1RUJ1

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj100
1RUI3 4LLFA 1ASJ2 5ABJA 1PGL1 1EV13 4Q4W2 4Q4X3 4JGZA 1MQTC 1R081 5L7OB 1ND3A 1RMU3 5DDJ1 1NCRB 1F2NA 4QPGC 5C8CA 5A33B 4CDXA 4JGZB 5D8AB 2R073 2WWSA 4Q4W3 1IHMA 1POV3 5ACA2 1RUD1 1RUC3 1OOPB 5CFCB 3ZFFB 1AR93 1HXS1 1RUF3 3TN91 1VAKA 4YVSB 4YVWA 4CEWA 1AR71 2GH8A 4EJRA 5ABJC 1MEC3 3J8F1 1OOPA 1NCQB 1R093 2HWF1 1TMF3 2FZ1A 1VBC3 5C8CC 4CDXC 1MEC2 3FBMA 1C8M1 4Q4Y3 1POV1 3ZFGC 4Q4V1 1ND2A 1RUD2 1VB2A 4FSJA 4YVSC 4GB33 5ACA3 5ABJB 1TME1 2MEV2 1HX6A 1PVC1 1MQTA 3ZFEB 1PO23 5CFDB 1BEV2 1VBE2 1HRI1 4QPGA 1BEV1 1VBE1 5C4WC 1C8M3 1RHI2 1MEC1 1HRI2 3VBUC 1VBD1 1CJDA 4N43B 1RVF2 1R083 2HWE2 3VBSB 4RQPB 1RVF1 4CDWA 3NAPA 4Q4V2 1HRI3 1ZBE3 2HWD2 1RUI1 1AL23 1AR61 5D8AA 1VRH3 1PIV1 4IV3A 1FPN1 4WM7A 5BNNA 2HWB2 2HWE3 4CDQB 2RS11 1H8TA 2WFF2 2WZR2 5C4WA 1ZBE2 2R071 4N43A 5LK7B 5FMOL 4Q4W1 1QJU3 1QJX1 2ZAHA 3ZFGA 3VBFB 3NAPC 5BNOC 1POV0 2HWC2 1R1A1 1FOD3 2RM23 1R091 4IV3C 2R042 4Y4YA 1RUI2 1RVF3 4GMP3 1NA1C 3VBOC 1PIV2 1D4M1 5BNPB 1ASJ3 1Z7S3 4RS5B 5C9AB 2RS51 3JBG1 1VBC1 1QJX2 1MQTB 3VBFC 2BPA2 1VB4A 2RS52 3JBG2 3M8LA 4RS5A 5C9AA 1HQNA 5K0UA 1AYN3 2FZ2A 5JZGA 4RR3B 4CDUB 1QJX3 1R1A2 4WM7C 4JGZC 4GMP0 5J96B 4QPIA 5FMOS 1ND3C 4GB32 1AL22 1AR82 1B35A 1FOD1 1GFF2 1VBB3 1AR62 1PVC3 5FOJB 1BBT3 3VBFA 5BNOA 5JZGB 1ZBA2 1RHI1 4CEWB 4CDXB 3LOBA 2RR12 1QJY3 2BFUS 2WS91 4SBVA 3ZFGB 4QPIC 4FTSA 1AL0G 1H8TB 1NA1A 3VBOA 5J98B 4WM7B 1VBB1 2WLPA 2HWB3 2XBO2 1R092 2BFUL 2XBO1 2WFF1 1C8NA 2XPJA 4GMP1 4WM8A 1QQP1 1ND2C 2R072 5JZGC 1VBD3 2HWF2 3ZFEC 5CFDA 2RR11 2QQPA 1NCQA 1BBT2 2HWC3 1AR73 1ASJ1 4JGYA 2ZTNA 1AYM1 1VBD2 2RMU2 3VBHC 4RFT0 4AEDC 1NY71 5CFCC 2RR13 1EAH2 1AR63 1A6CA 1VBB2 4GH4C 3VBRC 1RUD3 1RUC1 1FPN3 5L7OA 1EAH3 1RUC2 2XBO3 1NCQC 2RS33 1K5MA 5BNNC 1RB8G 3NAPB 1V9U3 2TBVA 2HWF3 1F8VA 1AYM3 5GKAC 2PLV3 2HWE1 2WZR3 1BBT1 5CFCA 3VBHB 2WS92 2HWD1 4QPGB 1C8M2 1RHI3 2IZWA 4RHV3 3IDEA 3VDDB 4Q4V3 2RS53 3JBG3 1EAH1 1X36A 5CFDC 1K5MC 4GH4B 3VBRB 5BNPC 3JB4C 2X5IC 1X33A 1W39A 1ZBA1 5BNNB 4N53B 3DPRC 1RMU2 5C4WB 2R062 1VBC2 4IV1C 3VDDA 1BEV3 1VBE3 1QQP3 4N53A 1DDLA 1Z7S1 2R063 1AR83 1BMV1 1VBA3 4YVSA 1Z7S2 4RR3C 4CDUC 1AR91 1RUF1 5DDJ2 3VBUA 1AR92 1RUF2 4CEYC 4AEDB 1ZBA3 5ACA1 1QJY2 3ZFFA 1AR81 1FOD2 1HXS2 2BUKA 4IV1A 1AR72 4N53C 5A32A 4QPIB 2R061 1H8TC 1M06G 2RM21 1HRV1 1RUJ3 4RR3A 4CDUA 1AYM2 1HXS3 2GSYA 2WS93 2ZZQA 1NOVA 4N43C 1HRV2 5D8AC 4FTBA 1NY72 1QJZA 5BNPA 4RHV2 1EV12 1BMV2 2X5IA 1TMF2 1AUYA 1RUG3 3JD71 1NA1B 3VBOB 3ZFFC 1SMVA 1FPN2 3DPRA 1OOPC 1WCDJ 2RS32 3VDDC 3VBSA 1PO13 1RUH1 4CDQC 4FTEA 1D4M2 1OHFA 1QJU2 1PIV3 1VRH1 2PLV2 1QJU1 5AC92 3HAGA 5AC91 4PDWA 4CEYA 2RM22 1B35B 2HWC1 5C8CB 3ZFEA 1PO22 1ND3B 2DF7A 3ZXAC 1RUE1 4JGYC 5K0UC 4IV3B 4Y5Z0 3CJIC 1V9U2 1RUH3 3JD72 1PO11 4CDQA 4GB31 5A32B 4Q4Y1 1PVC2 1TME3 4RQPA 4Q4Y2 2HWB1 1QJY1 3S6PA 4GH4A 3VBRA 2RS12 2WZR1 4PDWB 1AYN2 1ZBE1 3J8F2 1VRH2 5L7OC 1R1A3 4YVWB 2R043 4CDWC 3VBUB 1PO21 1HRV3 1RUJ1 5A33A 2RMU1 1B35C 1OPOA 3TN93 2RS13 1PGW2 1RUE2 4WM8B 2WFF3 3VBSC 1AL21 1V9U1 3J8F3 1PGW1 1K5MB 4RHV1 5K0UB 1TMF1 4RQPC 1ND2B 1NCRA 1RUE3 2RMU3 3DPRB 4NWVA 1COV2 4PDWC 2MEV3 1AYN1 4Z92B 1QQP2 1RUH2 3JD73 4Q4X1 1RUG1 2X5IB 2BBVA 1VBA1 4IV1B 1FMD1 3JB8A 1RMU1 5DDJ3 1RUJ2 1COV3 1E57A 4YVWC 1PGL2 1FMD2 2Y26A 3CJIA 4NWWA 4CEWC 4CDWB 5BNOB 1EV11 1R082 2R041 4CEYB 1NCRC 2VQ0A 4WM8C 1FMD3 2RS31 4JGYB 3TN92 1D4M3 2HWD3 1TME2 2MEV1 1NG0A 1PO12 3CJIB 3VBHA 4AEDA 4Q4X2 2PLV1 4RS5C 5C9AC 1COV1 1CD3G 1VBA2 4BCUA 5AC93 1RUG2
chains in the Genus database with same CATH superfamily
2AEZA 4LLFA 5LBEA 1PGL1 1EV13 3O0XA 2RDSA 4LEJA 4Q4X3 5KHIA 2P17A 1HJGA 4SLIA 4EWEA 2Y38A 3TNQA 1TQ5A 4L11A 4MGZE 2PXJA 4LK6A 4L8QA 4QU1A 3W59A 2HEWF 2P6CA 1AXYA 1ND3A 1RMU3 1NCRB 4UF0B 4UW6A 5DDJ1 2DWRA 4QQOA 1CAWA 1ZZ7A 2GNBA 5JDBA 5FOBB 3MPBA 5A33B 2XKOA 4KWKA 2WIIB 1YIFA 4LKSA 5FKCA 1POV3 2VUDA 1LNSA 1RUC3 4META 2WAAA 5CFCB 1HXS1 4PLOA 4XVHA 1XNBA 3AK0A 3RGBA 2NN8A 2FDHA 1GP5A 4YM0A 1UX6A 4V1PA 4CEWA 5ABJC 3NQHA 5LRRA 3IAPA 2CHHA 2SBAA 1MEC3 4LA2A 1W8NA 2AC1A 3AL6A 3ZIWA 4D7YA 1X50A 4LKEA 3K46A 4BWOA 2BGPA 3GJBA 2J1VA 4LE4A 4OHXA 5FWEA 5F5IA 2YGMA 4Z8BA 4D3WA 4RN5A 1H4GA 2Y6FA 2YG0A 4C8DA 5A1AA 4XMAA 4CRQA 2YY1A 4TSVA 3POJA 2F6BA 3WV6A 2W1WA 3C8XA 3PTRB 2EIGA 4Q4Y3 5GLVA 2J22A 5GLZA 3ZFGC 3ABZA 5F6LB 4BLJA 1SBDA 2P5BA 2DVGA 4L92A 3M1HA 3FUOA 5FMBA 4O61A 1GKBA 1W2UA 2X10A 3AP4A 3C7OA 4IXLA 1ZM1A 4NHYA 5DQ0A 3RYKA 4AI1A 2WBKA 4ZU4A 1NAEA 4AI9A 2MEV2 1SFNA 2KM2A 1HX6A 4FVVA 1PVC1 2C26A 4OLLA 4Q0QA 1S2EA 3NO8A 1ODNA 2NZ9A 1JOPA 1VBE2 4IESA 4NUBA 3LIHA 1VALA 3KQRA 4QU2A 3ZM8A 4IQPA 3WQ7A 4MH0E 1C8M3 3AP5A 4Z2WA 1GZCA 3VBUC 1W6OA 2EA7A 2NM1A 2P6HA 1VBD1 1MS5A 4XAEA 4N43B 1G9AA 3A21A 3NV4A 2Q1FA 2BWCA 4PBOA 4KG8A 5FK8A 5FPZA 3T3YA 1Z78A 5KXBA 4RQPB 1VE0A 1HRI3 5IATA 2F4PA 2E7AA 5A3NA 2HWD2 1MZ6A 4QKDA 1AL23 4UFLA 3SEEA 1AR61 4HETA 2A75A 2VZSA 3B9IA 1LEMA 1ZZ6A 2BGCA 2Y6HA 4XPVA 1QWRA 1JH5A 4I3GA 1OD5A 2J1UA 3PTYA 5D8AA 4RA0A 1W9YA 2VZ3A 2QQVA 3IIIA 4KGQA 1OQDA 2RS11 2WZR2 5I93A 3IDAA 1ULPA 5FZKA 4X8PA 1ZBE2 2GDFA 2VD7A 3I59A 4QPWA 5LK7B 2WO3A 2LUWA 2VW1A 3VHOA 1P8JA 1ZRRA 1A8MA 3FFQA 3ZFGA 1JTZX 2ARXA 5A3LA 3KV6A 3FC0A 1W8OA 1N1YA 5M0TA 3UNPA 5LRSA 1L7LA 1NXMA 2VOWA 3ZKUA 4DOUA 4UBHA 3T0AA 5LCWL 4PBPA 1R1A1 3H1MA 4PF5A 3RI9A 1JHJA 2W91A 3B69A 3WF4A 2NMOA 2YZ4A 1ULFA 4LNVA 3ZXEA 1RUI2 1A78A 1BK0A 1KFUL 3D82A 4IGQA 2LM3A 3H9AA 3ON7A 4FBFA 5CU1A 3CKHA 4GMP3 1NA1C 1V6KA 4N90A 1PIV2 2EIDA 2QQIA 4QDSA 1SDWA 4XF1A 4AHYA 5JXJA 2VQUA 4RS5B 3RDIA 1MVEA 4Y1ZA 4XTPA 1AF9A 2JDMA 3K3OA 4G4FA 3SC7X 1IPJA 5LW9A 5D2AA 1QJX2 1MQTB 1MS9A 2R49A 3AZXA 4TZDA 2BPA2 1GP6A 1L3JA 1UZWA 2MNGA 2AZ5A 2PMWB 3M8LA 4AVVA 3J4UH 4RS5A 3N9PA 2DVBA 3BYWA 1AYN3 2D44A 4H2AA 2JG8C 1XYNA 4RR3B 4Z2AA 3MUZ1 3EBRA 2W52A 4BISA 4NIDA 4LBQA 2AYHA 1HN0A 3TEXA 3AZZA 4AVSA 3POYA 4FFHA 1MS0A 2PFWA 5FZEA 4A7KA 4QPIA 1DLCA 3I2OA 5T55A 3WQ1A 4KBBA 1SBEA 4BPZA 2RDNA 1GV9A 4W6YA 1B35A 1FOD1 2B46X 2NYYA 1VBB3 4IE7A 5CKQA 3LSEA 3UESA 4DFSA 1AR62 2Y6LA 3LPGA 3MIBA 1UYYA 4D6SA 5FOJB 4A2UA 5DPNA 3O1VA 1YFUA 3WHUA 3CNAA 5KHHA 5I0TA 3T1MA 3QD6A 1OUXA 1KEXA 2HJIA 3FL7A 3IDCB 4A6OA 3IM0A 2ZA9A 4R9CA 1ZBA2 2R6QA 4FFIA 3LOBA 1CGPA 2MPFA 3FLRA 1W03A 2JDAA 1QJY3 2IVJA 4JTNA 3SKVA 1YQ6A 2WS91 5FZ8A 4IW3A 1VMJA 2WO2A 2BERA 3TAYA 3WW2A 3ST7A 2SLIA 5LEKA 4B7EA 5J98B 4TWTA 1QEXA 1Y9MA 2BOJA 3KVBA 4HK8A 1LOBA 1AX0A 2A70A 2FCUA 3LFMA 1REFA 1GR3A 5L36A 4CCCA 1AVBA 2BFUL 2VMFA 3NV3A 4AAXA 2WFF1 2IXLA 2E51A 1OQ1A 2GC2A 4NOTA 1F4AA 2WQZC 3HQXA 3EXUA 5FRAA 3WZ1A 1DG6A 1BCXA 3BPSA 3GCXA 2QFEA 2UWBA 2Q8EA 2C0ZA 1KGYA 3W21A 2GMMA 4JTOA 2QQPA 1NCQA 3KCXA 4K6BA 1CAUA 3ATGA 4NE9A 3KCYA 1AR73 1KD7A 4E8CA 3ZR5A 2A6XA 1ASJ1 5IK8A 2Q8DA 3H8XA 4HLTA 4UW4A 1I9RA 4CCOA 4EN7B 4AVAA 1NT0A 2C5DA 4Y33A 1AYM1 3PIJA 3FHAA 1RC6A 4M0NA 3GJAA 3J9SA 1W28A 1NE4A 2XJQA 4I0BA 3FUQA 1VLNA 1ZRFA 1DQ2A 3IPVA 5IW0A 1W8WA 1YHFA 2H6CA 4CPBD 1G9BA 3VV1A 1EAH2 4OUSA 3CBNA 5F3CA 5I0DA 4GH4C 4JQTA 2QE3A 2VVFA 3HEIA 5KHJA 1FPN3 1MR5A 1VP6A 2JDKA 1LR5A 4B29A 3PUIA 1RUC2 5LEJA 4UW5A 4H7MA 1RB8G 3VZMA 3NAPB 4R52A 4OI1A 1DQ1A 3QCWA 2TBVA 3NWKA 5A7NA 1IS5A 1KQRA 1DZRA 4UAPA 4FCAA 3P1IA 1DHKB 1WBFA 1OA4A 4P9LA 3WX5A 2WZR3 3VL9A 5A3UA 1WKYA 5CFCA 2GC3A 5LK5A 2VMEA 1FNYA 2XWJB 5HBAA 1YQ8A 3THTA 3I2FA 4LBQD 1ENRA 3LIGA 3WVJA 3LAGA 2IZWA 3NMBA 3U1XA 2ORXA 4YZ4A 4AWDA 5FY0A 3KWVA 3IDEA 5IHRA 1O5UA 1UXXX 1EAH1 1X36A 3GYDA 4YG6A 3SQOA 5JOXA 3HIFA 1K5MC 1CAVB 3LA3A 1UY3A 3JB4C 2VH9A 3A7QA 4NMIA 4XDOA 1OLME 1F15A 1GU3A 1W2TA 1JZ7A 3NJXA 2BRTA 5FPXA 5JOZA 5BNNB 4HMZA 4Q0VA 2VBBA 4FI9A 4A41A 4LUMA 4KH9A 3RMYA 2CGPA 2ZHKA 2R062 2D3RA 4R4XA 2D98A 4R9BA 1VBE3 3MV11 3GBFA 3OD0A 4IE5A 4J6GA 2WZ8A 2PN5A 3U78A 3BU0A 3EYPA 1Z7S1 5APAA 4MYEA 1GZ9A 5JR7B 1BMV1 4E4DX 1Z7S2 4CDUC 1UW8A 3SXWA 5FYSA 5JSOA 4CP9A 2JJ6A 5BNQA 2FDJA 4CEYC 2QUOA 4YGDA 3UJOA 1DGRA 5LA1A 1YQ5A 1I6XA 1S2BA 1WW6A 2ZJCA 4FPGA 1SLCA 1W3XA 4JDOA 4K9SA 4OVEA 2B39A 1AR81 3H3LA 1PZ8A 4LHNA 3AFKA 3OY8B 1IS3A 1Q8VA 1NYWA 2RV9A 4LORA 3WNOA 1JYNA 4Q29A 2WJSA 4IV1A 1YJLA 2AENA 4PLMA 1YEWA 1AR72 2WAOA 3OGRA 4RFRB 1BVP1 3WR0A 3NV2A 1H8TC 2RM21 5F5CA 1HRV1 4L99A 3B00A 3FE5A 4RR3A 4Y1UA 4ZS3A 5BY5A 4N43C 1U5ZA 1T2XA 1FXZA 5K8SA 1CZSA 2VMDA 3RZJA 1NY72 3OSDA 1X9PA 3AZYA 4XDQA 4XZPA 4AVTA 2EXJA 3VBOB 2ID4A 3ZXKA 1SMVA 2ZGLA 4CPBA 5JI9A 2W95A 3W20A 4P00B 1OBNA 3M3IA 1AJKA 1LTEA 3DXUA 3PL0A 5DN2A 4CTEA 1O8SA 2GZWA 3WW4A 5D1IA 5IFTA 4HANA 1RUH1 1MACA 4DRVA 5T3NA 1MS3A 3ZYGA 2QKDA 1D4M2 1ENXA 3LE0A 4TXWA 3USUA 2ATFA 1ST8A 3UV9A 4GZ9A 1RTVA 1L7QA 4D7TA 3IZOA 1V6MA 2QQWA 5HCAA 3U10A 3AMNA 4YZ5A 3OGJA 2QZ3A 1LOGA 1QF3A 4ZU7A 4YW6A 3UKTA 4BQ1A 5AC91 4PDWA 2VE1A 4CEYA 2RM22 3EO6A 2F17A 1XU2A 4FP3A 2VNRA 4P9GA 3ZN6A 4AGGA 4MGQA 2LW8A 5FK7A 1Q8QA 2HLEA 3ECQA 4IV3B 3WF3A 3IKWA 2YBPA 3CHXA 3CJIC 4QXBA 5LA0A 1RUH3 3UL2A 1W6QB 1AXZA 1DQ5A 4GB31 1OD3A 5A32B 4Q4Y1 2VBDA 5IVYA 3ZSJA 4KMQA 1PGSA 4QKBA 2ZZJA 1TME3 4MXWA 3T0DA 2HWB1 2V73A 3S6PA 1RJ8A 3BIEA 3VBRA 5FZ7A 2WO7A 2O8OA 1CWPA 1AYN2 5IJRA 5IVFA 1UMIA 3J8F2 1UMZA 2IXKA 5L7OC 5HI0A 2WKKA 4YVWB 1OVSA 1H8VA 5T5PA 4JDNA 1UPIA 4CDWC 5JCTA 1W05A 4XYXA 1HRV3 2FDKA 3NNMA 4IEZA 4W4ZA 5DUUA 2VNGA 5K7PA 1BXHA 1B35C 1PGW2 1DBNA 1RUE2 4H55A 3ZN5A 1JI6A 3VBSC 2PHDA 3WNMA 1AL21 4V2WA 3J8F3 1PGW1 4GD4A 5K4LA 1G7YA 5FYTA 5FZGA 3TRSB 1TG7A 1SPPB 2W0XA 5FAXA 5JOYA 1JHNA 4LITA 5FXWA 4XUTA 1EY2A 2CNAA 4NWVA 5FY7A 4D69A 5JR2A 4GJYA 2H6BA 4LTAA 2FQPA 2QQJA 3WG1A 2KA3A 5FZIA 4A7YA 1RUH2 4Q4X1 2D97A 3GF6A 1QKQA 1OLQA 2WNVB 4FQ4A 3LEGA 4D7SA 2CY6A 2ZX3A 4OMCA 3VZJA 4PIZA 5A70A 3ME2A 2OQ6A 1RMU1 5DDJ3 3MLLA 1COV3 1W3VA 1LHWA 4CSWA 4LO7A 5CB7A 4N7IA 4LHLA 4LLOA 5FYHA 1RGSA 4U2AA 3UT0A 1R082 3N7MA 5FBZA 1YC61 4I0AA 3MIGA 5IWFA 3BIWE 2OQ7A 1SLBA 5DAVA 1D4M3 2HWD3 5JXIA 1OFSA 1N1SA 1Q43A 2L9LA 1BYHA 1TME2 2R16A 4JAAA 3CJIB 4AW7A 5EJZB 4GWJA 5IK4A 2FDGA 3KQ4B 3U4SA 4ES8A 1ZZBA 5C9AC 1WW7A 1QH6A 4FPKA 4QT6A 5EZWA 4WVZA 1VBA2 4O65A 4M4RA 1FV3A 3NKTA 5LB6A 4NIGA 3TB0A 1GWLA 1O5LA 2D5HA 2ETEA 1WD4A 4X6RB 3ETQA 1ASJ2 5CBLA 3PU8A 4Q4W2 5JIUA 3FJSA 3SCHA 3NJZA 2UURA 3WLUA 1MQTC 1O4TA 2AH2A 2AR6A 1X9TA 3ZN6B 5JPNB 3W5NA 1ZVFA 2VOTA 3DECA 3ES4A 1FT9A 2QBXA 3LZZA 3SEPA 3OBTA 4CDXA 1SZBA 4JGZB 1I5PA 3KMHA 3KT7A 3MFCA 1Y4WA 2ZBJA 2WWSA 2XKPA 4Q4W3 2PHWA 1EPWA 3R6SA 3DEMA 4QM8A 4XQWA 4Q8KA 4CP1A 3ZFFB 1F5FA 4KNCA 1AR93 1RUF3 2E9QA 4JC1A 4KL1A 4AF9A 4BIOA 2EVXA 4YVSB 3SITA 5CKNA 2VZRA 4YRDA 2AREA 3S7EA 1AR71 2GH8A 4DPNA 1GNHA 1OVPA 4YLZA 1JYXA 1NCQB 5GZFA 1XYPA 3USUB 1QHDA 2UWCA 5GALA 3OUHA 2B45X 2FZ1A 1GBGA 3OGVA 2YROA 3EHKA 4IEWA 3SNMA 3N36A 3ZR6A 1I5ZA 2WNVC 5L9RA 3WY6A 5C8CC 4QHZA 1MEC2 1D4VB 1W2OA 4P9WA 2OA2A 1GANA 4D6RA 4JHTA 3PVNA 1CIYA 1UY1A 4RGAA 2BU9A 1ZRIA 2GMEA 4FOQA 4XACA 3UKNA 3KGZA 3ZYBA 4C1WA 1H9PA 4KWUA 3ZMOA 4Q4V1 2VXJA 2WSVA 3HN3A 2ZOEB 4LMFA 1O59A 4F7ZA 5SV5A 1F5JA 1E5SA 1VB2A 4IDZA 4AEJA 3WDVA 2OXBA 2VUCA 3IBMA 3BALA 4Y1XA 5SV8A 2R1BA 4BH9A 4EWDA 3N4MA 5FQ0A 1C3HA 4Q5OA 4BHPA 4UFMA 3ZSLA 2DU1A 1YYNA 2A71A 2RVAA 5F5QA 3R0RA 3UYJA 4FFFA 4AI2A 5B4NA 1ZRCA 3ZFEB 2CWSA 5EQUA 1PO23 4AXOA 4M3CF 2OKXA 1W06A 2VCAA 3R4SA 1WCUA 3K4AA 2VZPA 3WW1A 5FYCA 5FLJA 4CA9A 5C4WC 1Z0HA 1X8EA 5HCBA 5K9YA 3M70A 1KITA 3WQBA 3CF6E 3ORJA 2WNOA 1XNDA 1NX9A 2YU2A 4ORFA 1R083 3K3NA 1VMHA 3BKZA 3VBSB 1K45A 4YW3A 1RVF1 4HPKA 1V6IA 3FLTA 5HPOA 4D6QA 1ZBE3 4CZSA 4Y20B 2ZGNA 1ENQA 1GNZA 1RUI1 3AMMA 1PMIA 4OHYA 4UOJA 1JU4A 1SFYA 2VCBA 3N9LA 1GOFA 1PIV1 2JDNA 2VR4A 4IV3A 3T1LA 4WBBA 4WM7A 2OIIA 2Z4FA 4K21A 2HWB2 1UIKA 1SHWB 3MEPA 4H14A 4NAMA 4CXWA 5BNNA 1H8TA 3HR9A 3FHIB 4XCBA 3ZXFA 4ASLA 2ADEA 3K48A 3OEBA 4QAWA 2JE7A 4DUXA 5FJKA 3OCPA 1W9TA 2O8QA 4N43A 1WUVA 3E5XA 4QM9A 4QGNA 3PUQA 4A7ZA 2DTWA 5KXDA 4UBGA 1Y9GA 1XE0A 1HIXA 1WWYA 1GOHA 1WLTA 5BNOC 2XVKA 4Q0UA 4NN0A 5FYIA 3HD8B 2XXZA 4QDRA 1POV0 4QHBA 1OA2A 2PHTA 1UU6A 2UWAA 2A5ZA 1AX1A 2QTWB 2VZOA 1ZZ9A 2JDHA 2NQYA 1FOD3 2RM23 3CU7A 3RWNA 3VGIA 2NMNA 4Y4RA 3F95A 3CZJA 2VTXA 3NNLA 4P02B 2V09A 4MZUA 3U14A 1GZWA 4E9KA 4PLNA 1FYUA 2K46A 3BU7A 4NPRA 1D4M1 4MVTA 2D6LX 1W2NA 1I3HA 3V0BA 4AHXA 4QKNA 5C9AB 3HMYA 4PIYA 3BTAA 3U0ZA 1RUNA 1XNTA 3MGUA 2XJSA 5FQ0B 5H9RA 1S0IA 4UFJA 3OB8A 4LHSA 4XFIA 3T2TA 2P3KA 1VBC1 3OPTA 3IMNA 3A23A 4LIUA 3PVEA 1ULCA 4COVA 1KJLA 3H7JA 4JKKA 2A6WA 5LWBA 2JG9B 4G9SB 1W0NA 2YGLA 3CO2A 4AI0A 5IT6A 4YG3A 3AZVA 5G05L 3D0SA 3V0AA 1DGWA 1GMMA 2DCJA 2Z2SB 1R1A2 2I45A 2VQTA 3JUUA 2BDRA 3O0VA 3V0BB 1FV2A 1W0OA 3OPZA 3PURA 4X6QB 5EYXA 5GZEA 2W5FA 5J96B 3AXEA 4Z1VA 3HT2A 2UYAA 5FXXA 1SDDB 4L9BA 3RI8A 1ND3C 4HOOA 5FKBA 4ONUA 2Q8OA 4NHKA 1W9FA 1H1MA 1GFF2 2QDNA 3OTFA 3KGLA 4COYA 1J3RA 2VZUA 3TBDA 3TEWA 3POGA 3AMPA 4FPHA 4BB3A 1BBT3 3VBFA 4UI9L 5CISA 4KI5M 2DU0A 3GHMA 5BNOA 2B7YA 1HV0A 3RZZA 4KU8A 5JZGB 2G9ZA 4IEQA 4XF4A 4ASMB 1RHI1 1RJ7A 2X29A 5C3OA 5JMCA 2PQSA 2JG9C 4B1LA 4CYDA 4YW4A 1DYPA 2JE9A 4RYDA 2ZXQA 1JMUB 4XFFA 5GLUA 1ULEA 5FZLA 3KLSA 5F6KA 5BPXA 2QQNA 1V00A 2OZJA 2XOMA 3ZFGB 4BU2A 4E4SA 4QPIC 3J26N 4ARXA 1AL0G 1H8TB 4HT1T 2EAAA 1NA1A 2FCTA 2QJVA 5JUVA 1YJKA 4WM7B 4YPJA 5AFEA 4GIQA 3KV4A 4CUCA 3U4XA 2WLPA 3GZAA 2GNMA 4OZOA 2HWB3 3IIAA 1IPSA 1UX7A 2P2KA 3GGLA 4Y20A 3RZGA 3T08A 2WWUA 2PA7A 1S55A 3AB0A 2XPJA 4BLIA 4MADA 1UO9A 5A7WA 3KD4A 4AFAA 1OSGA 1VBD3 2GNDA 2Y60A 3ZSKA 4NRMA 4EN0A 4XUNA 2D3SA 3GHNA 5E88A 3MO4A 1J84A 1UY2A 3MIDA 3ZXLA 3S57A 3ZXDA 3NJVA 3WSOA 4COZA 5LASA 4NPLA 4UWDA 1RXGA 4K1ZA 1O4YA 3N9MA 2B8MA 5DAWA 2DFBA 2JDPA 1A3KA 2ZTNA 5FP8A 5A3OA 4N7UA 1XYOA 1WZXA 3ACIA 4ZS2A 2Q8CA 2EICA 3ZXJA 5CG9A 3MIEA 3WNPA 4LT5A 4IE0A 1WD3A 1GUIA 1YCIA 2IFRA 4L97A 2DVDA 2UY8A 4ET7A 3RMXA 1UWWA 1J3PA 3HN1A 4EN6B 4BQ5A 1RUC1 2CYFA 2JDZA 3VD5A 3MFAA 2VTXJ 3T4VA 2Y6JA 1GWKA 4CP0A 4B4RA 1GOGA 2VZVA 2YC0A 3AMHA 3OUIA 2WYFA 5KR7A 1J3QA 3ALQA 3BUCA 1V9U3 5FY8A 2RHPA 4UFKA 4OZXA 5KC6A 4D0QA 1F8VA 4QKFA 4B4QA 1AYM3 5GKAC 2YU1A 3I7DA 4JRAA 3O1SA 1UKGA 2YFUA 4COUA 4PQ9A 2WZPP 2ZEWA 2IXJA 3SH5A 3VBHB 2WS92 4DB5A 3K4DA 4AYUA 1JZ3A 1C8M2 1LKNA 2PQQA 2XJVA 3IAQA 1ONAA 4CCJA 3BTYA 1UIJA 3ES1A 3MIHA 4GWNA 2VJXA 4RHV3 3MDPA 3I3DA 5C3PA 1DIWA 2OX0A 4C91A 4ISRA 4O7XA 4AG4A 4BQWA 3WDWA 1H2MA 1W2AX 3VDCA 4AAPA 5CADA 3VBRB 1W8HA 4MV2A 3EJKA 2X5IC 1X33A 1X82A 1G86A 2BV4A 3UGFA 4AOCA 4LXLA 3E97A 4N53B 1PK6C 1H1IA 2DVAA 3DYOA 5FP7A 4HKWA 5JAXA 2R32A 4AEKA 1BLZA 5FTTC 1LOAA 1APNA 5GLTA 1BEV3 5FR3A 4PQQA 2VZQA 1QQP3 2XHNA 4N53A 5CAZA 1TVGA 2BQPA 1DDLA 1O3QA 3VN4A 1ZREA 2D5FA 1VBA3 1Y7BA 1IPKA 4GALA 1AR91 1RUF1 3GDBA 2DUOA 3EMRA 1DGLA 2ZKNA 3B94A 5LATA 4MO3M 1AR92 1RUF2 2ARBA 2VG9A 3LKJA 5GJ6A 4AZZA 5FYUA 5FYVA 4A3XA 4OI4A 5IAXA 1ZBA3 3CL1A 2FD8A 5FP9A 1QJY2 1W6OB 3ZFFA 5ANQA 5C8WA 2XQXA 1BVVA 1YQCA 1J1TA 1K3IA 4L2NA 3ZVXA 1F35A 5FBJA 1QIQA 3H3ZA 4N8MA 5HXVA 2I74A 1M06G 4XAAA 2Y64A 3KCCA 3ILNA 1JZ8A 3FHQA 2CAVA 4CDUA 1J83A 3AKSA 4TLGA 1CONA 2XL7A 2GSYA 2WS93 2ZZQA 4EN9B 4ZZ5A 5IAVA 5LA9A 2ARCA 5CVRA 4FOVA 4LR4A 1KJRA 2VOXA 2R1DA 1PVXA 1EV12 1R64A 4RHV2 2PAEA 2O0OA 3AJZA 3JZVA 3K2OA 4QPYA 5CEHA 5FIXA 1XPWA 4BQ2A 3JD71 4FP2A 1IQDC 1GICA 4YW7A 1TEIA 3VZNA 2FDFA 4HONA 4M4PA 1C4RA 2DDUA 5IVBA 3QBQA 1WW4A 2YC4A 3WQ0A 3OF1A 2D6KA 5FZAA 2IUWA 1PO13 5FY9A 3E6DA 2OYZA 3WDYA 3VHPA 2QZ2A 2B9UA 1E5HA 2VVEA 3P5BA 1H4HA 3M3CA 1PIV3 4S2DA 3RRDA 3B3QE 1QJU1 5AC92 4YZ2A 2ES3A 3OEAA 3HAGA 1LGBA 2JKXA 4QB1A 2G4IA 2PTMA 2E26A 4MGSA 3GZTB 4ISQA 2GALA 2C24A 1ND3B 2K0GA 2E63A 2Z42A 1VRBA 2ZGMA 2W1UA 3LEMA 5C70A 3FN9A 3ZXAC 5F5AA 5AFBA 4ZY9A 2WRAA 4AGVA 1JN2P 1IS6A 2WN2A 1F9KA 1FNZA 2DV9A 1V9U2 2WLQA 5DAXA 4J25A 3JD72 5DMYA 2ZEZA 2BOIA 4P08A 2XB6C 3NRUA 1OMIA 5KXEA 1PVC2 3Q8FA 2QNKA 5FO9B 2XMLA 4RQPA 3N35A 1T6BX 4BQXA 1NQDA 5CIRA 2ZGUA 1GWMA 1VAVA 4QQ2A 4PDWB 5EP9A 2W1QA 1LCLA 4YM3A 1CX1A 2ILMA 1IOAA 3UETA 2E32A 2ZEXA 1FX5A 3LDRA 3VKNA 4JX0A 3KT4A 3WD5A 3S30A 2X8KA 5AVPA 2E33A 5L19A 3VLBB 3P6BA 3TN93 2H0VA 4WM8B 1QMJA 1HB3A 2G9GA 5KBFA 1JUIA 2JB4A 1PNGA 1K5MB 3HT1A 4W65A 5K0UB 2VTFA 4QX8A 3LCPA 4ZXKA 1JYVA 3E6BA 4Y1YA 1ODMA 1U5XA 4CUGA 3I2KA 5A80A 4B8EA 3OJBA 1UU5A 5FY1A 4F8AA 3DPRB 1ACCA 3GALA 4PDWC 1N47A 2MEV3 1EYBA 4Y22A 4BJ0A 1QQP2 5EIYB 1JZ6A 2FDIA 3N7KA 1D7PM 4KQ7A 2WSUA 4MGTA 3O1MA 3DUIA 4BK4A 5FMDA 4JDMA 1FMD1 3FBYA 1PX3A 2GN3A 2V5DA 1ZA7A 3JB8A 3VB9A 1UOFA 1VJ2A 2QCSB 4YVWC 1PGL2 4Y26A 1FMD2 3CJIA 3Q8AA 1Q8OA 1SQ4A 5E8AA 3N7JA 4L0PA 3URFA 4CDWB 5GZGA 2TUNA 4XJWA 4DO0A 1LHUA 3B01A 1N3PA 3SISA 1AZDA 1OFNA 2ZACA 4NPMA 1HV1A 2R041 3AP7A 4M0HA 3VHRA 3DKQA 4XEZA 4EZHA 5DZFA 4YZ3A 4AFCA 4BOWA 1SG3A 2VMGA 2C9KA 1S0DA 3Q9OA 3ZXGA 2ZHLA 4XFCA 1H2NA 5CKMA 5B2GB 4CU8A 4LK7A 4LKFA 1AHSA 4NR1A 2VNOA 2CAUA 1CAUB 2JIJA 3KV9A 1LULA 5ISLA 1YI7A 2W92A 4LOSA 1Q5OA 3KZ4C 3RG0A 3AVRA 2A3XA 3WF1A 4Q4X2 2PLV1 4RS5C 4QB6A 1Q8SA 1T6GC 5F2WA 3RNSA 1STMA 2Q5TA 2JG8A 2ZEYA 1R1ZA 3I49A 2RG4A 4Y1VA 4A6SA 5JSPA 4TN7A 4UFIA 5ABJA 4HVOA 2GP3A 3T4HB 3RZHA 2WO1A 1H6XA 1SCRA 4GJZA 4JGZA 1UMHA 1UD1A 4XC9A 2Y8KA 1JS9A 1WW5A 1Y3TA 4NHLA 4K40A 1LJ7A 4FXKB 4CXYA 1SPPA 1V6OA 2GNTA 2GC0A 1F2NA 2WT0A 2XH6A 3BOPA 3WINE 1O3TA 2CSGA 1WA6X 1MZEA 5C3RA 4ITCA 3F2ZA 3EQEA 2I2SA 4Q26A 3POSA 3FWEA 1S1AA 1JOBA 3WNKA 5ACA2 3ZO0B 2PHRA 1V70A 1RUD1 1OOPB 2VCCA 4AFDA 1S0BA 2PYTA 4HPKB 1RITA 3TN91 3RYRA 5I0RA 1EUUA 1VAKA 3HBZA 4YG0A 4HSJA 3W5MA 4YVWA 1UU4A 4EJRA 1XC6A 2XL9A 3SH3A 3WP3A 1OOPA 5C3SA 1R093 2HWF1 2R0HA 1TMF3 4O9GA 4HBNA 1YUDA 1CAWB 1BKZA 2YXSA 5FZ6A 4FPLA 2J1AA 5E1RA 4CDXC 3AYAA 1NLQA 3X29B 1W99A 3GZEA 3FBMA 1C8M1 5KWRA 1C57A 3W58A 3OG2A 4CU7A 4K8RB 2RJKA 1POV1 3SH4A 5CG8A 2VQAA 3IN9A 1NLSA 2BZDA 3I8TA 5L9BA 1ND2A 1LENA 4IEPA 2VUJA 1DCSA 4NJ4A 3I4IA 4XUQA 3WT3A 1CESA 1CZTA 3CLPA 5ACA3 1HB4A 5ABJB 1TME1 3AC0A 1MQTA 1D0HA 1XQNA 4N9IA 5CFDB 2QQKA 1DQ0A 2OPKA 3LF7A 3KSCA 2XLAA 2DTYA 1WLWA 1XE8A 4PI0A 1BEV1 3PJYA 5DABA 3FZ3A 4I30A 4LE3A 5GLWA 5H9PA 5F7UA 1RHI2 5A3PA 1FAYA 2J1SA 2OZ6A 4IEYA 2XJTA 3RPQA 1CJDA 2XUMA 1RVF2 2DCKA 1W6PA 3JCIA 1ZYBA 1YNAA 4AK3A 1V0AA 1OKQA 3HQRA 2Z69A 5DAPA 3NAPA 3VKLA 4Q4V2 3WDUA 4CDWA 2ZGRA 2WR9A 3G7DA 3WXPA 4WZFA 1LODA 1L7RA 2VGDA 3LEIA 3JQXA 1FPN1 2N7GA 1KFXL 2WA3A 2ZGTA 4XFAA 4XUPA 3C7GA 2PHFA 4CDQB 5JLVA 3A0NA 2WFF2 4XQ4A 5IVEA 3FX3A 4A45A 2JICA 2XJRA 3GBWA 4K8FA 5FMOL 1NXD1 2HBTA 2R30A 2WYSA 3GZUC 4G3YC 3PJQA 1GZWB 2ADDA 1LECA 2JIGA 2ZAHA 3OOXA 2XQRA 1XJAA 3OBAA 2P3IA 3R05A 1GLHA 1VR3A 3LEKA 4DRRA 2VW2A 3VD4A 3S5AA 4OHZA 1UZVA 4ZXEA 3Q8CA 4YW2A 2HWC2 4EV0A 3ZKYA 4URTA 4XCAA 4DUWA 1SLIA 2H0BA 4E27A 4IV3C 1R091 4JKMA 4QHOA 2G9FA 2ZABA 4AFBA 4Y4YA 1S0FA 5DZEA 3C3VA 4FXGB 1RVF3 1MS1A 1JW6A 4PHZA 3O1RA 1OQEA 5J3UA 3H0OA 3ZPYA 3DN7A 3VBOC 2XHKA 5JPMB 2A3WA 3E1F1 3TYJA 1ASJ3 2P4EA 4BA6A 5BNPB 5JXGA 3D8CA 4K1YA 5JVVA 5CZKA 2VMHA 4ZU5A 1JU3A 2DUQA 2DCZA 1PM4A 4Y3OA 3JU9A 4K3UA 1UY4A 2J1EA 1TZOA 2WUHA 2RS52 3JBG2 2OUHA 5C71A 4QGLA 2QQLA 1UYZA 1PMHX 1YQ2A 4LBOA 4MXVA 5JZGA 2FZ2A 1HQWA 5FPAA 1JYIA 1QJX3 1VAMA 2IXCA 1YRZA 3RZMA 4FPEA 4WM7C 4CU9A 1QOSA 3KS7A 4IE4A 2WABA 3UGGA 1OURA 1WCQA 4AHZA 2QVSB 1YFXA 4OCTA 3WCSA 5FMOS 5FPVA 3ACLA 4GB32 3E5UA 2GU9A 1FI2A 1ZA4A 3BPZA 3T30A 4CE8A 3LFIA 1AR82 4OHWA 4XZUG 1DLLA 5IVJA 1PVC3 3BODA 3D6EA 2DCYA 2ZGPA 2V72A 4K7JA 3O12A 4P9IA 3FLPA 3PDQA 2E53A 2Y0OA 1QXJA 3AYDA 3M3OA 1WA4A 1XE7A 4W8JA 4YFZA 2W08A 1BK1A 5I91A 3CJXA 3DGTA 2QQUA 3ELNA 4CEWB 4KBZA 4LPLA 2ZMKA 2A7AA 1S0EA 4P9YA 4UFHA 3TNPB 3WEZA 4BDVB 1K42A 2MHFA 3VD9A 1MS4A 2RR12 3PVBB 1O3RA 2W3JA 4SBVA 4Y22B 1YIPA 4Y24A 1F31A 4H7LA 4FTSA 5CYYA 2VOKA 2PAKA 1LRHA 4AFMA 4BYYA 4CVUA 3WOGA 2WNVA 3WUCA 3QOPA 2ET7A 2BNNA 1ZX5A 5FFOC 2J42A 4IGOA 3MI8A 1R092 3OD4A 1UY0A 1NE6A 1UOJA 1H9WA 3RYPA 1WCSA 4S2FA 5IFPA 2XBO1 1C8NA 2C4XA 4DIQA 1YFWA 4GMP1 4WM8A 3BOWA 2R072 3EB7A 3IT8A 2ZGSA 3H8OA 1S0CA 1X7NA 3T2QA 1MZFA 2HWF2 2IXHA 5FO8B 1FATA 1OI6A 3JQWA 1UXZA 3MF6A 4NIHA 4DXZA 3OYWA 3ZFEC 5CFDA 2IC1A 4XBLA 1C5HA 1LEDA 4JGYA 1O91A 5F32A 5LA2A 3S7IA 1GQPA 1CVNA 2WINB 1I1EA 1HLCA 4NHMA 4XHXA 1VBD2 3VD3A 1XNKA 5I8YA 4AGRA 2VAUA 1CIWA 1LGCA 4OYUA 4AEDC 2W39A 1NY71 5CFCC 4WZCA 3ZPOA 2RR13 3RQ0A 2WT2A 1A6CA 1WMXA 1C1FA 3Q8EA 5C5UA 1WMFA 3JXSA 3VBRC 2Q30A 3OBRA 1LHVA 3B93A 3PVOA 5FZBA 1IG3A 3OUJA 5GZCA 1UZYA 5L7OA 2BW8A 1EAH3 5T5JA 1LOCA 3AFGA 4LO6B 1NCQC 1X8MA 1K5MA 1XB9A 1IQAA 5BNNC 5FCCA 1HW5A 1OH3A 1SFPA 4HKOA 5FYZA 4CDQC 3VZOA 1BQPA 5T5OA 1IZ3A 2PLV3 2DYCA 5FXZA 2RE9A 4H3WA 2HWE1 1XBFA 4OQ9A 4YW1A 5IVVA 2P3YA 3HBKA 1JYWA 1ZZ8A 1W0PA 1LU1A 3DL3A 4FT8A 1W6NB 5FUIA 2CU5A 4MOAA 5A7OA 2BJSA 4FQZA 3VDDB 5J1XA 4WVWA 4Q4V3 2Z79A 3LDKA 2RS53 3JBG3 2ZGQA 4WVVA 4XJUA 4AL9A 2EAKA 3S5QA 2RJ2A 4S2GA 5CFDC 2VPVA 1XOYA 2G19A 3K77A 4XBQA 5BNPC 4TLFA 5FPUA 1G9DA 2D93A 1EUTA 3PIGA 2GP5A 5KC5A 1QNWA 4XJAA 1PHMA 2WZEA 3DPRC 4NO4A 1RMU2 5T50A 2CGOA 1G9CA 4RL7A 4DQAA 5C4WB 3PU3A 2W94A 3INAA 1RIRA 3VDDA 3H50A 4W6XA 1OF3A 4QX7A 4AHWA 1N3OA 1W6NA 4I02A 1OC1A 1DGWX 3C7FA 4OUEA 5A7PA 5LZ6A 5A7SA 1C1LA 4XIKA 4JHZA 5G04L 4XF9A 1NLRA 1LOEA 4YVSA 1U0AA 1RINA 4XXAA 5E16A 4BE3A 5JIAA 4AVCA 2XWBB 4P9JA 4COWA 4AEDB 2GN7A 2CTVA 3VDBA 3WCRA 1XXNA 1DZTA 1QU0A 2QQOA 5AVAA 1D2SA 3DXTA 5ACA1 1H0BA 3ZDVA 4HL0A 1FOD2 2RDQA 5TSWA 3ZYPA 3AYEA 4BQ4A 2J1RA 5FREA 4CP9B 2BEOA 2JD9A 3PMEA 2HEVF 4TYSA 1V6JA 5IVCA 5A32A 4N53C 3VZKA 1VMFA 3AKPA 5DUVA 3H8RA 4QQHA 4EZ4A 4QPIB 4QX5A 1MZ5A 2NLRA 1QDOA 4LBNA 2WNUC 1US3A 1N1VA 1RUJ3 3J7LA 2VC9A 3SCFA 3CEWA 1AYM2 4XJ9A 4RGGA 5FWJA 2VOVA 1HXS3 4LBQB 4FTBA 1NOVA 2BP6A 4U36A 4BXSV 3I2IA 3NNGA 2QQMA 1QDCA 2VM9A 1QJZA 4NVPA 1WMDA 3J7HA 4A42A 2X5IA 4QXHA 3AM2A 3SMHA 4YZ1A 3PHMA 2VZTA 1A8DA 1RUG3 1QJEA 4XIOA 1NA1B 4OI2A 1D0GA 3ZLIA 2ZHMA 2PHUA 4LO5B 3NSTA 3MF9A 2A6ZA 3UGHA 1WCDJ 3D4KA 2X09A 3WP6A 3KHBA 3VDDC 2VW0A 5A6XA 1H1AA 1CR7A 2ZS6B 3USSA 2W46A 4FTEA 1BJQA 2IWGB 1LGNA 1QJU2 1W6MA 3HNMA 4YWAA 4AE2A 5EJ1B 1VRH1 3I54A 4WV8A 1OA3A 3W9AA 5FZ3A 3WP5A 2BNMA 2VU9A 5D21A 2D7FA 4DEQA 1JODA 1G8WA 2P34A 3T09A 3MLKA 4FO9A 5JXHA 3BI3A 5J09A 3AX4A 3P3NA 5C8CB 1UZ0A 4XHBA 2QDRA 2VZ1A 1PO22 2C9AA 1YWKA 2UY9A 5B4XA 5FP4A 3M4FA 5C33A 2DF7A 2HEYF 3AMQA 3LA7A 1UYXA 4M01A 1RUE1 5K0UC 4Y5Z0 2JENA 3MPPG 4CUBA 5GZDA 2BBAA 1IKQA 2KXLA 4LKDA 4YFWA 1PO11 2A6YA 4CDQA 3M2MA 4XF0A 4KGGA 1JYCA 3M3QA 4XFBA 2P37A 4AQ6A 5F37A 2YMZA 4NROA 1LAJA 3MICA 4P9XA 3VKOA 2WNUA 3CIHA 3AP9A 2DVFA 3HPNA 4IGPA 1SACA 2Q1MA 1QJY1 4HVQA 5J36A 4GH4A 4DXSA 2HYKA 4FPOB 1LOFC 2B5HA 1PX4A 1US2A 3S0MA 2BGOA 2PHXA 1DQ4A 3KF3A 1ULOA 3MW4A 1MS8A 2VY0A 1VRH2 4HK9A 4XTMA 3WF0A 5FZ9A 3WW3A 1R1A3 3IDBB 2D6PA 5LBCA 4JV4A 2R043 1DFQA 5F3IA 4E8DA 4BXFA 1RUJ1 3ZSMA 3NL1A 4C1XA 4MG2A 1UL9A 1OUSA 2DURA 1OXCA 4FOWA 4XILA 5A33A 4LBKA 1ALYA 1UQXA 2CV6A 2RS13 5FYBA 4RSUA 2WFF3 2G1MA 4Q8LA 5J7MA 4EN8B 4FPJA 1QH7A 1V9U1 2XUEA 4LBJA 1JBCA 2ERFA 4LBLA 4RHV1 3UKVA 4I0WB 4RQPC 1URXA 1J59A 3QH7A 1NCRA 1O6UA 2XR4A 4B1MA 5J37A 1N3QA 1WMEA 2RMU3 1PK6B 4XW3A 4BQYA 3AXDA 4DXTA 1PZ7A 2IFWA 1XNCA 2W47A 1AYN1 4Z92B 5A1FA 2E31A 2V4VA 1RUG1 2X5IB 3GCWA 3H1YA 3I2GA 1VBA1 2Y6GA 4LUKA 2LALA 1HN1A 4OHVA 3HOBA 4DY5A 5JI7A 5EWSA 4NWWA 2WC2A 4KWLA 1UN1A 5BNOB 4YGBA 2R0FA 4HG6B 4AQSA 2D6MA 1GYKA 4M3CB 4DS0A 1BHGA 1JZ2A 5DUWA 4UXAA 5F1RA 2VNVA 2VQ0A 2WFPA 3GM8A 1UNBA 4WM8C 1YLLA 2LROA 3M3EA 5EHDA 1FMD3 2JECA 2YB7A 5E89A 4GAZA 1RXFA 1OT5A 3UK9A 2DBNA 4QQLA 4HN1A 2RS31 2NPIA 1WLDA 3TN92 5L73A 2FCVA 2MEV1 2VXRA 3WG4A 5HV4A 4W50A 1NG0A 3ILFA 1QJFA 4Z82A 3SLIA 4AEDA 4B3NA 3TEZA 2WWJA 3I3QA 1COV1 4BCUA 5AC93 4R9AA 4MSVA 3DF0A 1RUG2 4NIAA 1RUI3 4EQVA 1KS5A 4UT5A 5GM0A 5I8SA 4CCLA 1LU2A 4MGKE 2OPWA 2DBIA 3DYPA 4Q1RA 4XE9A 1R081 5L7OB 4QXKA 3LWCA 5HCHA 4IL7A 3MUY1 2F4LA 4R4ZA 2DUPA 4QPGC 3I2HA 3NW4A 3OY8A 4NIIA 1JXNA 4INDA 5C8CA 3KT1A 5CNAA 3K75B 5D8AB 2R073 3N9QA 4YGEA 4W6WA 4CCKA 1M4WA 4FAGA 4CU6A 4LO8A 4FPYA 5FO7B 1RYYA 2WDBA 4MLOA 1IHMA 1KXGA 2WA4A 3POEA 3ZN4A 1CJPA 4BQ3A 5I0UA 3ACGA 3J7NA 5FZ1A 4K20A 5HCFA 4AQ2A 5A1LA 2AGSA 4XXPA 3VDAA 4ZONA 4LULA 3ZSEA 2AACA 3I2DA 2IXIA 2KR2A 3H7YA 2ZGKA 1B09A 3DYMA 3J8F1 3O0WA 1ZZCA 2VBPA 4HN0A 4QGMA 4MX3A 3PMSA 4R9DA 3OYWB 2ZKLA 5IK7A 3KB5A 2JB8A 3QH6A 3B5LB 4IE6A 1VBC3 2CL2A 1O7FA 2KD7A 3RJ2X 2W2IA 3O1PA 3DKWA 1WLCA 4CP2A 4ES9A 5JMOA 2A6VA 4Q27A 5FZOA 1SCSA 3TEYA 1GSLA 3BTXA 3ACHA 2GAUA 2GMPA 3J7MA 4FPCA 5FZ4A 2W9XA 3L2HA 3H42B 1RUD2 3WG3A 1DF0A 2XLGA 4FSJA 4YVSC 3RZKA 2ZX4A 4GB33 4E2QA 1N1TA 5LBBA 2JDYA 2AEYA 3HVDA 1UOBA 1BEV2 4JVAA 4P5YA 2Q4SA 1REDA 1JUHA 1WCKA 4YM2A 5FXVA 4X8NA 3TOJA 4E4HA 1HRI1 1QY4A 2YPJA 4QPGA 4BMBA 1CX4A 1VBE1 2WT1A 4I09A 4N9HA 2W68A 2XG3A 1GZTA 4CCNA 1UPSA 1BZWA 1MEC1 1HRI2 2W1SA 3RSJA 3SHRA 3R4UA 2ENRA 1H2KA 1KDMA 2CWMA 2HWE2 2JE8A 4RGKA 2J1TA 3ILRA 3ZYFA 3WDTA 3K51A 4LQRA 3U37A 2XDVA 1VRH3 4WVMA 5FLHA 3V56A 2IVIB 5A6QA 2B4KA 4LA3A 2Y33A 5DZGA 3H1WA 1SLTA 2Y0IA 2HWE3 3ENRA 3AKQA 1NUKA 2XGXA 4QB2A 1W6PB 5C4WA 2HKXA 1NKGA 2R071 3L9JT 1ENSA 3BN6A 3OGSA 3AKTA 4Q4W1 1JYTA 5FPLA 5JWPA 1TNFA 4J1WA 1QJU3 1QJX1 1IKPA 3NJYA 1PMJX 3VBFB 4AI3A 2K9ZA 4KWJA 3VL8A 5FJHA 3NAPC 1MPXA 4LHKA 3ETPA 4LIVA 4QWNA 4XQDA 1W6MB 2B42B 2Y34A 5HXMA 2JD4A 2VULA 2YFZA 3I3MA 4YGCA 4PCRA 1DZQA 1LESA 2R042 3IB3A 1HQLA 4Q0PA 3WP4A 1POQA 2AUYA 2X53S 5T5LA 1E5IA 2YV8A 2OUJA 4JQRA 3MLJA 1SLLA 4HZFA 1W8ZA 5FPBA 4XJ8A 1Z7S3 4E2GA 2I07B 1NZIA 3I3EA 3IWZA 2ZHNA 4FPFA 3POBA 1IS4A 2RS51 3JBG1 5FZFA 3I3BA 4A3ZA 3AZWA 1UKRA 1ZNPA 1XRUA 1WGPA 4OUMA 3VBFC 1VB4A 3MV01 1UCXA 5DXDA 5C9AA 1HQNA 4M3CE 5K0UA 2HBUA 3IMMA 2NP0A 1S0JA 2E6VA 4XETA 4CDUB 1W6QA 1VIWB 3OGGA 2CDPA 4HSLA 2YPDA 4URAA 2XJPA 5A6YA 2DFCA 1IG0A 1Q8PA 4JGZC 3WUDA 4GMP0 3H3UA 5F3GA 3RZLA 2EALA 3T2OA 1CAXB 4XMIA 5EPAA 2VUAA 1UZZA 3N9OA 4MHUA 1ULGA 1PZ9A 5JOWA 1AL22 5FP3A 4B4PA 4KU7A 1LOFA 2HYXA 2V4AA 4IEVA 2O14A 3T2PA 3U75A 3AKRA 1HKDA 1DGRN 2YHJA 1KS4A 4YNIA 1S0GA 2W87A 4P14A 4ARYA 5KHGA 1HB2A 3KV5A 1IGOA 2X05A 3VKMA 3POFA 1G9FA 2BYVE 2CGNA 4EWAA 2FHRA 1XSQA 3B9CA 5I0SA 1JZ5A 4PI2A 4CDXB 4IEOA 4XFGA 1C5IA 5IYYA 3KF5A 3LOIA 4OFGA 4EYUA 2LTNA 2D3PA 2BFUS 4NHXA 3FFZA 3Q8BA 3BVCA 5DG1A 2J7MA 5ERLA 1Y9QA 3WNNA 3PUHA 5HV0A 4GULA 1LHNA 3VBOA 5EJ3A 2YDEA 3AJYA 5H9QA 1VBB1 4DINB 3LD8A 2V5YA 3BTZA 4GXLA 2XBO2 3C2UA 4KG0A 4ATEA 3E6CC 1A34A 2EXKA 4QX1A 2YC2A 1LB2A 1W8FA 3KVAA 5LY1A 1QQP1 2RJLA 3A4UA 4ZZ8A 1ND2C 2YYOA 3LGRA 4DEVA 4BIFA 3V64A 4C0BA 4PIXA 5JZGC 5FUNA 4R8HA 3O1TA 4BK5A 3VUOA 1Q3EA 2OW4A 5T52A 1DYOA 2RR11 4QDQA 3I97A 3N3HA 4HXCA 2JWPA 1OH4A 1BBT2 1KDKA 2HWC3 3ITQA 4XABA 1H6YA 1XNAA 3AVSA 3M7AA 3PLQA 4Q1PA 1W8TA 5DAQA 2VL4A 5C6CA 1XU1A 2ZGOA 3UJQA 1RL3A 2WQ8A 4DZGA 4QX2A 2RMU2 2EXIA 3VBHC 4RFT0 3KHCA 1Q56A 4BZ4A 4F3JA 3MW3A 3THPA 2BTVC 2ZMLA 4LJHA 4YW5A 1AR63 1VBB2 2ZPXA 3MHZA 2VO5A 4CXXA 2ZX2A 5BV6A 4AR2A 2JEMA 1RUD3 4WVMB 1HDKA 2PHLA 3BGAA 1QGLA 2Y6KA 3APBA 2EIBA 2C6SA 2XBO3 2RS33 4MHRA 1W04A 2YUEA 4DMIA 2Z5WA 4MUVA 2HWF3 1SBFA 1PK6A 3ZDSA 1J58A 1AJOA 5LBFA 4HKLA 2OT7A 3BCWA 1BBT1 4AVBA 2BVVA 5J48A 3LDBA 2XVLA 4Y5TA 1OPMA 3MYXA 1SLAA 2EF6A 2Q0AA 1HJFA 2HWD1 4QPGB 1RHI3 4YYOA 2PELA 1AX2A 1UAIA 1OLMA 2A1XA 1O4ZA 3GXUA 4LBMA 3RVHA 2WNEA 3I59B 4QX3A 4GQ7A 1SEFA 4XFHA 4MXWB 4CUAA 3U07A 1C28A 2P1BA 4Q2FA 1JOJA 3LPFA 3GNEA 3OBZA 4GH4B 1O8PA 3QLQA 4FOYA 4O9EA 1W8UA 5BYNA 4OULA 5A3TA 1RUOA 4IETA 4HFSA 2EXHA 3N7LA 5FZHA 3LQCA 5FZMA 1W39A 4LO4B 1H30A 1ZBA1 3QACA 5F3EA 5IUQA 3PUSA 1YXWA 3HJRA 4LOTA 1D2QA 4OQ8A 4HVRA 1G6NA 3DCQA 4YM1A 5CA6A 2WNUB 3WNLA 2A73B 1VBC2 2HH9A 4IV1C 3NKGA 3WNXA 3AL5A 5EYYA 3IPVB 1QXRA 3HNBM 1NZCA 2BWAA 4XOGA 1OLRA 3I2JA 1CPMA 4ASKA 5F9TA 4XDPA 2RDRA 2XJUA 2R063 1AR83 3T0BA 4XURA 2VMIA 3K4ZA 2JG8B 1H2LA 4RR3C 5DDJ2 4CCDA 3DV8A 4GKYA 3H8UA 3VBUA 5ANNA 4Z07A 3ACFA 3MZHA 5I8TA 1YO8A 4A4AA 5FYYA 2OVUA 2XONA 3NVCA 2JXAA 3PUAA 1GQGA 5F2SA 3WF2A 2EIEA 4J1XA 1DQ6A 4IEUA 1ZRDA 4D94A 1W9WA 2VECA 4BM8A 1HXS2 4GA9A 5A3MA 2JKBA 2UYBA 2BUKA 4DUVA 1J1LA 4NAOA 3B02A 4E4ZA 5KHKA 2E7TA 3RFRA 3ROUA 5FDBA 4P5HA 4B7KA 2C1FA 3PNAA 3ZYIB 3POWA 1CAXA 2R061 3ZOIA 2R7EB 5FMCA 2E7QA 3SKJE 4JKLA 3R4DB 1YI9A 2JG9A 1HRV2 5D8AC 1MVQA 3ZYHA 4OMDA 3MBWA 3ZX7A 5BNPA 1CAVA 5LY2A 1BMV2 1TMF2 4Q0SA 1AUYA 1PNFA 1S2KA 1W90A 1F4HA 1KRIA 4V2VA 2VVDA 3ZFFC 4RD7A 4YSFA 1EP0A 2ZMNA 1FPN2 3DPRA 5FZCA 4I3PA 4QX0A 2CDOA 4EE2A 1OOPC 2RS32 2D6OX 1EPZA 2LRPA 4IERA 5F39A 5FYMA 3VBSA 1HB1A 4YARA 1ULDA 1TE1B 5FLIA 1OHFA 1GNYA 2ORZA 3WHTA 3CZUA 2WL1A 1QOOA 3A22A 3O1UA 2FBEA 5FZDA 2PLV2 2JDUA 4QQPA 3RWKX 1U5YA 5EV7A 4AQTA 4DY3A 3G6JB 3NNJA 4PJYA 4UF0A 3HQUA 1PM7A 3LA2A 3LB9A 2GC1A 5H9SA 4E2SA 5DG2A 1CZVA 1B35B 1DU3D 1W9SA 2A3YA 2HWC1 3MIFA 4Y5SA 3ZFEA 1OF4A 3ZMNA 4PF1A 3P3PA 3HNYM 4OI0A 2JX9A 1NQJA 3ZYRA 5C3QA 3FMGA 4JGYC 2K2SA 3GBGA 2ZX1A 1QNYA 5C5TA 3D5OA 3MW2A 1CPNA 4MGYE 1DYKA 4A44A 3CMGA 3HWJA 2VCMA 3O1OA 3ZIXA 2UU8A 1O3SA 2O1QA 2OS2A 4Q4Y2 4MGIE 2TNFA 3C7EA 4ZKTB 1CN1A 5FUPA 5BUVA 2RS12 2WZR1 4GWIA 3THDA 1OKOA 3KM5A 5E6HA 4D8MA 5T54A 2TEPA 1ZBE1 3RS6A 3D0JA 3ZYJB 4EROA 4JZRA 3OPWA 3E5QA 1U12A 1GP4A 1TNRA 1VPHA 2GH2A 3D3AA 3VBUB 1K12A 1YFYA 1PO21 4ZPIA 1S4CA 3NV1A 3RJRA 2RMU1 2WN3A 3NNFA 4AEMA 1OPOA 2D40A 4JRLA 2ARAA 2ZX0A 5A6ZA 1E5RA 4XUOA 3N9NA 4M00A 5FY4A 4QD2A 5JSRA 1WBLA 2BNOA 1JZ4A 4CCEA 2DCTA 1XSRA 2FMYA 1REEA 4QXCA 4C0HA 4ZHNA 1TMF1 2BVBA 1ND2B 3L2YA 3VHNA 3CQOA 3C7HA 5FV3A 2LS6A 5EFUA 1RUE3 2XVGA 4NRQA 5A3WA 5BXXA 3V0AB 4JCKA 1V6NA 2FMDA 1LHOA 4BMEA 1COV2 1CQ9A 1GQHA 3AP6A 3B7MA 2YBSA 2D6NA 3O14A 3JD73 4I2OA 4FFGA 2BBVA 4ATFA 1Y43B 2WQ4A 2YBKA 2B9VA 2PAMA 4IV1B 1AXKA 3BB6A 3SCGA 1U5IA 1RUJ2 3WG2A 5C7GA 1E57A 2ZAAA 4IUGA 4AI8A 1V6LA 1DP0A 2Y26A 4CEWC 5FZOB 2Q1ZB 4CCMA 1UYPA 3VZLA 5DUXA 1QXPA 1EV11 3LSDA 4FAHA 1K5JA 2ET1A 3O5SA 4XF3A 4CEYB 4GKXA 5A7WB 1NCRC 2D43A 2P3JA 4S2HA 4UW3A 4NRPA 3O7OA 5F8PA 5FY5A 4C90A 3AYCA 4F83A 5L9VA 5IK5A 4TTGA 4XJZA 4DXRA 4M3CA 3A0KA 4JGYB 1UF2C 1UOGA 5KXCA 2XLFA 3U11A 1PO12 1QOTA 4XBNA 3TWIA 3POIA 3VBHA 3WDXA 5FZ0A 4IEXA 4PT6A 3THCA 2ZCWA 3ASIA 4I01A 4GWMA 4UYBA 4DNYA 1CD3G 4QMAA 3VKFC 5EXOA 3VD7A 5A7QA 3CDZB 2VMCA 3V65A
chains in the Genus database with same CATH topology
4LLFA 1PGL1 1EV13 3O0XA 5KHIA 4LEJA 4Q4X3 2P17A 4SLIA 4EWEA 2Y38A 3TNQA 1TQ5A 4L11A 4MGZE 3W59A 4L8QA 2HEWF 1AXYA 1ND3A 1RMU3 1NCRB 4UW6A 5DDJ1 2DWRA 4QQOA 1CAWA 1ZZ7A 2GNBA 5JDBA 5FOBB 3MPBA 5A33B 2XKOA 4KWKA 2WIIB 1YIFA 1POV3 1RUC3 4META 5CFCB 1HXS1 4PLOA 1XNBA 3AK0A 2NN8A 4YM0A 1UX6A 4V1PA 4CEWA 5ABJC 5LRRA 2SBAA 1MEC3 4LA2A 3ZIWA 4D7YA 1X50A 4BWOA 4LE4A 4OHXA 2YGMA 4D3WA 1H4GA 4XMAA 4CRQA 2YY1A 4TSVA 2F6BA 3WV6A 2EIGA 4Q4Y3 5GLVA 5GLZA 3ZFGC 5F6LB 4BLJA 1SBDA 4L92A 2DVGA 3M1HA 3FUOA 1GKBA 1W2UA 4IXLA 3AP4A 3RYKA 4AI1A 1ZM1A 4ZU4A 2MEV2 1SFNA 2KM2A 1HX6A 4FVVA 1PVC1 4OLLA 4Q0QA 3NO8A 2NZ9A 4IESA 1VBE2 1VALA 3KQRA 4QU2A 4IQPA 3WQ7A 4MH0E 1C8M3 3AP5A 4Z2WA 1GZCA 3VBUC 1W6OA 2EA7A 2NM1A 1VBD1 1MS5A 4N43B 1G9AA 3NV4A 4PBOA 2BWCA 4KG8A 5FPZA 1Z78A 5KXBA 4RQPB 1HRI3 2F4PA 2E7AA 2HWD2 1MZ6A 1AL23 1AR61 4HETA 2A75A 4XPVA 3B9IA 1LEMA 1ZZ6A 2BGCA 1QWRA 1JH5A 4I3GA 1OD5A 3PTYA 5D8AA 4RA0A 4KGQA 1OQDA 2RS11 2WZR2 5I93A 4X8PA 1ZBE2 2GDFA 3I59A 5LK7B 2LUWA 2VW1A 3VHOA 1ZRRA 1A8MA 3FFQA 3ZFGA 1JTZX 2ARXA 5A3LA 5LRSA 3FC0A 1N1YA 1NXMA 2VOWA 4DOUA 4UBHA 4PBPA 1R1A1 3H1MA 4PF5A 3RI9A 3B69A 2NMOA 2YZ4A 1ULFA 4LNVA 3ZXEA 1RUI2 1A78A 3D82A 1KFUL 2LM3A 3H9AA 4FBFA 5CU1A 4GMP3 1NA1C 1V6KA 4N90A 1PIV2 4XF1A 1SDWA 4AHYA 3RDIA 4RS5B 1MVEA 4Y1ZA 4XTPA 1AF9A 4G4FA 1IPJA 1QJX2 1MQTB 1MS9A 2R49A 3AZXA 4TZDA 2BPA2 1L3JA 2MNGA 2AZ5A 3M8LA 4AVVA 3J4UH 4RS5A 2DVBA 1AYN3 2D44A 2JG8C 1XYNA 4RR3B 3EBRA 2W52A 4LBQA 2AYHA 3AZZA 4AVSA 3POYA 1MS0A 2PFWA 4A7KA 4QPIA 5T55A 3WQ1A 4KBBA 1SBEA 4BPZA 1GV9A 4W6YA 1B35A 1FOD1 2NYYA 2B46X 1VBB3 1AR62 3LSEA 4DFSA 3MIBA 5FOJB 4A2UA 1YFUA 3WHUA 3CNAA 5KHHA 5I0TA 3T1MA 3QD6A 2HJIA 3IDCB 3IM0A 2ZA9A 4R9CA 1ZBA2 2R6QA 3LOBA 1CGPA 2MPFA 3FLRA 1QJY3 4JTNA 2WS91 3TAYA 3WW2A 3ST7A 2SLIA 5LEKA 4B7EA 5J98B 4TWTA 4HK8A 1LOBA 1AX0A 2A70A 1REFA 1GR3A 5L36A 1AVBA 2BFUL 3NV3A 2WFF1 2IXLA 2E51A 1OQ1A 2GC2A 4NOTA 2WQZC 3HQXA 3EXUA 5FRAA 3WZ1A 1DG6A 1BCXA 2QFEA 2UWBA 2C0ZA 2GMMA 4JTOA 2QQPA 1NCQA 3KCXA 4K6BA 1CAUA 3ATGA 5IK8A 3KCYA 1AR73 1KD7A 2A6XA 1ASJ1 4HLTA 4UW4A 1I9RA 4EN7B 4AVAA 2C5DA 1AYM1 1RC6A 4M0NA 3J9SA 1NE4A 2XJQA 4I0BA 3FUQA 1VLNA 1ZRFA 1DQ2A 3IPVA 1G9BA 1YHFA 2H6CA 3VV1A 1EAH2 4OUSA 4GH4C 2QE3A 2VVFA 5KHJA 1FPN3 1MR5A 1VP6A 1LR5A 4B29A 1RUC2 5LEJA 4UW5A 4H7MA 1RB8G 3VZMA 3NAPB 4R52A 4OI1A 1DQ1A 3QCWA 2TBVA 3NWKA 1IS5A 1KQRA 1DZRA 4FCAA 4P9LA 1DHKB 1WBFA 1OA4A 3WX5A 2WZR3 3VL9A 5CFCA 2GC3A 5LK5A 2XWJB 1FNYA 5HBAA 3THTA 4LBQD 1ENRA 3WVJA 3LAGA 2IZWA 4YZ4A 4AWDA 3IDEA 1O5UA 1EAH1 1X36A 3GYDA 4YG6A 5JOXA 3HIFA 1K5MC 1CAVB 3LA3A 3JB4C 2VH9A 5FPXA 5JOZA 5BNNB 4HMZA 4Q0VA 4LUMA 4KH9A 3RMYA 2CGPA 2ZHKA 2R062 2D3RA 4R4XA 2D98A 4R9BA 1VBE3 3GBFA 3OD0A 4J6GA 2PN5A 1Z7S1 4MYEA 1GZ9A 5JR7B 1BMV1 4E4DX 1Z7S2 4CDUC 1UW8A 3SXWA 5JSOA 5BNQA 2JJ6A 4CEYC 2QUOA 4YGDA 3UJOA 1DGRA 1I6XA 2ZJCA 1S2BA 1WW6A 4FPGA 1SLCA 4JDOA 4K9SA 4OVEA 4UBGA 2B39A 1AR81 4LHNA 1PZ8A 3ZXJA 3AFKA 3OY8B 1IS3A 1Q8VA 1NYWA 4Q29A 2WJSA 4IV1A 1YJLA 2AENA 4PLMA 1AR72 1BVP1 3WR0A 3NV2A 1H8TC 2RM21 1HRV1 4L99A 3B00A 3FE5A 4RR3A 4Y1UA 5BY5A 4N43C 1U5ZA 1FXZA 5K8SA 1NY72 3AZYA 4XDQA 4XZPA 4AVTA 2EXJA 3VBOB 3ZXKA 1SMVA 2ZGLA 5JI9A 3M3IA 1AJKA 1LTEA 4CTEA 2GZWA 3WW4A 5D1IA 4HANA 1RUH1 1MACA 4DRVA 5T3NA 1MS3A 3ZYGA 2QKDA 1D4M2 1ENXA 4CDQC 3USUA 3UV9A 2ATFA 1RTVA 4D7TA 5HCAA 1V6MA 3U10A 3AMNA 4YZ5A 3OGJA 2QZ3A 1LOGA 1QF3A 4ZU7A 5AC91 3UKTA 4BQ1A 4PDWA 4CEYA 2RM22 3EO6A 1XU2A 4FP3A 2VNRA 4P9GA 3ZN6A 4AGGA 1Q8QA 3ECQA 4IV3B 3IKWA 3CJIC 1RUH3 3UL2A 1W6QB 1AXZA 1DQ5A 4GB31 5A32B 3ZSJA 4Q4Y1 1PGSA 2ZZJA 1TME3 4MXWA 2HWB1 2V73A 3S6PA 1RJ8A 3VBRA 2O8OA 1AYN2 3J8F2 1UMZA 2IXKA 5L7OC 5HI0A 2WKKA 4YVWB 1H8VA 5T5PA 4JDNA 1UPIA 4CDWC 5JCTA 4XYXA 1HRV3 4IEZA 5DUUA 2VNGA 5K7PA 1BXHA 1B35C 1PGW2 1DBNA 1RUE2 4H55A 3ZN5A 3VBSC 2PHDA 1AL21 3J8F3 1PGW1 1G7YA 3TRSB 5JOYA 2W0XA 5FAXA 1JHNA 1EY2A 2CNAA 4NWVA 4D69A 2H6BA 4LTAA 2FQPA 3WG1A 2KA3A 4A7YA 1RUH2 4Q4X1 2D97A 3GF6A 1QKQA 1OLQA 2WNVB 4FQ4A 4D7SA 2CY6A 2ZX3A 3VZJA 4PIZA 3ME2A 1RMU1 5DDJ3 3MLLA 1COV3 1LHWA 4LO7A 5CB7A 4N7IA 4LHLA 4LLOA 1RGSA 4U2AA 1R082 3N7MA 5FBZA 4I0AA 3MIGA 3BIWE 1SLBA 1D4M3 2HWD3 2R16A 1N1SA 1OFSA 1Q43A 1BYHA 1TME2 4JAAA 3CJIB 4AW7A 5IK4A 4ES8A 1ZZBA 5C9AC 1WW7A 1QH6A 4FPKA 4QT6A 5EZWA 4WVZA 1VBA2 1FV3A 3NKTA 3TB0A 4X6RB 1O5LA 2D5HA 2ETEA 1WD4A 3ETQA 1ASJ2 5CBLA 5JIUA 4Q4W2 3FJSA 3SCHA 3NJZA 2UURA 3WLUA 1MQTC 1O4TA 2AH2A 2AR6A 3ZN6B 5JPNB 1ZVFA 3ES4A 3LZZA 1FT9A 3OBTA 4CDXA 4JGZB 3KMHA 3KT7A 3MFCA 2ZBJA 2WWSA 2XKPA 4Q4W3 2PHWA 1EPWA 3R6SA 4QM8A 4XQWA 4Q8KA 4CP1A 3ZFFB 1F5FA 4KNCA 1AR93 1RUF3 2E9QA 4JC1A 4KL1A 4AF9A 4BIOA 2EVXA 4YVSB 3SITA 4YRDA 2AREA 3S7EA 1AR71 2GH8A 4DPNA 1GNHA 4YLZA 1NCQB 5GZFA 1XYPA 3USUB 1QHDA 2UWCA 5GALA 2B45X 2FZ1A 1GBGA 4IEWA 2YROA 3EHKA 3SNMA 3N36A 1I5ZA 2WNVC 3WY6A 5C8CC 1MEC2 1D4VB 4P9WA 2OA2A 1GANA 3PVNA 4RGAA 2GMEA 4FOQA 3UKNA 3KGZA 4C1WA 1H9PA 3ZMOA 4Q4V1 2WSVA 2ZOEB 4F7ZA 5SV5A 1F5JA 1VB2A 4AEJA 3WDVA 5SV8A 3IBMA 4BH9A 3BALA 4Y1XA 4EWDA 2R1BA 3N4MA 5FQ0A 1C3HA 4BHPA 3ZSLA 2DU1A 1YYNA 2A71A 5F5QA 3R0RA 4AI2A 1ZRCA 3ZFEB 2CWSA 1PO23 4AXOA 4M3CF 3R4SA 3WW1A 5FLJA 5C4WC 1Z0HA 1X8EA 5HCBA 5K9YA 3M70A 1KITA 3CF6E 1XNDA 4ORFA 1R083 3VBSB 4YW3A 1RVF1 4HPKA 1V6IA 3FLTA 1ZBE3 4CZSA 4Y20B 2ZGNA 1ENQA 1GNZA 1RUI1 3AMMA 1PMIA 4OHYA 1SFYA 3T1LA 1PIV1 4IV3A 4WBBA 4WM7A 2OIIA 4K21A 5BNNA 2HWB2 1UIKA 3MEPA 4H14A 1H8TA 3HR9A 3FHIB 3ZXFA 4ASLA 3K48A 2JE7A 3OCPA 2O8QA 4N43A 4QM9A 1WUVA 3E5XA 4QGNA 4A7ZA 2DTWA 5KXDA 1HIXA 1WLTA 5BNOC 2XVKA 4Q0UA 4NN0A 3HD8B 1POV0 4QHBA 1OA2A 2PHTA 1UU6A 2UWAA 2A5ZA 1AX1A 1ZZ9A 2NQYA 1FOD3 2RM23 3CU7A 3RWNA 3VGIA 2NMNA 2V09A 4MZUA 4E9KA 1GZWA 4PLNA 1FYUA 3BU7A 4NPRA 1D4M1 4MVTA 2D6LX 1I3HA 3V0BA 4AHXA 5C9AB 3HMYA 4PIYA 3BTAA 3U0ZA 1RUNA 3MGUA 5FQ0B 2XJSA 5H9RA 1S0IA 4XFIA 3T2TA 2P3KA 1VBC1 3IMNA 3PVEA 1ULCA 4COVA 1KJLA 3H7JA 2A6WA 2JG9B 4G9SB 2YGLA 3CO2A 4AI0A 5IT6A 4YG3A 3AZVA 3D0SA 3V0AA 1DGWA 2DCJA 3JUUA 2Z2SB 1R1A2 2I45A 3O0VA 3V0BB 1FV2A 1W0OA 3OPZA 4X6QB 5EYXA 5GZEA 5J96B 3AXEA 4Z1VA 3HT2A 2UYAA 4L9BA 3RI8A 1ND3C 2Q8OA 4ONUA 4NHKA 1H1MA 1GFF2 2QDNA 3OTFA 3KGLA 4COYA 1J3RA 3TBDA 3AMPA 4FPHA 1BBT3 3VBFA 2DU0A 3GHMA 5BNOA 2B7YA 1HV0A 3RZZA 4KU8A 5JZGB 4IEQA 4XF4A 4ASMB 1RHI1 1RJ7A 2X29A 5JMCA 2JG9C 4CYDA 4YW4A 1DYPA 2JE9A 4XFFA 5GLUA 1ULEA 3KLSA 5F6KA 5BPXA 1V00A 2OZJA 3ZFGB 4E4SA 4QPIC 3J26N 1AL0G 1H8TB 4HT1T 2EAAA 1NA1A 2QJVA 1YJKA 4WM7B 5AFEA 4GIQA 3U4XA 2WLPA 3GZAA 2GNMA 2HWB3 3IIAA 2P2KA 4Y20A 2PA7A 1S55A 3AB0A 2XPJA 4BLIA 3KD4A 4AFAA 1OSGA 1VBD3 2GNDA 3ZSKA 4EN0A 2D3SA 3GHNA 5E88A 3ZXLA 3MIDA 3ZXDA 4COZA 4K1ZA 1O4YA 2B8MA 2DFBA 1A3KA 2ZTNA 4N7UA 1XYOA 5CG9A 3MIEA 4LT5A 1WD3A 1YCIA 2IFRA 4L97A 2DVDA 2UY8A 3RMXA 3HN1A 1J3PA 4EN6B 1RUC1 2CYFA 2JDZA 3MFAA 4CP0A 4B4RA 3AMHA 2YC0A 1J3QA 3ALQA 1V9U3 2RHPA 4OZXA 5KC6A 1F8VA 4B4QA 1AYM3 5GKAC 3I7DA 4JRAA 1UKGA 4COUA 4PQ9A 2WZPP 2IXJA 3SH5A 3VBHB 2WS92 4DB5A 4AYUA 1C8M2 2PQQA 1LKNA 2XJVA 1ONAA 1UIJA 3ES1A 3MIHA 4GWNA 4RHV3 3MDPA 1DIWA 4C91A 4ISRA 4AG4A 3WDWA 1H2MA 5CADA 3VBRB 4MV2A 3EJKA 2X5IC 1X33A 1X82A 1G86A 3E97A 4N53B 1PK6C 1H1IA 2DVAA 4HKWA 5JAXA 2R32A 4AEKA 5FTTC 1LOAA 1APNA 5GLTA 1BEV3 1QQP3 4N53A 5CAZA 2BQPA 1DDLA 1O3QA 3VN4A 1ZREA 2D5FA 1VBA3 1Y7BA 1IPKA 4GALA 1AR91 1RUF1 2DUOA 1DGLA 2ZKNA 3B94A 5GJ6A 1AR92 1RUF2 2ARBA 2VG9A 3LKJA 4A3XA 4OI4A 1ZBA3 3CL1A 1QJY2 1W6OB 3ZFFA 5C8WA 1BVVA 1J1TA 4L2NA 3ZVXA 3H3ZA 5HXVA 2I74A 1M06G 3KCCA 3ILNA 2CAVA 4CDUA 3AKSA 2XL7A 1CONA 2GSYA 2WS93 2ZZQA 4EN9B 5CVRA 4FOVA 4LR4A 1KJRA 2VOXA 2R1DA 1PVXA 1EV12 4RHV2 2PAEA 2O0OA 3AJZA 3JZVA 4QPYA 3JD71 4FP2A 1GICA 1TEIA 3VZNA 1C4RA 3QBQA 1WW4A 3WQ0A 3OF1A 2D6KA 1PO13 3E6DA 2OYZA 3WDYA 3VHPA 2QZ2A 2B9UA 2VVEA 1H4HA 3M3CA 1PIV3 4S2DA 3RRDA 3B3QE 1QJU1 5AC92 4YZ2A 2ES3A 3HAGA 1LGBA 2G4IA 2PTMA 3GZTB 4ISQA 2GALA 2K0GA 1ND3B 2E63A 2Z42A 2ZGMA 3ZXAC 5AFBA 4AGVA 1JN2P 1IS6A 1F9KA 1FNZA 2DV9A 1V9U2 2WLQA 3JD72 2XB6C 1OMIA 5KXEA 1PVC2 2QNKA 5FO9B 4RQPA 3N35A 1NQDA 5CIRA 2ZGUA 1VAVA 4QQ2A 4PDWB 1LCLA 4YM3A 2ILMA 1IOAA 1FX5A 3VKNA 3KT4A 3WD5A 3S30A 2X8KA 5AVPA 5L19A 3VLBB 3TN93 2H0VA 4WM8B 1QMJA 2G9GA 5KBFA 1JUIA 1PNGA 1K5MB 3HT1A 4W65A 5K0UB 3LCPA 4ZXKA 3E6BA 4Y1YA 1U5XA 4B8EA 3OJBA 1UU5A 4F8AA 3DPRB 3GALA 4PDWC 1N47A 2MEV3 1EYBA 4Y22A 1QQP2 3N7KA 4KQ7A 2WSUA 3DUIA 4JDMA 1FMD1 3FBYA 2GN3A 3JB8A 1VJ2A 2QCSB 4YVWC 1PGL2 4Y26A 1FMD2 3CJIA 5E8AA 1Q8OA 1SQ4A 3URFA 3N7JA 4CDWB 5GZGA 2TUNA 4XJWA 3B01A 1LHUA 1N3PA 3SISA 1AZDA 1OFNA 2ZACA 3VHRA 1HV1A 2R041 3AP7A 4M0HA 4XEZA 5DZFA 4YZ3A 4AFCA 4BOWA 2VMGA 1S0DA 3Q9OA 3ZXGA 2ZHLA 4XFCA 1H2NA 5B2GB 1AHSA 4NR1A 2VNOA 2CAUA 1CAUB 1LULA 1YI7A 3RG0A 1Q5OA 3KZ4C 2A3XA 4Q4X2 2PLV1 4RS5C 1Q8SA 1T6GC 3RNSA 2Q5TA 2JG8A 1R1ZA 4Y1VA 5JSPA 5ABJA 4HVOA 4JGZA 1SCRA 1UD1A 4NHLA 1WW5A 1Y3TA 4K40A 1LJ7A 4FXKB 1V6OA 2GC0A 2GNTA 2WT0A 1F2NA 3BOPA 2XH6A 3WINE 1O3TA 1MZEA 4ITCA 3EQEA 2I2SA 4Q26A 3POSA 3FWEA 1S1AA 5ACA2 3ZO0B 2PHRA 1V70A 1RUD1 1OOPB 4AFDA 1S0BA 2PYTA 4HPKB 1RITA 3TN91 3RYRA 5I0RA 1VAKA 3HBZA 4YG0A 4HSJA 4YVWA 1UU4A 4EJRA 2XL9A 3SH3A 3WP3A 1OOPA 1R093 2HWF1 2R0HA 1TMF3 4O9GA 4HBNA 1YUDA 1CAWB 1BKZA 2YXSA 4FPLA 5E1RA 4CDXC 3AYAA 3X29B 3FBMA 1C8M1 5KWRA 1C57A 3W58A 2RJKA 1POV1 3SH4A 5CG8A 2VQAA 3IN9A 1NLSA 3I8TA 1ND2A 1LENA 4IEPA 2VUJA 3I4IA 3WT3A 1CESA 3CLPA 5ACA3 5ABJB 1TME1 1MQTA 1D0HA 1XQNA 4N9IA 5CFDB 1DQ0A 2OPKA 3KSCA 2XLAA 2DTYA 1WLWA 1XE8A 1BEV1 3PJYA 5GLWA 3FZ3A 4I30A 4LE3A 5H9PA 1RHI2 1FAYA 2OZ6A 4IEYA 2XJTA 3RPQA 1CJDA 2XUMA 1RVF2 2DCKA 1W6PA 3JCIA 1ZYBA 1YNAA 4AK3A 1OKQA 3VKLA 2Z69A 4CDWA 3NAPA 3WDUA 4Q4V2 2ZGRA 3G7DA 3WXPA 4WZFA 1LODA 2VGDA 3JQXA 1FPN1 2N7GA 1KFXL 2WA3A 2ZGTA 4XFAA 5JLVA 2PHFA 4CDQB 3A0NA 2WFF2 4XQ4A 3FX3A 2JICA 2XJRA 3GBWA 4K8FA 5FMOL 1NXD1 2R30A 4G3YC 3GZUC 3PJQA 1GZWB 1LECA 2ZAHA 2P3IA 3R05A 1GLHA 1VR3A 4DRRA 2VW2A 4OHZA 4YW2A 2HWC2 4EV0A 4URTA 1SLIA 2H0BA 4E27A 4IV3C 1R091 2G9FA 2ZABA 4AFBA 4Y4YA 1S0FA 5DZEA 3C3VA 4FXGB 1RVF3 1MS1A 1JW6A 1OQEA 5J3UA 3H0OA 3ZPYA 3DN7A 3VBOC 2XHKA 5JPMB 2A3WA 4BA6A 3TYJA 1ASJ3 5BNPB 3D8CA 4K1YA 5JVVA 2VMHA 4ZU5A 2DUQA 2DCZA 3JU9A 4K3UA 2RS52 3JBG2 2OUHA 4QGLA 4LBOA 2FZ2A 4MXVA 5JZGA 1HQWA 1JYIA 1QJX3 1VAMA 2IXCA 1YRZA 4FPEA 4WM7C 1QOSA 3KS7A 4AHZA 2QVSB 1YFXA 3WCSA 5FMOS 3ACLA 4GB32 3E5UA 2GU9A 1FI2A 1ZA4A 3BPZA 1AR82 4OHWA 1DLLA 1PVC3 3BODA 3D6EA 2DCYA 2ZGPA 4K7JA 3O12A 4P9IA 3FLPA 2E53A 2Y0OA 1QXJA