IA 2G19A 4XJUA 1AVBA 4FI9A 1NQJA 1VBB2 5EFUA 2VULA 2R063 2WINB 4OLLA 2D3SA 5FMOL 3VDBA 1QJU2 2XB6C 3NMBA 3D3AA 4MLOA 2GC1A 5FKBA 2X05A 5K8SA 5A33B 1YFWA 1DDLA 3PVBB 3ON7A 3W58A 4LR4A 1ALYA 5FUNA 2P6HA 3HAGA 2OQ6A 5CKQA 1FPN1 5LBCA 1HRI1 4CEWB 1CZSA 5ACA2 2QQPA 1W2TA 3K46A 2XDVA 2GAUA 2YGMA 2B42B 4E27A 1ASJ3 3E5UA 4HANA 2A6ZA 4PBOA 4R52A 1SLLA 1AX1A 2BEOA 4I01A 4L0PA 3RI9A 5FIXA 5AVPA 3D4KA 4URTA 1YYNA 4OZXA 4YGDA 3HN3A 2PHFA 2ZMLA 4LHLA 1S2BA 4QQOA 2Q8CA 1Y9QA 3WW2A 1JOPA 3AL5A 5BXXA 4FP2A 3OBAA 4R9CA 4UW5A 3GCWA 2BP6A 5A3OA 4YSFA 1AX2A 2FCVA 2FMDA 4A7ZA 4YG3A 2RJ2A 1GWKA 4CU9A 2KD7A 1AL21 3USSA 3KB5A 1JBCA 2R1DA 2W1UA 5LY2A 1O91A 2HWE1 5FPVA 2XJQA 1MS0A 5ABJC 1O3RA 1SPPA 2PELA 1XPWA 4WVVA 3HT1A 1R083 4I3PA 5FYSA 4IE7A 2DUQA 1SLTA 3H3UA 1V9U3 2MEV1 2VCMA 3LD8A 3L9JT 3CZJA 4ES8A 4LK6A 2H0VA 1LJ7A 1RMU3 1ULGA 1EY2A 3QOPA 1NZCA 3BN6A 2A71A 4CDUC 4DXZA 2CTVA 4C8DA 1E5SA 3A23A 1W06A 4M3CA 2JE8A 3VD9A 4IEUA 3N7JA 3KQ4B 1H6XA 3AZZA 2XLGA 5KWRA 1NLRA 1MS9A 3NVCA 3NL1A 2XVGA 4ZY9A 4BPZA 1H1MA 4XJ9A 2YPDA 4CRQA 1F2NA 4Q4W2 1JZ3A 3BUCA 5AC91 3FHAA 1ZZCA 2WZR2 2XBO1 4HONA 4YZ5A 4ZXEA 1ZRIA 2GMMA 1IS3A 1RUJ3 1DGWX 4URAA 5HXVA 2GMPA 4Q4X1 2A6XA 1YQ6A 3MIBA 3D82A 3FE5A 3WW1A 2WQZC 5D8AC 5J98B 2BYVE 1K42A 3NAPB 5H9PA 5F3EA 4MGKE 1SFNA 2ZX1A 4QX2A 5FZ1A 5F6LB 1RJ7A 2FMYA 3VGIA 5JSRA 1PM7A 1F4HA 4LO8A 5KHJA 4IE4A 4LHSA 1W9YA 2XJPA 3QD6A 3R05A 3V56A 2QQWA 1J1LA 1ENRA 1RUG3 4COUA 5GZCA 2QQLA 1P8JA 1WWYA 2Z4FA 1HQNA 1R093 4X8NA 2JG9A 2LROA 4P14A 4D7TA 4ISQA 5BNOB 4R8HA 1DLCA 4BHPA 4JHTA 5IFTA 4HG6B 4AAPA 1IG3A 4ITCA 2YB7A 4QPWA 5LASA 1C5IA 1SBEA 5T50A 2YFZA 5EWSA 4CP2A 5E8AA 5CAZA 4QQ2A 1VBD3 3E6CC 2XHNA 1GP6A 1K5JA 1OLQA 4AHZA 4LE3A 2ORXA 2BTVC 3TN93 3MW2A 2BBAA 2WYSA 4YM3A 3WQBA 1EAH1 4FPCA 3D6EA 2C26A 4AI9A 1E5IA 2VUDA 4K8RB 4R4XA 1D0GA 5C4WA 1PO23 4FOQA 5C70A 5JSOA 4OMCA 5LRSA 3H8UA 4TSVA 4XDOA 5BNPC 3A4UA 1FMD1 1U5XA 2ZGUA 4OYUA 4HL0A 5GKAC 3TNQA 1SFPA 4YZ1A 4EN7B 2QFEA 4LA2A 2E63A 2SBAA 3AMHA 2NMOA 3I3MA 3OPTA 4XURA 1IS5A 1LOFC 2TBVA 2QZ2A 2QZ3A 3ZXAC 3B5LB 5C6CA 1K5MC 4HETA 1HXS3 5HI0A 1SPPB 5TSWA 4JKMA 4QX3A 5D8AA 3NJZA 3VZOA 4Q1PA 1V6NA 1UXXX 2VOKA 2JDNA 2Q30A 2WO3A 5M0TA 4IE6A 3MIEA 4HK8A 4FPLA 4JTOA 4YNIA 1RUI2 2ERFA 1JN2P 3WDTA 3ZFFC 2HKXA 3E97A 2RM21 1HV0A 1O4ZA 3ACIA 2D98A 1LGCA 2CHHA 4Q0PA 1GFF2 1W28A 5FYUA 2YDEA 4XOGA 3EYPA 3H3LA 2B46X 3FBYA 4D0QA 3MF6A 2JD4A 4BQWA 1ULEA 3OGRA 1LOBA 4G4FA 4RS5A 3AXDA 3HQRA 5LA2A 3K4ZA 4R4ZA 5A3NA 1O5LA 1PGL2 3HNYM 1JYNA 1DQ0A 2JECA 1QJY3 2OUHA 4COVA 1LGBA 3KVBA 3WNKA 5FBJA 5L73A 1RUOA 2CL2A 3N9NA 4LOSA 3AFGA 5FPUA 4E9KA 2D6MA 1JZ7A 3LIHA 5C7GA 1REEA 1F8VA 3I2HA 5K9YA 4UBHA 5HPOA 1J83A 1X8EA 1RUF3 4QHBA 3POSA 1U5YA 1DYPA 1STMA 1XXNA 2VUAA 3AZWA 1QXRA 5FYZA 4N43B 4DXRA 2HWD3 1Y43B 5FXZA 3VDDA 4OVEA 5A6ZA 4Y24A 2VOTA 5HV0A 1VR3A 2WABA 2WAOA 1BK0A 3WF2A 5IVYA 1WW4A 4CE8A 4E4SA 4INDA 3LEMA 1RUE3 4SBVA 2JG9B 3PU3A 4QDQA 5JZGA 2D43A 3N9OA 2WLPA 2XVKA 3I59A 4KI5M 2B9VA 2VMDA 3GZEA 3KMHA 4OMDA 1JYTA 3OOXA 3U4XA 3WG1A 5IAXA 1VMJA 3I8TA 3OPWA 4Y1UA 5IVJA 3D5OA 3DGTA 4NHMA 3O1MA 2E51A 4QQHA 4Z82A 3V0AA 2CY6A 5C4WB 5HV4A 2O14A 2RR11 1UOGA 5A3PA 1G9BA 1DP0A 2OXBA 3RZZA 4KGGA 3KZ4C 5K7PA 4PLOA 5KXCA 4Q0UA 2HH9A 1QJX3 3THCA 1C8M3 1RUC2 3ILNA 5C33A 2OUJA 4B8EA 2VVEA 4GB32 4XXAA 1MZ5A 1YO8A 3ZXLA 2BBVA 1EV12 3VKFC 2WS91 4MHUA 3ILFA 1QF3A 4GJYA 4AEDA 5EHDA 1F5JA 4LEJA 4NRPA 4UAPA 1IQDC 1W8FA 2BVBA 3CMGA 3HWJA 3LPGA 1BBT3 5L7OA 2HEYF 5APAA 2A75A 1CQ9A 4XTPA 1A78A 2WO7A 4GIQA 4W65A 4XUNA 4DFSA 5IVFA 5I8TA 1W2UA 3WF1A 3B7MA 4LHNA 2ZA9A 1AR71 3B93A 2R071 4DRVA 5FTTC 4DY5A 5FYYA 3POBA 1G9CA 2CGPA 1MPXA 1WD3A 3E5QA 1SBFA 1ULFA 3LDBA 4QDSA 2WWJA 5T5PA 3UETA 3WNLA 4FFHA 5F39A 4CCLA 4IE5A 3AKTA 4GH4A 3LA2A 1WA4A 3M3EA 3MLKA 4L9BA 3VZMA 2JB8A 4AEJA 1VALA 4QPIC 3MIFA 2ZX3A 4LKSA 4LUMA 3ZN5A 3AX4A 4FPYA 2G9ZA 1DZQA 4FPOB 1RUH3 2BERA 2IVIB 3BPZA 1RUD2 2Y34A 1YFYA 4RS5B 3AM2A 2VJXA 4HT1T 3VKNA 1LEDA 3I2GA 5K4LA 3LDRA 2AGSA 2OPWA 3THDA 1KDMA 1JZ6A 1JZ2A 1JOJA 1QXJA 2FZ1A 1FXZA 1ZBA3 4YLZA 1ST8A 3M3QA 1EAH3 1YI9A 5GLVA 1HRV1 3ZFGB 2IXKA 4XFHA 4AAXA 4CA9A 4YZ2A 1T6GC 2A6VA 3PTRB 2DBIA 1UIJA 2DU1A 4MYEA 3S6PA 2WNUA 1LU2A 1OLRA 3KVAA 5C8CA 3VDDB 1ND3C 3N9LA 1POV1 1UOJA 2HLEA 3O1PA 4QPGA 4BQ4A 2WZEA 4FTBA 3VZJA 2Y6JA 3KV6A 3KCYA 5HCFA 5CISA 2VQTA 3AJZA 4UI9L 2E53A 4Y5Z0 5JZGB 5JCTA 3I59B 1VBC1 3VUOA 1U5ZA 4HBNA 3HNBM 3THTA 2NYYA 3QBQA 5FK7A 4QQLA 5F5AA 1VBB3 3J7NA 5F3IA 5FYBA 2DTYA 3T0AA 1HQWA 2H6BA 1W2NA 3V0AB 1QJZA 2RS31 2ZXQA 1H2KA 1JS9A 2PQQA 5F9TA 1MZEA 3TEYA 1J59A 3RFRA 4LO5B 1UY3A 2X53S 5FR3A 1UCXA 1S2EA 2B8MA 2XONA 3SEPA 5B4NA 2GH2A 5SV8A 3MHZA 4C1XA 2DCZA 5ACA3 1JMUB 4EN6B 1XC6A 2KXLA 1UMZA 2P3KA 2ZGOA 3N7KA 2NP0A 1UKRA 2VQUA 3I3QA 1POV0 3OD4A 4IDZA 3OCPA 4EROA 2ZEYA 4M4PA 4AEDB 4XQ4A 1E5RA 4NMIA 1FX5A 1ND2A 3O7OA 2Q8OA 4AWDA 5T5LA 3APBA 5C9AA 5L7OB 3MPPG 4HZFA 1V6JA 2WSVA 1QQP2 3R4SA 5FYMA 5LZ6A 1JHNA 3GZUC 1W8TA 4Q4V2 1VBE1 2RHPA 5L9VA 3MI8A 3AKQA 3UKNA 3GBWA 3ZFEC 3DV8A 4WZFA 1XNTA 2V73A 1GMMA 1LHOA 2DF7A 3GXUA 1JZ4A 1S2KA 3BODA 2C0ZA 5FCCA 4RR3C 2YZ4A 5EQUA 3FN9A 4WM8A 3VBOA 1WUVA 3RI8A 1JYCA 1PO12 4IEYA 2J1TA 3QLQA 4ES9A 5BPXA 2PHTA 3WVJA 1O7FA 1OT5A 3MIGA 4GH4B 1SQ4A 2R041 1ND3A 2HBUA 3B00A 4KBZA 1AYM2 3HQXA 1QOTA 1ODMA 1APNA 1VBA1 2E7QA 1DYOA 3PUIA 4D7SA 4LBJA 3WDYA 3MBWA 4KWUA 4P5YA 4QB2A 2V4VA 2WR9A 1CIYA 3ECQA 3ZPYA 4BQYA 5FBZA 3KT7A 4JDMA 1RB8G 3MPBA 1NX9A 1XOYA 4H7LA 3LAGA 3GYDA 4MH0E 4E2GA 2WNVA 2ZMNA 2RS12 2IZWA 4Q4W3 3ZYBA 3AC0A 5IATA 2WUHA 5DDJ1 3LOIA 1AXKA 4AZZA 5A80A 2XGXA 4NR1A 1KD7A 2D6OX 4TTGA 1ONAA 5H9RA 4XIKA 4FQZA 5FYHA 5CFDB 1X8MA 1J1TA 1L7RA 3CNAA 3OPZA 1JODA 1JUIA 5FZ9A 3JD73 5FZGA 5KHHA 3MFAA 2LALA 1F9KA 4XACA 2QVSB 1O6UA 4Y26A 4BA6A 5IK7A 1UY4A 5J48A 2WNUB 4XFBA 1DU3D 4A41A 3E6DA 1W2AX 5C8CB 1VRH1 3IBMA 4UXAA 2JXAA 5AVAA 2FDJA 4GWJA 2O0OA 3B69A 4KMQA 4BIFA 5JDBA 1AUYA 4QPGB 2QTWB 4KNCA 3POJA 1C1FA 5AC93 1ZRFA 3WX5A 1URXA 1GZWA 1YIFA 2HWB2 2WFPA 3ZSJA 5JSPA 1AR92 4BQ2A 2E31A 2VC9A 4AI2A 2J7MA 2ZEWA 1NYWA 1OQDA 3QACA 5B4XA 1G9AA 3T4HB 1OQ1A 3JBG1 3VBFC 4IV3C 3RYRA 1Q8QA 3S30A 1DF0A 3ZFEA 4KG0A 1FATA 3LFIA 4FO9A 3DKQA 4L11A 1DZRA 2WFF1 4H2AA 4XYXA 5EYXA 4MGIE 3THPA 4M4RA 3WDXA 5EIYB 3U10A 1Q8PA 4LLOA 3NV3A 1B35C 4CTEA 3MEPA 5JLVA 1RVF1 1HB3A 1FOD2 3NNGA 1D4VB 3UGHA 3MUY1 1AYN1 2X29A 3VBSB 4OUMA 1W3XA 3S7IA 4IUGA 2V4AA 3T3YA 2R061 1VAKA 2I2SA 1YRZA 3MICA 1QIQA 4XUQA 3GF6A 1XSQA 4AVCA 1X7NA 3RJRA 3ABZA 4QXHA 2YROA 3ZXKA 1UPSA 3O1TA 1ND2B 3U1XA 2ZBJA 3NRUA 2XXZA 2E33A 5C9AB 4TLFA 4AEKA 2LRPA 2VXJA 3UGFA 3FLRA 2NMNA 3SH3A 1SCRA 4NRMA 1EYBA 1YLLA 4FT8A 4HVRA 5BUVA 4MX3A 4E8DA 4LE4A 4LHKA 2BUKA 1ASJ1 4ARYA 5C3OA 3TBDA 1MVEA 1TG7A 2WNOA 1NA1A 3KM5A 3VBUA 2WA4A 1ACCA 5LEJA 3R6SA 4WM8B 3P6BA 1QWRA 3OYWA 5FZDA 3AKPA 1ZA7A 4UFJA 4LPLA 2XLFA 1UOFA 1AL0G 4YPJA 5CYYA 4NIAA 5L36A 3UJOA 4A4AA 3PHMA 1YUDA 3IDAA 5F5CA 3EQEA 3WOGA 1TMF2 1C28A 4W4ZA 3GGLA 2VZOA 5LRRA 3TOJA 2OA2A 2WWUA 3J7LA 2W1QA 1D4M2 5FAXA 2YMZA 5SV5A 1UWWA 1AXZA 3AP6A 3POYA 2BVVA 1QMJA 2G9GA 2WNVB 3FHQA 3VBFA 1NY72 1V9U1 4IV3A 2XR4A 4FPJA 4DUVA 3ZSLA 1LNSA 1LODA 2OZJA 1IGOA 1IKPA 3DN7A 2CAVA 3C7HA 1YC61 3UJQA 5FJHA 5FMBA 4IL7A 3WQ1A 2OW4A 4JDNA 4P9LA 4H14A 4V1PA 2HEVF 2XOMA 4MV2A 4X6RB 4UFHA 1COV3 3FMGA 2PTMA 3NNFA 3BTYA 1FPN2 1HRI2 5T3NA 3VBOB 2VZRA 2DUOA 3PJQA 4XZUG 2V5YA 4LO6B 3NJVA 4CCOA 5IK4A 4H7MA 1W05A 1RUJ1 5DG2A 5A1LA 1W90A 1S0GA 4PJYA 4RFT0 1GZWB 1KFXL 3WHUA 5FDBA 4AFCA 3N4MA 4A7KA 3K75B 3MLLA 1UYPA 2AEYA 1WD4A 1Y4WA 2JJ6A 1W6OA 3PMSA 2A3YA 2EIEA 1ZBE3 1W8UA 4ZU7A 4L92A 4OI4A 4QHZA 1AL22 1L7QA 3VHPA 5JXJA 1TNRA 2Z79A 4AEMA 4D6RA 2HWE2 3WG2A 5KXDA 3KF5A 3FX3A 4R9DA 1RUG1 1ZZ8A 3LEGA 5DMYA 3K4AA 1PM4A 2PLV2 5KHKA 1VPHA 1R091 4QGMA 2WDBA 2VAUA 5FP9A 2MEV2 2QQIA 1W8WA 1AXYA 1IPJA 1T6BX 2VZPA 2YFUA 4YM2A 2BDRA 3IAPA 4HFSA 1VBD1 2QQJA 1RUC3 5C71A 2K9ZA 5FZOB 4Y1ZA 4RFRB 3O0WA 4MGTA 2DDUA 3TN91 2XJTA 4ZZ5A 2OT7A 2AREA 1EV13 4AI3A 2KM2A 2XL9A 1W2OA 2NZ9A 1UPIA 3HNMA 2ENRA 2XBO2 1PO21 3OSDA 4XCBA 3LPFA 1JYIA 2YC0A 3S0MA 2LS6A 3SQOA 3W59A 2QE3A 3SKVA 1KFUL 2MPFA 4GKYA 1NA1B 2PHDA 2Q1ZB 4XVHA 2GH8A 2VR4A 2VZ3A 2VECA 4Q4X2 3VBUB 5FPBA 4GMP3 4HPKB 3NQHA 3KHBA 4P9YA 3KS7A 3OYWB 4YWAA 5KXBA 3WXPA 3N9PA 1W9TA 1ZX5A 2BQPA 2WQ8A 1HW5A 3LSEA 3R4DB 4AVAA 5I93A 5IK8A 5A1FA 2RJLA 1QHDA 3Q9OA 3LCPA 1GNYA 1ZYBA 4E4ZA 4PIYA 3SLIA 1X36A 1HXS1 1S0JA 3H1YA 2YV8A 3CIHA 5C5TA 3GZAA 4B4RA 2VQAA 3B94A 1X9PA 3VBFB 1YFUA 3H8XA 4AGVA 4V2VA 1D2QA 1RUD3 3POEA 4QHOA 4UYBA 5FZAA 3M3OA 3VKLA 1YJLA 5CFCA 1OF3A 4YVWB 2DVFA 1MS5A 1UMHA 4W50A 4DZGA 5FZIA 3ZN6A 3PUAA 4QB1A 1H9PA 3HVDA 3WCSA 2Z2SB 5AFBA 2ARBA 2EICA 4CPBD 5DUXA 2WT0A 3DKWA 1Z7S2 4NIDA 2O1QA 1AYN3 3FZ3A 4WZCA 5D21A 3ZXFA 2ZKLA 3PURA 3OB8A 1QJY1 1NG0A 2GNBA 2JEMA 4CU6A 1FMD2 5LBEA 2UWBA 2W0XA 4NIGA 5G04L 1CONA 4K40A 4MGZE 1VMFA 5IFPA 4HKWA 3LE0A 2ZGNA 4DOUA 5KR7A 2PHWA 2W95A 2W5FA 4UT5A 1UD1A 2W39A 1W6OB 1RUF1 4L8QA 3A0NA 2GNDA 1UAIA 1OKOA 4S2HA 4TLGA 2HWD1 4N43C 3WCRA 3B3QE 2ET7A 2R30A 2CAUA 3J8F3 2IWGB 4RYDA 5IYYA 4DINB 4PLMA 4E2SA 2ZGTA 4CEYA 4Z8BA 1NKGA 2YBKA 2VNRA 3ACGA 4UFIA 1JZ8A 1S0CA 2D6PA 5A6XA 1RUE1 2ZTNA 4OHWA 3OY8A 1OURA 2JG9C 2XG3A 4YW4A 3DPRC 3WNPA 3RJ2X 1UU6A 3VKMA 4KH9A 5BY5A 3TWIA 1X50A 2RM22 4XUPA 4UFKA 1TE1B 3PL0A 3SEEA 2Z5WA 1D2SA 2VW2A 3FL7A 4B7EA 3UNPA 1LKNA 4META 1KS4A 1WCDJ 3OEBA 4RGGA 4W6XA 4IEXA 5HCHA 4OQ9A 3PVOA 1TVGA 2RS52 4LIVA 3NJXA 4CUAA 3G6JB 1YQ2A 3U78A 2PHUA 1FAYA 4A7YA 5C4WC 2VMFA 1LOCA 4K9SA 4WM7A 3WG4A 4BYYA 1JXNA 1QJX1 1C8M1 2E7AA 1HDKA 1I3HA 4FTEA 3GALA 4XDQA 5DAXA 4ZKTB 3ITQA 2W87A 4FOWA 3N9QA 4YVSA 3U4SA 4DS0A 3NV4A 2D5HA 3DXUA 4BQ5A 3FUQA 1GANA 1UX6A 3PJYA 1Q8OA 5FZ8A 1Q3EA 4TXWA 2KA3A 4Y1VA 4COWA 4Q8KA 1S0EA 1WCUA 4XQWA 1O3SA 5CA6A 1BBT1 1UO9A 4LNVA 4M3CE 2VMCA 4DRRA 1J3QA 1KQRA 2WA3A 1UKGA 2ADEA 1F4AA 1BEV3 3IPVA 4CUBA 1UN1A 2Y6KA 3PIJA 4R9BA 1Q8SA 2BWCA 5CKMA 4ASMB 1WLDA 5CZKA 2DVDA 2C6SA 4N43A 2L9LA 1PX4A 3O1UA 5DXDA 5CFCB 2BFUL 2DVBA 1TME3 1MQTA 2B45X 3HD8B 4AI8A 4IEZA 2ZHMA 3ZN6B 4OQ8A 5F7UA 4H55A 2VOWA 1UXZA 1G7YA 1FV3A 2P5BA 3H42B 4XF9A 3J26N 1XNBA 3EMRA 4MHRA 4BMBA 1RUH1 2CV6A 2J22A 3DPRA 3IWZA 1REFA 4RS5C 3QCWA 5GLUA 4IEVA 2V09A 1Y9GA 1MEC2 4EWAA 4HVOA 1GR3A 2R1BA 1CWPA 4K21A 3TEXA 1ULOA 2QKDA 2I45A 1YFXA 4A44A 2YBPA 1ZBA1 5DABA 3W9AA 2X5IC 4Y20A 2VVFA 3J4UH 4UWDA 4QKNA 2WS92 1PVC3 3OGSA 1FT9A 1NQDA 4PHZA 3BIWE 1FNZA 3Q8CA 1A6CA 5CNAA 3ZFGC 1JH5A 1W6MA 3C7EA 2FDFA 1NE4A 1PIV3 4CXWA 2BGCA 5KC5A 3FJSA 4LBLA 5LK5A 1KEXA 1GWLA 3KV5A 3NV2A 5FY7A 1OPMA 2V72A 3VDDC 2A7AA 4CEYB 4QMAA 2AENA 1MS8A 4XBQA 2R072 4OCTA 3HT2A 4HKOA 4EE2A 5GALA 1WW6A 2XL7A 3OY8B 4BQ3A 1W0PA 2JKXA 2DCKA 3HPNA 4QKDA 5JZGC 1RXFA 5FMOS 4NPRA 4CZSA 3BU0A 4PQ9A 3PIGA 4JTNA 3KGZA 4LORA 4UBGA 3DUIA 5J96B 4MOAA 1VBB1 3PVEA 1Y9MA 4XFCA 4C90A 1FNYA 2BNMA 1LAJA 3LDKA 1SBDA 1GZTA 1PGW1 1LR5A 2HWF2 2WIIB 4O61A 4UFMA 5A7QA 5A32A 1B09A 2I74A 5GLZA 1O5UA 5FY0A 3WDUA 1OVPA 4CCDA 4MXWA 4NHXA 1AR62 4WM7B 1J84A 4YZ3A 3ZIXA 1G9FA 4AFDA 3O1SA 3OG2A 4AYUA 4FQ4A 4CXYA 3H1WA 1H2MA 3SITA 5EJ3A 5ACA1 4KWLA 4JGZA 3IMMA 5F32A 2WSUA 4YVSB 4Q4Y2 5JOWA 4YARA 1HRV2 4AEDC 1RHI2 1OA2A 3K4DA 3KCCA 2BGOA 3PU8A 4I2OA 4NN0A 5I91A 2ZX0A 2P37A 3S5AA 4ET7A 5ANQA 3ZDSA 2A6WA 4Z07A 2YHJA 3EXUA 5L7OC 1XJAA 3KLSA 1UQXA 2EXJA 4C1WA 5L19A 3TRSB 3ES1A 4ORFA 4Q8LA 3WNNA 2ARAA 1GLHA 4QAWA 4ATEA 2X5IA 1UZ0A 3TEZA 1WKYA 1F15A 1NZIA 5LWBA 3IPVB 2VCBA 5FY9A 1ZZ7A 3ZFGA 1D4M3 1DQ2A 2J1SA 1CPNA 1XRUA 3ZKYA 1RL3A 1S0DA 5FUIA 4CPBA 2MHFA 3LF7A 1V00A 1V6LA 4GH4C 4LQRA 1MQTB 1K45A 3AP7A 4XJWA 1TQ5A 1LULA 1CGPA 4M0NA 2NM1A 4AVTA 3N7MA 4QT6A 4FAGA 4ZZ8A 1QEXA 2WT2A 1H9WA 4UW3A 5CU1A 2AACA 3DXTA 2RS32 2A3XA 2EALA 3DPRB 4JKLA 4AK3A 4OI0A 3VBRA 1CJDA 2RV9A 3RYPA 4Q4W1 4U2AA 3E5XA 2MNGA 2V5DA 1BMV1 1N1SA 1R1A2 2VNVA 2ZX2A 3WF0A 2PN5A 3R0RA 5EXOA 1GZCA 1AX0A 2D3PA 3BCWA 1GQPA 3BTXA 1GP4A 1CAUA 3BVCA 1JYVA 4FSJA 4BOWA 4UW6A 1N3PA 4Y20B 3M1HA 2H6CA 4JHZA 2IXIA 5CFDC 4F8AA 1GQGA 4L99A 1KXGA 3JD71 1GOGA 1ENQA 4CDWB 2XJRA 1OA3A 2VOVA 4IGQA 1W6MB 5FYIA 1DZTA 3J7MA 2WNUC 1SACA 1PHMA 5HBAA 3AYDA 5C8CC 5FLJA 4EN9B 2JE9A 3OBRA 1N3OA 3TEWA 1CAWB 4QPGC 5FWJA 4GD4A 5T5OA 4RGKA 3DYOA 4XHBA 2IVJA 5A7OA 4HMZA 4D6QA 3O0XA 4LTAA 4JGYA 1LU1A 2QDRA 2Y33A 4FPKA 1QNWA 4QGLA 5DAPA 2HEWF 4PLNA 1H8TA 1RXGA 4DY3A 1G6NA 3MGUA 2Y6FA 5GJ6A 3IDEA 3ZYGA 4TYSA 1VBA2 2VZTA 3N7LA 2DFBA 4F3JA 2F4PA 1SLCA 3WZ1A 2HWC3 3ZMOA 5FO8B 2IXLA 1NLQA 3SMHA 5A32B 1OVSA 4OFGA 4MXWB 4S2GA 2Y0IA 2LTNA 3CKHA 4K20A 3WDWA 1XYNA 2Y8KA 3PTYA 2XH6A 2Y60A 3S5QA 5CB7A 1PZ7A 5D1IA 3KCXA 3VBSC 4IQPA 2GU9A 1W99A 3ASIA 3C7FA 3FLTA 3P3NA 4JGZB 4PQQA 5F2WA 3BOPA 2K2SA 3SXWA 5FZLA 4HSLA 2VBBA 2IFRA 4BCUA 4DXTA 1ND2C 1CVNA 2W91A 4JZRA 4Z2WA 2AH2A 1HJFA 4JX0A 5C9AC 1VLNA 4A3XA 2GZWA 1VRH2 3HJRA 4YM0A 4KWJA 3R4UA 3VBHA 3WQ0A 1V6IA 4M00A 2DVAA 5FXXA 2J42A 2X5IB 5DQ0A 4N53C 2EA7A 5CFDA 5FMDA 4P9WA 4C0BA 1DQ1A 5C8WA 4WM8C 3WUCA 2D6KA 2JDPA 1G8WA 4IESA 3WP5A 4KL1A 1W9FA 2RDNA 4FAHA 5GLWA 1MACA 5FUPA 4OI1A 3RVHA 1PK6C 1JUHA 3VHNA 2VMIA 1W9WA 3G7DA 1PMJX 1H30A 2VZVA 1DHKB 2C9AA 4P9IA 3AZYA 4KWKA 3RYKA 2ZX4A 3OUJA 2VY0A 4L97A 4Y3OA 1RVF2 5IW0A 3T1MA 3VBRB 1H6YA 1SDDB 2PA7A 1CAXA 2WNVC 1Z7S3 1ULCA 3RZJA 1OI6A 1H1AA 1O8SA 1QGLA 1CAUB 5GZDA 5FQ0A 1QJU3 2Z69A 2DYCA 3DL3A 2JE7A 3AYEA 2UURA 2PYTA 3WINE 2D6NA 4D69A 5JWPA 1COV1 2Y38A 1MZ6A 2ZKNA 4JVAA 4RA0A 1BK1A 2W9XA 5FO7B 1YJKA 3FFQA 4ZS3A 3VBSA 2W08A 4B7KA 2JG8A 2B7YA 2Q1MA 2W1SA 2XWBB 2ZGSA 3VBOC 3WD5A 4BU2A 3WDVA 3TAYA 1MS3A 5FXVA 1ASJ2 2OS2A 3IDCB 4TZDA 3S57A 3I3DA 5CKNA 4BJ0A 1GZ9A 3W5NA 1GV9A 2RDQA 3SCFA 3L2YA 1OUSA 1E5HA 1BJQA 3WP3A 2ZHNA 1AZDA 4NAMA 4QU1A 2UY9A 4JGYB 1WLWA 3MFCA 2QQOA 2FQPA 4LBNA 4WV8A 3A7QA 3IN9A 2ZGQA 1H1IA 2QJVA 5DZFA 1H8TB 1ZBE1 3AJYA 3WEZA 1CD3G 1HKDA 1ZZ9A 1QDCA 2D6LX 2XQXA 3ELNA 2YYOA 3OTFA 5EJZB 1U12A 4N53A 4XABA 4AHXA 1XYPA 4PDWA 1RTVA 4NO4A 1R64A 4CCEA 4LBQD 4AQTA 2CYFA 4YGCA 4MGQA 3MIDA 5LBFA 5F1RA 1R082 2VVDA 3JCIA 4I3GA 2CWSA 2RS53 4XF0A 4Y4RA 4QX7A 5BYNA 5JPMB 1GWMA 1QJFA 1IOAA 3ILRA 1H2NA 3KV9A 3H8RA 1LEMA 1RMU2 5FFOC 4OUSA 5I8YA 4NROA 1PK6A 1JU4A 1LHNA 4NIIA 3W21A 3AK0A 1RUC1 3RG0A 1FYUA 3HN1A 3AYAA 3OGJA 2P4EA 3CQOA 1EPWA 4F7ZA 4MG2A 2OVUA 1EV11 1NT0A 2W52A 2QUOA 4K3UA 4AQ2A 4CUGA 3S7EA 1Y3TA 1O3TA 2WZR3 3N3HA 4AG4A 2JB4A 4XIOA 2J1VA 4NWVA 5EZWA 1RGSA 3VBHB 1KRIA 4BDVB 3T2QA 1NA1C 1GOHA 3UGGA 3AMPA 4AOCA 5FZ0A 3VBUC 4GMP1 4WVZA 4IW3A 3OGGA 2Z42A 1WA6X 1WGPA 4CCJA 1C57A 4ZU5A 4FFFA 2BOJA 5K0UA 4I30A 4HXCA 3VZLA 3MZHA 2DCYA 4EWEA 1S0BA 1ZA4A 4P9XA 2YGLA 5FPZA 5FP4A 3SISA 4HSJA 4ATFA 3B01A 3AP4A 3ORJA 1YQ8A 4J25A 5A7WB 1RUG2 3H3ZA 4C91A 3K51A 4LJHA 2RMU2 2BU9A 1AR82 1R092 1OOPB 3ZYPA 1CAXB 5FWEA 1YWKA 3ZSMA 1RUD1 3ZIWA 1DQ4A 3NNMA 3LA7A 4WVMA 4CP1A 3WG3A 5FQ0B 1MEC3 4GA9A 3K3NA 4LKDA 4YVWC 1VBD2 2VQ0A 3I2DA 3M8LA 4ARXA 2W68A 3OGVA 1CN1A 3U14A 3ZXJA 4AI0A 4XILA 4CDQA 3N36A 3TN92 2WL1A 1RUNA 1VP6A 3JQWA 1VRBA 4GMP0 3WQ7A 2XWJB 1Z78A 2XQRA 4XBNA 4XQDA 1ENSA 1WW7A 1PO22 2GC3A 2E7TA 3JZVA 2W47A 1W8ZA 2JG8B 2O8QA 2VUCA 2DUPA 5JIAA 4JDOA 1IG0A 2VCAA 2ARXA 5FOJB 5JVVA 2C4XA 5LATA 2D93A 2OX0A 1N3QA 5FZOA 2P3IA 1POQA 3LSDA 4R9AA 1VAVA 3BI3A 5IK5A 4IV1A 3O0VA 3WY6A 2FDIA 4DEQA 4LMFA 1LOGA 2DCTA 4RHV2 2VZUA 2PAEA 1SZBA 2GP5A 4M01A 1MS1A 1QH7A 1ZZBA 3H9AA 4N53B 4EZ4A 4Q1RA 4PDWB 1DFQA 3J8F1 5A7PA 4ZPIA 5FZEA 1QNYA 1JI6A 1NCRA 1PNGA 4SLIA 3HEIA 5F5IA 4HPKA 2K46A 2BPA2 2FDHA 2HWF3 1YQ5A 3ZR5A 4XFAA 1L3JA 4XE9A 1UL9A 2N7GA 4NHLA 2EIBA 4OHVA 4UW4A 1J3RA 4YW5A 1UY1A 5A6QA 5LA0A 2BV4A 2DV9A 1KS5A 1PK6B 1AR63 2PMWB 1RUI3 1UU5A 4AFMA 2B9UA 4XDPA 5JR7B 3VN4A 4D8MA 4E4DX 4XFGA 5JXIA 2XPJA 2VMGA 4FFIA 2VUJA 3NWKA 5DG1A 5E88A 3ETQA 1ENXA 1S4CA 4Q4Y3 3WV6A 2WNEA 3ZSEA 4L2NA 4ONUA 1H4GA 3GCXA 1RHI3 4JQRA 2VCCA 3IAQA 1O4TA 4E2QA 4P00B 5J1XA 4S2DA 3O1VA 2JDHA 2VNOA 1OC1A 3M7AA 4NIHA 1BKZA 4JC1A 4YVWA 1QQP1 3I2KA 5JXGA 3HOBA 4P5HA 4XAAA 3JXSA 2X09A 3ZO0B 3U0ZA 2P1BA 4X8PA 2BWAA 4AVSA 4N7UA 4NRQA 4QKFA 4FXKB 1RUF2 5EJ1B 5K0UB 1X33A 1PO11 2CNAA 3PUQA 2Q8DA 2HWD2 4WVWA 2I07B 3W20A 3T09A 5FZCA 1LHVA 2IUWA 3OEAA 1AYM1 5I0DA 3MUZ1 4KU7A 5FV3A 2ZEXA 5ISLA 1BEV1 2IFWA 2G9FA 1RIRA 4UFLA 4DIQA 2BOIA 5JOXA 1ULPA 2BZDA 3CHXA 2YG0A 5T54A 1DQ6A 5FY4A 1RYYA 3VKOA 2XUMA 3CL1A 2EAAA 3SCGA 2VM9A 4CCNA 5J37A 1OMIA 4WVMB 1NUKA 3AP9A 1GSLA 5EP9A 3PLQA 5CFCC 1N1YA 4KBBA 1DGLA 1R1A3 1TME1 3K3OA 2VZSA 1KJRA 4CDQB 1MS4A 2NQYA 4LT5A 5F8PA 2ZPXA 4MO3M 2ORZA 3JQXA 1LECA 4Y1XA 5A3TA 3SNMA 4CUCA 3T08A 1NOVA 2JIJA 2UWCA 3MIHA 2EXKA 3ZDVA 2BNNA 4KU8A 3Q8BA 5FP8A 1W6QA 3K2OA 4XF3A 1QJX2 3M3IA 1YCIA 3ST7A 1XU2A 2QBXA 5ANNA 2ZS6B 4GJZA 4N7IA 2D3RA 5BNNB 3A21A 4GB33 2A3WA 1SHWB 3NKGA 2WZPP 3WHTA 1PVC1 4IV1B 2J1AA 2WWSA 4K1ZA 4EZHA 1QU0A 5AC92 4LO4B 5C3SA 4BK5A 3LZZA 1CX4A 4HKLA 1PIV1 2OQ7A 1BBT2 1J58A 1OLMA 3JB4C 1XNCA 2Q1FA 3M2MA 4KQ7A 5DAQA 5BV6A 4CCMA 3HBZA 3MYXA 1H8VA 1NCRB 3FUOA 3POIA 1IHMA 4QX1A 4IGOA 4LULA 4YGEA 5JI7A 4BM8A 4CEYC 3M3CA 4GKXA 4JRAA 4XCAA 1HN1A 1UW8A 4G9SB 1MR5A 4BISA 4RN5A 1AHSA 4FP3A 1DGRN 1HB4A 4LBMA 4ZXKA 2DTWA 2GN7A 1FOD1 1DYKA 3EBRA 3ALQA 2BNOA 4OULA 2GSYA 4MGSA 3VZNA 3NW4A 2VBDA 3MDPA 4BE3A 3H7JA 1IPSA 5I8SA 5JMCA 3VHRA 4U36A 5DZGA 4G3YC 2ZHKA 2FCTA 2OZ6A 2WYFA 2VXRA 3AMMA 2IXCA 1GYKA 4XZPA 5FZFA 4DB5A 1UZYA 3VV1A 5IVEA 3P1IA 1RUH2 1KDKA 4CSWA 1LESA 1UU4A 3CJIB 4XBLA 4PCRA 3U37A 3LWCA 3WUDA 4WM7C 3WW3A 3AFKA 2QQMA 4O7XA 1K12A 5I0RA 1ZNPA 2J1UA 3RMYA 1DGRA 2DURA 4YFZA 4YVSC 1EAH2 4K8FA 3SH5A 3VL9A 3ETPA 2EAKA 4XUTA 3BTAA 4NOTA 4FOYA 4CP9A 4ZONA 3VD5A 3CF6E 5LK7B 4PI2A 5FY5A 1M4WA 3ZM8A 4AQSA 3VZKA 5FP3A 1I5PA 5JOYA 4QXCA 1WCQA 3B02A 1T2XA 3NNJA 5A3LA 4DO0A 1HQLA 2BGPA 1LRHA 3AKRA 3MO4A 4COZA 3BOWA 1D4M1 3TYJA 1CAVA 3UT0A 3MV01 3RSJA 1XE7A 2VW0A 3SHRA 4DNYA 1SCSA 2B5HA 1AJKA 5FPLA 3C7OA 1MQTC 2PHRA 1D0HA 4AL9A 2ARCA 4TWTA 1F5FA 4IEPA 1PGW2 2QDNA 4DEVA 3QH6A 2FHRA 4LBOA 4QU2A 5IT6A 4PT6A 1YHFA 4CDXB 5AFEA 3AP5A 4Y1YA 1JYXA 2PXJA 3NO8A 3T2PA 2A70A 4F83A 2WJSA 4AFBA 4B1LA 1W6QB 1ZRRA 4UF0A 2OYZA 2Y6HA 4B4PA 2FZ2A 1HJGA 1XQNA 4D94A 1EPZA 5EV7A 3W5MA 4ZHNA 2Y6GA 2CDOA 5IWFA 3VB9A 1PZ9A 4LBQB 3MW3A 2XVLA 2TUNA 3ZXGA 3BTZA 2R32A 1ZRDA 2WN3A 3LGRA 4CDWC 4HK9A 4IEQA 3AMNA 3CU7A 1QQP3 3FFZA 4Q4V3 1PMHX 1EP0A 4I09A 1I6XA 3LEKA 5H9SA 4YW7A 1LB2A 2YUEA 4ASKA 2VZ1A 1WMEA 3POFA 4MZUA 1SG3A 4MGYE 1GNZA 3VL8A 2PLV1 1LHWA 1PO13 5FYVA 3URFA 5CG8A 3ATGA 5E16A 2VG9A 1W3VA 2G1MA 3N35A 2QQUA 3V0BA 1AYM3 2GC0A 2GN3A 2VD7A 3CEWA 3I7DA 4B1MA 4E4HA 5GZGA 1XNAA 2XKOA 2HWC1 3OUHA 3ACLA 4AGGA 1NLSA 2OPKA 4Y22A 4IGPA 3P3PA 2DWRA 3I3EA 3NKTA 5JMOA 4A42A 1UIKA 2KR2A 3ACHA 2RS13 3HQUA 4YW3A 2AUYA 2VMEA 4EN0A 3H8OA 1BMV2 3OBZA 1S0IA 1ZREA 2EXIA 4O9GA 5CEHA 2LW8A 4JGZC 4Q27A 5T55A 4XAEA 2JDZA 1S1AA 4XHXA 3LQCA 1XU1A 4FPHA 4HOOA 1YI7A 3JD72 1ULDA 2A5ZA 4GALA 2P17A 2X10A 4XETA 2RR12 4CP9B 2WC2A 5FZ4A 3GZTB 4YW6A 4QD2A 5DN2A 3AMQA 1HIXA 4AGRA 4N9HA 1O3QA 4YM1A 3UK9A 4BMEA 1QJEA 3B9CA 4M0HA 3ES4A 1F35A 5A7NA 3OUIA 4W6WA 2VU9A 4D7YA 1AJOA 3I49A 2HWB3 2PQSA 3DYPA 1AR93 1CAVB 2D40A 1HX6A 3C2UA 3GNEA 4LA3A 4CDWA 3AVRA 5DZEA 2RMU3 1AR83 4MUVA 4COYA 3ZR6A 3WNMA 4D6SA 1BHGA 5A6YA 4Z1VA 2GNMA 3I97A 1LTEA 1WBFA 4XFFA 3LOBA 2FCUA 1AR72 4ZU4A 1CAWA 3MF9A 3BU7A 2J1EA 4Y4YA 3BIEA 5FK8A 4GWNA 5ABJA 2E32A 4LKFA 2DBNA 2JDUA 3RZHA 3VBRC 1FV2A 5KC6A 1FOD3 5FREA 1OUXA 2B4KA 1Z7S1 4RQPC 5FO9B 4UF0B 1VB2A 2XUEA 2JD9A 2C24A 2ZJCA 3VD3A 4CDUA 3AZVA 2Q0AA 1OBNA 3A0KA 1QJU1 4XFIA 5T5JA 4HLTA 3NNLA 2CSGA 3USUA 3EO6A 5HXMA 4AQ6A 3U11A 4LKEA 1UZZA 2ATFA 2ET1A 4RHV3 4QPYA 4OHZA 1Z0HA 2JENA 5GZEA 2NLRA 1NAEA 1XYOA 2PHXA 4BQXA 1RITA 2XJUA 3IZOA 5LY1A 1BVP1 1VMHA 1ZZ6A 2PAKA 3VLBB 3ZPOA 3DEMA 3NSTA 5ERLA 1N47A 4JGYC 2VTXA 3I2OA 4PI0A 5CIRA 5KBFA 4A2UA 1H8TC 3V0BB 2WO2A 2WN2A 1OFNA 4DUXA 1WBLA 1TMF3 2F6BA 5IVBA 2QQKA 5DUUA 1C3HA 4M3CB 1U5IA 4NHYA 4P08A 4Y22B 1JW6A 3WP6A 3VD4A 4KG8A 1KITA 3M70A 2RS51 1VBC2 4ZS2A 3D8CA 5GM0A 1X9TA 3OJBA 4DQAA 3JB8A 3AYCA 4GAZA 4NWWA 5T52A 4Z2AA 5JXHA 4XEZA 1YEWA 5CADA 4XJZA 1Q5OA 5FMCA 1OHFA 1ZVFA 3WT3A 3RZGA 5JUVA 4AR2A 3PUHA 1O4YA 2LM3A 2YU1A 1C5HA 2ZGLA 3A22A 3CJXA 3O5SA 4I0AA 1COV2 4BZ4A 5LEKA 4OZOA 5DPNA 4BLJA 2YY1A 4RQPA 2WZR1 1FPN3 3AXEA 1HRI3 1XBFA 2YBSA 2QQVA 3OF1A 4XC9A 5FPAA 2CGOA 4YW1A 4I0WB 2W94A 2W3JA 5FLIA 3VBHC 5BNPA 4N8MA 3JU9A 5G05L 2CGNA 5FYTA 1A34A 4BXSV 3HBKA 2AC1A 2VE1A 1W6PA 1A3KA 2PHLA 4XMIA 1BYHA 4IEOA 2BFUS 3RWKX 2PFWA 1NCQC 2ZCWA 3GDBA 4QX0A 4Q0VA 1EUUA 5J7MA 1ZBE2 1VBE2 3UYJA 1JHJA 1LOFA 2HJIA 1LCLA 5A3UA 4XJAA 1OD5A 5D2AA 4IERA 1AL23 3UKVA 1SFYA 4P9JA 1K5MA 1L7LA 1V6MA 2HWE3 3UV9A 5ABJB 3KSCA 1CX1A 2PLV3 4GXLA 1DGWA 1OOPC 5FXWA 3RWNA 4QQPA 2MEV3 3T2OA 3VDCA 2R042 4E8CA 4YRDA 1H2LA 1OPOA 2ZGKA 4FVVA 3ZFFA 4CDUB 1E57A 3J7HA 4Q0QA 1MEC1 4N9IA 4BLIA 3T1LA 2EIDA 2VNGA 3POGA 3RMXA 5FZMA 5FY1A 3ZOIA 3USUB 2HYXA 2ZMKA 3DECA 3L2HA 4A6OA 3Q8EA 5FZ7A 2VTFA 1KJLA 4KGQA 3WF4A 3ZX7A 4AVVA 3WNOA 1BCXA 4FPEA 1W0NA 3MV11 1RINA 2PAMA 2XBO3 3IIIA 1X82A 4NUBA 5DDJ2 4CYDA 5DUVA 1UYZA 5FY8A 2JG8C 4CXXA 2WKKA 2AZ5A 3UKTA 4RGAA 2Y64A 5H9QA 1EUTA 5IVCA 2VH9A 2ZGMA 4QXBA 3WP4A 4AVBA 3RZLA 4Q4X3 1NXMA 1PNFA 1W9SA 3KGLA 2A1XA 5E89A 5D8AB 2RVAA 3RGBA 2UYAA 2OKXA 4PIXA 2GALA 1QXPA 2WLQA 2FD8A 3O1RA 2VZQA 1GKBA 4Y33A 3UL2A 3E6BA 1YQCA 5C3PA 1IQAA 1XNDA 3IB3A 5A7SA 4DUWA 5F37A 5LW9A 5L9RA 3D0JA 1W04A 3AB0A 5I0UA 4PDWC 2GMEA 2IXJA 3LA3A 1Q8VA 3ZXDA 2GP3A 2AR6A 1OKQA 4Z92B 3Q8FA 2HWF1 1GNHA 1NCQA 1DCSA 4EV0A 3RZMA 2Y0OA 4LLFA 1VAMA 3CLPA 3JBG2 3GJBA 3WLUA 1YXWA 2H0BA 2ID4A 3WSOA 3GJAA 3WF3A 1AR61 1RUI1 1D7PM 1IZ3A 1FI2A 1UNBA 2JICA 5JAXA 4K1YA 2WFF2 2CU5A 1W03A 5CBLA 5CVRA 5A7WA 1JYWA 2D5FA 3NJYA 1BQPA 3IM0A 4O65A 1OOPA 4Q4Y1 3JUUA 4JQTA 4YGBA 4PIZA 4RQPB 1RHI1 1AYN2 1QKQA 4FXGB 2DVGA 3K48A 5JOZA 3C3VA 1PGL1 3PVNA 4DPNA 4AW7A 4QKBA 4EWDA 5BNPB 2R062 5J36A 1M06G 1H0BA 1FMD3 1UZWA 1VIWB 2ZAHA 4P02B 4K6BA 2RG4A 1W6PB 1W39A 2RE9A 4IXLA 3ENRA 5E1RA 3I4IA 3F95A 3D0SA 2GNTA 5IUQA 4I02A 1G86A 3ZXEA 2UYBA 2UWAA 5K0UC 3ZMNA 2LUWA 2E6VA 4NE9A 1GBGA 4CU7A 1C1LA 3M4FA 3J8F2 4HN1A 4JV4A 1K5MB 1PZ8A 1UYYA 4YZ4A 3GBFA 2DCJA 2WZ8A 1LHUA 1I5ZA 4EQVA 5HCAA 1G9DA 2JIGA 2ZHLA 2WBKA 1J3PA 4FCAA 3MW4A 3ZYJB 4P9GA 2ZAAA 3H1MA 4ISRA 4XF4A 3ZFFB 5FZ3A 4CVUA 5C5UA 3DYMA 3ZKUA 2RM23 4EN8B 4GULA 2WO1A 3KF3A 1R1A1 1Y7BA 4LO7A 1V0AA 4PF5A 1QH6A 2QNKA 4C0HA 5J3UA 3RNSA 1R1ZA 3B9IA 4V2WA 4CDQC 4H3WA 4QPIA 2W46A 2EXHA 2IC1A 1V9U2 5DAVA 1YIPA 4YW2A 5KHGA 1SLIA 2XJVA 2DFCA 3T4VA 3I2JA 4J1WA 4LK7A 1W6NA 5L9BA 2ZZJA 1JTZX 3GHNA 2XMLA 5IAVA 2VBPA 5JIUA 1Q43A 1IPKA 1NE6A 4NHKA 4GB31 5BNNC 4LIUA 4WBBA 5I0SA 4RSUA 4YFWA 3T0BA 4OHXA 4IV1C 2G4IA 2BW8A 2F17A 1VE0A 4J6GA 3P5BA 5FOBB 2FDKA 3BALA 1XE0A 5JI9A 1S0FA 5C3RA 1DQ5A 1H4HA 3HMYA 4CCCA 2YXSA 5IVVA 3LIGA 4AF9A 1RUJ2 2BRTA 2JDMA 2ADDA 3OBTA 2QQNA 1O8PA 5J09A 5F3CA 2P6CA 2C5DA 1HB2A 1NCRC 2X8KA 1BLZA 1CZTA 3FHIB 2R7EB 5F5QA 1BXHA 4MVTA 1BEV2 1NCQB 1W8HA 3VDAA 2JX9A 4AHWA 4W8JA 2UY8A 5FRAA 4DXSA 3O1OA 1JOBA 1XNKA 1U0AA 5A1AA 1WMDA 3IMNA 3KQRA 2GC2A 3FWEA 2R49A 1N1VA 1SDWA 1V70A 3AZXA 5FZKA 4YG6A 1TME2 1SEFA 1SLBA 1US3A 4Q0SA 5E6HA 5IJRA 3PNAA 5LBBA 1OFSA 3SH4A 1W8OA 5LCWL
chains in the Genus database with same CATH topology
1S55A 1WW5A 4AE2A 3IKWA 4YYOA 2ZABA 1TNFA 5I0TA 2RR13 4OI2A 3CJIC 3ZVXA 5HCBA 4CP0A 4J1XA 2VW1A 4MSVA 1VJ2A 3LB9A 4YG0A 1QY4A 1PVC2 2WS93 3AKSA 3WR0A 2A73B 1REDA 1WMFA 2VGDA 4QGNA 1LENA 1RC6A 2RJKA 4GWMA 5A3MA 1PIV2 1LOAA 3IIAA 2VPVA 2UU8A 3IT8A 3ZN4A 3EHKA 3X29B 1HV1A 4MXVA 4FPGA 5BNNA 2XHKA 1AR73 2D7FA 3WW4A 2R073 2EF6A 3O14A 1I9RA 2ES3A 4RR3A 5FPXA 2B39A 4AXOA 1Q56A 3HIFA 2HYKA 1N1TA 5BNQA 4OHYA 5FLHA 3RS6A 2ZGPA 1HXS2 2QCSB 2VOXA 2TEPA 2GDFA 2NPIA 2XLAA 2YPJA 4M3CF 4XW3A 3DF0A 4QPIB 1A8MA 3WNXA 2EVXA 3MLJA 2XKPA 1V6OA 1XE8A 4D3WA 4CDXC 3FBMA 1CPMA 3ZYRA 1W6NB 1IS6A 1AF9A 5GLTA 3GBGA 2ZOEB 4RD7A 4CEWC 3QH7A 2EIGA 4XPVA 3RPQA 3RQ0A 3KT4A 3H0OA 4Q29A 3TNPB 1IKQA 1HLCA 3ROUA 3V64A 1HRV3 5EYYA 2XJSA 3T2TA 4NVPA 4XTMA 3CJIA 4FOVA 3J9SA 5GZFA 4S2FA 1LOEA 1QJY2 2K0GA 2P2KA 1IS4A 1BZWA 4Q4V1 1ND3B 4GQ7A 4O9EA 1POV3 4IETA 1C8NA 1DBNA 4XJ8A 3EJKA 4JRLA 2C1FA 1BVVA 4RL7A 1DLLA 4FBFA 1R081 1NXD1 1VBC3 5F6KA 4JAAA 4QXKA 3FC0A 4FPFA 1RMU1 1WCSA 1W0OA 5JPNB 2R6QA 3RDIA 3ME2A 1QOSA 1RJ8A 5KHIA 3GHMA 1CR7A 3I54A 4X6QB 3FLPA 1RUE2 3SCHA 2A6YA 1B35A 1QDOA 2ZGRA 4I0BA 4BH9A 2RS33 3KT1A 1C4RA 1PMIA 1GQHA 2IXHA 2DU0A 2RS11 2O8OA 2R0FA 4N90A 1DIWA 4LBKA 4W6YA 2D97A 3POWA 5A33A 5B2GB 1OQEA 4CDXA 3PMEA 4AFAA 1YNAA 1CJPA 3NAPC 4B3NA 4CEWA 1C8M2 1VBE3 4XF1A 4QM9A 3ZFEB 2NN8A 4BQ1A 1WLCA 4JCKA 1VB4A 4LBQA 1ZM1A 2HWB1 1ZRCA 4RR3B 1AR91 4B29A 4LUKA 4Q26A 2RMU1 1AR81 3U07A 3OD0A 2VMHA 2Q4SA 4BIOA 2ZZQA 4DMIA 2R043 3ZYIB 5BNOC 3BB6A 2P34A 1VBA3 4QX5A 2ILMA 4EJRA 2ZACA 1WLTA 2HWC2 4XMAA 4AHYA 1DG6A 1OA4A 1OSGA 1WCKA 1UF2C 3LKJA 3ZSKA 3NV1A 3H7YA 4FTSA 2D44A 5DDJ3 1I1EA 4B4QA 5DUWA 5KXEA 4QM8A 2JKBA 4PBPA 3KD4A 2SLIA 3CO2A 1V6KA 4AI1A 4ASLA 4XXPA 4HN0A 2ETEA 4RHV1 2AYHA 2OIIA 2Y26A 3HR9A 1VRH3 1SLAA 3INAA 4IEWA 1PVXA 1MZFA 1SMVA 2E9QA 1ZBA2 1GICA 1MVQA 2CWMA 2R0HA 2R16A 2Q5TA 3VHOA 3H50A 1F31A 1TEIA 2P3JA 2TNFA 3NAPA 2WT1A 3JBG3 1CIWA 4IV3B 1A8DA 4K7JA 5CG9A 1PGSA 1LGNA 1QOOA 1TMF1 2WFF3 2FBEA 3IDBB 1B35B 2WQ4A 4BWOA 3O12A 3V65A 1RVF3 1CESA 4Q2FA 1NY71 4HVQA 3RRDA 3TB0A 5BNOA 4XJUA 1AVBA 1NQJA 1VBB2 5EFUA 2VULA 2R063 2WINB 4OLLA 2D3SA 5FMOL 1QJU2 2XB6C 4MLOA 2GC1A 5K8SA 5A33B 1YFWA 1DDLA 3PVBB 3W58A 4LR4A 1ALYA 3HAGA 1FPN1 4CEWB 1HRI1 2QQPA 5ACA2 2YGMA 2GAUA 2B42B 4E27A 1ASJ3 3E5UA 4HANA 2A6ZA 4PBOA 4R52A 1SLLA 1AX1A 2BEOA 4I01A 3RI9A 5AVPA 3D4KA 4URTA 1YYNA 4OZXA 4YGDA 4LHLA 2PHFA 2ZMLA 4QQOA 1S2BA 1Y9QA 3WW2A 5BXXA 4FP2A 4R9CA 4UW5A 4YSFA 1AX2A 2FMDA 4A7ZA 4YG3A 1AL21 3USSA 3KB5A 1JBCA 2R1DA 1O91A 2HWE1 2XJQA 1MS0A 5ABJC 2PELA 4WVVA 3HT1A 1R083 4I3PA 3WDXA 2DUQA 1SLTA 3H3UA 1V9U3 2MEV1 3L9JT 4ES8A 2H0VA 1LJ7A 1RMU3 1ULGA 1EY2A 3QOPA 1NZCA 2A71A 4CDUC 4DXZA 2CTVA 4M3CA 4IEUA 3N7JA 3AZZA 5KWRA 2XLGA 1NLRA 1MS9A 3NVCA 3NL1A 2XVGA 4BPZA 1H1MA 4XJ9A 4CRQA 1F2NA 4Q4W2 5AC91 1ZZCA 2WZR2 2XBO1 4YZ5A 2GMMA 1IS3A 1RUJ3 1DGWX 5HXVA 2GMPA 4Q4X1 2A6XA 3MIBA 3D82A 3FE5A 3WW1A 2WQZC 5D8AC 5J98B 2BYVE 3NAPB 5H9PA 4MGKE 1SFNA 2ZX1A 5F6LB 1RJ7A 2FMYA 3VGIA 5JSRA 1PM7A 4LO8A 5KHJA 3QD6A 2XJPA 3R05A 3V56A 1J1LA 1ENRA 1RUG3 4COUA 5GZCA 1HQNA 1R093 4X8NA 2JG9A 4P14A 4D7TA 4ISQA 5BNOB 4R8HA 4BHPA 4ITCA 1C5IA 1SBEA 5T50A 5EWSA 4CP2A 5CAZA 5E8AA 4QQ2A 1VBD3 3E6CC 1OLQA 4AHZA 4LE3A 3TN93 2BTVC 3MW2A 4YM3A 1EAH1 4FPCA 3D6EA 4R4XA 5C4WA 1D0GA 1PO23 4FOQA 5JSOA 5LRSA 3H8UA 4TSVA 5BNPC 3A4UA 1FMD1 1U5XA 2ZGUA 4HL0A 5GKAC 3TNQA 4YZ1A 4EN7B 2QFEA 4LA2A 2E63A 2SBAA 3AMHA 2NMOA 1IS5A 1LOFC 2TBVA 2QZ2A 2QZ3A 3ZXAC 3B5LB 5C6CA 1K5MC 4HETA 1HXS3 5HI0A 5TSWA 5D8AA 3NJZA 3VZOA 4Q1PA 1V6NA 2VOKA 2Q30A 3MIEA 4HK8A 4FPLA 4JTOA 4YNIA 1RUI2 2ERFA 1JN2P 3WDTA 3ZFFC 2HKXA 3E97A 2RM21 1HV0A 1O4ZA 2D98A 1LGCA 4Q0PA 1GFF2 2YDEA 4XOGA 2B46X 3FBYA 3MF6A 2JD4A 1ULEA 1LOBA 4G4FA 4RS5A 3AXDA 1PGL2 4R4ZA 1O5LA 1DQ0A 2JECA 1QJY3 2OUHA 4COVA 1LGBA 5L73A 1RUOA 2CL2A 3AFGA 4E9KA 2D6MA 1F8VA 1REEA 5K9YA 4UBHA 1X8EA 1RUF3 4QHBA 3POSA 1U5YA 1DYPA 1XXNA 2VUAA 3AZWA 1QXRA 4N43B 2HWD3 1Y43B 3VDDA 4OVEA 4Y24A 1VR3A 4E4SA 1WW4A 4INDA 1RUE3 4SBVA 2JG9B 5JZGA 2D43A 2WLPA 2XVKA 3I59A 3KMHA 3U4XA 3WG1A 3I8TA 4Y1UA 3D5OA 3DGTA 4NHMA 2E51A 4QQHA 4Z82A 3V0AA 2CY6A 5C4WB 2RR11 1G9BA 3RZZA 4KGGA 3KZ4C 5K7PA 4PLOA 5KXCA 4Q0UA 1QJX3 1C8M3 1RUC2 3ILNA 5C33A 2OUJA 4B8EA 2VVEA 4GB32 4XXAA 1MZ5A 1YO8A 3ZXLA 2BBVA 1EV12 3VKFC 2WS91 3ILFA 1QF3A 4AEDA 1F5JA 4LEJA 2BVBA 3HWJA 5L7OA 1BBT3 2HEYF 2A75A 1CQ9A 4XTPA 1A78A 4GIQA 4W65A 4DFSA 5I8TA 1W2UA 3B7MA 4LHNA 2ZA9A 1AR71 3B93A 2R071 4DRVA 5FTTC 4DY5A 2CGPA 1G9CA 1WD3A 3E5QA 1SBFA 1ULFA 5T5PA 3AKTA 4GH4A 3LA2A 1WA4A 3M3EA 3MLKA 4L9BA 3VZMA 4AEJA 1VALA 4QPIC 3MIFA 2ZX3A 3ZN5A 4LUMA 3AX4A 4FPYA 1DZQA 4FPOB 1RUH3 3BPZA 4RS5B 1RUD2 1YFYA 3AM2A 4HT1T 3VKNA 1LEDA 2AGSA 1KDMA 1JOJA 1QXJA 2FZ1A 1FXZA 1ZBA3 4YLZA 3M3QA 1EAH3 1YI9A 5GLVA 1HRV1 3ZFGB 2IXKA 4XFHA 4YZ2A 1T6GC 2A6VA 1UIJA 2DU1A 4MYEA 3S6PA 2WNUA 1LU2A 1OLRA 5C8CA 3VDDB 1ND3C 1POV1 4QPGA 4FTBA 3VZJA 3KCYA 5HCFA 3AJZA 2E53A 4Y5Z0 5JZGB 5JCTA 3I59B 1VBC1 3VUOA 1U5ZA 4HBNA 3THTA 2NYYA 3QBQA 4QQLA 1VBB3 2DTYA 1HQWA 2H6BA 3V0AB 1QJZA 2RS31 1H2KA 2PQQA 5F9TA 1MZEA 1J59A 4LO5B 2X53S 1UCXA 2B8MA 2GH2A 5SV8A 4C1XA 5ACA3 2DCZA 2NP0A 4EN6B 2KXLA 3N7KA 1UMZA 2P3KA 2ZGOA 1UKRA 1POV0 3OD4A 3OCPA 4EROA 4AEDB 4XQ4A 1FX5A 1ND2A 3O7OA 2Q8OA 4AWDA 5T5LA 3APBA 5C9AA 5L7OB 3MPPG 4HZFA 1V6JA 2WSVA 1QQP2 3R4SA 1JHNA 3GZUC 4Q4V2 1VBE1 2RHPA 3MI8A 3AKQA 3UKNA 3GBWA 3ZFEC 3DV8A 4WZFA 2V73A 1LHOA 2DF7A 1S2KA 3BODA 2C0ZA 5FCCA 4RR3C 2YZ4A 4WM8A 1WUVA 3RI8A 1JYCA 1PO12 4IEYA 4ES9A 3QLQA 5BPXA 2PHTA 3WVJA 1O7FA 3MIGA 4GH4B 1SQ4A 2R041 1ND3A 3B00A 1AYM2 3HQXA 1QOTA 1APNA 1VBA1 2E7QA 4D7SA 4LBJA 3WDYA 3ECQA 3ZPYA 5FBZA 3KT7A 4JDMA 1RB8G 3MPBA 4H7LA 3LAGA 3GYDA 4MH0E 4E2GA 2WNVA 2ZMNA 2RS12 2IZWA 4Q4W3 5DDJ1 3LOIA 1AXKA 2XGXA 4NR1A 1KD7A 2D6OX 1ONAA 5H9RA 4XIKA 4FQZA 5CFDB 1X8MA 1J1TA 3CNAA 3OPZA 1JUIA 5KHHA 3JD73 3MFAA 2LALA 1F9KA 2QVSB 4BA6A 4Y26A 5IK7A 5J48A 2WNUB 4XFBA 1DU3D 3E6DA 5C8CB 1VRH1 3IBMA 4UXAA 2JXAA 5AVAA 3VBOA 4BIFA 2O0OA 3B69A 5JDBA 1AUYA 4QPGB 4KNCA 1C1FA 1ZRFA 3WX5A 1URXA 1GZWA 1YIFA 2HWB2 2WFPA 3ZSJA 5JSPA 1AR92 4AI2A 1NYWA 1OQDA 3QACA 1G9AA 1OQ1A 3JBG1 3VBFC 4IV3C 3RYRA 1Q8QA 3S30A 1DF0A 3ZFEA 4KG0A 1FATA 4FO9A 4L11A 1DZRA 2WFF1 4XYXA 5EYXA 4MGIE 3THPA 3U10A 1Q8PA 4LLOA 3NV3A 1B35C 4CTEA 3MEPA 5JLVA 1RVF1 1FOD2 1D4VB 1AYN1 2X29A 3VBSB 4OUMA 3S7IA 2R061 1VAKA 2I2SA 1YRZA 3MICA 3GF6A 4AVCA 1X7NA 3RJRA 2YROA 3ZXKA 1UPSA 1ND2B 2ZBJA 5C9AB 4TLFA 4AEKA 3FLRA 2NMNA 3SH3A 1SCRA 1EYBA 1YLLA 4FT8A 4HVRA 5BUVA 4MX3A 4LE4A 4LHKA 1ASJ1 2BUKA 3TBDA 1MVEA 1NA1A 3KM5A 3VBUA 2WA4A 5LEJA 3R6SA 4WM8B 1QWRA 3OYWA 3AKPA 2XLFA 1AL0G 5L36A 3UJOA 3PHMA 1YUDA 3WOGA 3EQEA 1TMF2 1C28A 5LRRA 3TOJA 2OA2A 1D4M2 5FAXA 2YMZA 5SV5A 1AXZA 3AP6A 3POYA 2BVVA 1QMJA 2G9GA 2WNVB 3VBFA 1NY72 1V9U1 4IV3A 4FPJA 3ZSLA 1LODA 2OZJA 1IGOA 1IKPA 3DN7A 2CAVA 3UJQA 4IL7A 3WQ1A 2OW4A 4JDNA 4P9LA 4H14A 4V1PA 2HEVF 4MV2A 4X6RB 1COV3 3FMGA 2PTMA 1FPN2 1HRI2 5T3NA 3VBOB 2DUOA 3PJQA 5IK4A 2V5YA 4LO6B 4H7MA 1RUJ1 5DG2A 1S0GA 4PJYA 4RFT0 1GZWB 1KFXL 3WHUA 5FDBA 4AFCA 3N4MA 4A7KA 3MLLA 1WD4A 2JJ6A 3PMSA 1W6OA 2A3YA 1ZBE3 4ZU7A 4L92A 4OI4A 1AL22 3VHPA 1TNRA 2Z79A 4AEMA 2HWE2 3WG2A 5KXDA 3FX3A 4R9DA 1RUG1 1ZZ8A 2PLV2 5KHKA 1R091 4QGMA 2MEV2 1AXYA 1IPJA 4YM2A 4HFSA 1VBD1 1RUC3 2K9ZA 4Y1ZA 3O0WA 3TN91 2XJTA 2AREA 1EV13 4AI3A 2KM2A 2XL9A 2NZ9A 1UPIA 2ENRA 2XBO2 1PO21 1JYIA 2YC0A 3S0MA 3W59A 2QE3A 1KFUL 2MPFA 4GKYA 1NA1B 2PHDA 2Q1ZB 2GH8A 4Q4X2 3VBUB 2VECA 4GMP3 4HPKB 4P9YA 3KS7A 3OYWB 5KXBA 3WXPA 2BQPA 1ZX5A 3LSEA 4AVAA 1HW5A 5I93A 3R4DB 5IK8A 2RJLA 1QHDA 3Q9OA 3LCPA 4E4ZA 1ZYBA 4PIYA 3SLIA 1X36A 1HXS1 1S0JA 3H1YA 2YV8A 3GZAA 4B4RA 2VQAA 3B94A 3VBFB 1YFUA 4AGVA 1D2QA 1RUD3 3M3OA 3VKLA 1YJLA 5CFCA 4YVWB 2DVFA 1MS5A 4DZGA 3ZN6A 1H9PA 3WCSA 2Z2SB 5AFBA 2ARBA 5DUXA 2WT0A 3DKWA 1Z7S2 2O1QA 1AYN3 3FZ3A 4WZCA 3ZXFA 2ZKLA 1QJY1 1NG0A 2GNBA 2JEMA 1FMD2 2UWBA 2W0XA 1CONA 4K40A 4MGZE 4HKWA 4DOUA 2ZGNA 2PHWA 1UD1A 2W39A 1W6OB 1RUF1 4L8QA 3A0NA 2GNDA 1UAIA 4S2HA 2HWD1 4N43C 3WCRA 3B3QE 2ET7A 2R30A 2CAUA 3J8F3 2IWGB 4DINB 4PLMA 4E2SA 2ZGTA 4CEYA 4Z8BA 2VNRA 1S0CA 2D6PA 1RUE1 2ZTNA 4OHWA 3OY8A 2XG3A 2JG9C 4YW4A 3DPRC 3RJ2X 1UU6A 3VKMA 4KH9A 5BY5A 3TWIA 1X50A 2RM22 1TE1B 4B7EA 2Z5WA 1D2SA 2VW2A 1LKNA 4META 1KS4A 1WCDJ 4RGGA 4W6XA 4IEXA 3PVOA 2RS52 3G6JB 2PHUA 1FAYA 4A7YA 5C4WC 1LOCA 4K9SA 4WM7A 3WG4A 4BYYA 1JXNA 1QJX1 1C8M1 2E7AA 1HDKA 1I3HA 4FTEA 3GALA 4XDQA 4ZKTB 4FOWA 4YVSA 4DS0A 3NV4A 2D5HA 3FUQA 1GANA 1UX6A 3PJYA 1Q8OA 1Q3EA 2KA3A 4Y1VA 4COWA 4Q8KA 1S0EA 4XQWA 1O3SA 5CA6A 1BBT1 4LNVA 4M3CE 4DRRA 1J3QA 1KQRA 2WA3A 1UKGA 1BEV3 3IPVA 1UN1A 4R9BA 1Q8SA 2BWCA 4ASMB 1WLDA 2DVDA 4N43A 5DXDA 5CFCB 2BFUL 2DVBA 1TME3 1MQTA 2B45X 3HD8B 4AI8A 4IEZA 2ZHMA 3ZN6B 4H55A 2VOWA 1G7YA 1FV3A 4XF9A 3J26N 1XNBA 4BMBA 1RUH1 2CV6A 3DPRA 3IWZA 4RS5C 1REFA 3QCWA 5GLUA 4IEVA 2V09A 1MEC2 4EWAA 4HVOA 1GR3A 2R1BA 4K21A 2QKDA 2I45A 1YFXA 1ZBA1 3W9AA 2X5IC 4Y20A 2VVFA 3J4UH 2WS92 1PVC3 1FT9A 1NQDA 3BIWE 1FNZA 5CNAA 1A6CA 3ZFGC 1JH5A 1W6MA 1NE4A 1PIV3 2BGCA 5KC5A 3FJSA 4LBLA 5LK5A 3VDDC 3NV2A 1OPMA 2A7AA 4CEYB 4QMAA 2AENA 1MS8A 4XBQA 2R072 3HT2A 4HKOA 5GALA 1WW6A 2XL7A 3OY8B 1W0PA 2DCKA 5JZGC 5FMOS 4CZSA 4NPRA 4PQ9A 4JTNA 3KGZA 4UBGA 3DUIA 5J96B 1VBB1 3PVEA 4C90A 1FNYA 2BNMA 1SBDA 1PGW1 2HWF2 1LR5A 2WIIB 5A32A 1B09A 2I74A 5GLZA 1O5UA 3WDUA 4MXWA 1AR62 4WM7B 4YZ3A 3ZIXA 1G9FA 4AFDA 4AYUA 4FQ4A 3H1WA 1H2MA 3SITA 5EJ3A 5ACA1 4KWLA 4JGZA 2WSUA 4YVSB 4Q4Y2 5JOWA 4YARA 1HRV2 4AEDC 1RHI2 1OA2A 3KCCA 4I2OA 4NN0A 5I91A 2ZX0A 2P37A 3ZDSA 2A6WA 4Z07A 2YHJA 3EXUA 5L7OC 3KLSA 4C1WA 2EXJA 5L19A 3TRSB 3ES1A 4ORFA 4Q8LA 1GLHA 4ATEA 2X5IA 3IPVB 1ZZ7A 3ZFGA 1D4M3 1DQ2A 1CPNA 1XRUA 1RL3A 1S0DA 2MHFA 1V00A 1V6LA 4GH4C 1MQTB 3AP7A 4XJWA 1TQ5A 1LULA 1CGPA 4M0NA 2NM1A 4AVTA 3N7MA 4QT6A 4FAGA 2WT2A 1H9WA 4UW3A 5CU1A 2RS32 2A3XA 2EALA 3DPRB 4AK3A 4OI0A 3VBRA 1CJDA 3RYPA 4Q4W1 4U2AA 3E5XA 2MNGA 1BMV1 1N1SA 1R1A2 2ZX2A 2PN5A 3R0RA 5EXOA 1GZCA 1AX0A 2D3PA 3BCWA 4FSJA 1CAUA 4BOWA 4UW6A 1N3PA 4Y20B 3M1HA 2H6CA 2IXIA 5CFDC 4F8AA 1GQGA 4L99A 1KXGA 3JD71 1ENQA 4CDWB 2XJRA 1OA3A 2VOVA 1W6MB 1DZTA 2WNUC 1SACA 1PHMA 5HBAA 3AYDA 5C8CC 5FLJA 4EN9B 2JE9A 3OBRA 1N3OA 1CAWB 4QPGC 5T5OA 4XHBA 4HMZA 3O0XA 4LTAA 4JGYA 1LU1A 2QDRA 4FPKA 1QNWA 4QGLA 2HEWF 4PLNA 1H8TA 4DY3A 1G6NA 3MGUA 5GJ6A 3IDEA 3ZYGA 4TYSA 1VBA2 3N7LA 2DFBA 4F3JA