1RUJ1

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords RHINOVIRUS 14
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj100
1VBD2 1NA1A 1MEC3 1OOPA 1PGL1 2XPJA 2VQ0A 2MEV2 1PO11 1RUD1 1ZBA1 5ACA1 1H8TA 5K0UA 5AC92 3ZFFA 1VBE2 4JGZC 4QPIB 2HWD1 2HWE3 1EV11 1RMU2 1QJX1 1WCDJ 1H8TB 1VRH3 1VBB1 2X5IB 1PO23 1VBB3 1VB2A 1AYN3 1HXS1 5BNPB 2RS33 1OOPC 2RS52 5C9AB 1AR81 4IV3C 1GFF2 1BBT3 1RUH3 4PDWB 2WFF3 3VBSB 2BFUL 2FZ1A 2R041 4SBVA 5C9AA 1AYM3 3IDEA 3VBUB 4RS5A 1VBB2 2RM22 2GH8A 3VBSA 2X5IA 3CJIB 5CFCC 1QJX2 5CFDA 2RR11 2HWD2 1COV2 1MQTA 3TN93 2FZ2A 4YVWB 5ACA2 4Y5Z0 1DDLA 1PO12 1RUD2 2MEV1 3ZFEC 2XBO3 1POV0 1CD3G 1VBD1 1RVF3 4GB33 3JBG1 1FOD3 4N53B 2HWC2 5CFCA 1VB4A 1AR73 1VBE1 1V9U3 1AL22 3NAPA 5BNPC 1B35C 1BBT2 1OOPB 5C9AC 1PO13 1RUD3 3VBHB 2RMU3 5BNOB 2WWSA 1RHI1 5L7OB 3NAPB 4FSJA 2HWE1 3ZFGA 4Q4W1 1AR72 1VRH1 4QPGB 2HWF2 2Y26A 5A32A 4RR3A 2HWD3 4WM8B 4JGZA 1SMVA 4CDWB 1PO21 1QJY3 5A32B 4AEDA 4QPGA 1MEC1 1RUJ2 5K0UB 1RHI3 5CFDB 1X36A 3ZFGB 3CJIA 1RUH2 1RUC2 1PVC1 4GH4C 4CDQC 1FMD1 3DPRB 1RVF1 4JGYC 5ABJB 1NG0A 1C8M1 1RUG1 1VBA2 1B35B 4Q4X3 1R083 2WZR3 1R081 1AYM1 1FPN3 1BMV1 2WS91 1AR62 3CJIC 3JB4C 4RQPA 3TN91 1R1A3 1POV1 5J96B 1COV3 4AEDC 2RS53 1AR61 4WM8C 5BNNC 4YVSA 3JD72 2WS92 4CDXB 1QJU1 2R063 1AYM2 4GB32 5C4WC 1FPN2 2QQPA 2RS13 3JD71 1HRV1 5A33A 1NCQB 3VDDA 4Q4Y3 1C8M2 1VBA1 2TBVA 3VBRC 3ZFGC 1QJZA 2HWB3 2HWB1 1RUC1 1HQNA 2RS31 1C8NA 3TN92 1TMF3 5GKAC 3VBUC 2XBO2 1QJX3 2WZR2 5C8CA 5BNPA 1R082 1VBC3 1FOD2 4CDUA 1C8M3 1PIV3 1RVF2 1EV13 3VBFC 1RUH1 2RR13 3ZFEB 1EAH2 5LK7B 1POV3 1QJY2 2MEV3 1RUG3 4CDXC 5CFDC 1PIV2 1X33A 4CDUB 1HRI2 1ASJ1 1BBT1 4PDWC 3VBSC 2HWF3 2HWF1 1VAKA 4IV1C 1AYN1 1VRH2 2RS11 4WM7B 4CEYC 4N43B 4Q4X2 2BBVA 1ND3C 3JBG2 4GH4A 5DDJ3 2WLPA 4IV3A 5JZGA 2ZAHA 1K5MC 1F8VA 1RUE2 2BFUS 4YVWC 1AR91 1NCQA 1V9U2 1HXS3 1NCRB 1AL21 1AUYA 1ND2C 1COV1 2RR12 1R091 4CEWA 4NWVA 4CEWC 5BNNB 1D4M3 2PLV2 4RR3C 2RM21 1RUC3 5K0UC 1RB8G 5D8AB 1NY72 2R042 2GSYA 1D4M1 1QQP1 1K5MA 5JZGC 1ND2A 2RS51 4JGYB 1ND3A 5BNOC 1QQP2 1ZBA3 1D4M2 2BPA2 1NY71 1B35A 3JB8A 4CEYA 1ZBE2 4IV1A 1VBC2 4N43C 1VBC1 1ND3B 1ZBE1 5FOJB 3VBOB 1ND2B 1RMU1 1EV12 1R092 1RUE3 4Q4V3 1AR82 2WS93 5AC91 1V9U1 5FMOS 1ZBA2 1HXS2 4YVSB 3ZFEA 1ASJ3 4GMP0 1RUE1 1PGL2 4Q4W3 3VBFA 1RUF1 2PLV3 1MQTC 2RMU1 5C4WB 1RUF3 2PLV1 1AR63 1RUI2 2X5IC 4RFT0 4GH4B 1R093 1Z7S3 4N43A 4RS5C 1TME2 5C8CC 1AR92 1ASJ2 4RHV3 5JZGB 4IV1B 5BNOA 1RUJ3 1QQP3 3JBG3 4FTSA 2ZZQA 1QJY1 4Q4X1 5A33B 1PGW1 1EAH1 2RS12 1FMD3 3VDDC 1AYN2 4FTEA 3S6PA 1AR93 4RHV2 1HRI3 5C4WA 1NCRC 5D8AA 1TME3 1HRI1 1PIV1 1R1A1 1NOVA 1FOD1 5BNNA 1QJU3 5FMOL 4Q4Y1 1TMF2 3ZFFC 1H8TC 2HWC3 3JD73 2WZR1 1NCQC 4RQPB 4YVWA 2XBO1 2DF7A 3VBOA 1NA1C 1HX6A 1Z7S2 3HAGA 5ACA3 5DDJ2 1VBA3 4WM7C 4CEYB 2R062 3VBHA 1E57A 3DPRA 1CJDA 4NWWA 1A6CA 4JGYA 2R072 4WM7A 2WFF2 4GB31 4PDWA 2IZWA 2RS32 3VBOC 2HWB2 3J8F1 4GMP1 4CDXA 4N53A 4EJRA 4Q4V2 3VBFB 4CDWA 4QPGC 4JGZB 4Q4V1 4QPIC 3M8LA 3J8F2 1BEV2 1PVC3 1HRV2 1F2NA 1RMU3 2R043 1FPN1 1BMV2 1ZBE3 1NCRA 1QJU2 2WFF1 1MQTB 5D8AC 2R071 4CDUC 1BEV1 1RUG2 5L7OA 1Z7S1 1EAH3 4RS5B 5ABJA 3VBUA 1BEV3 1PVC2 1AR83 5C8CB 4CDQB 3ZXAC 1IHMA 2BUKA 5ABJC 2ZTNA 1M06G 1MEC2 1RUJ1 1K5MB 1VBD3 3VBRA 5L7OC 4Z92B 1W39A 2RM23 3NAPC 3LOBA 2R061 4Y4YA 5DDJ1 1FMD2 3VDDB 1OPOA 3FBMA 4RHV1 1OHFA 4YVSC 4CEWB 4WM8A 4AEDB 4RR3B 1AR71 4LLFA 4QPIA 1HRV3 1PGW2 1AL0G 3J8F3 4GMP3 4CDWC 3ZFFB 1PO22 1TMF1 4N53C 4Q4Y2 4FTBA 4RQPC 1R1A2 4IV3B 1NA1B 1TME1 1VBE3 3VBRB 5AC93 1AL23 3DPRC 2R073 3VBHC 4Q4W2 2HWE2 2HWC1 5J98B 4BCUA 1RUI1 4CDQA 1RUI3 1RHI2 5CFCB 2RMU2 1RUF2
chains in the Genus database with same CATH superfamily
3GCXA 1VBD2 3OGRA 1ENRA 2CGOA 1PGL1 2VNVA 1KRIA 4DUWA 4YGDA 2MEV2 2ZS6B 3WW2A 4E8CA 5F2SA 3O0WA 5F39A 3U75A 3VHRA 4FO9A 4XABA 5AC92 2WA4A 2IC1A 2I07B 1BK0A 4JGZC 2G4IA 1LKNA 1S1AA 4JTOA 4P00B 2HWD1 5FWEA 3VHPA 3ZSJA 4AFCA 4COVA 1EV11 1QJX1 4IERA 4DO0A 2QQUA 1OLMA 1H8TB 1NLQA 1VRH3 1GWMA 3QCWA 5FZMA 3U4SA 2PHFA 4LXLA 5BNQA 1KD7A 2W87A 1VBB3 2K46A 4CP9A 1KDMA 4AI0A 3K3NA 3WXPA 2VO5A 3PDQA 5FYMA 4FFGA 4CPBD 2C6SA 3BALA 3VZJA 5BNPB 2RS33 4CU9A 5DUUA 4CCCA 3O1OA 3KT1A 5FYCA 2WT2A 3KHBA 3GZTB 4PDWB 5J1XA 4JDOA 1W8TA 2WO1A 2BW8A 1SPPA 3MGUA 5FZIA 4SBVA 1GSLA 2R041 4IESA 2GNDA 1ALYA 1DG6A 1HB4A 3O0XA 4FXGB 5ERLA 2HYKA 1VBB2 5JOWA 4M0NA 5KXDA 1F31A 1UPSA 1JUIA 3SCGA 4XOGA 1YWKA 4P9XA 2JE9A 3CJIB 1WLDA 1HIXA 2NMNA 2C24A 5FFOC 2BWAA 3CHXA 2AACA 3U11A 1UU4A 4NPMA 2PHUA 3X29B 2JIGA 1MQTA 2YPJA 2XJPA 4OQ8A 4BXSV 1OA2A 1SBFA 3HJRA 2I45A 4W6XA 3ZYGA 5ACA2 3O1TA 1SBDA 2QDNA 4DIQA 1PO12 3RZLA 4X6RB 3IDCB 1GP4A 1POV0 1UU6A 1V70A 1LHOA 1W9SA 3I2GA 4A42A 4BH9A 1SDWA 2JX9A 4P14A 3ZN4A 3T2PA 1Y9GA 2ZHKA 2VQUA 4ONUA 4YG0A 3GJAA 2VMIA 3SQOA 3HQXA 3KD4A 1GV9A 4Q27A 3WT3A 3NAPA 2JIJA 3M7AA 3J7LA 3LOIA 1B35C 2QQKA 1BBT2 1OOPB 2DTYA 2Q1MA 3MF9A 4QM8A 4URTA 5IWFA 5A3WA 3U37A 3RMXA 3V0AA 3EB7A 2UY9A 3UNPA 3O0VA 2NM1A 2DVAA 5BPXA 2PHLA 3CNAA 4LULA 3T1LA 4S2HA 1GZTA 2XLFA 4FSJA 2BWCA 2HWE1 4LK7A 1W99A 4OCTA 1X50A 1X7NA 2B7YA 3AB0A 4XFAA 3T0BA 4EN9B 2ARBA 4D6QA 2VMFA 4CA9A 1PHMA 3E6DA 1Q8SA 3IBMA 2L9LA 5C3SA 2Y26A 3NV3A 1W8HA 4BWOA 1SBEA 1GWLA 2WNVC 2HWD3 5FZ1A 3WNLA 1XNBA 1YI7A 2QUOA 2VUDA 3RI9A 4QM9A 5EWSA 3HN3A 1FYUA 5LRSA 2QFEA 4FPEA 4XMAA 3L9JT 4M01A 1G9DA 3AP7A 3AZVA 2YGMA 1OFNA 1L3JA 3MW4A 2GU9A 5FP7A 2WA3A 4AEDA 4QPGA 4BQ4A 1RUJ2 5CKQA 2VJXA 4AVBA 2D43A 1IGOA 1W6NB 3H3UA 1X36A 4IL7A 3MIHA 4MUVA 4W4ZA 3ZFGB 2R30A 1RUC2 2X09A 2E7QA 3WUDA 4R9BA 2E7TA 3F2ZA 2RG4A 4GWJA 4XQDA 4GH4C 2WZEA 4XZUG 2VZVA 1H8VA 1XU2A 4YGBA 2R0HA 4M0HA 4HSLA 3AK0A 3CU7A 4OI2A 4LK6A 2JD9A 4XFBA 2WINB 3AYDA 3UJOA 1R083 2WAAA 2RDSA 2TUNA 3H1MA 4CCEA 2VQAA 2YFUA 1CZVA 5DG2A 1FAYA 3ZYJB 4RD7A 4I02A 2Y34A 4M3CF 4CCDA 4GZ9A 3MIGA 2VW2A 1WWYA 4TWTA 4KU7A 2DCJA 3CJIC 1GWKA 1R1A3 1DU3D 1XRUA 1EUUA 1DZTA 1V6OA 2OUJA 2ZEYA 5EIYB 3OGGA 2YG0A 2VVDA 4OUMA 3N9NA 5J96B 1GP5A 4COUA 3A23A 1UMIA 3HQRA 5TSWA 1JH5A 4QU2A 3NNMA 2VVEA 1W3VA 4XVHA 3AJYA 3AZZA 4YNIA 3WX5A 5AFEA 2XL7A 2WS92 5BNNC 3LEGA 4FPFA 4PI2A 2Q1ZB 1QJU1 3ZYBA 3CKHA 1N47A 3AKTA 1AJKA 1AYM2 2XUMA 5C4WC 4N90A 1FPN2 2DUPA 4D94A 4AYUA 2E6VA 4AHYA 4HLTA 4NIHA 2D6MA 3JD71 3VZNA 4M3CB 1H4HA 1QU0A 4GALA 1JOJA 4NROA 4CUBA 3ALQA 5A33A 3I3MA 4QXKA 4Q4Y3 1C8M2 1VBA1 4IEXA 5IW0A 3ZN6A 4A45A 2WNEA 3JUUA 4HPKA 2YUEA 1QJZA 3E1F1 2QQVA 5HXVA 3UT0A 3LFIA 2HWB1 4GIQA 2A3WA 3UKNA 4E27A 1U5XA 2D6KA 1C8NA 1TMF3 5JXGA 4ZKTB 1J3PA 2QDRA 3FZ3A 1AHSA 1QJX3 1QH6A 4R8HA 2XJVA 4MGKE 3PMSA 1GBGA 3BOWA 2UWAA 2OZJA 2E33A 1DFQA 1UMHA 1KDKA 3ZDVA 5EP9A 4LR4A 2CY6A 4AHWA 5FYZA 3HPNA 3VZMA 1PIV3 2HEVF 3I3QA 1W9YA 5FBJA 4XF4A 4CE8A 1TG7A 4Q0SA 4R4XA 2ES3A 4YGEA 1KFXL 1XE0A 2A6YA 3DUIA 3GGLA 3DECA 2OIIA 4Q8KA 1SCRA 2YZ4A 2NLRA 3MV01 4KG8A 2CAVA 4UW4A 3AZWA 3WHUA 1ST8A 3ZYIB 2JICA 5JR2A 1POV3 2VOXA 4NPRA 3DGTA 3K4DA 2Q1FA 3M70A 3ZR5A 4E4HA 4UF0A 3ZOIA 4FP3A 2PQQA 2R32A 5CFDC 3ELNA 4XHBA 1KEXA 1GZ9A 2CSGA 3PIJA 2DFCA 3OBZA 1HRI2 3KCXA 1ASJ1 5DABA 4CDUB 2C5DA 4PDWC 3LIHA 3NSTA 2UWCA 4Z82A 3RGBA 2V4AA 4YZ5A 3WDUA 2HWF1 2H0BA 1D0GA 4QD2A 1QGLA 1VRH2 1VE0A 3I7DA 3RFRA 3TYJA 1AX1A 2W47A 3HNBM 5CKMA 5FPBA 4KU8A 4YLZA 1I1EA 1APNA 1PM7A 3JBG2 4MG2A 3W5MA 1Q3EA 5H9SA 4IV3A 3KHCA 2Y6FA 4ZY9A 5EHDA 3MYXA 2P6CA 3A0NA 5K4LA 1SCSA 5LWBA 1K5MC 5E89A 1RUNA 2BFUS 1AR91 1NCQA 2VGDA 4NPLA 1N1SA 1AL21 1W6QB 2ARXA 1QJEA 1JZ7A 2AREA 4HANA 3MO4A 4CEWA 1W6QA 4I09A 3NO8A 1S0CA 4JDNA 5BNNB 1DYOA 2NYYA 3ZXFA 5DQ0A 1UWWA 3BI3A 4N9HA 5LZ6A 3AKQA 1NLSA 3UYJA 2Y38A 1WA4A 3WF1A 3T09A 2A5ZA 2Y6HA 2GNMA 4GKYA 3SHRA 4PLOA 1LAJA 3BTYA 2BNMA 4HZFA 1YC61 3T4HB 5JZGC 2CAUA 1BLZA 1ND2A 2D6LX 5IVVA 4QB6A 2D3PA 3I59B 4UFMA 4A7YA 1MS0A 2C4XA 1GU3A 5L19A 1S2KA 2KR2A 3B9CA 4BPZA 1AXYA 2EXKA 4TSVA 3LPFA 4IV1A 5E88A 1YFYA 1VBC2 3NW4A 2PHXA 4YPJA 1KJRA 3U0ZA 3VBOB 1YRZA 1ND2B 4J1WA 3WUCA 4D7SA 5KXEA 2FD8A 2VQTA 5FP9A 2XLAA 1IQDC 3MDPA 1GUIA 2DVFA 4A7KA 2VOWA 4Q4V3 4B1LA 3SISA 2GC3A 3BB6A 3WNKA 1ZBA2 1QNYA 2A6VA 3CO2A 3TBDA 3UKVA 4YVSB 1UX6A 2EXJA 4E2SA 1PVXA 4NRMA 4UW3A 5FMCA 1O3TA 1O59A 3AMNA 1MS3A 3B9IA 3KB5A 4RN5A 1OH4A 5FZ7A 2QZ2A 1LOFA 2QQNA 2PLV1 2Y64A 1AR63 3FFZA 5L9VA 2VECA 4XAAA 3BIWE 2WNUA 2X5IC 5LEKA 1DQ2A 1S2BA 1Z7S3 3IT8A 3E5XA 1YQ2A 5DUXA 1UYYA 1YYNA 3I3DA 4IGPA 4PHZA 1ASJ2 3ZDSA 4B7KA 1UIJA 5FY4A 2XL9A 4K20A 2KXLA 4UI9L 3HEIA 1S0FA 3ACLA 2JB4A 1PNFA 3GCWA 4HPKB 2CGNA 3JBG3 4Q8LA 1UKGA 4MVTA 4YM3A 4NE9A 1HQLA 3T4VA 4Q4X1 5A33B 4QHOA 1PGW1 1AJOA 2YPDA 5T3NA 2JE8A 4OVEA 3V56A 2HKXA 4EROA 5DMYA 4TZDA 3B01A 4XMIA 4FPGA 5D8AA 2P5BA 1YHFA 2WT0A 3PUSA 4LT5A 4R4ZA 2QQMA 1VP6A 1QJFA 4I3PA 4AL9A 1K42A 2YYOA 1OA3A 1QJU3 2CU5A 3FBYA 4XETA 3S7EA 1A78A 4NVPA 1J1LA 1FATA 1H8TC 2HWC3 2IWGB 4LIUA 2YXSA 2Z79A 3UGGA 5LEJA 3JD73 1NCQC 2WL1A 2CL2A 4XCBA 2Q8DA 4YW3A 1H2NA 4N9IA 2DF7A 4KWKA 4BQ3A 1CR7A 2J22A 1MS8A 4QPWA 1NA1C 1W6OA 5E16A 3WP3A 4RGAA 3OGVA 1KJLA 1Z7S2 5FXVA 3S5QA 4A6OA 1JXNA 1DGLA 1Q8PA 1XU1A 2XWBB 4WM7C 5LBBA 2JDPA 3D6EA 4B8EA 1E57A 4CEYB 3Q8EA 4XF1A 4WM7A 1BVVA 2I74A 4N8MA 2WFF2 4HG6B 4Q0VA 2CNAA 4QDQA 4HKLA 2ZGMA 2RJ2A 4MV2A 1CX4A 2IZWA 4MLOA 4G9SB 1HW5A 2Y6JA 3VBOC 5KR7A 3U4XA 5FUPA 3HWJA 4N53A 4QQ2A 3VBFB 1WMDA 2EXIA 1DQ1A 3H7YA 1G6NA 1YQ5A 2EVXA 5GLTA 4ES8A 2YY1A 1LOCA 3L2HA 2JDAA 4LBLA 3GM8A 2OZ6A 2ILMA 1F2NA 5A7QA 1YFWA 5F5IA 1UZZA 1QF3A 4GJZA 5D8AC 4XJUA 4EWEA 1CAXB 1DYPA 2XJRA 3WG2A 1NE6A 3OD0A 1LHWA 1K12A 3NKGA 3IN9A 4WVZA 2LUWA 4ZPIA 4DS0A 1QXJA 3AMQA 1GLHA 3AJZA 1FX5A 2ZX0A 3ME2A 3HVDA 4DOUA 1AR83 3CZUA 4QXCA 5GZDA 3KT7A 2DWRA 3QOPA 2LRPA 4CCKA 1C28A 4HVOA 1W8UA 3AP6A 4KGGA 1E5IA 2O14A 5FAXA 3N3HA 2BUKA 1Y9QA 2E63A 2I2SA 5CADA 4IEZA 1M06G 4IE4A 4LE4A 1RUJ1 2VNRA 3AP5A 3MUZ1 2O8QA 1K5MB 2D44A 3N4MA 1W39A 4AVCA 4UFHA 2EXHA 4PBOA 2A7AA 1JYNA 3LOBA 4YYOA 5FY7A 3ZXEA 3PUQA 4L97A 1YIFA 5DDJ1 4QGLA 2DURA 5A7OA 5APAA 5LA9A 4OYUA 3E6CC 1OUSA 4RHV1 3O12A 4HXCA 5A7SA 4O61A 4WM8A 5LBEA 4AEDB 3SCFA 1F5FA 1FT9A 5F8PA 3NNGA 4B4PA 2HH9A 1CVNA 3BKZA 2QCSB 3PU3A 4LBKA 1O4TA 3THDA 5A3TA 5FTTC 3R0RA 3WP6A 1JHJA 3VKNA 1PO22 1UOBA 1X9TA 1TMF1 4QAWA 2BU9A 1O6UA 3LA7A 2V09A 4HT1T 3SEEA 1BJQA 2W1WA 4ISRA 5F5AA 4I0BA 3GZUC 4MGSA 3BCWA 3SKJE 3VD4A 4DMIA 1XNCA 5JLVA 3QLQA 1ULOA 5IAVA 4CUGA 4XBQA 2D40A 1JZ4A 3IMMA 4UBHA 3WZ1A 3VBHC 4Q4W2 3WCSA 4LUKA 1UY1A 2YC2A 4QXBA 5T55A 5I0RA 4CDQA 3HNMA 1RUI1 2BJSA 4W65A 2IXJA 1XB9A 4HMZA 1RHI2 1ND2C 2RMU2 5I8SA 4BMBA 4A41A 2P3KA 5BYNA 1MEC3 1OOPA 2YU2A 3VDBA 4M4RA 2A3YA 2VQ0A 1SQ4A 4EN0A 1J3RA 1PO11 2WSVA 5FKBA 5A1LA 3LDKA 2GH2A 3D0JA 4DXZA 1H8TA 2O0OA 4PBPA 5ACA1 4FCAA 1VBE2 2ID4A 2N7GA 5FY0A 1OVPA 4UBGA 2IFWA 3DYPA 4A3XA 4DY5A 2JG9B 2R49A 2ORXA 1N1YA 3LGRA 1UXZA 1WCDJ 1J59A 5JIAA 3S5AA 3SH5A 1ZM1A 2BVBA 5FZ4A 1ODMA 2VY0A 1VBB1 2VMCA 2XQRA 5FCCA 2FDIA 2EIGA 4V2VA 1LU2A 1VB2A 5IK4A 2CTVA 1HXS1 4AQSA 2J1TA 2V4VA 3WD5A 2RS52 5C9AB 3H0OA 1AR81 2OPKA 3DEMA 3LWCA 4IE0A 3BPZA 4IV3C 1RUH3 2ZPXA 3N36A 4LO6B 4QKBA 4OHZA 4IDZA 4XF3A 4P5HA 2ZA9A 1KS5A 4MHUA 4PF5A 3GF6A 3KV9A 4FOQA 4LKEA 4BQXA 5A3MA 2RE9A 3I3EA 1OH3A 4U36A 5FBZA 2XJSA 1AYM3 4UW5A 2OS2A 1REDA 1E5RA 3KZ4C 2TNFA 2WUHA 3T0AA 5F6KA 2RM22 1G9AA 1ZZ9A 5FYYA 3LFMA 5HV4A 1XYNA 2X5IA 1S4CA 2HBTA 1QJX2 2PHRA 2WAOA 4S2GA 5CFDA 2HWD2 3DCQA 4HBNA 1QEXA 4LEJA 3TN93 1SACA 4YVWB 2IXCA 1O3QA 3SH4A 1ZYBA 4CP9B 3R4UA 1O91A 1OD5A 3OSDA 4QX5A 2DCYA 4BQ2A 3MW2A 1O5UA 2B45X 2MEV1 3I2IA 4QQOA 1GP6A 1F4AA 2VTXA 3URFA 3USSA 2B42B 1MZFA 3DV8A 3W58A 4NO4A 1CD3G 1VBD1 3DYMA 2XONA 2WO3A 4K8RB 5T5OA 5CU1A 5J7MA 3PVNA 1RVF3 1VPHA 3E97A 4Y24A 3PUAA 4N53B 4QX8A 3LAGA 3VD7A 5CFCA 2DCZA 4O65A 2WQ4A 5FDBA 4I2OA 2Y0OA 1UCXA 4CCNA 3MIFA 5BNPC 3K3OA 4LORA 5A3NA 3HQUA 1O7FA 3TRSB 1RUD3 2ZKNA 1QDCA 2VBBA 1IS4A 2RMU3 2PELA 2IXKA 2WWSA 3UGFA 2EIDA 1EP0A 5A7WA 1EPWA 4DINB 3VKFC 4NHKA 5A6ZA 4ATFA 1W6OB 4LO4B 4JC1A 2FCVA 2RDQA 4D3WA 5HI0A 1IS6A 1TE1B 2O8OA 5A32A 2HEWF 4Q0PA 1I5PA 2E31A 4S2DA 1W6MB 3OUHA 4QQLA 3LDBA 5ISLA 2YBSA 3N9MA 5B4NA 1Z78A 2WRAA 2BGOA 3TEYA 1DGRN 1QHDA 2EAAA 4IEUA 4SLIA 1JOBA 1U5YA 1H2KA 4B4QA 1LU1A 4CDWB 4OI0A 5FYBA 3TEXA 4GULA 1QJY3 1UYZA 5A32B 1Q8OA 4MX3A 3GZAA 5IHRA 5LCWL 3H3LA 1CAVB 1MEC1 4L8QA 5K0UB 4X8NA 4CRQA 3KSCA 4YFZA 3FHQA 1VR3A 1T2XA 2VR4A 1RUH2 5FPUA 4XFCA 4K9SA 3WP4A 1PVC1 1H6YA 1YFUA 2VNGA 4YFWA 5HPOA 5IVBA 3AKPA 4LBOA 5I0TA 5C3QA 1J58A 1RVF1 3DYOA 3ZXLA 5ABJB 1SFPA 1W6PA 1RUG1 1B35B 1WLWA 1ZZBA 2DFBA 2VCAA 4HONA 2ZX1A 1LOBA 4RGKA 1IG0A 1QOSA 3PTRB 5DG1A 5LBFA 1FPN3 2ET1A 1YI9A 5IFTA 4WV8A 3ST7A 4XC9A 3ZXGA 3TWIA 1UKRA 4LOTA 1JU3A 4OULA 3AP9A 3TN91 3BIEA 1VMJA 1POV1 1CJPA 4Q1RA 4ITCA 3OOXA 3O1RA 2JG8B 3IIIA 4AEKA 3GYDA 1COV3 2YV8A 3IIAA 2ATFA 4LKDA 1OLME 4M4PA 3LD8A 1MS9A 3DKQA 3MFAA 5FREA 4AEDC 5GLUA 2PXJA 4W6YA 2VD7A 2RS53 1X9PA 2WNVB 3LB9A 3PUHA 3ZLIA 2K2SA 2EAKA 2AENA 4XIKA 4YVSA 5JR7B 2C1FA 4COWA 1VJ2A 3PTYA 4CDXB 2R063 4P08A 3J7MA 4EN7B 1PZ8A 1ULCA 4L9BA 2E9QA 2XWJB 3MICA 1JZ5A 4IEWA 5DAVA 4LBMA 2EALA 4QU1A 2JKXA 2X8KA 4XDOA 1M4WA 3IZOA 2A3XA 3ZSMA 4JQRA 3CJXA 2ZGUA 5SV5A 3VBRC 3OBAA 2FHRA 2K0GA 2H0VA 3AZYA 2PMWB 4QDRA 1OSGA 2HWB3 4NAOA 4UWDA 3USUA 1D2SA 2UU8A 4QHZA 3EJKA 3TN92 2RS31 1OKQA 2VBDA 1NXD1 2XBO2 3MBWA 3RZKA 2FDGA 4FOWA 1K5JA 2B9VA 2HEYF 3THCA 4LHNA 4M3CE 2VXRA 1FOD2 1C8M3 2BYVE 1RVF2 4FOVA 3FWEA 4KMQA 5DAXA 2F6BA 1C4RA 2G9ZA 3SITA 3GNEA 1OQ1A 3ZMNA 5C5UA 3T0DA 1RUH1 2RR13 2W91A 4LHSA 3MUY1 2OT7A 5LK7B 3JU9A 1CX1A 3BN6A 2V73A 3Q8BA 3V0BA 3TEZA 5FZOB 1SLAA 1GICA 2QQJA 4AQTA 5FZDA 1PIV2 4AWDA 2D6NA 2NN8A 4PIXA 5FY9A 5HV0A 4DRRA 5CG8A 2HWF3 3PLQA 1OQDA 3VD9A 3WQ1A 3OYWA 1FV3A 4QB1A 1AYN1 2AGSA 4Q1PA 4XDQA 5GZFA 4YG3A 1NZIA 1UOJA 2BBVA 3WF2A 1H2LA 4GH4A 2ZX4A 4CP2A 2YC4A 2VMDA 4KQ7A 5FZKA 1LB2A 2UY8A 3B5LB 2VOVA 2XHKA 3KCYA 2ZAHA 5FZGA 5JZGA 3AL6A 2P2KA 2JEMA 5FZ8A 1F8VA 4BLJA 1IQAA 1J83A 2WQZC 2ZOEB 4LPLA 5B2GB 4YVWC 1G9BA 4C8DA 3HIFA 4MHRA 4FOYA 1DGWA 1V9U2 2J42A 1W8NA 1LRHA 1UZWA 1JI6A 2GDFA 2BDRA 3EBRA 3D8CA 4NWVA 2VUAA 3PL0A 4CEWC 1WCQA 2PFWA 2V5YA 3DKWA 4OUEA 5FQ0A 5JSOA 3P3PA 3RZHA 2GN3A 4JVAA 2RM21 1O4ZA 2DCTA 3E5QA 1RUC3 4UT5A 5E6HA 3ZIXA 4E2GA 5FUIA 3OPWA 3ZR6A 4Y20A 1NY72 2GSYA 2JG8A 4H2AA 5C7GA 2DUOA 3BU7A 4XQ4A 1K5MA 1JYWA 2W0XA 4QKDA 4MYEA 4DZGA 2BVVA 1FI2A 1OVSA 1RXGA 4JAAA 4INDA 3RVHA 2RS51 4JGYB 2BNNA 4IGOA 3TAYA 1HB3A 3OCPA 5BNOC 1D4M2 3FLRA 4I0AA 4AHZA 1B35A 1LHUA 2XKPA 4NAMA 5FRAA 2IXHA 2WN3A 3R6SA 3TNPB 4BOWA 1CGPA 5CNAA 5A1FA 2X10A 4IEPA 4BK5A 1ZBE1 1PGSA 5JOZA 3MEPA 3BODA 4HSJA 4A6SA 1GNYA 3ITQA 3ECQA 3N7LA 4KGQA 1G8WA 3V64A 2VW1A 5IVJA 4M3CA 4EE2A 4DUVA 4F7ZA 2JDHA 2CV6A 1WCKA 1AR82 2ZX3A 1V0AA 3QACA 5F5CA 5LRRA 5C3OA 5CEHA 4LNVA 3BTZA 1HXS2 3OY8A 3BTAA 3ZFEA 4YW7A 1D7PM 3NQHA 5JSPA 3KS7A 2MPFA 1EY2A 1I6XA 4Q4W3 2JB8A 3ZPYA 2ZMLA 1WW6A 1SLCA 3VBFA 2PLV3 2RMU1 5JIUA 1RUF3 2ZJCA 1Q8QA 1W6MA 4XTPA 1RUI2 4P02B 5T54A 3VV1A 2J1EA 1A8DA 2Y6LA 5A1AA 1LOEA 2IUWA 1L7QA 3WNPA 4LOSA 3FHAA 4RFT0 2QQLA 1R093 1O4YA 5L9BA 4HL0A 5G05L 4XTMA 5FYTA 3THPA 4N43A 3IKWA 3NJXA 3JZVA 3WCRA 1QDOA 3ZKYA 4UFKA 1QOOA 1XE7A 5F3GA 4GA9A 1RJ7A 5GJ6A 1XOYA 3WP5A 1XQNA 1WGPA 3FE5A 4FQZA 1QQP3 4LBJA 2XJUA 1KS4A 3CZJA 1V00A 2YB7A 3UGHA 4PQQA 3JQWA 4QKFA 3WQ0A 1EAH1 3KCCA 4LHLA 2RS12 4CCJA 1FMD3 5FK7A 1L7RA 1W04A 4FTEA 2GAUA 2GALA 1AR93 4RHV2 1HRI3 2BOJA 2PHDA 3T2TA 1Q56A 4AI3A 1JODA 1W0NA 3AX4A 4I0WB 4I3GA 2JG9C 3M4FA 2YFZA 5FLHA 5JUVA 1V6NA 5FMOL 1TMF2 2DU0A 2AYHA 4P9YA 4YSFA 1JZ8A 3O1UA 3HNYM 1DQ5A 1QY4A 3J7NA 2SLIA 2XR4A 3HR9A 1W05A 2Q8CA 4NIGA 1DLCA 4YVWA 4ZXEA 3ZN5A 4AEMA 4C91A 4OHWA 5KHKA 1HX6A 3GBWA 1O8PA 3V65A 1IG3A 4MGTA 3HAGA 4S2FA 5DN2A 4JRLA 4AFAA 2VCMA 3LE0A 1JUHA 1C3HA 5DDJ2 2J7MA 3N7MA 3LF7A 1T6BX 2VTFA 4C0BA 1W9TA 1TQ5A 2ADEA 4NWWA 5F7UA 4JGYA 4YW6A 2LW8A 4DFSA 3E5UA 5EJZB 1N1VA 1YIPA 1IPKA 2IVJA 3KF3A 3WR0A 3KV4A 2ZCWA 4Q0QA 4Y20B 1CESA 1GOHA 1H1AA 5FPVA 3INAA 1KXGA 3SCHA 3WF4A 4JGZB 5FQ0B 4G3YC 4QPIC 1GMMA 4QX0A 3H1WA 3UJQA 4YWAA 1JN2P 4CSWA 1PVC3 4XJ9A 1HRV2 3C7GA 4AK3A 1Z0HA 4YM2A 4J1XA 1XNKA 1ULEA 1BMV2 3ACGA 2Y0IA 4XJAA 5F3CA 5FPXA 1ZBE3 4CXYA 2WFF1 1MQTB 4QX3A 3W9AA 1JHNA 1NT0A 3MLLA 5E8AA 1TEIA 4AVVA 4AHXA 4BXFA 3LDRA 4PLMA 3WNNA 3ZVXA 5F3IA 3OGSA 3VZKA 5KHHA 4Z2AA 2WIIB 1Z7S1 4IUGA 4PF1A 3K48A 1BEV3 4HKWA 4LHKA 5C8CB 3M3IA 5CYYA 2JKBA 4CDQB 1MZ6A 3I59A 5FYSA 4HVQA 2ZTNA 3M3CA 3HT1A 2UURA 4Z92B 4FPKA 4DB5A 5FMBA 3ENRA 2RM23 3VL8A 3NAPC 1WLTA 4AI9A 1PK6A 3FUOA 2Y6KA 5FLIA 1C5IA 1FMD2 3DN7A 3VDDB 5H9PA 1OPOA 1SDDB 3RJ2X 1PMIA 1TVGA 1D4VB 1ZZCA 3C8XA 2HJIA 1RC6A 4YVSC 4CEWB 2A70A 2VZOA 3I49A 4ZHNA 5J09A 4RR3B 1MVQA 3AMHA 5FO8B 1LESA 2DDUA 1PGW2 4LJHA 1QOTA 3WNMA 3H8OA 3ACIA 4CDWC 2WDBA 2P3JA 1HV1A 1R64A 2BOIA 2OA2A 2B8MA 1OMIA 4DXSA 1GQGA 1JZ2A 2WBKA 4BU2A 4D8MA 3WG3A 4IV3B 4YZ3A 4AFMA 2UWBA 4LO7A 3FUQA 1CZSA 5IUQA 4LKSA 2NZ9A 1VBE3 2OPWA 4JQTA 1VRBA 4XAEA 3LA2A 4YGCA 1UQXA 5EZWA 1AL23 1AX0A 3W20A 1N3OA 1W9WA 3F95A 4U2AA 5J98B 2A73B 1YQCA 2HWC1 3OB8A 3WG4A 2JJ6A 1W28A 5IK5A 2QJVA 3LEKA 2GP3A 3SLIA 2K9ZA 4YW2A 1WD4A 1ZZ6A 4UF0B 4OFGA 4YZ4A 2VULA 2YMZA 1VIWB 3PJQA 3RS6A 1XNTA 1ZBA1 5F1RA 5EJ1B 5FYUA 2ZABA 1XSQA 2R6QA 4QPIB 4BZ4A 4ZU7A 2HWE3 5D21A 4C0HA 5C5TA 5A70A 1DLLA 4ZXKA 2Y6GA 1FNZA 1UY3A 2VZ1A 3POJA 1S0IA 4JCKA 5JXJA 1US3A 4Y33A 3WVJA 1SZBA 5CG9A 3E6BA 4FPJA 3QD6A 3VD3A 5KBFA 4NHMA 4BIFA 1RJ8A 5GZCA 3N9QA 3PHMA 2FQPA 2XB6C 4XXPA 1U5IA 1V6KA 1BBT3 4HK9A 1R1ZA 2CHHA 2ZGOA 2ZHLA 5CVRA 4AF9A 1HDKA 2WFF3 5HBAA 4J6GA 2Q8EA 3VBSB 5FYVA 3CMGA 2ZZJA 3NRUA 3FX3A 3VBUB 2W46A 2PQSA 4RS5A 1IS3A 1HQWA 3MLKA 4R9CA 1LTEA 4EN6B 2VTXJ 4UAPA 3KWVA 5F32A 1LCLA 4B3NA 1HN0A 4BK4A 4CU7A 4FPCA 4UFLA 4QT6A 1SLLA 5CFCC 3AVRA 2Z69A 1D2QA 2WZ8A 2WN2A 5IVCA 1TNFA 1OD3A 2UYBA 2YGLA 4OZXA 2AC1A 1IS5A 4QHBA 2BZDA 2ET7A 4ATEA 5JCTA 2FZ2A 2YDEA 1H4GA 1KQRA 2ZGNA 1RUD2 3POEA 3ZFEC 2XBO3 4LKFA 4LQRA 2P37A 1XE8A 4LO8A 4XFHA 4W8JA 5EXOA 3WDYA 5I91A 2PTMA 4XUNA 3RG0A 3LSEA 4CU6A 4JZRA 5FMDA 3JBG1 1FOD3 4Q26A 3OUIA 3UKTA 2WLQA 1MZEA 2C9AA 3N9LA 5IVYA 2GNBA 1HB1A 1YNAA 3PURA 3WNOA 2W1SA 1YUDA 1AR73 3OF1A 4UYBA 1AL22 3OD4A 4BYYA 2O1QA 3I2KA 4AQ2A 1V6JA 4GAZA 5C9AC 3POYA 3VDCA 1N3PA 1MS5A 1OQEA 1V6LA 1W2AX 4YG6A 1DYKA 4IE6A 2GC1A 5A7NA 1JW6A 1Y3TA 5A3PA 3RYKA 2ZHNA 4R52A 5L7OB 1I5ZA 3ZFGA 2Y8KA 5FY1A 5M0TA 2Q8OA 5AFBA 1AR72 3J4UH 3QH6A 1VRH1 2ZGKA 4A2UA 4QPGB 4CP1A 2HWF2 1AXZA 2WNUB 4N7IA 4R9DA 3O7OA 2ZEXA 4RR3A 2E53A 4FQ4A 2VAUA 1Q8VA 1XPWA 2V5DA 3B7MA 3POSA 4JHTA 5J37A 2JENA 4CXWA 4JHZA 3WQ7A 1SMVA 3NV2A 3PJYA 4XHXA 2BP6A 1IOAA 3CDZB 2Y60A 1V6IA 1RHI3 1LHNA 1GZWB 3AP4A 5CFDB 4OI1A 4NHYA 1DQ6A 2QBXA 2G9GA 5I0SA 1U12A 1RIRA 4TN7A 5IYYA 2VMEA 3ZXDA 4CUAA 4DEVA 1AZDA 4CDQC 4FAGA 3D82A 1FMD1 3DPRB 3DXTA 4JGYC 1NG0A 2PYTA 1C8M1 1VBA2 4NUBA 4RFRB 4WVVA 4C90A 4FPOB 3ZM8A 2WZR3 2JDKA 2JDUA 3GBGA 1AYM1 2QQWA 1ZVFA 4MADA 4BIOA 2IFRA 3WDTA 3NL1A 3HD8B 2WS91 5F9TA 3JB4C 4RQPA 4FFFA 3WOGA 1MPXA 1ULPA 1XYPA 2BQPA 3W5NA 2W95A 2A6XA 2LROA 4XIOA 2BERA 4AQ6A 2G9FA 1ODNA 2QE3A 4ZZ5A 3PUIA 2JG9A 4WM8C 5ANQA 4A4AA 3JD72 3M3EA 4UXAA 4CCMA 4H55A 3ORJA 5BUVA 1N1TA 4YW5A 3Q9OA 4GB32 2QQPA 3Q8FA 1DZRA 3AFGA 2RS13 1O5LA 4L0PA 4D7YA 5JDBA 2GMMA 3CBNA 1HRV1 1UU5A 1NCQB 3MW3A 3VDDA 2NMOA 3I54A 4LA2A 3RZGA 2VCCA 3WDXA 5FZLA 2AUYA 4CCLA 1PK6B 3MF6A 3JXSA 4KBBA 1SFNA 2AH2A 2F4LA 1ZZ8A 1SPPB 3VHNA 1RUC1 4YM0A 5T50A 5DZFA 3SKVA 5IAXA 2VZTA 2MHFA 4QDSA 5FZBA 1CN1A 3LKJA 5GKAC 2GC0A 4GXLA 4FAHA 1URXA 1K45A 1H9PA 5IJRA 4XUPA 2OKXA 4EZ4A 2VZRA 2WZR2 3H3ZA 1JU4A 3VL9A 5BNPA 1NAEA 1GYKA 5C8CA 4TTGA 1ZREA 4KWUA 1UOGA 3C7FA 1VBC3 3RMYA 2OUHA 3RZMA 3RQ0A 3WV6A 4CDUA 4KI5M 1LEMA 2AEYA 1IZ3A 1UZ0A 1XSRA 4PJYA 1H30A 3ZXJA 4AE2A 4AZZA 4ASKA 3J26N 2CDPA 2WWUA 4QXHA 3POFA 3T3YA 4AI2A 1ZX5A 3FHIB 3VBFC 3MZHA 5A3OA 4Q29A 3NMBA 2JDZA 5FXWA 2J1RA 1F9KA 3U1XA 4XBNA 4CU8A 4E2QA 3WF0A 1D0HA 1QJY2 2QZ3A 1NX9A 3UL2A 3RWNA 3S7IA 5A7PA 3A21A 3KQRA 2MEV3 3U10A 4F83A 4ORFA 2HBUA 1LOGA 4CDXC 4PCRA 3AXDA 4X6QB 3AM2A 1VALA 1Y4WA 4ARXA 2D3RA 1AVBA 1CPMA 1QKQA 1X33A 1U0AA 3HN1A 5T52A 1BBT1 1C1FA 3VBSC 3MPBA 1LGNA 1LODA 4OHVA 3PIGA 4AG4A 1CAWA 4COZA 3D5OA 2RS11 2FDKA 3K46A 4N43B 2WNOA 4B29A 2JDYA 2PHWA 5FK8A 1WA6X 5DDJ3 5FZ0A 3QH7A 4DEQA 1PX4A 3LZZA 3ZX7A 3OTFA 4MSVA 1RUE2 2XXZA 1W8ZA 2DYCA 3EYPA 3FC0A 5C71A 1UXXX 1S0DA 1S0JA 4Y26A 3VDAA 3NV4A 1HXS3 2ZGLA 5KC5A 1YO8A 4LLOA 5CKNA 5EYYA 1LGCA 1V6MA 2LM3A 3OY8B 1AUYA 1BHGA 2NQYA 3MIEA 1C5HA 1R091 2IXLA 1UYXA 4XF0A 5FYIA 3A4UA 3NWKA 2JWPA 4PQ9A 4IE7A 3WDVA 5K0UC 1NQDA 1QXPA 3R4DB 4XUQA 1RB8G 3C3VA 5LA2A 4CPBA 2R042 4AFDA 3M2MA 5GLZA 3RJRA 4OHYA 3VLBB 1QQP1 3MLJA 4BISA 1W8FA 2GC2A 4XE9A 1UMZA 5GALA 1LEDA 1CAUB 2HYXA 3GZEA 4LBQB 4IEVA 1ND3A 3TOJA 1QQP2 5FLJA 1ZBA3 2B5HA 5K8SA 2X05A 2QQIA 4O9GA 4CEYA 1ZBE2 2KA3A 2GZWA 1BQPA 4G4FA 1ND3B 4CZSA 4L2NA 4H3WA 4C1XA 2PN5A 1S55A 4AOCA 1EV12 1R092 1SLTA 4TLFA 1UY0A 3AYAA 3W59A 3WNXA 3WW3A 4I01A 3FJSA 4AGVA 5HCAA 3OBTA 2A1XA 2YBKA 5AC91 5FMOS 3RRDA 4NHXA 1G9CA 2AR6A 2E32A 4CUCA 5J36A 4AR2A 2J1AA 5LK5A 1ASJ3 2E7AA 4GMP0 1RUE1 5F3EA 3ZXKA 1PGL2 5A6XA 3ES4A 5C6CA 1S0BA 4JKKA 3D3AA 1RUF1 4Y1UA 3AXEA 2JE7A 1UW8A 4XEZA 2ZEWA 4NIAA 1RGSA 2KM2A 4GH4B 4HN0A 1TNRA 2A71A 1XXNA 2PHTA 2WYSA 3GDBA 4LITA 2OW4A 4DXRA 1LHVA 1EUTA 1PM4A 1UNBA 1YCIA 1TME2 3VZLA 1PMHX 4QWNA 1B09A 2TEPA 1UF2C 2W5FA 3BUCA 3VN4A 1ZRFA 2DBIA 2VMGA 2FMDA 4WVMA 1RUJ3 2WABA 5CB7A 3LCPA 5FPAA 1DIWA 2ZAAA 2ZGTA 1US2A 4XYXA 3WHTA 2ZZQA 1QJY1 5F6LB 1QMJA 5H9RA 3CEWA 3PU8A 1AYN2 3NNLA 3POIA 4CTEA 4L99A 2B9UA 3S6PA 2ZGRA 4BQWA 2FDFA 3KGZA 3K75B 2R16A 2ZGQA 2ENRA 5FZAA 1PIV1 1R1A1 1BKZA 2VH9A 4LA3A 3IDBB 4BM8A 5KXCA 3BTXA 1F35A 1CQ9A 5B4XA 1LECA 1Y9MA 3T30A 4Q4Y1 3T2QA 3ZFFC 1HKDA 3HT2A 4QGMA 3AVSA 2PAEA 1XC6A 2D6OX 2WZR1 3CF6E 4BQYA 2J1VA 4RQPB 2YU1A 4GD4A 4J25A 5FZ6A 4BHPA 4NOTA 1WLCA 1BYHA 5DXDA 3VBOA 5JXHA 4QMAA 2OX0A 3JCIA 3ZYPA 1MR5A 1G86A 2CDOA 1ENXA 1W9FA 1KITA 1CONA 2VZQA 4JKLA 4ZONA 3WY6A 5BV6A 4ET7A 1UOFA 1OPMA 2DU1A 5FYHA 5CA6A 1VBA3 5IT6A 3VBHA 3QBQA 2ZEZA 2XJTA 3DPRA 4HK8A 2ZMNA 4MO3M 3H8RA 1CJDA 2Z42A 2LTNA 1A6CA 2R072 1QXRA 4XUTA 4BQ5A 4GB31 3GBFA 3MV11 2P3IA 4PDWA 4ZS2A 4LTAA 4QX1A 3IAPA 1XJAA 4MGZE 2RS32 1OC1A 4CDXA 4GMP1 4JX0A 4D0QA 3O1SA 5SV8A 2XH6A 4EJRA 2ZHMA 2C26A 4Z8BA 1DCSA 5I8YA 2XJQA 3KGLA 2JDMA 4Q4V1 2OQ7A 3M8LA 4PLNA 4QGNA 4MGQA 1JMUB 2ARAA 2DUQA 3J8F2 3U14A 4E8DA 2FBEA 5KXBA 2GNTA 1YJKA 1UO9A 2B39A 2EIBA 4ASMB 3I2FA 5A3LA 3KV6A 2FMYA 4QQHA 1RYYA 3EO6A 4L92A 3ZSLA 1J3QA 4FP2A 4CDUC 4XCAA 1BEV1 1YEWA 4LBNA 4RGGA 4FPHA 3EMRA 5FP8A 5L7OA 1XNAA 1ZNPA 2W3JA 1W6PB 3RYRA 1JBCA 5ABJA 1GOGA 3UESA 3BVCA 3OJBA 3HBZA 3AYEA 4B1MA 1C1LA 3P6BA 3JQXA 1CZTA 1UIKA 2VW0A 4UW6A 2YROA 2GMPA 1IHMA 3I2HA 3KT4A 3R05A 2VOKA 3MIDA 1ZA7A 3ZXAC 4COYA 3ASIA 4DXTA 5ABJC 4R9AA 2NP0A 5L7OC 1DGRA 1PMJX 2RVAA 3B02A 1ZRIA 5FZEA 4A44A 4BDVB 1CAVA 3MHZA 5T5LA 1LJ7A 4BJ0A 1XYOA 1UY4A 2JXAA 1ZRRA 2R061 4H7LA 1W2UA 3SNMA 4W6WA 1HV0A 4GKXA 3IPVA 4Q2FA 1QWRA 2XKOA 3FBMA 2VXJA 2QTWB 1OI6A 2DCKA 1AR71 4LLFA 3A0KA 4IW3A 3B94A 4DPNA 1EYBA 2F17A 5HCBA 4GMP3 1A3KA 4EWDA 1DQ4A 5FWJA 3ZFFB 4RYDA 4DNYA 2VNOA 2H6BA 3PVBB 1JZ3A 3OPZA 4N53C 2XDVA 4FTBA 3N9OA 4RQPC 4IETA 3WG1A 5HXMA 1GR3A 1REFA 1CIYA 5JSRA 2OVUA 4GWNA 3N35A 1NA1B 1NZCA 4HVRA 1H9WA 2DBNA 3CQOA 4FVVA 3WSOA 3VBRB 2C9KA 3NV1A 4K40A 3DPRC 3POWA 2R073 2JD4A 3LQCA 4OMCA 5FIXA 3AC0A 1DQ0A 4BCUA 5A6QA 1RUI3 4Y3OA 5CFCB 5C70A 1NA1A 4ARYA 4JV4A 1JYIA 4Z1VA 1J1TA 2Y33A 2WZPP 3ZYRA 4YZ1A 2XPJA 1GOFA 4V2WA 4XZPA 3RZJA 1RUD1 2R1BA 1VMFA 4UFJA 2ZXQA 5K0UA 4K1YA 3ZFFA 3BGAA 3I4IA 5C8WA 2DTWA 2Z4FA 1Y43B 4AGGA 1RMU2 2C0ZA 3AKSA 4OHXA 3IMNA 1VLNA 4WBBA 1W90A 4OI4A 2DVBA 4TXWA 2VUJA 1VMHA 4KL1A 5HCHA 3IPVB 2X5IB 3LA3A 1PO23 3OEBA 4P9IA 4X8PA 4AAXA 2WO7A 5LY2A 2JDNA 2XG3A 2P3YA 4XQWA 5IK8A 1AYN3 1EPZA 1PZ7A 4YZ2A 4FT8A 1YLLA 1OOPC 5I8TA 4LO5B 1GFF2 1OUXA 2QKDA 1K3IA 3J9SA 3J7HA 3K4ZA 1XBFA 2XVGA 3H1YA 3OG2A 2RDRA 1ZRDA 5JWPA 4LBQD 4O7XA 2BFUL 3I8TA 5EYXA 1MACA 2FZ1A 2W1UA 3KVAA 4Y22B 5LB6A 3OBRA 4AEJA 1N3QA 5C9AA 3IDEA 2BGCA 3B3QE 3WDWA 1LOAA 1RITA 3A22A 1WW5A 3WF3A 2GH8A 4Y5TA 5T5JA 2KD7A 5EV7A 2VOTA 3VBSA 4OLLA 3WINE 4FI9A 1BZWA 2WNUC 3H7JA 3K51A 2D3SA 1OXCA 4XACA 1DF0A 2W9XA 3DL3A 2RR11 4KBZA 3ZYFA 4CP0A 5JPNB 3VKLA 4XILA 1LOFC 1COV2 1LULA 3VGIA 1UYPA 4IEOA 2W92A 4Y5Z0 1DDLA 5A80A 5LA0A 1ZRCA 4DQAA 2ARCA 4L11A 3ABZA 1OKOA 4NHLA 2ZKLA 3D0SA 4YM1A 4XPVA 4BQ1A 1QIQA 4ZU4A 4D69A 5JPMB 2YHJA 1U5ZA 2XGXA 1IPJA 3I97A 4AGRA 4EN8B 2WKKA 4GB33 1UN1A 2D7FA 2HWC2 4AI8A 4E4SA 5C3RA 1VB4A 2DVGA 4E4DX 1REEA 1VBE1 1E5SA 1V9U3 5CZKA 5D2AA 5FPZA 4META 4K8FA 4P9JA 4GWIA 4XUOA 2SBAA 4IE5A 1AF9A 1PO13 1SG3A 1A34A 2RJKA 1O3RA 3I3BA 1BXHA 2G19A 3Q8AA 4QKNA 3VBHB 5DPNA 5BNOB 4JTNA 2P17A 3AYCA 3BPSA 1RHI1 3K4AA 2AEZA 2VVFA 3NAPB 3RI8A 4K1ZA 4NMIA 2W52A 3S30A 4Q4W1 3EXUA 2LALA 4HKOA 2E51A 2XVLA 2ZGSA 3P5BA 4MXVA 3T1MA 2Q5TA 1YFXA 4WM8B 3RZZA 2VBPA 1BVP1 3NNJA 2WC2A 4MXWB 4B4RA 4JGZA 4K6BA 3RYPA 3KF5A 4QB2A 4YRDA 3THTA 4DRVA 2IVIB 2X29A 1PO21 1UD1A 2VZSA 2CGPA 1H1IA 1BK1A 1H6XA 2PAMA 1WBLA 4F3JA 4P9LA 5K9YA 2VE1A 3C7OA 1X82A 1C57A 2LS6A 3CJIA 4Z2WA 5FV3A 5FZFA 5JVVA 3CL1A 1UX7A 1W3XA 2ADDA 5IATA 1YXWA 1LNSA 2E26A 3GHNA 2BEOA 3ILRA 3KV5A 3OUJA 4FXKB 5L36A 4XJ8A 4WVMB 4H14A 1WBFA 1PZ9A 5DZEA 4Q4X3 5T5PA 4IEYA 1ZZ7A 3H50A 2XQXA 5L9RA 1AXKA 3T2OA 1R081 2FCUA 3FN9A 2ZX2A 4EYUA 1DHKB 2P6HA 1W06A 3FMGA 1BMV1 3HMYA 4E4ZA 3GXUA 5FZ3A 3GHMA 5LY1A 1AR62 4A3ZA 4URAA 4Y5SA 4F8AA 2AZ5A 4QPYA 1HJFA 2XMLA 1GQPA 4BB3A 5L73A 4EWAA 4OQ9A 2EIEA 1NE4A 2VMHA 2BBAA 3NJVA 4N7UA 2H6CA 4NIIA 3MPPG 3U78A 4EZHA 3N7JA 2J1UA 1AR61 4JKMA 3K2OA 1WMFA 1NYWA 4KG0A 4MGYE 4IGQA 5FUNA 1JOPA 4HETA 2GMEA 4IEQA 4BLIA 3NJZA 1W2OA 1HB2A 5LW9A 1MS1A 3IM0A 4WVWA 1NQJA 2Q30A 5JOYA 4QX2A 2TBVA 4BMEA 4C1WA 1YQ6A 5LATA 1PNGA 1OT5A 4ZZ8A 3ZFGC 3LPGA 3I2OA 2P1BA 1CPNA 4Y22A 4KWJA 4AAPA 3DXUA 4D6SA 1P8JA 1HQNA 1ENQA 1FXZA 2A6ZA 4XBLA 1G7YA 1RL3A 4JDMA 3VBUC 1GNZA 3O1PA 3PVOA 5FKCA 1CAUA 3RPQA 2VUCA 3RDIA 3WW1A 2B4KA 4AI1A 1R082 3AMPA 3K77A 5A3UA 4JRAA 2Z5WA 2XHNA 5FZHA 1EV13 5FXZA 5JXIA 1JS9A 1QNWA 1OBNA 4YW4A 5LBCA 1CAXA 4P9GA 5GM0A 3ZO0B 3LIGA 2OYZA 3ZFEB 3I2DA 5CISA 4CYDA 1GQHA 4LE3A 5EJ3A 5FJHA 2R1DA 2ORZA 5FP4A 1EAH2 1STMA 3M1HA 1JTZX 2EF6A 3NKTA 4Z07A 3D4KA 4YARA 5DAWA 4BE3A 3AFKA 3CLPA 1FNYA 4LIVA 4D7TA 1RUG3 3ILNA 4MH0E 1WD3A 3OEAA 1W2TA 1ULDA 2R0FA 4CVUA 3B93A 4IXLA 2W1QA 4XFFA 5DAQA 1T6GC 2D93A 1YQ8A 2IXIA 2YBPA 4FFHA 4KWLA 5CAZA 1UZVA 2Q0AA 1J84A 4XFIA 3TB0A 1H1MA 1SLIA 1HJGA 1VAKA 3C2UA 4IV1C 5FPLA 2CYFA 1F4HA 4HOOA 5DUWA 4WM7B 5AVPA 2DV9A 1H2MA 3RNSA 3AMMA 4CEYC 2UYAA 5JAXA 1ENSA 1CAWB 4Q4X2 3NJYA 1GNHA 1ND3C 4HFSA 2WWJA 1GANA 3EHKA 2BGPA 5FXXA 3KQ4B 2BTVC 1CIWA 2WLPA 3POGA 1HLCA 3TEWA 1WW4A 3IB3A 3ZKUA 4NIDA 3S0MA 1OFSA 2ETEA 5DUVA 3IAQA 4KH9A 1NCRB 1ZA4A 3O14A 1NKGA 3PNAA 1COV1 5EQUA 3H42B 1NLRA 5FR3A 1DZQA 1KFUL 2RR12 3BOPA 2FDHA 5C3PA 4NR1A 2NPIA 2W2IA 1D4M3 2PLV2 4RR3C 4W50A 4UOJA 3GALA 3HBKA 1UZYA 4NRQA 5D8AB 1F15A 5IFPA 2QVSB 5IVFA 3VUOA 4OUSA 5J48A 1D4M1 1OF3A 1OLQA 2RJLA 1O3SA 5LASA 1IKPA 2D98A 3DF0A 1FV2A 3G6JB 4K7JA 3KLSA 3P1IA 4HN1A 4M00A 1SLBA 5FJKA 4P9WA 3OYWB 1WUVA 4IQPA 3IDAA 4EQVA 2BPA2 3Q8CA 1NY71 3JB8A 5DAPA 3VD5A 4N43C 1MZ5A 1VBC1 2WSUA 2CWMA 3VHOA 3AZXA 5FOJB 5JMOA 1GKBA 4B7EA 1AX2A 1KGYA 4FPYA 1ONAA 4WZCA 1RMU1 2WO2A 5FZOA 5KHGA 3V0BB 5FO9B 2P34A 4ASLA 5K7PA 1JYXA 1RUE3 1X8EA 3ETPA 1OLRA 4RSUA 3POBA 5I93A 3VKOA 2WS93 1V9U1 2ERFA 5F5QA 5EFUA 2WFPA 5H9QA 5KHJA 1W2NA 2XOMA 2BNOA 4XURA 4MGIE 4MXWA 3T08A 4ISQA 1VAMA 3I2JA 1MQTC 5C4WB 5IK7A 3AL5A 3ACFA 3G7DA 4PIZA 3BU0A 1DP0A 3GJBA 3SH3A 2PAKA 2RDNA 3CIHA 4AVSA 4LUMA 1ACCA 2W68A 1S0GA 2VZUA 3P3NA 4XJZA 3SXWA 3ZYHA 5JOXA 1PK6C 3B69A 2VC9A 4PIYA 4QQPA 4I30A 5I0UA 4RS5C 3TNQA 4GQ7A 4NN0A 5KC6A 1QH7A 5C8CC 2MNGA 1HN1A 4K21A 1AR92 4RHV3 3SMHA 5JZGB 5BY5A 5JI9A 3NNFA 4IV1B 3W21A 3WEZA 5BNOA 3UV9A 1W8OA 2RV9A 3FLTA 5GZGA 5FZCA 4OMDA 5AVAA 5C33A 4GJYA 4PI0A 3KMHA 1UY2A 4AVAA 4P5YA 4E9KA 4FTSA 4ZS3A 3ACHA 4XJWA 3A7QA 3APBA 4OZOA 3VZOA 1CWPA 2ZMKA 4YW1A 1NXMA 3WLUA 2JG8C 2XUEA 1WMEA 5J3UA 3S57A 4XW3A 3VDDC 3U07A 1GZWA 2DVDA 3M3OA 2R7EB 4NRPA 1VAVA 3N9PA 3BYWA 3OGJA 1SHWB 1NCRC 4XFGA 1I3HA 1TME3 2RHPA 1HRI1 5CIRA 3N7KA 5C4WA 5A6YA 2F4PA 1G9FA 1MS4A 1NOVA 1W8WA 2ZACA 1FOD1 5BNNA 3IWZA 5GZEA 1LENA 1I9RA 2BV4A 3FFQA 3H8UA 3ZMOA 1W0OA 2VL4A 1H0BA 3LSDA 2GP5A 1WCUA 2XBO1 3ZSKA 3HOBA 3PVEA 4WZFA 3WQBA 2D97A 3ATGA 4H7MA 4XDPA 3PMEA 5LA1A 2OQ6A 3L2YA 4Y4RA 5JI7A 1POQA 5DZGA 5BXXA 2FDJA 4TLGA 1WKYA 1X8MA 3FLPA 5ACA3 1JYCA 1TZOA 3LEMA 4FFIA 1WW7A 2R062 4XXAA 1RINA 3ILFA 3KM5A 1WZXA 3ZPOA 1Q5OA 2ZBJA 3ZN6B 4D6RA 3ES1A 1OF4A 2VCBA 2Q4SA 2YC0A 3UETA 3USUB 1YJLA 4LMFA 3SEPA 4AVTA 4UFIA 1SEFA 2HWB2 3J8F1 2PA7A 2D5FA 4Q4V2 2A75A 3C7HA 4FPLA 1UAIA 4CDWA 4QPGC 3LEIA 1A8MA 3FL7A 1O8SA 2CWSA 2P4EA 4GWMA 1ULFA 4RA0A 4TYSA 4Y1VA 2EA7A 1BEV2 1W03A 1RMU3 1S2EA 2D6PA 2R043 5FP3A 1FPN1 2GN7A 1SFYA 4AW7A 4KNCA 1NCRA 1QJU2 2WNVA 2WT1A 5GLWA 1GZCA 1WMXA 2R071 1JYVA 4MOAA 2X53S 4A7ZA 3AKRA 4Q5OA 1RUG2 1S0EA 2EICA 3ZSEA 3O5SA 5FZ9A 4MZUA 5A7WB 3RSJA 5D1IA 4DY3A 5FOBB 3O1MA 4Y1ZA 4RS5B 1EAH3 1RTVA 4RL7A 3RWKX 1DBNA 1PVC2 2W39A 3KVBA 5GLVA 3VBUA 2G1MA 4ES9A 2BRTA 2XVKA 2OXBA 4LBQA 4EV0A 4QX7A 5E1RA 5FO7B 3B00A 3UK9A 3ROUA 2FCTA 2Z2SB 4CXXA 5KWRA 3ETQA 1MEC2 1DGWX 4K3UA 5G04L 1IPSA 2QQOA 1VBD3 2A6WA 1MVEA 3VBRA 1W6NA 3WW4A 2D5HA 4ZU5A 3H8XA 3VB9A 1OA4A 5F37A 1PX3A 3OPTA 2VM9A 4Y4YA 5KHIA 1UPIA 1BCXA 3R4SA 1NUKA 5HCFA 5F2WA 2VZPA 4Y1XA 3ZIWA 4AXOA 2W94A 4AFBA 2VZ3A 4PT6A 1ULGA 1OHFA 2WR9A 2VG9A 4O9EA 2JECA 3C7EA 3MIBA 1IKQA 2XLGA 3M3QA 3SC7X 4QPIA 4CCOA 4DUXA 1HRV3 1AL0G 3J8F3 1RUOA 5EPAA 1W0PA 5I0DA 3NVCA 4Q0UA 2HLEA 2ZGPA 4BA6A 1RXFA 2B46X 1WCSA 4Q4Y2 1JZ6A 1L7LA 2WQ8A 1UL9A 5CBLA 1E5HA 1Q43A 1JYTA 3ON7A 5JMCA 1R1A2 1F5JA 4FBFA 1OURA 4XF9A 1Y7BA 4V1PA 3VKMA 3O1VA 1TME1 2V72A 2WYFA 3V0AB 5FY8A 5AC93 5IVEA 1LGBA 5FY5A 2WJSA 2W08A 2VPVA 1LR5A 3EQEA 2HWE2 1XNDA 2VU9A 3H9AA 5ANNA 3MFCA 2QNKA 4NJ4A 2J1SA 3MI8A 4Y1YA 1RUF2
chains in the Genus database with same CATH topology
1VBD2 1ENRA 2CGOA 1PGL1 1KRIA 4YGDA 2MEV2 2ZS6B 3WW2A 3O0WA 3VHRA 4FO9A 5AC92 2WA4A 2IC1A 2I07B 3VHPA 4JGZC 2G4IA 1LKNA 1S1AA 4JTOA 2HWD1 4COVA 3ZSJA 4AFCA 1EV11 1QJX1 4IERA 1H8TB 1VRH3 3QCWA 2PHFA 5BNQA 1KD7A 1VBB3 1KDMA 4AI0A 3WXPA 3BALA 3VZJA 5BNPB 2RS33 5DUUA 3KT1A 2WT2A 3GZTB 4PDWB 4JDOA 2BW8A 3MGUA 4SBVA 1GSLA 2R041 4IESA 2GNDA 1ALYA 1DG6A 3O0XA 4FXGB 2HYKA 1VBB2 5JOWA 4M0NA 5KXDA 1F31A 1UPSA 1JUIA 3SCGA 4XOGA 1YWKA 4P9XA 2JE9A 3CJIB 1WLDA 1HIXA 2NMNA 5FFOC 3U11A 2BWAA 3X29B 1UU4A 2PHUA 1MQTA 2YPJA 2XJPA 1OA2A 1SBFA 4W6XA 2I45A 3ZYGA 5ACA2 1SBDA 2QDNA 1PO12 4X6RB 3IDCB 1POV0 1UU6A 1V70A 1LHOA 4BH9A 1SDWA 2JX9A 4P14A 3ZN4A 2ZHKA 4ONUA 4YG0A 2VMIA 3HQXA 3KD4A 1GV9A 4Q27A 3WT3A 3NAPA 3M7AA 3LOIA 1B35C 3MF9A 1BBT2 1OOPB 2DTYA 2Q1MA 4QM8A 4URTA 3V65A 3V0AA 3RMXA 2UY9A 3O0VA 2NM1A 2DVAA 5BPXA 2PHLA 3CNAA 4LULA 3T1LA 4S2HA 2XLFA 4FSJA 2BWCA 2HWE1 4XFAA 1X50A 1X7NA 2B7YA 3AB0A 4EN9B 2ARBA 1PHMA 3E6DA 1Q8SA 3IBMA 2Y26A 3NV3A 4BWOA 1SBEA 2WNVC 2HWD3 1XNBA 1YI7A 2QUOA 3RI9A 4QM9A 5EWSA 1FYUA 5LRSA 2QFEA 4FPEA 4XMAA 3L9JT 4M01A 1G9DA 3AZVA 3AP7A 2YGMA 1OFNA 1L3JA 3MW4A 2GU9A 2WA3A 4AEDA 4QPGA 1RUJ2 4AVBA 2D43A 1IGOA 1W6NB 3H3UA 1X36A 4IL7A 3MIHA 4MUVA 3ZFGB 2R30A 1RUC2 2E7QA 3WUDA 4R9BA 2E7TA 4XQDA 4GH4C 1H8VA 1XU2A 4YGBA 2R0HA 4M0HA 4HSLA 3AK0A 3CU7A 4OI2A 4XFBA 2WINB 3AYDA 3UJOA 1R083 3H1MA 2TUNA 2VQAA 3ZYJB 5DG2A 1FAYA 4RD7A 4I02A 4M3CF 3MIGA 2VW2A 4TWTA 4KU7A 2DCJA 3CJIC 1R1A3 1XRUA 1DU3D 1DZTA 1V6OA 2OUJA 5J96B 3OGGA 2VVDA 4OUMA 4COUA 5TSWA 1JH5A 4QU2A 2VVEA 4YNIA 3AJYA 3AZZA 5AFEA 3WX5A 5BNNC 2XL7A 2WS92 4FPFA 2Q1ZB 1QJU1 1N47A 3AKTA 1AJKA 1AYM2 2XUMA 5C4WC 4N90A 1FPN2 2DUPA 4D94A 4AYUA 2E6VA 4AHYA 4HLTA 2D6MA 3JD71 3VZNA 4M3CB 1H4HA 1QU0A 4GALA 1JOJA 3ALQA 5A33A 4QXKA 4Q4Y3 1C8M2 1VBA1 4IEXA 3ZN6A 2WNEA 3JUUA 4HPKA 2YUEA 1QJZA 5HXVA 2HWB1 4GIQA 2A3WA 3UKNA 4E27A 1U5XA 2D6KA 1C8NA 1TMF3 4ZKTB 2QDRA 1J3PA 3FZ3A 1AHSA 1QJX3 1QH6A 4R8HA 2XJVA 4MGKE 3PMSA 1GBGA 3BOWA 2UWAA 2OZJA 1DFQA 1KDKA 4LR4A 2CY6A 4AHWA 3VZMA 1PIV3 2HEVF 4XF4A 4Q0SA 4R4XA 2ES3A 4YGEA 1KFXL 2A6YA 3DUIA 4Q8KA 2OIIA 1SCRA 2YZ4A 2NLRA 4KG8A 4UW4A 2CAVA 3WHUA 3AZWA 3ZYIB 2JICA 1POV3 2VOXA 4NPRA 3DGTA 3M70A 4FP3A 2PQQA 2R32A 5CFDC 3ELNA 4XHBA 1GZ9A 4CDUB 2DFCA 1HRI2 3KCXA 1ASJ1 2C5DA 4PDWC 4Z82A 3NSTA 2UWCA 3WDUA 2HWF1 2H0BA 1D0GA 4QD2A 1QGLA 1VRH2 3I7DA 3TYJA 1AX1A 1I1EA 4KU8A 4YLZA 1APNA 1PM7A 3JBG2 1Q3EA 5H9SA 4IV3A 3MYXA 3A0NA 1SCSA 1K5MC 5E89A 1RUNA 2BFUS 1AR91 1NCQA 2VGDA 1N1SA 1AL21 1W6QB 2ARXA 2AREA 4HANA 4CEWA 1W6QA 4I09A 3NO8A 1S0CA 4JDNA 5BNNB 2NYYA 3ZXFA 4N9HA 3AKQA 1NLSA 2Y38A 1WA4A 2A5ZA 2GNMA 4GKYA 3SHRA 4PLOA 2BNMA 4HZFA 5JZGC 2CAUA 1ND2A 2D6LX 2D3PA 3I59B 4A7YA 1MS0A 5L19A 1S2KA 3B9CA 4BPZA 1AXYA 2EXKA 4TSVA 4IV1A 5E88A 1YFYA 1VBC2 3NW4A 2PHXA 1KJRA 3U0ZA 3VBOB 1YRZA 1ND2B 4J1WA 3WUCA 4D7SA 5KXEA 2XLAA 3MDPA 2DVFA 4A7KA 2VOWA 4Q4V3 3SISA 2GC3A 3BB6A 1ZBA2 1QNYA 2A6VA 3CO2A 3TBDA 3UKVA 4YVSB 1UX6A 2EXJA 4E2SA 1PVXA 1O3TA 4UW3A 3AMNA 3B9IA 1MS3A 3KB5A 2QZ2A 1LOFA 2PLV1 1AR63 3FFZA 2VECA 3BIWE 2WNUA 2X5IC 5LEKA 1DQ2A 1S2BA 1Z7S3 3IT8A 3E5XA 5DUXA 1YYNA 3ZDSA 1ASJ2 4B7KA 1UIJA 2XL9A 4K20A 2KXLA 1S0FA 3ACLA 1PNFA 4HPKB 2CGNA 3JBG3 4Q8LA 1UKGA 4MVTA 4YM3A 1HQLA 4Q4X1 5A33B 1PGW1 1AJOA 5T3NA 4OVEA 3V56A 2HKXA 4EROA 4TZDA 3B01A 4XMIA 4FPGA 5D8AA 4LT5A 1YHFA 2WT0A 4R4ZA 1VP6A 4I3PA 2YYOA 1OA3A 1QJU3 3FBYA 4XETA 3S7EA 1A78A 4NVPA 1J1LA 1FATA 1H8TC 2HWC3 2IWGB 2YXSA 2Z79A 5LEJA 3JD73 1NCQC 2WL1A 2CL2A 4YW3A 1H2NA 4N9IA 2DF7A 4KWKA 1CR7A 1MS8A 1NA1C 1W6OA 5E16A 3WP3A 4RGAA 1KJLA 1Z7S2 1JXNA 1DGLA 1Q8PA 1XU1A 2XWBB 4WM7C 4B8EA 3D6EA 4CEYB 1E57A 4XF1A 4WM7A 1BVVA 2I74A 2WFF2 4Q0VA 2CNAA 4HKLA 2ZGMA 4MV2A 1CX4A 2IZWA 4MLOA 4G9SB 1HW5A 3VBOC 3U4XA 3HWJA 4N53A 4QQ2A 3VBFB 1WMDA 2EXIA 1DQ1A 3H7YA 1G6NA 2EVXA 5GLTA 4ES8A 2YY1A 1LOCA 3L2HA 4LBLA 1F2NA 2ILMA 2OZ6A 1YFWA 1UZZA 1QF3A 5D8AC 4XJUA 4EWEA 1CAXB 1DYPA 2XJRA 3WG2A 1NE6A 3OD0A 1LHWA 3NKGA 3IN9A 4WVZA 2LUWA 4DS0A 1QXJA 3AMQA 1GLHA 3AJZA 1FX5A 2ZX0A 3ME2A 4DOUA 1AR83 5GZDA 3KT7A 2DWRA 3QOPA 1C28A 4HVOA 3AP6A 4KGGA 5FAXA 3N3HA 2BUKA 1Y9QA 2E63A 2I2SA 5CADA 4IEZA 1M06G 4LE4A 1RUJ1 2VNRA 3AP5A 2O8QA 1K5MB 2D44A 3N4MA 1W39A 4AVCA 2EXHA 4PBOA 2A7AA 3LOBA 4YYOA 3ZXEA 4L97A 1YIFA 5DDJ1 4QGLA 2DURA 3E6CC 4RHV1 3O12A 4WM8A 4AEDB 3SCFA 1F5FA 1FT9A 4B4PA 1CVNA 2QCSB 4LBKA 1O4TA 5FTTC 3R0RA 3WP6A 3VKNA 1PO22 1TMF1 3LA7A 2V09A 4HT1T 1BJQA 4ISRA 4I0BA 3GZUC 3BCWA 4DMIA 1XNCA 5JLVA 3QLQA 4XBQA 2D40A 4UBHA 3WZ1A 3VBHC 4Q4W2 3WCSA 4LUKA 5I0RA 5T55A 4CDQA 1RUI1 4W65A 2IXJA 4HMZA 1RHI2 2RMU2 1ND2C 5I8SA 4BMBA 2P3KA 5BYNA 1MEC3 1OOPA 2A3YA 2VQ0A 1SQ4A 4EN0A 1J3RA 1PO11 2WSVA 2GH2A 3D0JA 4DXZA 1H8TA 2O0OA 4PBPA 5ACA1 4FCAA 1VBE2 2N7GA 4UBGA 2IFWA 4A3XA 4DY5A 2JG9B 2R49A 1N1YA 3LGRA 1WCDJ 1J59A 5JIAA 3SH5A 1ZM1A 2BVBA 2VY0A 1VBB1 5FCCA 2EIGA 1LU2A 1VB2A 5IK4A 2CTVA 1HXS1 4AQSA 3WD5A 2RS52 5C9AB 3H0OA 1AR81 2OPKA 3LWCA 3BPZA 4IV3C 1RUH3 2ZPXA 3N36A 4LO6B 4OHZA 4XF3A 4P5HA 2ZA9A 1KS5A 4PF5A 3GF6A 4FOQA 5A3MA 2RE9A 4U36A 5FBZA 2XJSA 1AYM3 4UW5A 1REDA 3KZ4C 2TNFA 5F6KA 2RM22 1G9AA 1ZZ9A 1XYNA 2X5IA 1QJX2 2PHRA 4S2GA 5CFDA 2HWD2 4HBNA 4LEJA 3TN93 1SACA 4YVWB 2IXCA 1O3QA 3SH4A 1ZYBA 3R4UA 1O91A 1OD5A 4QX5A 2DCYA 3MW2A 1O5UA 2B45X 2MEV1 4QQOA 3USSA 3URFA 2B42B 1MZFA 3DV8A 3W58A 4NO4A 1CD3G 1VBD1 5T5OA 5J7MA 5CU1A 3PVNA 1RVF3 3E97A 4Y24A 4N53B 3LAGA 5CFCA 2DCZA 2WQ4A 5FDBA 4I2OA 2Y0OA 1UCXA 3MIFA 5BNPC 3TRSB 1O7FA 1RUD3 2ZKNA 1QDCA 1IS4A 2RMU3 2PELA 2IXKA 2WWSA 1EP0A 4DINB 1EPWA 3VKFC 4NHKA 4ATFA 1W6OB 4LO4B 4JC1A 4D3WA 5HI0A 1IS6A 1TE1B 2O8OA 5A32A 2HEWF 4Q0PA 4S2DA 1W6MB 4QQLA 1Z78A 1DGRN 1QHDA 2EAAA 4IEUA 4SLIA 1U5YA 1H2KA 4B4QA 1LU1A 4CDWB 4OI0A 4GULA 1QJY3 5A32B 1Q8OA 4MX3A 3GZAA 1CAVB 1MEC1 4L8QA 5K0UB 4X8NA 4CRQA 3KSCA 4YFZA 1VR3A 1RUH2 4XFCA 4K9SA 3WP4A 1PVC1 1YFUA 2VNGA 4YFWA 3AKPA 4LBOA 5I0TA 1J58A 1RVF1 3ZXLA 5ABJB 1W6PA 1RUG1 1B35B 1WLWA 1ZZBA 2DFBA 2ZX1A 1LOBA 5DG1A 1QOSA 1FPN3 2ET1A 1YI9A 4WV8A 3ST7A 3ZXGA 3TWIA 1UKRA 4OULA 3AP9A 3TN91 1POV1 1CJPA 4Q1RA 4ITCA 2JG8B 4AEKA 3GYDA 1COV3 2YV8A 3IIAA 2ATFA 4AEDC 1MS9A 3MFAA 5FREA 5GLUA 4W6YA 3LB9A 2RS53 2WNVB 2K2SA 2EAKA 2AENA 4XIKA 4YVSA 5JR7B 2C1FA 4COWA 1VJ2A 3PTYA 4CDXB 2R063 4EN7B 1PZ8A 1ULCA 4L9BA 2E9QA 2XWJB 3MICA 4IEWA 4LBMA 2EALA 2X8KA 1M4WA 2A3XA 3ZSMA 4JQRA 3CJXA 2ZGUA 5SV5A 3VBRC 2FHRA 2K0GA 2H0VA 3AZYA 1OSGA 2HWB3 3USUA 1D2SA 2UU8A 3EJKA 3TN92 2RS31 1OKQA 1NXD1 2XBO2 4FOWA 2HEYF 4LHNA 4M3CE 2VXRA 1FOD2 1C8M3 2BYVE 1RVF2 4FOVA 3FWEA 2F6BA 1C4RA 3SITA 3GNEA 1OQ1A 3ZMNA 1RUH1 2RR13 5LK7B 3JU9A 2V73A 3V0BA 1SLAA 1GICA 4AQTA 1PIV2 4AWDA 2D6NA 2NN8A 4PIXA 4DRRA 5CG8A 2HWF3 3PLQA 1OQDA 3WQ1A 3OYWA 1FV3A 1AYN1 2AGSA 4Q1PA 4XDQA 5GZFA 4YG3A 2BBVA 1H2LA 4GH4A 2ZX4A 4CP2A 1LB2A 4KQ7A 2UY8A 3B5LB 2VOVA 2XHKA 3KCYA 2ZAHA 5JZGA 2P2KA 2JEMA 1F8VA 4BLJA 1IQAA 2WQZC 2ZOEB 5B2GB 4YVWC 1G9BA 3HIFA 4FOYA 1DGWA 1V9U2 1LRHA 2GDFA 3EBRA 3D8CA 4NWVA 2VUAA 4CEWC 2V5YA 2PFWA 3DKWA 5FQ0A 5JSOA 3P3PA 2GN3A 4JVAA 2RM21 1O4ZA 2DCTA 3E5QA 1RUC3 3ZIXA 4E2GA 4Y20A 1NY72 2GSYA 2JG8A 2DUOA 3BU7A 4XQ4A 1K5MA 2W0XA 4MYEA 4DZGA 2BVVA 1FI2A 4JAAA 4INDA 2RS51 4JGYB 2BNNA 3TAYA 3OCPA 5BNOC 1D4M2 3FLRA 4I0AA 4AHZA 1B35A 1LHUA 2XKPA 5FRAA 3R6SA 2IXHA 3TNPB 4BOWA 1CGPA 5CNAA 4IEPA 1ZBE1 1PGSA 5JOZA 3MEPA 3BODA 4HSJA 3N7LA 4KGQA 3ECQA 3V64A 1G8WA 2VW1A 4M3CA 4F7ZA 2CV6A 1WCKA 1AR82 2ZX3A 5LRRA 3QACA 4LNVA 1HXS2 3OY8A 3BTAA 3ZFEA 5JSPA 3KS7A 2MPFA 1EY2A 1I6XA 4Q4W3 3ZPYA 2ZMLA 1WW6A 1SLCA 3VBFA 2PLV3 2RMU1 5JIUA 1RUF3 2ZJCA 1Q8QA 1W6MA 4XTPA 1RUI2 5T54A 3VV1A 1A8DA 1LOEA 4RFT0 1R093 1O4YA 4HL0A 4XTMA 3THPA 4N43A 3IKWA 3JZVA 3WCRA 1QDOA 1QOOA 1XE7A 4GA9A 1RJ7A 5GJ6A 3WP5A 1XQNA 1WGPA 3FE5A 4FQZA 1QQP3 4LBJA 2XJUA 1KS4A 1V00A 3WQ0A 3JQWA 1EAH1 3KCCA 4LHLA 2RS12 1FMD3 4FTEA 2GAUA 2GALA 1AR93 4RHV2 1HRI3 2PHDA 3T2TA 1Q56A 4AI3A 3AX4A 4I0WB 4I3GA 2JG9C 3M4FA 5FLHA 1V6NA 5FMOL 1TMF2 2DU0A 2AYHA 4P9YA 4YSFA 1DQ5A 1QY4A 2SLIA 3HR9A 4YVWA 3ZN5A 4AEMA 4C91A 4OHWA 5KHKA 1HX6A 3GBWA 3HAGA 4S2FA 4AFAA 4JRLA 1JUHA 1C3HA 5DDJ2 3N7MA 4C0BA 1TQ5A 4NWWA 4JGYA 4DFSA 3E5UA 1N1VA 1YIPA 1IPKA 3WR0A 2ZCWA 4Q0QA 4Y20B 1CESA 1H1AA 3INAA 1KXGA 3SCHA 4JGZB 5FQ0B 4G3YC 4QPIC 3H1WA 3UJQA 1JN2P 1PVC3 4XJ9A 1HRV2 4AK3A 1Z0HA 4YM2A 4J1XA 1XNKA 1ULEA 1BMV2 2Y0IA 4XJAA 5FPXA 1ZBE3 2WFF1 1MQTB 3W9AA 1JHNA 3MLLA 5E8AA 1TEIA 4AVVA 4AHXA 4PLMA 3ZVXA 3VZKA 5KHHA 2WIIB 1Z7S1 3K48A 1BEV3 4HKWA 4LHKA 5C8CB 3M3IA 2JKBA 4CDQB 1MZ6A 3I59A 4HVQA 2ZTNA 3M3CA 3HT1A 2UURA 4Z92B 4FPKA 4DB5A 3ENRA 2RM23 3VL8A 3NAPC 1WLTA 1PK6A 3FUOA 5FLIA 1C5IA 1FMD2 3DN7A 3VDDB 5H9PA 1OPOA 3RJ2X 1PMIA 1ZZCA 1D4VB 2HJIA 1RC6A 4YVSC 4CEWB 2A70A 5J09A 4RR3B 3AMHA 1MVQA 5FO8B 1LESA 1PGW2 1QOTA 4CDWC 2P3JA 1HV1A 2OA2A 2B8MA 1OMIA 1GQGA 3WG3A 4IV3B 4YZ3A 4AFMA 2UWBA 4LO7A 3FUQA 5IUQA 2NZ9A 1VBE3 4YGCA 5EZWA 3LA2A 1AL23 1AX0A 1N3OA 4U2AA 5J98B 2A73B 2HWC1 3WG4A 2JJ6A 5IK5A 2QJVA 3SLIA 2K9ZA 4YW2A 1WD4A 1ZZ6A 4OFGA 4YZ4A 2VULA 2YMZA 1VIWB 3PJQA 3RS6A 1ZBA1 5F1RA 2ZABA 2R6QA 4QPIB 4BZ4A 4ZU7A 2HWE3 4C0HA 1DLLA 4ZXKA 1FNZA 1S0IA 4JCKA 3WVJA 5CG9A 3E6BA 4FPJA 3QD6A 5KBFA 4NHMA 4BIFA 1RJ8A 5GZCA 3PHMA 2FQPA 2XB6C 4XXPA 1U5IA 1V6KA 1BBT3 4HK9A 1R1ZA 2ZGOA 2ZHLA 5CVRA 4AF9A 1HDKA 2WFF3 5HBAA 4J6GA 3VBSB 2ZZJA 3FX3A 3VBUB 4RS5A 1IS3A 1HQWA 3MLKA 4R9CA 1LTEA 4EN6B 4B3NA 1LCLA 4FPCA 4QT6A 1SLLA 5CFCC 2Z69A 1D2QA 1TNFA 4ATEA 2UYBA 2YGLA 4OZXA 4QHBA 1IS5A 5JCTA 2ET7A 2FZ2A 2YDEA 1H4GA 1KQRA 2ZGNA 1RUD2 3ZFEC 2XBO3 2P37A 1XE8A 4LO8A 4XFHA 5EXOA 3WDYA 5I91A 2PTMA 3RG0A 3LSEA 3JBG1 1FOD3 4Q26A 3UKTA 2WLQA 1MZEA 2C9AA 2GNBA 1YNAA 1YUDA 1AR73 3OF1A 1AL22 3OD4A 4BYYA 2O1QA 4AQ2A 1V6JA 5C9AC 3POYA 1N3PA 1MS5A 1OQEA 1V6LA 4YG6A 1DYKA 2GC1A 1JW6A 1Y3TA 3RYKA 2ZHNA 4R52A 5L7OB 1I5ZA 3ZFGA 2Q8OA 1AR72 3J4UH 3QH6A 1VRH1 2ZGKA 4A2UA 4QPGB 4CP1A 2HWF2 1AXZA 2WNUB 4N7IA 4R9DA 3O7OA 4RR3A 2E53A 4FQ4A 3B7MA 1Q8VA 3POSA 5J37A 2JENA 3WQ7A 1SMVA 3NV2A 3PJYA 4XHXA 1IOAA 1V6IA 1RHI3 1LHNA 1GZWB 3AP4A 5CFDB 4OI1A 1DQ6A 2G9GA 5I0SA 1U12A 1RIRA 3ZXDA 1AZDA 4CDQC 4FAGA 3D82A 1FMD1 3DPRB 4JGYC 1NG0A 2PYTA 1C8M1 1VBA2 4WVVA 4C90A 4FPOB 2WZR3 3GBGA 1AYM1 1ZVFA 4BIOA 2IFRA 3WDTA 3NL1A 3HD8B 2WS91 5F9TA 3JB4C 4RQPA 3WOGA 1XYPA 2BQPA 2A6XA 4XIOA 4AQ6A 2G9FA 2QE3A 4WM8C 2JG9A 3JD72 3M3EA 4UXAA 4H55A 5BUVA 1N1TA 4YW5A 3Q9OA 4GB32 2QQPA 4D7YA 1DZRA 3AFGA 2RS13 1O5LA