1RUJ1

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords RHINOVIRUS 14
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj100
2X5IB 5CFDB 5L7OB 4NWVA 1ND3A 4GH4B 4WM7B 2RS31 1R1A1 1VBC2 3TN91 3ZFGB 1EAH1 5C8CC 1FMD1 2RS11 3IDEA 5C9AC 3DPRC 2WFF1 1ZBE2 1RUH2 3ZFEC 3JB4C 1R093 5C4WB 1R092 1R082 5DDJ2 5C9AB 2RR12 1MEC2 1AR93 5D8AB 5CFCA 1VRH2 1RVF2 1PO22 4Q4V3 4CDUB 1NA1A 2FZ1A 3LOBA 1NA1B 5AC92 4N43A 1RUF3 5CFCB 1PO12 5C4WA 4Q4Y2 5BNNA 4PDWA 1K5MA 1MEC1 1MQTA 2WS91 3VBHA 3VBHB 1HXS1 1V9U1 3ZFGA 1AR91 3VBUC 2RR13 4YVSA 1K5MB 1RVF3 2RS52 5CFDA 1VBE2 1ZBE3 2RS32 1H8TB 2HWB3 1ZBA3 4CDUA 1NOVA 1POV1 4Q4X2 4QPGB 5ABJB 2WS93 2ZZQA 3ZFFB 1AR71 5K0UC 1VBB2 4JGZC 1QJY3 4YVSC 2HWC1 1RVF1 2HWD3 4IV3C 2FZ2A 1C8NA 1AL21 1ZBE1 1MQTC 1W39A 1EV12 4GH4A 4WM7A 1ND3B 1ZBA1 1COV2 3JBG1 5L7OA 1VBB1 4CDQC 1POV3 1VRH1 1RUG3 1QJX3 2DF7A 4FSJA 1DDLA 1AYM3 1RUC1 3VBRA 2HWF3 2PLV1 5FOJB 5CFCC 2HWD1 3VDDA 4Q4Y3 1VBD2 1VBD3 2R073 1RUD3 1HRI1 4RFT0 4RHV3 1POV0 5A33A 4JGZB 1NCRA 2TBVA 1VBA1 5JZGB 3J8F2 3FBMA 4Q4X1 4CDWB 1RUG1 1QJX1 2R042 2HWF1 2PLV3 4IV1A 1PGW2 2Y26A 1RUH3 4CEYC 4YVWA 4Q4Y1 3CJIA 4Y4YA 1RUD1 2R071 2RMU2 4RR3C 4QPIA 1QQP1 1ASJ3 4RQPA 5BNPC 2WS92 1ND2B 2HWF2 1VBA3 1PGL1 1VBC1 4RR3A 1B35A 1FOD2 1TME2 3HAGA 4FTEA 4AEDA 1RMU3 1HRV3 1NCRC 1V9U2 1COV3 3J8F3 2XPJA 3ZFGC 1QQP3 3VBOB 4FTBA 1PIV1 4RS5B 2IZWA 4GB33 3DPRB 1OHFA 2R061 1BMV2 1BEV2 2WFF2 1WCDJ 3ZFEB 3VBSA 1FPN2 2MEV1 4AEDC 4CDUC 1AL0G 2HWE1 1HRV1 1OPOA 1ASJ2 3CJIC 5AC93 2XBO3 1AYM2 1D4M1 1COV1 3JBG2 4GH4C 4WM7C 4CDQA 4IV3A 1AL22 4PDWB 4GMP0 3VBSB 2RS53 1RUI2 5BNNB 1RMU2 1HRV2 1AR83 1PVC1 1IHMA 1RUE1 2BPA2 4RS5A 2ZAHA 1HQNA 3VBOA 1R1A3 1HXS2 3TN93 5ACA1 2RS13 1B35C 1FMD3 2WLPA 1RUC2 1OOPB 5A32A 1BBT1 1VBA2 1X36A 2WFF3 4CDXC 1BEV3 2RM22 1PO13 1VAKA 4N53C 4Q4W1 4RQPC 5BNPA 1Z7S1 4AEDB 1B35B 1R083 2RS51 2BUKA 1AYN1 1F8VA 1RUI3 4RR3B 1RUE3 4N43C 3VBRC 4YVWC 1PO21 4RS5C 4CEYA 2WZR1 3M8LA 1RUF1 2HWE2 1AR61 2GH8A 5ACA3 1NCQC 3CJIB 5D8AC 4PDWC 5L7OC 1AR72 1BBT3 4YVWB 5C4WC 2BFUS 4GMP1 3ZXAC 1BEV1 1PO11 4IV1B 2RM23 4Q4W3 1EV11 1CJDA 1R081 5J96B 1FPN3 1HXS3 4CDWA 2RMU3 4CDXB 2RR11 1ND3C 1NCQB 1PO23 3VDDC 3JD71 4GB32 2WZR3 5K0UA 2RS33 4CDXA 1AR63 1TMF2 2HWB1 5ACA2 4Z92B 1C8M2 1VB4A 1C8M3 5LK7B 4CEWA 2XBO2 5ABJC 1EV13 1FPN1 2MEV2 2RMU1 4Q4V1 2HWC3 4CEYB 3JD73 1FMD2 2RS12 3VBFB 1RHI1 1ZBA2 3ZFFC 5K0UB 2WWSA 3S6PA 5BNNC 1MEC3 1C8M1 1GFF2 4Q4V2 1VRH3 3NAPB 5FMOS 5BNOA 1NY71 1V9U3 5FMOL 4QPGA 1VB2A 1AUYA 1FOD3 1TME3 2ZTNA 1VBD1 1SMVA 4WM8A 5DDJ1 2R062 1RHI3 1HRI3 4RHV1 3VBHC 1QJZA 1QJU2 4IV3B 2BBVA 4CDQB 4YVSB 3TN92 1R1A2 5GKAC 3JB8A 4Q4X3 1ND2C 1AR73 1BBT2 1MQTB 5BNPB 1RUF2 1PIV2 1QJY1 1RUH1 4JGYB 1FOD1 1TME1 5C8CB 5A32B 1OOPA 1AL23 5DDJ3 3VBUA 1RUE2 4N43B 3JBG3 1F2NA 1VBB3 4IV1C 5D8AA 1QJY2 1VBC3 3VBUB 5C9AA 1RUJ3 3NAPC 1H8TC 5C8CA 1M06G 1AYM1 1RUC3 1PGW1 4JGYA 1RHI2 1RMU1 2HWB2 1X33A 2BFUL 3J8F1 1QQP2 1AR92 4QPGC 1HX6A 4RQPB 1PIV3 2R041 2X5IA 3ZFEA 4QPIB 1RUJ1 1TMF3 3DPRA 5J98B 4WM8B 1RUD2 2R072 1BMV1 1AYN2 4JGYC 5AC91 4Q4W2 5BNOB 1D4M3 1QJU3 4EJRA 1D4M2 3NAPA 1RUJ2 1ASJ1 5JZGA 2HWC2 1QJX2 1RUG2 2PLV2 4JGZA 2R043 4FTSA 1AR82 1NY72 1RB8G 4CEWC 1PVC3 2GSYA 1TMF1 1NG0A 3VBFA 1NA1C 1ND2A 3VDDB 4N53A 4LLFA 1EAH2 4BCUA 3VBRB 2X5IC 2WZR2 3VBFC 1QJU1 1VBE1 1PGL2 4CEWB 2QQPA 5CFDC 4N53B 4WM8C 1Z7S3 1Z7S2 4GB31 3JD72 3VBOC 4NWWA 2R063 1AYN3 1A6CA 1RUI1 1HRI2 2MEV3 5BNOC 1NCRB 4Y5Z0 5A33B 1NCQA 2HWE3 1K5MC 1EAH3 2XBO1 3ZFFA 5ABJA 1VBE3 4GMP3 1PVC2 1AR62 4SBVA 4QPIC 2RM21 4CDWC 2VQ0A 1OOPC 1CD3G 2HWD2 1E57A 1H8TA 1R091 5JZGC 3VBSC 1AR81 4RHV2
chains in the Genus database with same CATH superfamily
1W99A 2X5IB 3UK9A 2XG3A 1CESA 2FDFA 3LKJA 2ZABA 1NAEA 4MHUA 4COVA 4GH4B 3VLBB 1W05A 1YI7A 5FY9A 1EAH1 4NIHA 4ET7A 5FBZA 5G05L 3THCA 3IDEA 2QQVA 1WKYA 2B9VA 3MUZ1 1OA2A 2DTYA 5FZ8A 4NHMA 3KHCA 3VZLA 3WCRA 3D3AA 2J1UA 3IT8A 4FPOB 3JQXA 4QXKA 3CLPA 5IVVA 3MIGA 3GBGA 5FZHA 1U5ZA 1H1MA 4M0NA 1UX7A 3ZDSA 1ALYA 2VAUA 3NJVA 1H1AA 1J58A 3LPFA 1R082 4OHVA 5C9AB 2RR12 1JUIA 1MEC2 1AR93 2B8MA 3AZVA 3TAYA 5CFCA 1RVF2 1PO22 1XNBA 3OG2A 4GXLA 2FCVA 2QQIA 2QZ2A 4NHXA 4AHYA 4GJZA 4N43A 4AQSA 1RUF3 3KCXA 4E8DA 5CFCB 2WNUB 1SDDB 2O1QA 5CNAA 3A7QA 1LOCA 2VQUA 1O4ZA 4Q4Y2 5BNNA 2Y6FA 2G9ZA 4XQ4A 4PDWA 3APBA 1LR5A 1W9SA 1K5MA 3JUUA 3O5SA 4YSFA 5C3QA 4OULA 3ZKUA 2W39A 5K7PA 2YV8A 4NAOA 4A4AA 5F3IA 2OX0A 2XR4A 1MQTA 4HSLA 3VBHA 4B7KA 4IE5A 1HXS1 3T2OA 5T54A 4Z1VA 1XC6A 2XL7A 1UZVA 3BUCA 4H7MA 1FI2A 1CX4A 3IN9A 1O4TA 2H6CA 3ILRA 4LHLA 1MACA 2FMYA 4U36A 2VTXA 4MLOA 1DU3D 5CEHA 1MS0A 4OHZA 2HWB3 4C90A 4ASMB 1BVP1 4HN0A 1V6KA 3W9AA 2ARCA 1YIFA 2W46A 4GULA 5JIUA 3UJOA 5F9TA 2XH6A 2ZZJA 4QPGB 4COUA 4XJ9A 1GSLA 4GALA 3ZXDA 2O14A 2ZZQA 3HNMA 2VU9A 5FUNA 2GAUA 5DXDA 1VRBA 3WXPA 4FOVA 3H0OA 1BJQA 1ZRDA 1QJY3 4YVSC 2HWC1 3LGRA 4MGZE 4HVQA 2UURA 2XOMA 3N9NA 1JYCA 1SACA 5FO7B 5EFUA 4ES9A 2AEZA 3H8OA 4DO0A 2SBAA 1MPXA 1ZYBA 4YLZA 3OJBA 4WM7A 2FDKA 2DUQA 1ZBA1 3JBG1 5BY5A 4BOWA 2C24A 2D3RA 3ON7A 1VBB1 2VCMA 1MZ6A 1POV3 4AZZA 3FC0A 3RWNA 1VRH1 4QX2A 4DQAA 4DRRA 5HCAA 2XVKA 1QJX3 5JPNB 2BNMA 3KZ4C 4W4ZA 4JRAA 2JDKA 2D43A 4META 5DUVA 3VBRA 4EYUA 4B1LA 5FYHA 1OC1A 4AL9A 2RDSA 3H1WA 5I93A 5CFCC 1B09A 4S2FA 2HWD1 1W90A 1VBD2 4HLTA 3ZN5A 4MG2A 1MZFA 2QDNA 3EBRA 1GOFA 2CV6A 1S2EA 2VJXA 3B00A 2JX9A 3IM0A 4TSVA 1WCSA 1XSQA 2VTFA 4JGZB 4LA3A 5KXDA 3LA3A 1CAWA 3LB9A 5GM0A 1W6OB 5I0RA 4TLGA 4J1WA 2BW8A 1S0DA 2BNOA 3FBMA 4EZHA 2YBSA 1E5IA 3BPSA 3MF9A 4LULA 4F7ZA 4Q4X1 5CG8A 2ZMKA 4YZ3A 5A7WA 2VZQA 2VMEA 4CP0A 3W58A 5JDBA 2VMCA 5DG2A 3WP3A 5FUPA 1IG3A 4IV1A 2W92A 2YHJA 3OBAA 2Y26A 4ZPIA 3VV1A 1NX9A 4YVWA 4Q4Y1 2YC0A 2BGCA 2VW0A 4AE2A 3LQCA 3BKZA 4QX1A 1A8MA 5SV8A 2R071 3AMMA 5LBCA 5AVPA 2RMU2 5JMCA 3D8CA 4RR3C 3ZR6A 1JODA 1N3PA 3I2KA 2X8KA 2RV9A 5T50A 3AMPA 3I2HA 4Q8KA 4CUAA 1PGL1 3ACHA 1CAVA 1OI6A 4BXFA 3BU7A 4LE3A 3RNSA 1MZ5A 4YYOA 4RR3A 4WZCA 3B93A 4OZOA 3V56A 3O14A 1F4AA 1LHVA 1LOAA 1B35A 1FOD2 4CCLA 1DQ1A 2AH2A 2VPVA 1UU4A 3HAGA 2BGPA 4K6BA 3KSCA 4Z2AA 3AVRA 1LJ7A 4D0QA 5FY8A 4D6RA 3DCQA 4NIDA 1RMU3 1XE0A 1J3RA 2GZWA 2DURA 3CIHA 1ZRFA 1R1ZA 3PL0A 1H6XA 5ERLA 2ZAAA 1NCRC 2A71A 4R52A 3UETA 1V9U2 4AVVA 3WDXA 1ENRA 2XPJA 2P6CA 2ORXA 2WJSA 4PCRA 3ZFGC 3UKVA 1NLRA 4BQ1A 1GP5A 2Y6LA 1OHFA 1O3SA 2A73B 1BMV2 1JHJA 1UYXA 3MHZA 1DZQA 2PHXA 1DFQA 3VKLA 1NXD1 2IC1A 3MV01 4LQRA 1MZEA 3WVJA 4AEDC 2WUHA 4HL0A 1U5IA 1AL0G 1UWWA 4LR4A 4OMCA 3KCYA 3V0BB 1GP6A 2WNVC 2WFPA 4UXAA 4K8FA 1OURA 2V4VA 3N9MA 3PU3A 2E7TA 4ZS3A 4CU6A 5AC93 2JIJA 4WM7C 3LOBA 5JR7B 1QOTA 1F9KA 3HQRA 1DYOA 3OCPA 1HN0A 2Z42A 1AL22 2E63A 2SLIA 4H2AA 1VIWB 3GGLA 3JZVA 3USUB 1RMU2 3ENRA 4YARA 4PI2A 1PVC1 1IHMA 1WZXA 1GNHA 1RUE1 2QQUA 2RDRA 3N9OA 5F2WA 4Z2WA 1WCUA 4PBPA 4BJ0A 1G9AA 2XLGA 3SLIA 3AP6A 1HQNA 5IJRA 3DYOA 3RSJA 3T4HB 4QXBA 1PMHX 4YW3A 1HXS2 3TNPB 2VMFA 3ZPYA 3RZJA 4O7XA 4D69A 2B4KA 2VUCA 4UT5A 2WLPA 1RUC2 3LSEA 4CSWA 3WDWA 5LA0A 2W3JA 3W5NA 1BBT1 1RJ7A 2NYYA 1JUHA 1SLBA 2R0FA 1JZ4A 3AMQA 1NE6A 4JV4A 1CIWA 4OI2A 3MW3A 4Q4W1 1W8WA 1Z7S1 3RVHA 1BYHA 4YGDA 4AI8A 4QKFA 1R083 2VNGA 2BUKA 4CU9A 4JAAA 1YFYA 1GV9A 1AYN1 1LU1A 1RUI3 3K4ZA 4IETA 3ZXGA 1PZ7A 1F8VA 3ACLA 2PELA 2WN2A 1BK0A 2KM2A 3HVDA 3WG2A 2B45X 1PO21 3S57A 4RS5C 2FDIA 1XNKA 2WZR1 5I91A 1GZWB 1RUF1 4LIVA 5JCTA 1JZ8A 2HWE2 1AR61 1J3PA 3WV6A 1S0GA 4MXWA 4XDOA 3K3NA 3CJIB 4YG0A 4IEQA 1UW8A 5D8AC 3RZZA 4AQ6A 3H8RA 2XMLA 5FP4A 2QE3A 4BU2A 2BFUS 1FV2A 4FCAA 5A3MA 4I02A 4Q2FA 4Z8BA 1H9PA 1EUUA 1V6OA 5J96B 2PFWA 1HXS3 2W47A 1XNCA 4UBGA 3FHAA 3IKWA 1HQLA 1GU3A 4GB32 5C5TA 1PGSA 5IK5A 3EYPA 4WV8A 4FPEA 4E4ZA 3T0BA 3POYA 3FZ3A 1DYKA 3ZM8A 1HJGA 2E7QA 2HWB1 2YROA 5ACA2 4PT6A 3GJBA 5FZFA 4AVBA 2RDQA 1QKQA 3VKOA 4IQPA 3J7HA 1PK6C 4AAPA 3KF5A 2XBO2 3VD4A 1EV13 1ENQA 5T52A 1QNWA 2W0XA 1FPN1 2MEV2 1JW6A 2ZCWA 4XACA 3N7KA 3WT3A 4XFBA 1W2TA 2VQAA 1YEWA 2W91A 4FI9A 5A3TA 2EIGA 2HWC3 4CEYB 3JD73 1VAVA 1FMD2 2RS12 1IS5A 2JDPA 1W6PA 2IXIA 3B94A 5FYIA 5FPVA 1DIWA 3I97A 1GKBA 2W87A 3SH3A 3OF1A 1ZBA2 3WP6A 3ZFFC 1UYPA 2WWSA 1KD7A 3N9PA 2W1SA 1V6IA 3MPBA 4NROA 1GFF2 4PF5A 4URTA 4Q4V2 3HMYA 4YW4A 1VRH3 1PVXA 3BI3A 3OEBA 5FMOS 4DXRA 2MNGA 3O0XA 1RITA 1QXRA 3GYDA 1W9WA 3AFKA 4QQLA 2UWBA 3PJYA 3KHBA 4NE9A 1LB2A 4BQ3A 2WT2A 3ZVXA 2KR2A 3E5QA 5B2GB 4K40A 3J7LA 4XURA 3VZOA 3H3UA 1APNA 2O8OA 5FBJA 3MLKA 2R062 4Y33A 4MXWB 4HSJA 3RQ0A 5LY1A 3T2TA 3ZN4A 4HFSA 1QJZA 1GZWA 4GAZA 3VBHC 4LBQB 2GNMA 3SMHA 4IV3B 3WDYA 4AFMA 2BBVA 3KV6A 4A3ZA 3WR0A 1Q8SA 1G9FA 1OVSA 4LPLA 3R4DB 4NRMA 4AVCA 4Q4X3 5A3WA 1H4HA 3NO8A 1AR73 3M3EA 3MIFA 4KI5M 4NPRA 4IERA 1PIV2 4A2UA 1KEXA 4NUBA 5JOYA 2GMMA 2QQWA 1S55A 1TME1 3TEXA 1AHSA 4HETA 5JSOA 1AL23 4BM8A 5JI9A 5DDJ3 3CZJA 1LGCA 4Q27A 3WF4A 1SQ4A 2CTVA 4KL1A 3IAQA 4H14A 4OYUA 4R4XA 3AB0A 4CPBD 2OIIA 4HANA 4XCBA 4EZ4A 1OUXA 2QFEA 3NNLA 5L9RA 1U5YA 4YGEA 2FD8A 1L7QA 3VBUB 1LGBA 4DY3A 2BRTA 2J1EA 4JX0A 1M06G 1AYM1 1RUC3 4K21A 2P3YA 4UWDA 2IWGB 4XCAA 1RMU1 4CU7A 4LUMA 1W2UA 1Q8QA 3A23A 1PM7A 4QB2A 2PMWB 5A1AA 1X33A 2HKXA 4QX7A 3CU7A 4PQ9A 4DOUA 1JOPA 3E6CC 4I0AA 4XXPA 4DEVA 4QQHA 1LKNA 5L73A 1TNFA 3CHXA 5FZCA 3I3MA 3LD8A 5FXXA 2EAAA 1HLCA 1CWPA 1WD4A 4Y1VA 5IFPA 3PUQA 3WNPA 1LHOA 2ZX4A 1QEXA 2WWJA 2XL9A 5FYSA 3RFRA 4A45A 4YM1A 3I2JA 5E8AA 5J09A 3I49A 4XUTA 3EXUA 2W1QA 2WC2A 1YLLA 1BMV1 1YCIA 3ZSEA 1AYN2 3RGBA 3LDRA 3WEZA 3C7FA 1UU6A 2BVVA 4CCDA 3T08A 1GP4A 5AC91 3PTRB 1WCQA 1QJU3 3W59A 4GKXA 4EJRA 3AMHA 4FFIA 5FZOB 5IVCA 1F5JA 2JJ6A 3T09A 4TWTA 1JZ5A 1XE7A 5FMBA 2UYBA 3SCGA 3WW4A 4AI3A 4QPWA 4KG8A 4LT5A 2VOXA 4IEUA 4JTOA 5KR7A 5FZEA 4CEWC 1PVC3 4XF4A 1CAUA 1MS4A 1UQXA 2Y6KA 3ASIA 3NJZA 5FR3A 2VG9A 3GZTB 4YW6A 3VBFA 3G7DA 1UAIA 2XGXA 3OD0A 1GZCA 4CTEA 4YZ1A 1EAH2 5EPAA 3LIHA 1OBNA 4BCUA 4AHXA 4MGKE 2WZR2 3VBFC 5I8YA 3ITQA 2PHUA 1ST8A 4QPYA 3VZKA 4LIUA 3O1SA 1OSGA 1UYYA 3ZIWA 4Q0SA 1PGL2 4FFHA 4CEWB 1JYIA 5CFDC 4LKDA 4WM8C 4F3JA 1JI6A 2RJ2A 3DGTA 1Z7S3 3LIGA 1A8DA 3JD72 4FOQA 2JDUA 4IEVA 5GZDA 3V64A 3VBOC 3W21A 4I3PA 4ZZ8A 1AYN3 1A6CA 1RUI1 3OGGA 3DL3A 2NZ9A 2XVGA 3B9CA 4QU2A 5DABA 1SLCA 3U4SA 1X9TA 1W6OA 1CAWB 1YUDA 2B7YA 3BIEA 4XQWA 5FZIA 3HPNA 3VZMA 1UYZA 5KHJA 2CNAA 1AX0A 4DUXA 3LEIA 4MO3M 3FN9A 1W8HA 3MGUA 1GNYA 3ETPA 3IMMA 5LEJA 3OPTA 5ABJA 1X8EA 1RYYA 1VBE3 3MIDA 4DXTA 2K46A 3K46A 2D44A 1JHNA 2AENA 5EJ1B 5CVRA 1GNZA 3N7JA 2HWD2 3RS6A 4AFCA 2VOKA 2VECA 1JBCA 4IUGA 2X29A 3QCWA 2ZEYA 4EE2A 3AZZA 3THDA 2OA2A 5E89A 3VHOA 1VMFA 4UI9L 4GWJA 4XFFA 2DUPA 3TOJA 3H9AA 3WW2A 4WM7B 1Y7BA 5C8CC 1W9YA 2ZMNA 1FMD1 1VALA 2C26A 2I07B 2RS11 2UWCA 4RN5A 5DAVA 5FMDA 3WQ1A 2PAMA 1F4HA 5C9AC 5FXWA 4OQ8A 4FXKB 4B1MA 4M00A 4XZUG 4YWAA 1DGWX 5T3NA 4RSUA 1RUH2 1W9TA 2HYXA 2UY8A 4KG0A 1KQRA 2AACA 1URXA 2AREA 3HBZA 1JMUB 1VMHA 5GZFA 1G86A 4XF0A 5C4WB 2G19A 4FPLA 5FZGA 3WDVA 2JDAA 5FYTA 3SISA 2WBKA 1VRH2 1K45A 2VVFA 4MGYE 4AXOA 1NA1B 3AJZA 3I3DA 3I4IA 1U12A 1YFWA 1UOGA 5AC92 2PAEA 3B7MA 4N90A 4DIQA 1FNZA 4BK5A 2J22A 1N1TA 2PAKA 4IW3A 1QMJA 4LHSA 2FHRA 4OVEA 3V0AB 3UJQA 4CRQA 1BK1A 4CP2A 3ILNA 3IWZA 1UX6A 5C3RA 2EIEA 2TUNA 1V6MA 2VUJA 2WS91 1XE8A 2JENA 3F2ZA 2CU5A 3GHMA 4OI4A 3VBHB 4BQ4A 3LA2A 3UGGA 3WY6A 4AK3A 1DYPA 4QX5A 2ZEXA 1AR91 3POSA 3K4DA 3FHQA 2RR13 4MXVA 4IEYA 1ZM1A 4R9DA 3O1VA 3RYPA 1K5MB 2RS52 3LPGA 5FY4A 2GU9A 5CFDA 3NNFA 1Y43B 1BHGA 2Q4SA 5EIYB 1AXZA 3GALA 1ZBE3 2RS32 4E4DX 3MIBA 4IGQA 3T30A 3WX5A 2WNUA 4WZFA 1LOFA 1OD5A 3K77A 1ZX5A 3SKVA 1DGRA 1NE4A 1LU2A 4BB3A 3N36A 3MDPA 2KD7A 3ZFFB 2R16A 1AR71 2YG0A 4Y1YA 5FLHA 1QJFA 3ZXJA 1IGOA 1SFYA 3ME2A 3I3BA 1UXZA 4JGZC 2WT0A 2YB7A 4PIYA 4QXCA 1IPSA 2HH9A 3EQEA 3PNAA 4LORA 3TNQA 2FZ2A 1C8NA 1AL21 4XTPA 3IIIA 3T0AA 1W39A 4IXLA 4GH4A 4RFRB 1UKRA 4NRQA 1COV2 4Y3OA 5FXZA 2XVLA 2P17A 3AZXA 2DWRA 2QQLA 2VM9A 4CDQC 1C4RA 2BERA 4LOSA 5L19A 1YHFA 2Z69A 2LW8A 4IE4A 4PF1A 2MPFA 2EXHA 1MS9A 2DF7A 4LNVA 2CGOA 3B02A 1AYM3 1RUC1 1DDLA 3ZIXA 1CZTA 5DUUA 4DINB 1W3XA 2JG8A 3DYMA 3PVBB 4Y5SA 2H0VA 4P14A 1IPJA 2V5YA 4LE4A 4RYDA 4CCOA 5I0DA 4R9BA 2BGOA 2E7AA 3I54A 3O12A 1AX1A 2BVBA 5I0TA 4JZRA 5F37A 2D40A 2IVIB 4AI9A 4PLNA 3M7AA 1I9RA 3QOPA 5HPOA 3PU8A 3OGSA 4DPNA 3GBFA 1NCRA 4A41A 4CZSA 2QQKA 3CO2A 3ZLIA 3ZX7A 2BOIA 2CWSA 1SLAA 4FPYA 5FZAA 3BTYA 4CUBA 4R8HA 1QJX1 2ZGLA 5GLZA 3POBA 2R0HA 3B3QE 1U0AA 3ZYPA 4LITA 4M3CF 3PUHA 3LDKA 1PGW2 4UBHA 4AHWA 2XQXA 1DQ4A 1RUH3 1REDA 1SBDA 5C3PA 3SEEA 1GR3A 4YZ2A 1G9BA 1WCKA 3HT1A 4YGCA 2BDRA 2OZ6A 3CJIA 1UIJA 3IB3A 3ZMNA 5JUVA 5DN2A 1MVEA 2CDOA 3MV11 1WD3A 1OA4A 5BNPC 4G4FA 3J7MA 3U10A 1QDCA 3ZYBA 2VULA 1IPKA 1HN1A 5EYXA 2VBBA 1YC61 3H3ZA 2JG9B 3AKRA 3S7EA 1OH4A 4A44A 5IVEA 5IVFA 1TME2 1VPHA 3PHMA 3ECQA 5FJKA 1LOFC 2DFCA 3PURA 5LA1A 2QNKA 5E16A 1W2OA 1Y9GA 4OUMA 2P6HA 4O61A 3TEZA 1LOGA 4FAGA 1JS9A 4K1YA 4PLMA 5DZEA 4AFBA 4L92A 1PK6A 1COV3 4J6GA 3CEWA 5F32A 3NV2A 3ZDVA 4CXYA 1ZRIA 3AZYA 2ZX3A 1HB1A 2GP5A 4XF1A 5GLUA 2ORZA 1MVQA 5I0UA 5C5UA 3AP4A 4ORFA 1YQCA 3E6DA 5J7MA 5LCWL 4AQTA 4AGVA 1W28A 4XOGA 3SCFA 2P4EA 4FFGA 4P08A 1OPOA 2WO3A 5IVBA 3AP5A 1ASJ2 2ZGKA 1LECA 2GN3A 3FMGA 4I01A 1CAXA 1FV3A 1I5PA 5EP9A 5EQUA 5CB7A 3JBG2 4GH4C 1O3TA 3ILFA 2DCKA 4HT1T 2DBIA 2JECA 4BE3A 3W5MA 1O8PA 2NLRA 3V0BA 1TEIA 2A6VA 2A7AA 4AFAA 4Y4RA 2JB4A 4NRPA 4CDQA 1RUOA 3WNLA 4M4PA 4GMP0 4P9XA 2RS53 5C3OA 2D98A 1LRHA 2G1MA 1XNTA 1F35A 1HRV2 3ACFA 3FL7A 3WF3A 3FFZA 1QH6A 2BPA2 1R64A 1KRIA 4YG6A 1X82A 2X10A 3VL8A 3ZXLA 2AUYA 3CQOA 1GZ9A 3I2GA 5ACA1 2HLEA 2YU2A 3O0WA 1B35C 1FMD3 2RS13 2I2SA 3OUIA 2R6QA 3E97A 4JDMA 3TRSB 3VHPA 5T5PA 3ZKYA 4NHYA 3LDBA 4HMZA 2Y6JA 1F5FA 1X36A 4XYXA 1BEV3 2IXLA 1LHUA 1VAKA 3AX4A 5GLTA 1PMJX 4QHOA 4BIFA 2GH2A 5BNPA 1U5XA 5HXVA 4DS0A 1B35B 4RR3B 3C8XA 1W0OA 2BV4A 4RL7A 3B9IA 4P5YA 1RUE3 1IS6A 1GYKA 5AVAA 2ERFA 1XOYA 3VBRC 2Q5TA 5A6YA 5JPMB 1TVGA 2FBEA 3A21A 2CSGA 3KT4A 3O1PA 1RGSA 4K20A 4MV2A 2J1RA 1KS5A 2Y0OA 1NCQC 1LOEA 2DVDA 2QQOA 5L7OC 1DZTA 2P3JA 3A22A 3AM2A 1BBT3 3AYAA 1YIPA 3OSDA 1GANA 4GMP1 4YVWB 3WF1A 1EYBA 5EJ3A 2Q0AA 1RL3A 5FZLA 2X05A 3ZXAC 4Y1UA 4IV1B 3B01A 4F8AA 1BXHA 4Q4W3 2K2SA 2F4PA 1XYPA 3HD8B 1W04A 2QVSB 1R081 3VD5A 3W20A 2VTXJ 3ZN6A 4BPZA 2E53A 1OFNA 2JICA 2OXBA 1LOBA 5DPNA 3ZYIB 4CDXB 2RR11 4IGPA 4ISRA 3ZYFA 1PO23 2JD9A 5CG9A 1I1EA 4I09A 2WZR3 2YBPA 1BQPA 1UY0A 5ANQA 2RS33 3KD4A 3UESA 2EF6A 1AR63 2Q8EA 1JU3A 2DVAA 3NL1A 4YW7A 3HJRA 3HNYM 2D6MA 2JIGA 2R49A 2VW1A 1RXGA 4LBOA 4AYUA 2I74A 5JOZA 2VOWA 4NAMA 5FOBB 2E26A 3AC0A 4BIOA 3HN1A 2DU0A 3OBRA 4AQ2A 4HKWA 5GZCA 4D3WA 5J48A 5FK8A 3KMHA 1O91A 2WO2A 4GIQA 4ARYA 4ZU7A 2XWBB 5C70A 4AI0A 3NNGA 3ZYHA 1MS5A 1CJPA 4N7UA 1S1AA 3AP7A 5H9QA 1TZOA 5K4LA 1HIXA 2HYKA 3AKSA 2JG9C 2JDNA 1GQPA 3JQWA 3BPZA 5B4XA 4OHWA 3DKQA 4XVHA 3S0MA 2Y60A 3ES1A 3AK0A 5JSPA 4DRVA 3GHNA 5BNNC 4XJZA 3O1MA 1UPSA 3NAPB 4J1XA 1C5HA 3P3PA 4UW3A 3T2PA 4C8DA 4CCKA 3R05A 3CKHA 3GF6A 2IXKA 1NY71 3RG0A 1V9U3 2W1WA 3VDBA 5FZ6A 1XJAA 3RZLA 4K8RB 4XFIA 4QPGA 5FMOL 5AFBA 1Q8OA 4IE0A 5CKNA 4HG6B 4XTMA 2E32A 4GWNA 1OPMA 4D6SA 3MIEA 1SFNA 1SG3A 2VR4A 1V70A 3NV3A 4WM8A 3VDAA 4D6QA 4D94A 1QGLA 4ONUA 5FZKA 3ZSJA 4Q26A 1DGWA 5F5AA 3WQBA 4BISA 4O65A 3BIWE 1QJU2 5KHHA 4BQYA 5LK5A 4CP9A 1KFUL 5FPLA 3J9SA 3VHRA 3TN92 1R1A2 4XJ8A 3JB8A 3LAGA 5F3GA 5F8PA 1ND2C 1MQTB 4Q0PA 1Q3EA 3IPVA 4D7SA 2VXRA 4MHRA 3BALA 4JTNA 2VMHA 3RPQA 4V2WA 1RUH1 1YQ6A 2DVGA 2Y0IA 4UF0B 5C8CB 5A32B 2A3YA 2ZEZA 3TWIA 3UNPA 1CONA 1O7FA 3TB0A 2ZOEB 4N7IA 5K8SA 1EPWA 2PQQA 1RUE2 3IDCB 5JI7A 1LHNA 4Y20B 1YRZA 3K2OA 4N43B 4XJAA 3UGFA 5A7QA 5IT6A 4QXHA 1F2NA 4FVVA 4D7YA 4CXXA 1PMIA 1YI9A 2YYOA 2OYZA 3WF0A 1OF4A 4Y20A 1DG6A 1PX3A 1NT0A 3KGZA 4W65A 5C9AA 1JZ6A 2NP0A 3SH5A 1H8TC 3GM8A 3U0ZA 2WZPP 1C57A 5FYVA 1GLHA 5C8CA 3PMEA 3THPA 3OGVA 4XETA 3UGHA 2Z5WA 2A6YA 1K3IA 5T5OA 4M01A 1P8JA 3P5BA 2HWB2 2PN5A 2E51A 3I59A 2ZKLA 1V6LA 2BFUL 1J59A 1LEDA 5H9SA 4NJ4A 2NN8A 1AR92 4CUGA 1JXNA 4S2DA 2WT1A 1H2KA 2OT7A 4CP9B 1HX6A 2Q30A 3I3EA 4RQPB 3MPPG 2X5IA 3ZFEA 4QPIB 5CBLA 3OEAA 2BJSA 3U37A 4BQ5A 3EJKA 2ZA9A 2QCSB 3DPRA 3GXUA 3MBWA 1OVPA 2Y33A 3H50A 4WM8B 5J98B 2ZXQA 3IZOA 5C33A 4QKBA 1N1SA 4QWNA 2LALA 4QU1A 4E2GA 1G9DA 4IE6A 4MADA 1RUD2 3UV9A 4Y22B 2VNOA 2AGSA 1EPZA 2NMNA 3VD9A 1ZZ6A 2ZX2A 1SPPA 4KGGA 1N1YA 2VGDA 3NAPA 5L36A 2RE9A 1JYNA 3OD4A 1RUJ2 2FCUA 2VUDA 1ASJ1 1H2NA 2BQPA 1W8OA 2ZGMA 3H1MA 4H3WA 2YC2A 3UT0A 1MS3A 4XAAA 1QJX2 3Q8FA 2JB8A 4L99A 2PLV2 3GJAA 3R4UA 3H7YA 2KXLA 1W8FA 1NY72 2QDRA 1O59A 1J1TA 1DCSA 2FCTA 4XC9A 3LF7A 5SV5A 1SCSA 3D5OA 1W2AX 2BU9A 4NPLA 2K0GA 5FJHA 3OGJA 1NA1C 1ND2A 1HW5A 3VDDB 2D3SA 3BOWA 2JXAA 3ACGA 1TE1B 3N4MA 4YW2A 3MLJA 2J7MA 4W6XA 3ZR5A 4W6WA 2JD4A 4TYSA 4DXSA 4MYEA 4JHTA 5M0TA 1QJU1 1N47A 2A70A 4PHZA 3IMNA 4XHBA 2Q8DA 4N53B 4QX8A 2VNVA 4CA9A 4LOTA 5FAXA 3G6JB 4GB31 4EN7B 1S0FA 3AKTA 2BTVC 2WQ8A 1VJ2A 2JKBA 3K75B 3OOXA 5IK7A 2ET7A 1HRI2 3KV4A 3TEYA 2VZ1A 4QDQA 5BNOC 4XFAA 4LXLA 4XFGA 4Y5Z0 4EWAA 1W6NA 4UFHA 2XLFA 3U75A 2HWE3 4AEMA 4FOYA 5KWRA 1GOHA 2J1SA 2NPIA 1JYVA 2XBO1 1E5SA 2D6PA 4LO4B 5LY2A 2YUEA 1ODMA 1E5RA 1ULEA 3C7GA 1RXFA 4GMP3 4OI1A 1OKOA 2ZHLA 1W8TA 1AR62 4SBVA 3IIAA 4XF3A 3BU0A 2Q8OA 5A3PA 1WA4A 2JE9A 1UMIA 2VQ0A 1F15A 1ULFA 4CDWC 4EN9B 5IK8A 1BKZA 1H8TA 1R091 5JZGC 1DQ2A 4Q0QA 1AR81 2YGLA 3VBSC 5FQ0B 2EALA 4QGLA 3PDQA 2X09A 4XHXA 3VD7A 2BP6A 4LBKA 5FY7A 3QLQA 1NQDA 4OQ9A 4NWVA 5L7OB 1ND3A 5J37A 1RTVA 1KDMA 1R1A1 2RS31 2VZTA 4H7LA 4UFIA 2B42B 3TN91 3ZFGB 1K42A 3ZPOA 2B5HA 3VB9A 4D7TA 5FY0A 4CCJA 3DPRC 1W8UA 4A7YA 1O4YA 2WFF1 4IDZA 4Y26A 1PX4A 4AHZA 3ZFEC 1UY2A 2H6BA 4QQOA 1DLLA 2P3IA 2TEPA 3C3VA 2XONA 4GJYA 5CU1A 4QX0A 1R092 4KWJA 5A7SA 5DDJ2 4CCMA 1X9PA 1W6MB 2ZKNA 4OZXA 2WSUA 2WZEA 2B46X 5D8AB 1ZNPA 2ENRA 4CDUB 1VMJA 2FZ1A 3DXUA 1NKGA 4OCTA 4QGNA 1S0IA 1PO12 2L9LA 5FZ0A 4LHNA 3DN7A 5ANNA 2KA3A 4AI2A 1D2SA 3RZGA 5KHGA 4M3CA 2ZGRA 3H1YA 4YW1A 2XUMA 3SITA 2E6VA 4MX3A 3UKNA 3WSOA 2VMIA 3LEGA 5FYUA 4CVUA 4MH0E 5FP9A 1ZA7A 3LSDA 3WG3A 3ZSLA 1CAXB 4MZUA 1XRUA 2O8QA 1CPNA 1V9U1 2W5FA 3B5LB 4O9EA 1WMDA 3ZFGA 4YVSA 5DUWA 4AVAA 1RVF3 1YFUA 2C1FA 4QB6A 5ISLA 1VBE2 1N1VA 1N3OA 5DAQA 3PTYA 5FQ0A 2AYHA 4FBFA 1UZWA 1WBFA 1XYNA 1H8TB 4KGQA 4OMDA 4Y1XA 5LBFA 3WINE 3WLUA 4B4QA 4N9HA 4COZA 3WUDA 3VUOA 4MGIE 3KB5A 4EN0A 3ATGA 4AGGA 4Q4X2 1IS4A 4KWKA 4NO4A 2OKXA 4CCCA 2ADDA 4ES8A 2WS93 1PK6B 3NSTA 4OUEA 5LB6A 4MGTA 3POWA 1AXKA 5JR2A 1O3RA 3D6EA 2OUJA 3RDIA 2ARAA 1VBB2 4INDA 4L97A 3WG1A 3ZYJB 1YO8A 3P3NA 1LGNA 1W6QA 3KGLA 3WG4A 1UO9A 2OS2A 1UKGA 1MQTC 1V6JA 1ZBE1 2Z4FA 1H8VA 1SBEA 1EV12 4HXCA 5LRRA 3VZJA 5J3UA 2ZGPA 2TNFA 3PLQA 4LTAA 1OD3A 2ZGSA 3I3QA 1T6BX 5HV0A 2BNNA 3KT7A 5JWPA 5LA2A 1RUG3 3BODA 1J1LA 4FSJA 4XF9A 3DXTA 5CZKA 4M3CE 4GZ9A 2HWF3 1I5ZA 2PLV1 4QGMA 4ZONA 5FY1A 4UFMA 3MYXA 2W95A 5FOJB 4ATEA 1X7NA 3NJYA 2JDYA 2D7FA 3POJA 4RD7A 3VDDA 5I8TA 1PNFA 5IHRA 2HBUA 1PHMA 2WYFA 1OT5A 3I2IA 1RUD3 4HK8A 1HRI1 4RFT0 5A7NA 5C7GA 1VLNA 4FXGB 3L2YA 5A33A 4P9GA 1ACCA 1GZTA 4IEOA 2WDBA 1VP6A 4CUCA 1VBA1 2VZUA 2ES3A 5JZGB 3C7OA 3OBZA 1H1IA 2RG4A 4QMAA 4CDWB 1SPPB 3Q8CA 5JXJA 1ZVFA 3DKWA 4FP2A 5A7PA 4UFJA 4BWOA 5F1RA 1UIKA 3HEIA 2ZGQA 4PQQA 4TN7A 1O3QA 5D21A 3U14A 1CR7A 3CF6E 2YFUA 4XXAA 2CAVA 2BYVE 3ES4A 2WNVA 4I3GA 3USSA 4EWDA 2EA7A 4RGKA 4QPIA 1QQP1 4XILA 1ASJ3 1N3QA 3KQRA 3POFA 4RQPA 3ORJA 2E33A 3C7EA 4PLOA 4X8NA 5T5JA 4AVSA 2WS92 3ZO0B 2HWF2 1QDOA 2XB6C 2Q1MA 3AL6A 3URFA 4BZ4A 1VBC1 2C0ZA 4QQ2A 5CIRA 5D2AA 4ZKTB 5C4WC 2LUWA 1S0CA 2Q1ZB 3INAA 1GQHA 3N9QA 3I59B 3I7DA 4AEDA 1UN1A 2PHFA 5CADA 1Y9QA 2ZGOA 5A80A 4KBZA 1HRV3 2WKKA 2J1VA 4N9IA 4WVMA 3CL1A 3WNKA 4E9KA 4AGRA 4C0BA 3J8F3 2IFRA 1OKQA 1QF3A 3OY8A 5IAVA 2ZHNA 4JKKA 5FPZA 4LK6A 4FTBA 3NNJA 5KHIA 2XJQA 2IZWA 4GB33 2VCCA 4B29A 2ZGUA 2PA7A 2A3WA 4HPKB 4LBQD 1BEV2 1RJ8A 3QACA 2PXJA 2VXJA 2DYCA 2JE7A 3VBSA 2W9XA 3DYPA 4UF0A 3KWVA 3SC7X 2HJIA 2YU1A 3VDCA 3H7JA 4DNYA 1JYXA 3RZKA 2HWE1 2JG8C 4OHYA 3IPVB 2ATFA 4E4SA 1OQDA 2XBO3 2Y6GA 4MUVA 2I45A 4LBLA 5IUQA 1COV1 4QHBA 1DZRA 3RYRA 3BYWA 3FJSA 2A3XA 2J42A 3V0AA 1ZZCA 3N9LA 3LOIA 4ZXEA 3HT2A 3P1IA 3PVNA 1SFPA 2AZ5A 5CYYA 2P5BA 2WRAA 4X6RB 1WLWA 1AR83 5JLVA 2UYAA 3A0KA 1YQ8A 2OW4A 3E5UA 4RS5A 3N7MA 2ZAHA 4XFCA 4Q0VA 1IQDC 1HB2A 3VBOA 4E4HA 3PJQA 4DEQA 1R1A3 5LATA 4L2NA 3Q9OA 1GQGA 3TN93 4W6YA 4WVVA 5A6XA 1OOPB 5KC5A 2CY6A 3RI9A 1HKDA 1YWKA 3E1F1 2WFF3 3OYWB 4M0HA 2DCZA 4NHLA 1S2KA 4RA0A 2RM22 1PO13 2CHHA 2VOTA 1OQEA 4BMEA 1STMA 1UY1A 2RHPA 5FPBA 5CA6A 4RQPC 1YYNA 2DUOA 4XZPA 4IEXA 2C9AA 3PVOA 5K9YA 2RS51 2LRPA 2CGNA 4YM0A 4V1PA 2QQNA 1LEMA 3T3YA 4FQ4A 3TEWA 2XJVA 2WA3A 2QBXA 2BWCA 1FAYA 3GCXA 4N43C 4UFKA 4WVWA 1IOAA 2R7EB 3M8LA 4EN6B 5LA9A 5FXVA 3DEMA 3K3OA 4LO8A 2GH8A 5ACA3 4CPBA 4C0HA 3MF6A 1EY2A 1ULDA 2VZ3A 1W3VA 3WF2A 4HKLA 4AEKA 1AR72 2J1AA 1BEV1 3F95A 2WO7A 3O0VA 1Q8PA 1KS4A 4AOCA 1OLMA 5F3EA 4WBBA 1H2LA 1YJLA 4LKEA 3J7NA 3RMYA 5J36A 2RMU3 1YQ5A 3VKMA 1GWLA 1RUNA 4FO9A 1D0GA 3GNEA 5K0UA 3GZEA 2VZVA 1S2BA 5JOWA 5FZDA 4CDXA 1OA3A 1WUVA 2YMZA 1TMF2 2VQTA 5AFEA 3ZN6B 4LMFA 2D6KA 2CAUA 5GJ6A 3WQ0A 3WW3A 4FAHA 4LEJA 2AEYA 1C8M3 5LK7B 3L2HA 1W0NA 4CEWA 4MGSA 3S7IA 1KJRA 4EQVA 3WQ7A 2VOVA 3ELNA 3Q8EA 4XJWA 3EB7A 4YPJA 4A6SA 4XIOA 2OPKA 4B4RA 3AYCA 3PIJA 5KC6A 3D0JA 1EP0A 4Q4V1 3S5AA 1V00A 4P00B 5FLJA 3S5QA 1SLIA 3MI8A 4ITCA 3VBFB 2XJUA 5FY5A 4BXSV 4CCEA 4IEPA 1CAUB 4HBNA 3KF3A 5EXOA 3H3LA 4CCNA 1RHI1 3H8XA 2WIIB 2FDHA 5BYNA 2X53S 5DQ0A 2W94A 4XMIA 2DVBA 3S6PA 5K0UB 4ZU5A 4UW4A 2DU1A 1MEC3 1W03A 1J84A 5FZMA 5KXBA 2Y34A 5FZOA 5FIXA 2GMPA 3NKTA 1IS3A 5HCFA 4BK4A 2XUEA 3VD3A 1HJFA 3WHUA 3WD5A 2XLAA 1Y3TA 1UOJA 3HQXA 5FP7A 1VB2A 2V4AA 4A42A 4BQWA 4CU8A 4BHPA 1FOD3 1XXNA 5I0SA 1HV1A 1OLRA 2XJRA 2F4LA 2WNUC 3RMXA 3THTA 3MW4A 1HRI3 2BEOA 2GN7A 2P3KA 4FP3A 4LA2A 2RVAA 3FWEA 4CP1A 3PUSA 2N7GA 2WNOA 2C4XA 4BA6A 2WA4A 4CDQB 1J3QA 3LWCA 3M1HA 5DZGA 5L9VA 2ZMLA 2JDZA 2WAAA 1UY3A 2BOJA 4JKMA 1S0EA 3I8TA 3LZZA 5FTTC 1UMHA 3NKGA 1RUF2 2LTNA 2ZPXA 3ZMOA 3HWJA 4FQZA 2WR9A 4G9SB 1LENA 2AC1A 1OOPA 2NM1A 1ZZ9A 3KLSA 5GALA 2EXKA 1UCXA 3VBUA 4E2SA 2DDUA 1LTEA 3GZAA 2ZHKA 5C6CA 5CAZA 3WDTA 2EXIA 2IVJA 2WQ4A 3FLTA 4D8MA 4PIXA 3R0RA 3SNMA 4IV1C 5JZGA 2ZGTA 1QJY2 1VBC3 3KV9A 4Y5TA 1NZIA 1RUJ3 4IGOA 5FRAA 4B8EA 4CE8A 1CZVA 4XBQA 4AF9A 1JN2P 1PGW1 4L0PA 4GQ7A 1RHI2 3PUIA 4K7JA 5D1IA 4QM9A 1H6YA 4IL7A 5DAPA 2E9QA 4R9CA 1A34A 3H42B 1CIYA 2MHFA 3J8F1 4U2AA 1E5HA 1WMXA 1HB4A 4QPGC 5BNQA 3PVEA 3IAPA 4G3YC 1FATA 1NXMA 1GWKA 3QH7A 2R041 1OLQA 5C3SA 5JVVA 5FZ7A 5FLIA 4QKDA 4YZ5A 1TMF3 2OZJA 1L3JA 3RYKA 3X29B 5FREA 4IE7A 4MOAA 1H4GA 1SZBA 2Z2SB 3WNMA 5F3CA 2A6XA 4P9LA 2R072 1VR3A 3OY8B 4AI1A 1BVVA 3M3CA 4JGYC 5DAXA 5F6KA 3U78A 3DECA 3M2MA 4Q4W2 3MO4A 2QQJA 2DV9A 1BLZA 3TBDA 3OPWA 4DUVA 1D4VB 1WW5A 3N7LA 4EROA 4XDPA 4PI0A 3ZXKA 2XJTA 2EIDA 4FTSA 1AR82 3I2FA 5BPXA 3M4FA 3U1XA 1RB8G 1WMFA 4QDSA 3BTAA 1W6PB 3OBTA 3RZHA 2JWPA 2W52A 2QUOA 4QHZA 5IFTA 1UZYA 2C9KA 1OF3A 4LKSA 4Q5OA 3JXSA 5JOXA 2G9FA 2VH9A 4A3XA 1Q5OA 3PUAA 3PMSA 2HEWF 5LBBA 3CNAA 4YFWA 5CKMA 1I6XA 2D6OX 3CMGA 2QQPA 2C6SA 4P9YA 3LFMA 2O0OA 1AJKA 2YDEA 4GKYA 5H9RA 4XIKA 2R063 4L9BA 2B9UA 2FQPA 2XKPA 1UY4A 4Y24A 1SHWB 1IQAA 1W06A 3MICA 4QAWA 4RGGA 1NUKA 2MEV3 2WLQA 2P34A 4I0WB 4QB1A 5A33B 4E8CA 4QT6A 1ODNA 4JRLA 5IVYA 4NR1A 3OB8A 1EAH3 1KGYA 4OUSA 3O1RA 3I2DA 3ZFFA 1JOJA 2VC9A 2W2IA 3EMRA 5FZBA 5I8SA 1OMIA 2JDHA 5JIAA 3K48A 1PVC2 1W8NA 5APAA 2WYSA 5JXHA 1OOPC 1A3KA 2D93A 2UY9A 4PJYA 5FO8B 3Q8AA 4Z07A 2CGPA 3CZUA 1OUSA 2P2KA 2WZ8A 1PZ8A 2QKDA 1L7LA 4I30A 2QTWB 2YZ4A 4FPJA 2D97A 2ETEA 4GWIA 2H0BA 5CFDB 1A78A 1UOBA 4GD4A 4AAXA 3VL9A 3RJ2X 2VE1A 2IFWA 3KS7A 1VBC2 3T4VA 1UXXX 3LEMA 3J4UH 1WW4A 5FYBA 1VE0A 4ZU4A 5GLVA 3AZWA 1W6QB 3T0DA 1HDKA 1M4WA 3ETQA 4UYBA 1D2QA 2LS6A 4XJUA 4ZS2A 1S4CA 5A7OA 1OH3A 4FT8A 1ZBE2 4MGQA 1KITA 5B4NA 1K12A 3O1UA 3JB4C 3O1TA 1R093 2ZACA 3N35A 2F17A 3UL2A 3WUCA 5HBAA 4FTEA 4HVOA 3SXWA 5DAWA 4XQDA 3R6SA 4W50A 1RIRA 2PTMA 4Q4V3 4YFZA 2F6BA 1DGLA 1NA1A 2PHRA 4AW7A 1JYWA 1MR5A 1PNGA 3BCWA 4UOJA 2DFBA 1FYUA 3VHNA 3WOGA 4DFSA 4XPVA 4X8PA 5C4WA 3USUA 4GA9A 2WABA 3SCHA 2V72A 5EWSA 1IZ3A 1G7YA 4YNIA 1LODA 4KWLA 5FMCA 4JDNA 3AP9A 3AYEA 5FWEA 1SLLA 4AFDA 1MEC1 4K1ZA 1X50A 1W8ZA 4YM2A 2W1UA 5T5LA 4C1WA 2Z79A 2VW2A 1UMZA 5FWJA 4L11A 3ROUA 3KVBA 2A5ZA 3NW4A 2P1BA 4XBNA 3POEA 5FZ9A 2PYTA 2VNRA 3EO6A 3NVCA 5FZ1A 4QKNA 3VBUC 2GMEA 1WGPA 2OQ6A 1QH7A 3O7OA 3P6BA 3DV8A 1XYOA 4Q1RA 1C5IA 1XBFA 3BVCA 4M3CB 2WSVA 4PBOA 3RI8A 5FO9B 4NIGA 1UOFA 4FPGA 3LEKA 1PM4A 5F7UA 1LULA 1ZRRA 3NMBA 4XUOA 4N8MA 4NIIA 3S30A 1DLCA 1NQJA 1RC6A 1UD1A 4E27A 5DUXA 3VGIA 1ZBA3 2XQRA 2Y8KA 4FOWA 3KM5A 4XABA 5FP3A 5IYYA 5A70A 4CDUA 2OUHA 4XUPA 1CX1A 1NOVA 1POV1 1WLCA 3ALQA 3UKTA 3E5XA 1QWRA 5ABJB 5K0UC 4LKFA 1GUIA 2C5DA 4TLFA 4ZY9A 4FFFA 4UAPA 3FBYA 1GMMA 2R32A 1QJEA 4YW5A 1RVF1 2HWD3 3LCPA 5HV4A 4JVAA 4H55A 4IV3C 1K5JA 5KXEA 4A6OA 2VMDA 2K9ZA 4CYDA 2ET1A 5LWBA 1CAVB 2DCTA 5J1XA 1ND3B 5HXMA 5F6LB 5FPXA 5L7OA 4OFGA 3AKQA 5BXXA 4KWUA 4ASKA 1GICA 2D6LX 5FYYA 4XUNA 1FT9A 1DHKB 4F83A 4DUWA 1T6GC 3LE0A 1NZCA 1UZ0A 1EUTA 1QY4A 2XJPA 1Z0HA 1H2MA 4Q4Y3 4BQXA 1VBD3 2YPDA 2ZJCA 3RRDA 4QM8A 5A1FA 3JCIA 2R073 1SCRA 4RHV3 5FKBA 1POV0 1PZ9A 3BN6A 2YGMA 4KU7A 4DMIA 1W6NB 1CQ9A 1ZZ8A 4LO6B 5LRSA 2XXZA 1UZZA 2TBVA 4AWDA 5KHKA 3J8F2 3LFIA 5FPAA 3AXEA 1JH5A 4YG3A 1RUG1 1CGPA 3PIGA 1JTZX 2R042 2HWF1 2PLV3 4KQ7A 5FYMA 4BDVB 3I2OA 4ATFA 2R1BA 2D5HA 2QJVA 4CEYC 2PHTA 3L9JT 1F31A 3MEPA 2XHKA 3D82A 4J25A 3CBNA 1WLTA 1US2A 4P02B 4R9AA 3U11A 4NPMA 4Y4YA 5IVJA 1D0HA 1RUD1 3FFQA 1YNAA 2WQZC 2YPJA 1OLME 4COYA 1ND2B 1VBA3 5JXIA 3K4AA 1Y9MA 1YJKA 2XDVA 2JEMA 3AVSA 4FPKA 1WMEA 2VL4A 1POQA 4LK7A 2OPWA 3T1MA 5A3LA 5A3NA 1FNYA 3OUJA 3OGRA 3V65A 2EIBA 3OYWA 2IXJA 1YFXA 4O9GA 1OFSA 5JAXA 2A6WA 3AXDA 5GZEA 3QBQA 1WWYA 2GNTA 4Z82A 3EHKA 3SQOA 5JMOA 1XU2A 5F5CA 3E6BA 1REFA 1QQP3 1ENXA 4Y1ZA 5A1LA 4DY5A 3RZMA 3N3HA 5EV7A 3VBOB 1KXGA 5G04L 1CVNA 1JOBA 1TG7A 1PIV1 3HNBM 4RS5B 3VZNA 3M3IA 5KXCA 5LW9A 5FZ3A 1O8SA 3DPRB 5JSRA 2R061 3D0SA 3KCCA 3NRUA 1CN1A 1DF0A 2D3PA 3C7HA 2WFF2 3MLLA 3WCSA 4XFHA 4MVTA 1WCDJ 2YC4A 2VBPA 3ZFEB 1SDWA 2GALA 5C8WA 1JZ3A 1FPN2 2MEV1 4TXWA 4JQRA 4CDUC 5A6QA 1QOSA 1LNSA 1DQ5A 1HRV1 3JU9A 2LROA 2ARXA 5FDBA 2VVDA 3CJIC 3LA7A 4ARXA 1O6UA 3M70A 2OVUA 5L9BA 1AYM2 4ZZ5A 1D4M1 2XJSA 1ONAA 5LBEA 3O1OA 1WA6X 2J1TA 1REEA 3AMNA 3M3QA 4OHXA 5F5IA 4URAA 1RINA 2V09A 2CYFA 3FLPA 4UW6A 5GZGA 4JQTA 3AJYA 4NHKA 3OUHA 1LESA 5IW0A 4IV3A 3ACIA 1QOOA 4LBQA 4PDWB 5FCCA 3VBSB 1RUI2 5BNNB 1X8MA 4EN8B 4HPKA 1ENSA 3POIA 4JC1A 5FKCA 5BUVA 4P5HA 4PIZA 1FXZA 3AL5A 1TNRA 4XE9A 4HONA 2AR6A 5FUIA 2YXSA 3HN3A 4OLLA 4AEJA 1QNYA 4ZHNA 3M3OA 4TZDA 3J26N 3OPZA 5IK4A 5A32A 4LBNA 1AXYA 5FZ4A 3SH4A 3WDUA 1VBA2 1QXPA 4HOOA 4WVMB 3ST7A 4CDXC 2CDPA 4FPHA 4XAEA 5E6HA 5IWFA 3WP4A 2IXCA 2NQYA 3MFAA 5KBFA 4N53C 3FUOA 3POGA 3D4KA 4X6QB 3QD6A 4AEDB 2FDJA 2HEYF 5FYCA 2ZGNA 4XDQA 1GWMA 4HKOA 1TQ5A 5A3OA 2WAOA 4KMQA 4BYYA 4M4RA 4QDRA 1US3A 4HZFA 4YVWC 5IATA 3IBMA 2VUAA 4MSVA 4CEYA 5EZWA 1ZRCA 5LASA 1XNAA 4LBMA 3MW2A 3SKJE 2D6NA 5E1RA 2YY1A 3U07A 1ULGA 3FUQA 4P9IA 2WNVB 4PDWC 2DVFA 2OQ7A 3BOPA 2EICA 1ULCA 3FX3A 1LCLA 1QIQA 3H8UA 5DZFA 1PO11 1JU4A 4JHZA 2ZX1A 2RM23 5HCBA 2LM3A 1EV11 1CJDA 3R4SA 4B4PA 1FPN3 2GC2A 2W68A 5DMYA 4KNCA 4CDWA 2Y64A 2WINB 1ND3C 1NCQB 3AYDA 4AG4A 3T1LA 3VDDC 3AKPA 4BQ2A 3JD71 2YFZA 4Q0UA 5FP8A 2ZS6B 3WHTA 5BV6A 2WWUA 1KJLA 3BTZA 1SLTA 4BLIA 1LAJA 4JKLA 1L7RA 2GP3A 4E2QA 3BB6A 1V6NA 4OI0A 1XPWA 1QU0A 4YGBA 3WZ1A 3RWKX 4Z92B 5FK7A 1C8M2 1VB4A 3FE5A 5IAXA 1G6NA 2BZDA 2P37A 2VY0A 2VZSA 3TYJA 5LEKA 3A0NA 4JDOA 5ABJC 2DCJA 1SBFA 4C1XA 3ABZA 3GCWA 1ULOA 4HK9A 4YRDA 2RMU1 1IG0A 3NNMA 2Q8CA 4XEZA 5C71A 4TTGA 1Q56A 4LO5B 1O5LA 4XMAA 3WP5A 1SEFA 1ULPA 1G9CA 3ZOIA 4XBLA 3VKNA 1XNDA 1WBLA 1YXWA 2G9GA 1Q8VA 4BH9A 1G8WA 3ZXEA 1C8M1 1H30A 1Q43A 4L8QA 1MS1A 1DBNA 3HIFA 1HB3A 4Q8LA 2VZRA 5BNOA 3BTXA 3KVAA 1BZWA 1UPIA 2XHNA 2VVEA 3GDBA 2A1XA 3WNOA 1ZZ7A 5DG1A 5TSWA 4S2HA 1QHDA 1AUYA 1TME3 2PQSA 2ZTNA 1XSRA 1S0BA 1VBD1 1SMVA 1W0PA 1YQ2A 5DDJ1 2GDFA 4R4ZA 4SLIA 4QX3A 1DGRN 4CXWA 1RHI3 2R1DA 5CKQA 2ILMA 4RHV1 3KV5A 1DQ6A 3HR9A 1AX2A 1J83A 2JDMA 5F39A 2ZBJA 1XB9A 1OXCA 5T55A 1D7PM 1GOGA 2DCYA 4BLJA 4YVSB 1JZ7A 1UF2C 5F2SA 5GKAC 4QD2A 4BMBA 3BGAA 1AVBA 1BBT2 4JCKA 3NV4A 5BNPB 5FYZA 4UW5A 2G4IA 2WL1A 4RGAA 1IKPA 3HOBA 1NYWA 1QJY1 4JGYB 3SHRA 1FOD1 1OQ1A 4NVPA 1W2NA 3ZYRA 2QZ3A 4NIAA 2V73A 3NWKA 4B3NA 1ZA4A 2ADEA 2VZOA 5F5QA 1CZSA 2GC3A 2XKOA 2VD7A 3MZHA 2JKXA 3KQ4B 5FV3A 5FPUA 3JBG3 5GLWA 4DB5A 1VBB3 3VKFC 4I2OA 2UU8A 1H0BA 3MFCA 4UFLA 1W6MA 2GC0A 1WW7A 5D8AA 4IESA 2D5FA 5EYYA 5A6ZA 3ZSMA 1FX5A 2CL2A 3NAPC 4A7KA 2WN3A 1S0JA 4A7ZA 4GWMA 3U4XA 4JGYA 3SEPA 2QQMA 2Y6HA 2ZHMA 3QH6A 2ZX0A 4P9WA 1JZ2A 3AFGA 4P9JA 2VZPA 1UU5A 1QQP2 1O5UA 3CDZB 2EVXA 4K9SA 4YZ4A 3K51A 2E31A 3MUY1 2NMOA 1UNBA 4NMIA 5H9PA 2CWMA 1PIV3 4DXZA 4S2GA 4LO7A 4C91A 4ASLA 2WO1A 4Q1PA 1C1FA 2DTWA 3OTFA 3KT1A 4Q29A 4QQPA 1RUJ1 4V2VA 2JE8A 3T2QA 1MS8A 4KBBA 2EXJA 4NN0A 1IKQA 1AF9A 4FPFA 1C28A 2DBNA 1ZREA 2VMGA 1JYTA 1WW6A 3NJXA 2FDGA 5BNOB 5A7WB 3CJXA 2VBDA 1D4M3 5A3UA 1D4M2 2RJLA 3ZXFA 2ZEWA 2ID4A 3NV1A 5FFOC 2HWC2 2PHLA 2V5DA 2VO5A 3HQUA 1RUG2 4JGZA 2R043 1XQNA 3FHIB 4ISQA 1AJOA 1KDKA 2GSYA 2PHDA 3IDBB 2JG9A 1TMF1 2VCBA 3WW1A 2FMDA 4WVZA 1LHWA 1NG0A 2UWAA 2WNEA 3Q8BA 5HI0A 1CPMA 2XWJB 4HVRA 5HCHA 1HV0A 3NQHA 4LHKA 4LLOA 1WLDA 2HEVF 4AR2A 4N53A 4LLFA 2W08A 3DUIA 2B39A 2GNDA 2GNBA 3MIHA 4K3UA 1V0AA 2EAKA 3C2UA 2RJKA 2X5IC 3RJRA 3B69A 3HBKA 3VBRB 3WNXA 1ZZBA 1KFXL 1QXJA 2BWAA 1VBE1 5EJZB 4AVTA 3GBWA 1DP0A 1T2XA 4EWEA 1Z7S2 4COWA 2RDNA 5JXGA 2HBTA 1DQ0A 1Y4WA 4NWWA 5E88A 2Y38A 4DZGA 3A4UA 1VAMA 2Q1FA 3ZYGA 2GC1A 1I3HA 3GZUC 2A75A 4IEZA 2VCAA 4LJHA 4KH9A 4NOTA 4W8JA 2IUWA 1NCRB 5EHDA 5CISA 1GBGA 4ZXKA 1NCQA 2A6ZA 4LBJA 3WNNA 4B7EA 5LZ6A 3ZSKA 1K5MC 4XUQA 1HQWA 4KU8A 1NLQA 4HN1A 1XU1A 4IEWA 4EV0A 4I0BA 3FLRA 1UL9A 2ARBA 3UYJA 1C3HA 4XW3A 2YBKA 4Y22A 4FPCA 1W9FA 4YM3A 2JG8B 1AZDA 1BCXA 3IDAA 1Z78A 4QPIC 2PHWA 2RM21 3DF0A 4LUKA 1CD3G 2R30A 2BBAA 2IXHA 1C1LA 1E57A 3VN4A 1H9WA 4RHV2 1NLSA
chains in the Genus database with same CATH topology
3UK9A 2X5IB 2XG3A 1CESA 3LKJA 2ZABA 4COVA 4GH4B 3VLBB 1YI7A 1EAH1 5FBZA 3IDEA 1OA2A 2DTYA 4NHMA 3VZLA 3WCRA 4FPOB 3IT8A 4QXKA 3JQXA 3CLPA 3MIGA 3GBGA 1U5ZA 1H1MA 4M0NA 3ZDSA 1ALYA 1H1AA 1J58A 1R082 4OHVA 5C9AB 2RR12 1JUIA 1MEC2 1AR93 2B8MA 3AZVA 3TAYA 5CFCA 1RVF2 1PO22 1XNBA 4GXLA 2QZ2A 4AHYA 4N43A 4AQSA 1RUF3 3KCXA 5CFCB 2WNUB 2O1QA 5CNAA 1LOCA 4Q4Y2 1O4ZA 5BNNA 4XQ4A 4PDWA 3APBA 1LR5A 3JUUA 1K5MA 3O5SA 4YSFA 4OULA 2W39A 5K7PA 2YV8A 4HSLA 1MQTA 3VBHA 4B7KA 1HXS1 5T54A 4Z1VA 2XL7A 4H7MA 1FI2A 1CX4A 3IN9A 1O4TA 2H6CA 3ILRA 4LHLA 1MACA 2FMYA 4U36A 4MLOA 1DU3D 1MS0A 4OHZA 2HWB3 4C90A 4ASMB 1BVP1 4HN0A 1V6KA 3W9AA 1YIFA 4GULA 5JIUA 3UJOA 5F9TA 2XH6A 2ZZJA 4QPGB 4COUA 4XJ9A 1GSLA 4GALA 3ZXDA 2ZZQA 2VU9A 2GAUA 5DXDA 3WXPA 4FOVA 3H0OA 1BJQA 1ZRDA 1QJY3 4YVSC 2HWC1 3LGRA 4MGZE 4HVQA 2UURA 5FO7B 1JYCA 1SACA 5EFUA 4ES9A 2SBAA 1ZYBA 4YLZA 3OJBA 4WM7A 2DUQA 1ZBA1 3JBG1 5BY5A 4BOWA 2D3RA 1VBB1 1MZ6A 1POV3 3FC0A 3RWNA 1VRH1 4DQAA 4DRRA 5HCAA 2XVKA 1QJX3 5JPNB 2BNMA 3KZ4C 4JRAA 5DUVA 2D43A 4META 3VBRA 3H1WA 5I93A 5CFCC 1B09A 4S2FA 2HWD1 1VBD2 4HLTA 3ZN5A 1MZFA 2QDNA 3EBRA 2CV6A 3B00A 2JX9A 3IM0A 4TSVA 1WCSA 5KXDA 4JGZB 4LA3A 3LA3A 1CAWA 3LB9A 5GM0A 1W6OB 5I0RA 4J1WA 2BW8A 1S0DA 2BNOA 3FBMA 3MF9A 4LULA 4F7ZA 5CG8A 4Q4X1 2ZMKA 4YZ3A 4CP0A 3W58A 5JDBA 5DG2A 3WP3A 4IV1A 2YHJA 3VV1A 2Y26A 4YVWA 4Q4Y1 2YC0A 2BGCA 2VW0A 4AE2A 1A8MA 5SV8A 2R071 3AMMA 5AVPA 2RMU2 5JMCA 3D8CA 4RR3C 1N3PA 2X8KA 5T50A 3AMPA 4Q8KA 1PGL1 1CAVA 1OI6A 3BU7A 4LE3A 3RNSA 1MZ5A 4YYOA 4RR3A 4WZCA 3B93A 3V56A 3O14A 1LHVA 1LOAA 1B35A 1FOD2 1DQ1A 2AH2A 2VPVA 1UU4A 3HAGA 4K6BA 4FTEA 3KSCA 1LJ7A 1RMU3 1J3RA 2GZWA 2DURA 1ZRFA 1R1ZA 2ZAAA 1NCRC 2A71A 4R52A 1V9U2 4AVVA 3WDXA 1ENRA 2XPJA 2WJSA 4PCRA 3ZFGC 3UKVA 1NLRA 4BQ1A 1OHFA 1O3SA 2A73B 1BMV2 1DZQA 2PHXA 1DFQA 3VKLA 1NXD1 2IC1A 1MZEA 3WVJA 4AEDC 4HL0A 1U5IA 1AL0G 4LR4A 3V0BB 3KCYA 2WNVC 2WFPA 4UXAA 4K8FA 5AC93 2E7TA 4WM7C 5JR7B 1QOTA 1F9KA 3OCPA 2Z42A 1AL22 2E63A 2SLIA 1VIWB 3JZVA 3USUB 1RMU2 3ENRA 4YARA 1PVC1 1IHMA 1GNHA 1RUE1 4Z2WA 4PBPA 1G9AA 2XLGA 3SLIA 3AP6A 1HQNA 3RSJA 4YW3A 1HXS2 3TNPB 3ZPYA 4D69A 2WLPA 1RUC2 3LSEA 3WDWA 1BBT1 1RJ7A 2NYYA 1JUHA 1SLBA 2R0FA 3AMQA 1NE6A 4JV4A 1CIWA 4OI2A 3MW3A 4Q4W1 4AI8A 1Z7S1 1BYHA 4YGDA 1R083 2VNGA 2BUKA 4JAAA 1YFYA 1LU1A 1AYN1 1GV9A 1RUI3 3ZXGA 4IETA 1F8VA 1PZ7A 3ACLA 2PELA 2KM2A 3WG2A 2B45X 1PO21 4RS5C 1XNKA 2WZR1 5I91A 1GZWB 1RUF1 5JCTA 2HWE2 1AR61 1J3PA 3WV6A 1S0GA 4MXWA 3CJIB 4YG0A 4IEQA 1UW8A 5D8AC 3RZZA 4AQ6A 2QE3A 2BFUS 1FV2A 4FCAA 5A3MA 4I02A 4Q2FA 4Z8BA 1H9PA 1V6OA 5J96B 2PFWA 1HXS3 1XNCA 4UBGA 3IKWA 1HQLA 4GB32 1PGSA 5IK5A 4WV8A 4FPEA 4E4ZA 3POYA 3FZ3A 1DYKA 2E7QA 2HWB1 2YROA 5ACA2 4AVBA 1QKQA 3VKOA 4IQPA 1PK6C 2XBO2 1EV13 1ENQA 5T52A 1QNWA 2W0XA 1FPN1 2MEV2 1JW6A 2ZCWA 3N7KA 3WT3A 4XFBA 2VQAA 2EIGA 2HWC3 4CEYB 3JD73 1VAVA 1FMD2 2RS12 1IS5A 1W6PA 2IXIA 3B94A 1DIWA 1GKBA 3SH3A 3OF1A 1ZBA2 3WP6A 3ZFFC 2WWSA 1KD7A 1V6IA 3MPBA 4PF5A 1GFF2 4URTA 4Q4V2 3HMYA 4YW4A 1VRH3 1PVXA 5FMOS 2MNGA 3O0XA 1RITA 1QXRA 3GYDA 3AFKA 4QQLA 1LB2A 2UWBA 3PJYA 2WT2A 3ZVXA 3E5QA 5B2GB 4K40A 3VZOA 3H3UA 1APNA 2O8OA 3MLKA 2R062 4MXWB 4HSJA 3RQ0A 3T2TA 3ZN4A 4HFSA 1QJZA 1GZWA 3VBHC 4LBQB 2GNMA 3SMHA 4IV3B 3WDYA 4AFMA 2BBVA 3WR0A 1Q8SA 1G9FA 3R4DB 4AVCA 4Q4X3 1H4HA 3NO8A 1AR73 3M3EA 3MIFA 4NPRA 4IERA 1PIV2 4A2UA 5JOYA 2GMMA 1S55A 1TME1 1AHSA 4HETA 5JSOA 1AL23 4BM8A 5JI9A 5DDJ3 1LGCA 4Q27A 1SQ4A 2CTVA 4KL1A 4H14A 4R4XA 3AB0A 2OIIA 4HANA 2QFEA 1U5YA 4YGEA 3VBUB 1LGBA 4DY3A 1M06G 1AYM1 1RUC3 4K21A 2IWGB 1RMU1 4LUMA 1W2UA 1Q8QA 1PM7A 1X33A 2HKXA 3CU7A 4PQ9A 4DOUA 3E6CC 4I0AA 4XXPA 4QQHA 1LKNA 5L73A 1TNFA 2EAAA 1HLCA 1WD4A 4Y1VA 1LHOA 2ZX4A 2XL9A 4YM1A 5E8AA 5J09A 3EXUA 2WC2A 1YLLA 1BMV1 1YCIA 3ZSEA 1AYN2 1UU6A 2BVVA 5AC91 1QJU3 3W59A 4GKXA 4EJRA 3AMHA 1F5JA 2JJ6A 4TWTA 1XE7A 2UYBA 3SCGA 3WW4A 4AI3A 4LT5A 4KG8A 2VOXA 4IEUA 4JTOA 4CEWC 1PVC3 4XF4A 1CAUA 1MS4A 3ASIA 3NJZA 2VG9A 3GZTB 3VBFA 3G7DA 1UAIA 2XGXA 3OD0A 1GZCA 4CTEA 4YZ1A 1EAH2 4BCUA 4AHXA 4MGKE 2WZR2 3VBFC 5I8YA 2PHUA 4QPYA 3VZKA 1OSGA 3ZIWA 4Q0SA 1PGL2 1JYIA 4CEWB 5CFDC 4WM8C 4F3JA 3DGTA 1Z7S3 4FOQA 1A8DA 3JD72 3V64A 4IEVA 5GZDA 3VBOC 4I3PA 1AYN3 1A6CA 1RUI1 3OGGA 3DL3A 2XVGA 3B9CA 2NZ9A 4QU2A 1SLCA 1W6OA 1CAWB 1YUDA 2B7YA 4XQWA 3VZMA 5KHJA 2CNAA 1AX0A 3MGUA 5LEJA 5ABJA 1X8EA 1VBE3 3MIDA 2D44A 1JHNA 2AENA 5CVRA 1GNZA 3N7JA 2HWD2 3RS6A 4AFCA 2VOKA 2VECA 1JBCA 2X29A 3QCWA 3AZZA 2OA2A 5E89A 3VHOA 4XFFA 2DUPA 3TOJA 3H9AA 3WW2A 4WM7B 1Y7BA 5C8CC 2ZMNA 1FMD1 1VALA 2I07B 2RS11 2UWCA 3WQ1A 2PAMA 5C9AC 4FXKB 4M00A 1DGWX 5T3NA 4RSUA 1RUH2 2UY8A 4KG0A 1KQRA 1URXA 2AREA 3HBZA 5GZFA 5C4WB 1G86A 4XF0A 4FPLA 3WDVA 3SISA 1VRH2 2VVFA 4MGYE 4AXOA 1NA1B 3AJZA 5AC92 3I4IA 1U12A 1YFWA 2PAEA 3B7MA 4N90A 1FNZA 1N1TA 2PAKA 1QMJA 2FHRA 4OVEA 3V0AB 3UJQA 4CRQA 1BK1A 4CP2A 3ILNA 3IWZA 1UX6A 2TUNA 1V6MA 2VUJA 2WS91 1XE8A 2JENA 3GHMA 4OI4A 3VBHB 3LA2A 3WY6A 4AK3A 1DYPA 4QX5A 1AR91 3POSA 4MXVA 2RR13 4IEYA 1ZM1A 4R9DA 3RYPA 1K5MB 2RS52 5CFDA 2GU9A 1Y43B 2Q4SA 1AXZA 3GALA 1ZBE3 2RS32 4E4DX 3MIBA 3WX5A 2WNUA 4WZFA 1LOFA 1OD5A 1ZX5A 1DGRA 1NE4A 1LU2A 3N36A 3MDPA 3ZFFB 2R16A 1AR71 4Y1YA 5FLHA 3ZXJA 1IGOA 1SFYA 3ME2A 4JGZC 2WT0A 4PIYA 3EQEA 3PNAA 3TNQA 2FZ2A 1C8NA 1AL21 4XTPA 1W39A 4IXLA 4GH4A 1UKRA 1COV2 2XVLA 2P17A 3AZXA 2DWRA 4CDQC 1C4RA 5L19A 1YHFA 2Z69A 2MPFA 2EXHA 1MS9A 2DF7A 4LNVA 2CGOA 3B02A 1AYM3 1RUC1 1DDLA 3ZIXA 5DUUA 4DINB 2JG8A 3PVBB 2H0VA 4P14A 1IPJA 2V5YA 4LE4A 4R9BA 2E7AA 3I54A 3O12A 1AX1A 2BVBA 5I0TA 2D40A 4PLNA 3M7AA 1I9RA 3QOPA 4DPNA 3GBFA 1NCRA 4CZSA 3CO2A 3ZX7A 2CWSA 1SLAA 4FPYA 4R8HA 1QJX1 2ZGLA 5GLZA 2R0HA 3B3QE 1U0AA 3ZYPA 4M3CF 1PGW2 4UBHA 4AHWA 1DQ4A 1RUH3 1REDA 1SBDA 4YZ2A 1GR3A 1G9BA 1WCKA 3HT1A 4YGCA 2OZ6A 3CJIA 1UIJA 3ZMNA 1MVEA 1WD3A 1OA4A 5BNPC 4G4FA 3U10A 1QDCA 2VULA 1IPKA 5EYXA 3H3ZA 2JG9B 3AKRA 3S7EA 1TME2 3PHMA 3ECQA 1LOFC 2DFCA 2QNKA 5E16A 4OUMA 1LOGA 4FAGA 4K1YA 4PLMA 5DZEA 4AFBA 4L92A 1PK6A 1COV3 4J6GA 3CEWA 3NV2A 3AZYA 2ZX3A 4XF1A 5I0UA 5GLUA 1MVQA 3AP4A 4ORFA 5J7MA 3E6DA 4AQTA 4AGVA 4XOGA 3SCFA 1OPOA 3AP5A 1ASJ2 2ZGKA 1LECA 2GN3A 3FMGA 4I01A 1CAXA 1FV3A 5CB7A 3JBG2 4GH4C 1O3TA 3ILFA 2DCKA 4HT1T 2JECA 4BE3A 3V0BA 2NLRA 1TEIA 2A6VA 2A7AA 4AFAA 1RUOA 4CDQA 4GMP0 4P9XA 2RS53 2D98A 1LRHA 1HRV2 3FFZA 1QH6A 2BPA2 1KRIA 4YG6A 1X82A 3VL8A 3ZXLA 2AUYA 1GZ9A 5ACA1 4DY5A 3O0WA 1B35C 1FMD3 2RS13 2I2SA 4JDMA 2R6QA 3E97A 3TRSB 3VHPA 5T5PA 4HMZA 1F5FA 1X36A 4XYXA 1BEV3 1LHUA 2IXLA 1VAKA 3AX4A 5GLTA 4BIFA 2GH2A 5BNPA 1U5XA 5HXVA 4DS0A 1B35B 4RR3B 1W0OA 4RL7A 3B9IA 1RUE3 1IS6A 1GYKA 5AVAA 2ERFA 3VBRC 2Q5TA 5JPMB 2FBEA 3KT4A 1RGSA 4K20A 4MV2A 1KS5A 2Y0OA 1NCQC 1LOEA 2DVDA 5L7OC 1DZTA 2P3JA 3AYAA 3AM2A 1BBT3 4YVWB 1YIPA 1GANA 4GMP1 3ZXAC 5C4WC 1EYBA 5EJ3A 2Q0AA 1RL3A 4Y1UA 4IV1B 3B01A 4F8AA 1BXHA 4Q4W3 2K2SA 2F4PA 1XYPA 3HD8B 3ZN6A 2QVSB 1R081 4BPZA 2E53A 1OFNA 2JICA 1LOBA 3ZYIB 4CDXB 2RR11 4ISRA 1PO23 5CG9A 1I1EA 4I09A 2WZR3 1BQPA 2RS33 3KD4A 2EF6A 1AR63 3NL1A 2DVAA 2D6MA 2R49A 2VW1A 4LBOA 4AYUA 5JOZA 2I74A 2VOWA 5FOBB 4BIOA 3HN1A 2DU0A 3OBRA 4AQ2A 4HKWA 5GZCA 4D3WA 5J48A 3KMHA 1O91A 4GIQA 4ZU7A 2XWBB 4AI0A 1MS5A 1CJPA 4N7UA 1S1AA 3AP7A 5H9QA 1HIXA 2HYKA 3AKSA 2JG9C 3JQWA 3S0MA 3BPZA 4OHWA 3ES1A 3AK0A 5JSPA 4DRVA 3GHNA 5BNNC 4XJZA 1UPSA 3NAPB 4J1XA 1C5HA 3P3PA 4UW3A 3R05A 3GF6A 2IXKA 1NY71 3RG0A 1V9U3 4XFIA 4QPGA 5FMOL 5AFBA 1Q8OA 4XTMA 4GWNA 1OPMA 3MIEA 1SFNA 3NV3A 4WM8A 1V70A 4D94A 1QGLA 4ONUA 3ZSJA 4Q26A 1DGWA 3BIWE 1QJU2 5KHHA 5LK5A 1KFUL 3J9SA 3VHRA 3TN92 1R1A2 4XJ8A 3JB8A 3LAGA 1ND2C 1MQTB 4Q0PA 1Q3EA 3IPVA 4D7SA 2VXRA 3BALA 4JTNA 2VMHA 3RPQA 1RUH1 2DVGA 2Y0IA 5C8CB 5A32B 2A3YA 3TWIA 1CONA 1O7FA 3TB0A 2ZOEB 4N7IA 5K8SA 1EPWA 2PQQA 1RUE2 3IDCB 5JI7A 1LHNA 4Y20B 1YRZA 4N43B 4XJAA 5IT6A 1F2NA 4FVVA 4D7YA 1PMIA 1YI9A 2YYOA 2OYZA 4Y20A 1DG6A 4W65A 3KGZA 5C9AA 2NP0A 3SH5A 1H8TC 3U0ZA 2WZPP 1C57A 5C8CA 1GLHA 3PMEA 3THPA 4XETA 2Z5WA 2A6YA 5T5OA 4M01A 2HWB2 2PN5A 2E51A 3I59A 2ZKLA 1V6LA 2BFUL 1J59A 1LEDA 5H9SA 2NN8A 1AR92 1JXNA 4S2DA 2WT1A 1H2KA 1HX6A 2Q30A 4RQPB 3MPPG 2X5IA 3ZFEA 4QPIB 5CBLA 3EJKA 2ZA9A 2QCSB 3DPRA 5J98B 4WM8B 3H50A 5C33A 1N1SA 4E2GA 2LALA 1G9DA 1RUD2 3UV9A 4Y22B 2VNOA 2AGSA 1EPZA 2NMNA 1ZZ6A 2ZX2A 4KGGA 1N1YA 2VGDA 3NAPA 5L36A 2RE9A 3OD4A 1RUJ2 1ASJ1 1H2NA 2BQPA 3H1MA 2ZGMA 4H3WA 5JZGA 1MS3A 1QJX2 4L99A 2PLV2 3R4UA 3H7YA 2KXLA 1NY72 2QDRA 1J1TA 5SV5A 1SCSA 3D5OA 2K0GA 3OGJA 1NA1C 1ND2A 1HW5A 3VDDB 2D3SA 3BOWA 2JXAA 3N4MA 1TE1B 4YW2A 3MLJA 4W6XA 4W6WA 2JD4A 4TYSA 4MYEA 1QJU1 1N47A 2A70A 3IMNA 4XHBA 4N53B 5FAXA 3G6JB 4GB31 4EN7B 1S0FA 3AKTA 2BTVC 1VJ2A 2JKBA 5IK7A 2ET7A 1HRI2 5BNOC 4XFAA 4XFGA 4Y5Z0 4EWAA 1W6NA 5KWRA 2XLFA 4AEMA 2HWE3 4FOYA 2NPIA 2XBO1 2D6PA 4LO4B 4OI1A 2YUEA 1ULEA 4GMP3 2ZHLA 1AR62 4SBVA 3IIAA 4XF3A 2Q8OA 1WA4A 2JE9A 2VQ0A 4CDWC 4EN9B 1ULFA 5IK8A 1BKZA 1H8TA 1R091 5JZGC 1DQ2A 4Q0QA 1AR81 2YGLA 3VBSC 5FQ0B 2EALA 4QGLA 4XHXA 4LBKA 3QLQA 1NQDA 5L7OB 4NWVA 1ND3A 5J37A 1RTVA 1KDMA 1R1A1 2RS31 4H7LA 3TN91 2B42B 3ZFGB 2B5HA 4D7TA 3DPRC 4A7YA 1O4YA 2WFF1 4Y26A 4AHZA 3ZFEC 2H6BA 4QQOA 1DLLA 2P3IA 2TEPA 3C3VA 5CU1A 1R092 4KWJA 5DDJ2 1W6MB 2ZKNA 4OZXA 2WSUA 5D8AB 2B46X 1ZNPA 2ENRA 4CDUB 2FZ1A 4QGNA 1S0IA 1PO12 4LHNA 3DN7A 2KA3A 4AI2A 1D2SA 5KHGA 4M3CA 2ZGRA 3H1YA 4YW1A 2XUMA 3SITA 2E6VA 4MX3A 3UKNA 2VMIA 4MH0E 3LSDA 3WG3A 3ZSLA 1CAXB 4MZUA 1XRUA 2O8QA 1CPNA 1V9U1 3B5LB 4O9EA 1WMDA 3ZFGA 4YVSA 5DUWA 4AVAA 1RVF3 1YFUA 2C1FA 1VBE2 1N1VA 1N3OA 5FQ0A 3PTYA 2AYHA 4FBFA 1WBFA 1XYNA 1H8TB 4KGQA 4Y1XA 3WINE 3WLUA 4COZA 4B4QA 4N9HA 3WUDA 3VUOA 4MGIE 3KB5A 4EN0A 3ATGA 4AGGA 4Q4X2 1IS4A 4KWKA 4NO4A 4ES8A 2WS93 1PK6B 3NSTA 3POWA 1AXKA 1O3RA 3D6EA 2OUJA 3RDIA 1VBB2 4INDA 4L97A 3WG1A 3ZYJB 1YO8A 3P3NA 1LGNA 1W6QA 3KGLA 3WG4A 1UKGA 1MQTC 1V6JA 1ZBE1 1H8VA 1SBEA 1EV12 5LRRA 3VZJA 5J3UA 2ZGPA 2TNFA 3PLQA 4LTAA 2ZGSA 2BNNA 3KT7A 5JWPA 1RUG3 3BODA 1J1LA 4FSJA 4XF9A 4M3CE 2HWF3 1I5ZA 2PLV1 4QGMA 3MYXA 5FOJB 4ATEA 1X7NA 4RD7A 3VDDA 2D7FA 5I8TA 1PNFA 1PHMA 1RUD3 4HK8A 1HRI1 4RFT0 1VLNA 4FXGB 3L2YA 5A33A 4P9GA 4IEOA 1VP6A 1VBA1 5JZGB 2ES3A 1H1IA 4QMAA 4CDWB 1ZVFA 3DKWA 4FP2A 4BWOA 5F1RA 1UIKA 2ZGQA 1O3QA 1CR7A 3CF6E 4XXAA 2CAVA 2BYVE 3ES4A 2WNVA 4I3GA 3USSA 4EWDA 2EA7A 4QPIA 1QQP1 4XILA 1ASJ3 1N3QA 3KQRA 4RQPA 4PLOA 4X8NA 5T5JA 4AVSA 2WS92 3ZO0B 2HWF2 1QDOA 2XB6C 2Q1MA 3URFA 4BZ4A 1VBC1 2C0ZA 4QQ2A 5CIRA