1RUJ1

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGGMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 48
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj100
2RR13 3TN92 2RS12 1R093 4YVSC 4RHV2 2HWB1 1MEC3 4Q4W3 4AEDA 4CDWA 1C8M3 1OHFA 1Z7S1 1COV3 2WFF1 1NCRB 1POV3 2RMU2 4CDXA 1WCDJ 2GH8A 4IV3A 1X33A 1AR62 1AL22 1D4M3 4Z92B 1OPOA 3VBFB 1F2NA 1NA1C 1POV0 1QJU2 5A32A 4CEYB 1ASJ2 4RQPC 1AR72 1AYM3 4CEWB 1EAH1 1HRI3 5BNOC 1QQP3 4N53C 3VDDC 4YVSA 5BNNB 1PGL1 1VBD3 2RM22 1RMU3 1OOPC 4PDWC 1VBA3 1AYN2 3S6PA 5C4WB 4Q4V2 1QJX3 1R083 2MEV3 2RR12 4GB33 2WZR1 1EV13 1NA1A 1PVC1 1R092 3ZFEA 1HQNA 1MEC2 4Q4W2 2HWC1 1C8M2 4RQPA 1COV2 2WWSA 3CJIA 5BNOA 1RUI3 1SMVA 4N53A 3VDDA 5C8CB 1RUE3 1RUJ1 1OOPA 1PGW1 4PDWA 1QJY1 5L7OC 1MQTC 4IV1A 5AC93 4Q4Y1 2GSYA 1AYM2 3TN91 2ZAHA 5DDJ3 1RVF3 1HRI2 4RHV1 1QQP2 4CDUB 1C8NA 3VBRC 5D8AB 2HWD3 3M8LA 2RMU1 1VBA2 2R041 4QPGC 1PGL2 1RUH3 1AL21 1TME3 4YVWB 3VBOC 1QJX2 2MEV2 1VBE2 4GB32 1QJU1 1VAKA 5L7OA 1ASJ1 1MQTA 2FZ2A 1RB8G 1H8TC 1RUI2 4BCUA 3ZFFB 2RM21 1RUE2 4RFT0 3VBRA 1BBT1 2FZ1A 1AL0G 3JBG3 3VBSB 1AYN1 4QPGA 2HWF3 1NG0A 1NCRC 4Q4V1 5AC92 3VBOA 1PO12 2BUKA 1VBC2 2RR11 1R091 1RVF2 4FSJA 1HRV3 4Q4Y2 3VBFC 1MEC1 4Q4W1 1C8M1 1COV1 2HWD2 1RUG3 1M06G 4GH4B 4CEYC 1POV1 2HWE3 4GMP3 5FMOL 1H8TA 1RUH2 4CEWC 4WM7B 1D4M1 1TME2 1X36A 2R042 5BNNC 3ZFGB 1IHMA 2QQPA 4GMP0 5JZGB 1NCRA 5K0UB 1AYM1 4Q4X2 1R1A3 1VRH3 5J98B 1HRI1 5C4WC 1QQP1 3VBUB 1V9U3 3VBFA 1B35B 1VBD1 1RMU1 1RUF3 3NAPB 4JGYB 1VBA1 1AR82 4CEYA 1RUC3 2RS33 2HWF2 4CEWA 1BBT2 1QJX1 2MEV1 1DDLA 1VBE1 3DPRB 3JD73 4GB31 5C8CC 4RR3B 5FMOS 5BNNA 5A33B 4Y4YA 5J96B 1AR93 2VQ0A 3JB8A 2HWE2 5C4WA 1RUI1 1FMD3 1RUE1 4CDUC 1A6CA 1K5MB 5D8AC 1D4M2 5ABJB 5AC91 1FOD3 2R063 2R073 1PO11 1VBC1 5C9AB 4WM8B 1VRH2 5DDJ1 1RVF1 4YVWC 5C8CA 1ZBA3 1VB4A 1QJZA 3HAGA 2WS93 4CDQB 2WZR3 2HWD1 1RUF2 5ACA3 1E57A 5BNPB 1RUC2 1RUH1 2PLV3 2RS32 5CFCB 1VBD2 1RMU2 1TME1 3JD72 1ND2B 1ND3B 4CDUA 1BMV2 4JGZB 4N43B 1NY71 4RS5B 3ZFFC 5D8AA 1R082 1AUYA 3VBSC 1AR92 1EV12 1RUD3 4YVWA 4Q4X3 1PO23 4LLFA 1VBB3 2RS13 5CFDB 3JBG1 1AR81 2HWF1 4GH4C 2R062 2R072 2XBO3 2TBVA 3VBHB 4WM7C 1AR63 1AL23 1ZBE3 1ZBA2 1HRV1 2BFUL 3ZFFA 2WS92 3ZFGC 2RS53 1CJDA 3VBSA 5DDJ2 1RUG1 5GKAC 5ACA2 2HWE1 5JZGC 4GMP1 1HXS3 2X5IB 2PLV2 5K0UC 1NCQB 1AR73 3VBUC 1RHI3 1B35C 1TMF3 1HX6A 3NAPC 4QPIB 4JGYC 3J8F3 4GH4A 1PIV3 1FPN3 5FOJB 1VRH1 1NY72 2XPJA 1RUD2 4WM7A 3DPRC 4AEDB 4CDWB 1PO22 4FTBA 4NWVA 1VBB2 4RR3C 1NOVA 3ZFGA 1RUF1 2Y26A 4CDXB 4IV3B 1BEV3 1RUC1 2BFUS 5JZGA 2RS31 5K0UA 2XBO2 3JBG2 3JD71 2ZZQA 2HWB3 1BMV1 1F8VA 5A32B 3VBUA 1ZBE2 1Z7S3 2WFF3 1R081 1B35A 3NAPA 4JGYA 1K5MC 2RS52 1AR91 1EV11 2IZWA 5ABJC 3LOBA 3ZFEC 1HRV2 4NWWA 4YVSB 1HXS2 1CD3G 3DPRA 5C9AC 4WM8C 1FMD1 1RUG2 4RR3A 3CJIC 1RHI2 5A33A 1TMF2 4CDQC 1FOD1 2R061 3J8F2 1EAH3 2BBVA 2R071 5BNPC 1PIV2 1FPN2 1W39A 5CFCC 1NA1B 4FTEA 4IV1C 3ZFEB 1ZBA1 1ND2C 1VBE3 4RQPB 2WS91 1ND3C 3FBMA 1R1A2 4JGZC 1K5MA 4N43C 4RS5C 5ACA1 5ABJA 3CJIB 5BNOB 1BEV2 1V9U2 4N53B 3VDDB 2PLV1 5C9AA 4WM8A 1PVC3 1OOPB 4PDWB 4FTSA 2HWB2 2HWC3 1Z7S2 4IV1B 2WFF2 4CDQA 5CFDC 5BNPA 5CFCA 1RUD1 4EJRA 4Q4X1 1PO21 1RUJ3 1ND2A 1PO13 1VBC3 4QPIA 3VBHC 1VBB1 1ND3A 1QJY3 2RS11 5LK7B 4JGZA 4N43A 4RS5A 4Q4Y3 1FMD2 3TN93 1GFF2 4SBVA 1EAH2 2WLPA 2XBO1 4RHV3 2X5IC 2BPA2 1AR61 1NCQC 5L7OB 1ZBE1 1MQTB 1FOD2 4Y5Z0 2RMU3 5CFDA 2R043 3ZXAC 2RS51 2ZTNA 4QPIC 2DF7A 1HXS1 2WZR2 1AR71 3VBRB 3VBHA 1PVC2 1QJU3 1VB2A 1ASJ3 4AEDC 4CDWC 4QPGB 2HWC2 1RHI1 1TMF1 3IDEA 4CDXC 3VBOB 3J8F1 4IV3C 1PIV1 1FPN1 1AR83 2X5IA 1NCQA 2RM23 1BBT3 1RUJ2 1PGW2 1QJY2 1R1A1 1AYN3 3JB4C 4Q4V3 1H8TB 1BEV1 1V9U1
chains in the Genus database with same CATH superfamily
3I3BA 1UOGA 3HQUA 2RR13 3RYKA 4UF0A 1SQ4A 4MVTA 3TN92 3UGHA 2RS12 2FDHA 1J58A 4FI9A 1BHGA 1OF4A 1ACCA 2EXJA 4HZFA 1W8ZA 3T1LA 2YDEA 4JDNA 3K3OA 3DCQA 4HETA 4CDWA 1O7FA 1Z7S1 5F32A 3WG3A 1OLRA 1PMHX 2LRPA 2RMU2 4AI0A 2JB4A 1Z78A 4PIXA 4BHPA 1X33A 1JODA 1S1AA 2YY1A 4CXXA 2Z4FA 2W1QA 2XHNA 4QX2A 5FV3A 1D4M3 3PTRB 1LODA 1RXGA 3O5SA 3VDBA 4NHKA 3VBFB 3DYOA 2WC2A 4AHZA 4J6GA 1V6KA 3SH4A 2E7TA 1CESA 2VUCA 2JJ6A 3FLPA 1LOAA 3O1OA 4J1XA 3SISA 4AE2A 5LBCA 4LHSA 3W58A 4XUNA 2DU0A 3FHAA 4PLMA 3OPWA 4S2DA 3IDCB 4ZXKA 4DEQA 1DQ1A 1UMHA 5F3GA 3IWZA 1HRI3 5BNOC 1EUUA 4AEKA 1HDKA 2ZMNA 1VIWB 3VDDC 4ASLA 2VQUA 2FCTA 2VXJA 4YVSA 1PGL1 4P02B 3LF7A 1RMU3 4LKDA 1UKGA 2KXLA 2PQQA 3LA2A 4MGIE 4PDWC 1STMA 4QDRA 3MIFA 3KCYA 2VNRA 5IWFA 1Z0HA 2D6MA 5L9VA 4GJZA 2BP6A 4XABA 5C4WB 1RUOA 1R083 1H1IA 4P9GA 2VUDA 3BTZA 2W94A 3KD4A 1R092 3LSDA 3NJYA 4QX0A 4Y1XA 1WW4A 3B69A 4IEXA 4X6RB 1HQNA 4Q4W2 1F35A 4FPHA 1ENQA 3AMNA 1ENXA 3I2FA 3M3QA 4K1ZA 2HYXA 2WWSA 4S2GA 4LBQD 2A3XA 4FOYA 5KXDA 5LK5A 5IVVA 4MGTA 4K7JA 5C8CB 2O14A 1Q8PA 1RIRA 3GF6A 1JI6A 1MVQA 3KGLA 3ETQA 4AR2A 2A6VA 2D97A 4PIZA 2FMDA 1HW5A 1SFPA 5T54A 3J7NA 4V2WA 4GJYA 3H3UA 3TRSB 1G9CA 1SHWB 5FPUA 4LULA 5AC93 2VVEA 4E4SA 3T0AA 4ARYA 2PHXA 3MYXA 3KCCA 1YHFA 4HKLA 1IQAA 1RVF3 2D3SA 4PJYA 2JXAA 3RJ2X 2AZ5A 4RHV1 3MIEA 4CDUB 2K9ZA 3HN1A 4HPKA 1C8NA 5A6XA 1WBFA 5EIYB 4E9KA 1A34A 5D8AB 1PZ7A 2QFEA 3HD8B 5T5LA 1QU0A 2HWD3 3D5OA 4W8JA 2ZX4A 3R6SA 5KC5A 1F31A 4FFIA 1CAUA 5T5JA 1WMEA 4AOCA 3ACGA 2WO3A 1OH3A 2R6QA 2YV8A 2C9AA 3QD6A 1TME3 4LKSA 4WVMA 3VBOC 1QJX2 3WCRA 2UYBA 1KITA 3L2HA 4LEJA 1KDKA 1HJGA 1GNHA 1ZA7A 3EBRA 4YM3A 5FO8B 1F9KA 3C7HA 4DINB 3AFKA 1V6OA 2E9QA 4FFGA 4P9LA 1OXCA 5I8SA 2FZ2A 1YIFA 1OA2A 1RB8G 5F2WA 4E2QA 5A6YA 3BALA 2ZMLA 3C7OA 4N7UA 4B4PA 4Z8BA 1MPXA 1YFYA 5I0RA 1YQ2A 1ODNA 4LK7A 3ST7A 4OI1A 4AG4A 4FPFA 3MUY1 4RFT0 1RUE2 2WYFA 2WQZC 2ZZJA 2B8MA 4AI8A 2AUYA 2Q1ZB 1IPJA 2FZ1A 2K2SA 2ZGQA 2OPKA 5HV4A 3OD0A 4LA3A 1MACA 3OG2A 1PO12 2BUKA 2DURA 4A41A 4AFBA 1I5PA 4EWDA 3H7YA 1AF9A 2WNUA 4XHXA 2DVFA 3MF6A 5FIXA 4D6SA 2R49A 5FXVA 1HRV3 3LFMA 2Q8CA 3H3ZA 3VBFC 3GJAA 4DY3A 1N3OA 2VZRA 1C8M1 1Q8OA 1QXJA 2QUOA 1WD4A 5FZ3A 3UKTA 4UWDA 2VC9A 1POV1 3M4FA 4UXAA 3FLRA 3BVCA 3IBMA 4A3XA 4I2OA 4UFMA 4QQPA 4LT5A 1RUH2 2GZWA 4WM7B 2I74A 3KQ4B 3MDPA 4AI9A 5JDBA 3PDQA 3ZVXA 2R042 4D3WA 5LBEA 1DGWA 3RZGA 4YG0A 3U78A 2UURA 2XWBB 1IHMA 4Q1PA 2QQPA 2NN8A 1W6QA 2VECA 1BKZA 1CJPA 1QH6A 5K0UB 1AYM1 3OGSA 4Q4X2 2CYFA 1R1A3 1VRH3 3KLSA 2VMEA 2AYHA 5C4WC 1QQP1 3MI8A 3RG0A 3VBUB 4IEYA 5KXEA 2FD8A 3J7MA 1O5UA 1XQNA 5FQ0A 3DF0A 4ES8A 3OYWB 5A3MA 4DUXA 5FYSA 1RUC3 2WL1A 4JHTA 2VMFA 2RS33 4CP9B 5E8AA 2X8KA 4META 1F5FA 2A6WA 2HWF2 3H42B 3HQRA 3MW3A 4PF5A 2MEV1 5EJ3A 5FY0A 3ZYRA 2XL7A 1JYNA 3DPRB 3JD73 1RUNA 3VHNA 5F8PA 5LA1A 5C8CC 4RR3B 2YFUA 1UZZA 1NLSA 2WKKA 1UAIA 2BTVC 4NPRA 5A33B 2H0VA 5JLVA 2DCTA 2Y6GA 3W21A 3ZXJA 5J96B 3S57A 1G8WA 2WNOA 2VG9A 3JB8A 2HWE2 3AK0A 2ZPXA 3LEIA 3A7QA 3OJBA 5EYXA 3WW1A 4KWJA 1RUI1 1Y9QA 2O0OA 4NPLA 4YG3A 4XUTA 1OFSA 4IW3A 4XCBA 2CNAA 4UFHA 1XOYA 4Q2FA 3OY8A 3RVHA 1EPWA 3N7MA 2EIBA 2QVSB 2RVAA 1WCQA 3IDAA 4CDUC 4CXYA 1A6CA 2Q0AA 2V09A 2ARCA 4LR4A 5FP9A 4A3ZA 3BUCA 5D8AC 1D4M2 2JDKA 5JAXA 1DHKB 1UWWA 2CDPA 1PK6B 2R063 5EJ1B 4E4HA 4FPLA 3E6BA 3S30A 3X29B 1W2OA 5C9AB 4EWAA 5I8YA 5DDJ1 1GWLA 1VAVA 3O7OA 4C1WA 1KD7A 5IATA 3ABZA 3EB7A 1X8EA 1YWKA 3WR0A 2WS93 1REFA 2GALA 1ULDA 3DUIA 3NJZA 4XJAA 1NXD1 1W99A 2Y6KA 5ACA3 1E57A 4CP9A 1LCLA 5BNPB 1PZ9A 3DXUA 4AGGA 2R1BA 2FDFA 2CSGA 2PLV3 3MLKA 4XETA 1RMU2 2GMMA 1NX9A 4AVVA 3R05A 1OKQA 3SXWA 2EAAA 2MNGA 1G6NA 1ZZCA 2IUWA 4N43B 2W39A 4COZA 2JG8A 2ZX2A 3IDBB 1R082 1DQ6A 1ULEA 2VO5A 2Y6JA 4MOAA 5FYZA 3WDUA 3SH3A 3I3DA 4MXWB 2BWCA 4FAHA 1AR92 4XDPA 4YRDA 4XFHA 2DCZA 1RUD3 3ZN5A 3VN4A 2IXJA 2Y64A 3CLPA 2W47A 1QJFA 3O1MA 3LQCA 4NHMA 4PT6A 1VBB3 2G19A 3GZAA 4S2HA 1VLNA 4Y5SA 1MR5A 4FVVA 3SCHA 3U07A 3AZVA 2Q4SA 4ZZ5A 5BYNA 5C3SA 5KXBA 5FXWA 4MHUA 4KH9A 1YIPA 3D0JA 1IG3A 4R9AA 4XJ8A 5FY7A 4COVA 1WLTA 2P1BA 4IGPA 3SKVA 2VNVA 2QQMA 2YBSA 4WM7C 1AR63 3GGLA 3GZTB 1F4HA 5FK8A 3UJOA 4M3CE 1O3TA 2FDIA 2BFUL 3PVNA 4M3CA 4C1XA 5BXXA 5AFBA 3VKNA 2ZGLA 2RS53 3VBSA 5GKAC 1UQXA 1IS4A 3RI9A 1QF3A 4YGCA 2E32A 3N7JA 3RPQA 2IXLA 3VD3A 1OVPA 3PVOA 5HCBA 4FP2A 5LBFA 5K0UC 4Y20B 5FWJA 1NCQB 1AR73 2IVIB 1XYPA 2P3KA 4MGZE 4FQ4A 2Y34A 3AC0A 3VBUC 1Y9GA 2H0BA 1KFXL 2XLAA 1TMF3 3LZZA 4BA6A 4B29A 1JU4A 3ZDVA 4ET7A 2XXZA 2P3YA 3RDIA 1O4YA 4Q0VA 5CB7A 4E2GA 3CEWA 4CYDA 1L3JA 2WZEA 1W6OA 4MGYE 3KV5A 2VY0A 1JZ7A 2C24A 5DMYA 3DPRC 2ZGTA 1XE0A 1OURA 1PO22 2CHHA 3HNBM 4NWVA 4OUSA 2VZ1A 4RR3C 1SFYA 1NOVA 2EVXA 1RUF1 5A3TA 4IV3B 4UW4A 1IPSA 2AGSA 2C4XA 2ZEXA 3TB0A 1FV2A 4B4RA 5KR7A 1V6LA 5F6LB 4BMBA 1PM4A 2HBUA 3OCPA 2NQYA 2QQVA 2YPDA 1AX0A 3LD8A 3OPTA 3MLLA 4W4ZA 3HVDA 4YGBA 4ZKTB 4Q0PA 1QDOA 2OKXA 4BZ4A 4XFGA 5T3NA 1ZBE2 2A6ZA 1E5IA 1GNYA 2ORXA 3NQHA 4QB1A 3ETPA 4YM1A 5F5QA 2XQXA 4Q8KA 5FCCA 2J7MA 3DKWA 2OUJA 2Y6FA 3POBA 4JGYA 1EV11 1UO9A 4FP3A 4LPLA 4YW2A 4DO0A 4JX0A 4CUBA 5IFTA 1UMIA 1R64A 1HRV2 3RMXA 4XXPA 2WFPA 4E4ZA 2PQSA 3GHMA 3RYRA 1UOBA 5C9AC 4IEQA 2CU5A 1DYKA 3ECQA 3P1IA 3VD4A 2ZKLA 1KJRA 2UY8A 2UYAA 3POIA 1X82A 1RHI2 2G4IA 4EROA 4OHXA 3WW2A 1P8JA 2R071 2P3IA 2Y0IA 1FPN2 5EFUA 5BNPC 5F5CA 1ONAA 1Q8SA 1T6BX 5FYCA 1NA1B 5GJ6A 4FTEA 1CAXB 1ZBA1 3JUUA 4O7XA 5H9SA 3WHUA 1DGWX 2LW8A 3N9NA 1RYYA 2VNGA 4RQPB 4QGNA 1R1A2 1U12A 3JZVA 4N43C 3VB9A 2JICA 1U5XA 1O3QA 4LBOA 4IL7A 2A3YA 1H2KA 3RWKX 4K40A 4WZFA 2YBPA 5FPAA 3KHCA 1EP0A 3OF1A 3E5XA 4GWJA 4J25A 4QMAA 3TNQA 2WN3A 4WM8A 2QQWA 3WCSA 1G9BA 5FLHA 4AVSA 1N47A 4QB6A 3THDA 1N1TA 3CMGA 2HWC3 3WNPA 3AZZA 3IIAA 1Z7S2 4QX7A 5M0TA 3VZNA 1VMFA 3HNMA 1J1TA 1JUHA 3QCWA 5E88A 5HCFA 3ZO0B 4BM8A 5C7GA 1TEIA 3FE5A 1W8OA 4GXLA 1CPMA 4QX8A 1RUJ3 5A70A 4YZ4A 5JI9A 4QPIA 4AGVA 1WA6X 1ND3A 1QJY3 2GNDA 4M0HA 5I8TA 5FFOC 4RS5A 4CUGA 3CIHA 4LUKA 5A7NA 1VMHA 1S0CA 3TN93 4CZSA 5LY1A 1EPZA 2DUQA 2WLPA 1WW6A 1WCSA 1WUVA 1OSGA 4BQYA 4FBFA 4NN0A 4Z2AA 3IIIA 5LCWL 1HB4A 3VD9A 1D4VB 1FNYA 1LEMA 1NCQC 2VOVA 5L7OB 1GP5A 1TG7A 3AP5A 4Y5Z0 1REEA 2RMU3 1VMJA 3AYEA 5CFDA 3B3QE 1KFUL 1T2XA 2JG9B 4TSVA 5EPAA 2D3RA 4MHRA 2QJVA 4BQWA 2BDRA 3CHXA 4D0QA 4P9IA 4RA0A 3VBRB 2XKPA 4NPMA 1WKYA 2PMWB 2H6CA 1O6UA 2JDPA 1BVP1 2VU9A 4F3JA 4L99A 3J7HA 2ZGRA 5A7QA 2K46A 2X05A 2VL4A 3WEZA 3KV4A 3R4SA 3MO4A 5LRSA 2W87A 4IV3C 3H8OA 1PIV1 2NYYA 4QHBA 4A7YA 4DMIA 3KVAA 4DY5A 2WUHA 2GN3A 1VAMA 5FJHA 3WW3A 1BBT3 5IVBA 1TNFA 3O12A 2OQ6A 3PUAA 4H7MA 4XHBA 4DEVA 4CCMA 4IE6A 1BVVA 4BH9A 2AENA 2W5FA 3SLIA 3ZSLA 4CVUA 1BEV1 5IVFA 1W8FA 3ZYBA 2VMHA 3K75B 3WDXA 1D0HA 1R093 2P17A 4RHV2 2CY6A 2HWB1 3BODA 3S5QA 1XU1A 4Q27A 4Q4W3 5IVYA 2Z79A 4AEDA 4BYYA 3IAPA 1BK0A 4HOOA 4AQSA 3LFIA 2J1EA 1WCDJ 4QXHA 3RMYA 3ZSKA 3RZMA 3TOJA 3T4VA 1AR62 1CPNA 4DRVA 1BK1A 2BVVA 3RZHA 1DGLA 5ISLA 4Z92B 4RYDA 1OPOA 2EICA 4Z2WA 2JIGA 2WZPP 1NA1C 4XF4A 4YWAA 1V0AA 4AGRA 5FO9B 1PM7A 2DCKA 2VZUA 4CEYB 2TEPA 2ZEWA 5FP3A 2D7FA 2UWBA 4E27A 4RQPC 5JSRA 3HQXA 5FZ4A 2XLFA 5A3NA 4CP1A 1AR72 2G9GA 2IWGB 1UYPA 2VBBA 4IERA 1D2SA 5FYYA 1EY2A 3WP3A 4JKKA 5CG8A 5BNNB 2BOJA 4OUMA 5FO7B 3U37A 3CJXA 3SH5A 1UD1A 4TTGA 3BU7A 1ENRA 3RJRA 5C8WA 2P6HA 4L8QA 1XB9A 4Y22B 3S6PA 4BLIA 4DRRA 2XKOA 5JIUA 4JZRA 1QJX3 1GNZA 2B9UA 1C5IA 3LCPA 5DUXA 2BGPA 4HKWA 3N3HA 3NWKA 1XJAA 1KS4A 1EV13 1PVC1 4OCTA 1SLCA 5DABA 3WNXA 3TWIA 1H4GA 3ZFEA 2DTYA 3V0BB 4GULA 3OUHA 2BEOA 1C8M2 3RQ0A 5C5UA 2VJXA 2YZ4A 2LUWA 1YJLA 1JW6A 4MXVA 4ES9A 3MFAA 1RTVA 4XIOA 3CJIA 5BNOA 4NHXA 1SMVA 3VDDA 2DTWA 3AMPA 1SPPA 1MVEA 2X10A 1KGYA 3LB9A 4D69A 1RUE3 1WA4A 2BWAA 2YG0A 4U2AA 3RYPA 3ZSEA 2VMCA 4PDWA 2X09A 4WVWA 3V0AB 5IK4A 3H7JA 1LGBA 4XAAA 5L7OC 5GZDA 4K8RB 4IV1A 4NHYA 3IMNA 4CXWA 4Q4Y1 1OF3A 2WNVB 4QT6A 2BNMA 2GNMA 1RITA 2YUEA 2JG9C 4P9WA 1AYM2 3SC7X 4OVEA 2W95A 4CCJA 3HN3A 2LTNA 1US2A 2OA2A 1QQP2 1ULFA 4QHZA 4W6YA 2VMGA 1SCRA 3VBRC 3CDZB 1C5HA 1NT0A 3ZMOA 4AI1A 1SBDA 1DQ2A 1JYIA 3ZYIB 3QLQA 4P9XA 5GLTA 3ZM8A 1WWYA 1GLHA 2PAKA 3F2ZA 1CZSA 1G86A 1RUH3 1AL21 1SBFA 5FXZA 5F2SA 1J83A 5A7PA 3FHIB 4YVWB 4XUOA 2MEV2 5HCAA 4HVRA 1HKDA 4QDQA 4Q4V3 1MS5A 2CAVA 2HJIA 2R1DA 1GZWA 4BQ2A 3U4SA 4FAGA 3ITQA 4UBHA 1UXXX 4ZU7A 1OC1A 3AVSA 4FFHA 2ETEA 4L9BA 1Y9MA 4BE3A 3IZOA 1WW5A 1RUI2 3MPBA 3B5LB 1WMFA 2B7YA 1ULCA 3SEPA 3U4XA 5EWSA 3LOIA 5J48A 2ZHLA 5C3PA 2JENA 5HV0A 3VDAA 1KXGA 3JBG3 4ZU4A 5DG1A 1UMZA 1AYN1 1W0NA 2BJSA 3ZLIA 1N1YA 1OVSA 4A42A 1UZVA 1UPIA 2HWF3 4LA2A 4A6OA 4KG8A 3A22A 5FMDA 1H2NA 3VBOA 1O4ZA 4B7KA 1ODMA 2A6XA 4IE7A 5FY1A 3KS7A 3U1XA 3UKNA 4AWDA 3DKQA 2YPJA 5LBBA 5JXIA 2BV4A 4BPZA 1MEC1 3S0MA 4D7YA 3EO6A 1OA3A 1L7LA 1ZM1A 2GN7A 2HYKA 4H7LA 1COV1 1SG3A 2QQNA 3C7FA 1RUG3 5J7MA 1A8MA 4GH4B 2JIJA 5T5PA 3WVJA 4CEYC 1NXMA 1M06G 1FV3A 4BQ1A 5DAVA 2HWE3 1YLLA 4GMP3 4QGMA 5FMOL 3AYDA 5IW0A 1W6PB 3FC0A 5LZ6A 2B45X 1IS6A 1DGRN 4HFSA 3ZKYA 4W65A 5BNNC 2LALA 3GHNA 1GQGA 3LSEA 4BLJA 5C6CA 2EXIA 1JH5A 2CGOA 3PMEA 4GMP0 4NOTA 2B5HA 5APAA 5GZFA 5DAWA 4HANA 2ATFA 5BY5A 2YU1A 3LIGA 1DLLA 4QQOA 5IYYA 4XQDA 3OGRA 5JXHA 1HQWA 2R30A 1U5IA 3MUZ1 4W6WA 1KQRA 4OLLA 4PF1A 3MHZA 2HKXA 3VBFA 4B7EA 1AX2A 4LBKA 1B35B 1VBD1 2EF6A 2WAAA 3CZJA 3PIGA 1DLCA 2OXBA 5FZ8A 3RS6A 4XZUG 5LW9A 3NAPB 1VBA1 4D6RA 4QM9A 5A80A 4D7SA 2A75A 4CUAA 2VXRA 4OMDA 3KGZA 4LJHA 4BQ3A 5JCTA 2BW8A 4CRQA 2WSVA 4CCDA 1BBT2 1V6MA 1DDLA 1VBE1 1MZFA 1LHNA 1W9YA 2JDMA 2VGDA 4GB31 3W9AA 4I0AA 4DXTA 2VQAA 3E5QA 2GNTA 3EMRA 2EAKA 2F4LA 4PLOA 4P5YA 4TXWA 4Y4YA 3TNPB 1AR93 2ES3A 2QQLA 4K9SA 3FUQA 3APBA 1E5HA 3AP9A 4INDA 2WNVC 2LS6A 4XOGA 5C4WA 4AQ2A 3OGVA 1GP4A 4OI0A 1DG6A 1X9TA 1FMD3 3BKZA 3ILRA 3GYDA 1DZQA 4PI2A 4XTPA 1OBNA 4AI3A 4GA9A 2X53S 1J1LA 3FMGA 2JX9A 5GLVA 5GLWA 4C0HA 1X50A 3KSCA 4J1WA 5DAXA 1NAEA 4ATEA 2JDHA 5H9RA 5ABJB 2A73B 4ZPIA 3FN9A 2OYZA 3IPVB 2JKXA 4YW3A 2UU8A 5CEHA 3OD4A 2YU2A 3WG2A 4XW3A 1JMUB 4YVWC 5C8CA 5I0SA 5FZOB 1CONA 1IKPA 2PHTA 1DFQA 4C8DA 3MICA 3ZPYA 3ILNA 4O65A 1RUF2 3RZJA 3WY6A 3SKJE 1RGSA 2W92A 2Z2SB 1UU5A 1APNA 2WBKA 4UT5A 1YI7A 3HJRA 1W6MB 1D0GA 3T0BA 5CFCB 1G9AA 3MEPA 1AVBA 1Y7BA 3FLTA 1NZCA 3ENRA 1LU2A 1ND2B 3N7LA 1UYXA 4LHNA 4DUVA 5K9YA 1DQ5A 4CDUA 1CX1A 4GWNA 3VL8A 4JGZB 2D5HA 5D8AA 4A6SA 1W04A 1NQDA 2OIIA 2P37A 2ARAA 2XOMA 1O8PA 3B7MA 1ZVFA 2GP5A 1EV12 3ALQA 3WDWA 2VW1A 3B01A 2VZQA 1W9WA 3Q8FA 2BGCA 5FZDA 1PO23 3EYPA 3MF9A 2Q1FA 3AMQA 1SLTA 2NPIA 5FLJA 4KBBA 1UZWA 1DP0A 1AR81 1JYVA 2ENRA 1D2QA 1XYOA 3U10A 4QKBA 5F3IA 5FLIA 4GH4C 4XVHA 1JZ5A 5FTTC 4NRQA 5EXOA 3C7GA 2R072 3ACFA 3ZIXA 3MV01 2TBVA 3VBHB 5C70A 4TN7A 1OLQA 1X8MA 1AL23 2VR4A 2XVGA 2ZEYA 1ZBE3 1ZBA2 3POWA 3ROUA 3AM2A 3G6JB 4DQAA 3M3CA 4ASMB 1WD3A 2ZS6B 4BXFA 3K2OA 4DS0A 3I8TA 4BOWA 3R4UA 1BCXA 2WT2A 1YI9A 2IC1A 2D3PA 5FUIA 1OQEA 4EN7B 4YZ3A 2BNOA 3MIHA 5A1LA 1HB2A 3THTA 3WP5A 5LY2A 5C3QA 5T55A 5FK7A 3K77A 3B93A 1B09A 5IJRA 4DUWA 2W1WA 4UYBA 1LRHA 1RHI3 5JXJA 1B35C 1PX4A 3M1HA 4MGSA 3CF6E 2GH2A 4TYSA 4HK8A 1HN1A 1HX6A 5FPBA 2W08A 3NAPC 4JDMA 4FPYA 4F83A 3O1RA 2X29A 1FPN3 3K4AA 1PNGA 4CUCA 4LBLA 4MADA 1NY72 4YSFA 1QOSA 4WM7A 3CU7A 2D93A 4IEUA 1OLME 5HBAA 1OLMA 4FTBA 2VCAA 3USUB 1XNAA 2YFZA 4GZ9A 4UW3A 4XQ4A 5EHDA 3AVRA 3I7DA 4CDXB 1LKNA 2W0XA 2ZOEB 3DECA 3QACA 2VTXJ 2VOXA 2V4VA 2BFUS 4XFIA 4CCLA 1LB2A 1YYNA 5K0UA 5T50A 3VKLA 3FUOA 5JR2A 2VH9A 3JBG2 5A32B 3VBUA 1Z7S3 4A7KA 2VMIA 2VVFA 2C5DA 4QX5A 3VLBB 1VALA 1DF0A 1S0DA 3OYWA 3M3IA 2OZJA 1J59A 5ABJC 3WF4A 3LOBA 1W8NA 2VUJA 2W91A 2ZGMA 3JU9A 1OQ1A 4Y24A 2A5ZA 1GV9A 3IMMA 4XDQA 3H0OA 3N9MA 4HK9A 4CPBA 4OHVA 3ZYFA 5LATA 1CD3G 1CZVA 3DPRA 3I2GA 1XYNA 1RUG2 3POGA 1JYWA 3HMYA 1IS3A 4P9YA 4RR3A 4XFCA 4MLOA 3VKOA 2FCVA 5FZEA 5A33A 3OBZA 3HWJA 2WO1A 1FOD1 2RJ2A 5FYTA 4OQ9A 1S0BA 4IGOA 4LBMA 3HIFA 1PIV2 5E1RA 5CIRA 3D6EA 3PU3A 1W39A 4PQ9A 5CFCC 1CGPA 1K42A 4Y26A 1LESA 5C5TA 2WINB 5I93A 1ND2C 1VBE3 4YW1A 1UX7A 1W8TA 4KNCA 4QM8A 3N36A 4JGZC 1WLCA 4R9DA 4C91A 3BPZA 1ZA4A 2Z69A 3ES1A 1W0PA 3SEEA 4KBZA 1BEV2 4N53B 1PK6A 5LEKA 1C28A 2QTWB 4IEOA 3GJBA 4G9SB 4LBQB 5FREA 2W1UA 5C9AA 4H14A 2ORZA 4DNYA 1OOPB 1LTEA 3OUJA 4KWUA 3Q9OA 4HT1T 2HWB2 2VE1A 4QX3A 4FTSA 2ZGPA 2PYTA 2Y60A 5DAQA 2WJSA 2ADEA 2W3JA 4NAMA 3O1VA 2HEYF 4XYXA 4YM2A 3E97A 2XJTA 5JI7A 5D1IA 3POEA 4E4DX 4ZHNA 4H2AA 5BNPA 5CADA 4PI0A 1JYCA 4XQWA 4C0BA 1ZYBA 1REDA 3ILFA 5K7PA 1RL3A 3UT0A 3A23A 5A3UA 4Q4X1 4BQ4A 1V6IA 1YC61 3VBHC 3ON7A 4AVTA 5F37A 1GQHA 2RS11 2QDNA 2DDUA 2JE8A 4N43A 5FY4A 2WRAA 1IG0A 5FZ0A 3T2QA 3ZN4A 3NKGA 4GD4A 3T2TA 1UU4A 1UYZA 1FMD2 4MXWA 3UESA 1GFF2 4Y1UA 2VQTA 1NZIA 2VZSA 2A6YA 3VZJA 2XBO1 4YARA 5I91A 2A1XA 2XVLA 4RHV3 4CSWA 4HSLA 1JN2P 1U5YA 4I09A 4PLNA 3GM8A 4RGAA 1I6XA 3T4HB 1VE0A 3OBAA 2BPA2 2VTFA 4I3GA 3CNAA 1MQTB 3WDTA 5CZKA 2YMZA 3EXUA 1ENSA 5L73A 3IAQA 4YZ1A 3T0DA 2GAUA 1TVGA 4XAEA 5E89A 1SEFA 2DVAA 2RE9A 3H1WA 5G05L 4BU2A 4PQQA 1S0JA 1UF2C 4IDZA 1CAVB 3PUHA 1HXS1 4QHOA 4R9CA 5CKQA 1YRZA 3PUIA 3LA3A 3O1SA 1GYKA 3PMSA 4LKEA 2VOKA 2RJKA 4YG6A 1PVC2 5BPXA 2ZKNA 4CCOA 2XB6C 3A21A 3UKVA 1KJLA 4QD2A 4QPGB 2C6SA 4XC9A 3IN9A 1LHWA 2ARBA 3E5UA 1UX6A 3ZN6B 3ZSJA 2J1TA 4CDXC 2D5FA 3J8F1 2PHRA 1F15A 3EHKA 5L9BA 1UL9A 3B00A 1AR83 2DWRA 4CP2A 4XUPA 4Y20A 3W20A 3WF3A 1NCQA 4CU6A 4XBLA 4JV4A 3VKFC 2J1AA 1HN0A 4D6QA 3DL3A 1HV0A 3JB4C 5FP4A 5FYHA 1PVXA 1ST8A 5AFEA 1POQA 2JWPA 2PHUA 2D6PA 5FZFA 1H8TB 3GDBA 3VD5A 3I3MA 2QZ2A 1TNRA 3NRUA 4K21A 1G9FA 2Y8KA 2YGLA 3ACIA 5A7WB 2D6LX 3AKRA 4E2SA 4M4PA 3DYMA 1ZRCA 3UGFA 2A3WA 2JDAA 3L2YA 1C8M3 1GQPA 4CTEA 2WFF1 2GC3A 4QDSA 1NCRB 1POV3 5A3LA 2EIDA 4IV3A 4N8MA 4GQ7A 1AL22 4G4FA 5FZAA 3GBWA 3INAA 3AP4A 4K3UA 1RXFA 3AKPA 3CKHA 1F2NA 3AL6A 2ZXQA 1A3KA 1CQ9A 4YW7A 2J1SA 4EYUA 1POV0 2WQ8A 4CU7A 4ISQA 4BK5A 4CP0A 1Q56A 5FZIA 3VD7A 1IQDC 2JDUA 4AZZA 4XJZA 1FX5A 1AYM3 4CEWB 4L2NA 2D43A 5LEJA 4QWNA 1W8HA 2B4KA 1EAH1 3K48A 4JVAA 5FZHA 2Q1MA 2IXIA 1QQP3 1YNAA 4N53C 2Q8OA 2QBXA 4ISRA 4YFWA 4XMAA 1OOPC 3CQOA 5SV8A 5IK5A 3NW4A 5LA0A 2V73A 1H1MA 3WV6A 1JZ8A 5JMOA 2D6KA 1V00A 5BNQA 3U0ZA 2DBIA 5DG2A 1AYN2 3OUIA 1XPWA 4GKXA 1OI6A 3WNMA 2W9XA 5KC6A 3AP6A 2MEV3 4NAOA 4HLTA 4ZS3A 2Q8EA 3UYJA 3LEMA 1NA1A 4Q8LA 5FYBA 4D94A 4AFMA 2B42B 4N9HA 1CAXA 5FZLA 4LO8A 2AC1A 3WINE 4BWOA 1MEC2 5FZMA 1OKOA 4YGEA 1S4CA 2JECA 2FCUA 4RQPA 1L7QA 3V64A 1XNBA 2ZGSA 1COV2 4P9JA 3ZPOA 5FDBA 1H4HA 4DPNA 1VJ2A 4WV8A 1RUI3 1BQPA 1VR3A 4XZPA 2QQUA 2V72A 2ZGNA 2VCBA 2Q30A 3SHRA 3ZXGA 1BXHA 4HXCA 1PGW1 2UWCA 2Y6LA 1W03A 2J42A 2GMEA 2P4EA 3W5MA 1LHUA 1JU3A 1MQTC 4JDOA 4MGQA 4ZONA 5LA9A 2GSYA 2MPFA 2ZX3A 3A0NA 3I2IA 5JOYA 2R7EB 2ZAHA 5DDJ3 3FBYA 1C57A 5EP9A 1BYHA 1Q8QA 3VGIA 3OPZA 1UOJA 3T08A 2XUMA 3POJA 4I01A 4CCEA 3PNAA 2TNFA 4C90A 3VZOA 1LOBA 1VBA2 2R041 4LITA 4QPGC 3HBKA 4FPCA 1Q3EA 1AXZA 4AI2A 4Z82A 1PGL2 2FHRA 1CVNA 1YQ6A 3RI8A 2ZAAA 4XUQA 1VBE2 1VP6A 2WO7A 4GALA 4GB32 3PVBB 5FXXA 1QJU1 2Y38A 4RGGA 1W6NB 4HKOA 3OB8A 4R4ZA 5JUVA 2CGPA 5L7OA 1ASJ1 3PJQA 5EJZB 3IT8A 1RC6A 3ZYGA 2VULA 3H8UA 2JB8A 4L92A 4LUMA 1XXNA 5LWBA 5FP8A 4XF3A 2JG9A 2XVKA 2ZHKA 3I97A 1UY3A 1OFNA 1QHDA 2FDKA 2EIGA 1H8TC 1OMIA 4BCUA 2BVBA 2C9KA 2Q5TA 4EQVA 4URAA 3ZFFB 2RM21 1GANA 4XFBA 3I4IA 3VBRA 3ZR6A 4Q0SA 4QQHA 3HEIA 1US3A 4JCKA 5IVEA 5IK7A 2NP0A 1WGPA 1LEDA 4KL1A 2IXHA 4XXAA 1J3RA 1X9PA 1CX4A 3URFA 1NCRC 4Q4V1 3VV1A 2JDYA 2WLQA 3A0KA 3ZMNA 2RR11 2ZMKA 5T52A 5IT6A 3MLJA 1DZTA 1SCSA 5CU1A 2WN2A 3ZXKA 5B4NA 1NKGA 5CG9A 3W59A 2VUAA 2VZTA 3BPSA 5AVAA 1MS8A 4RFRB 2L9LA 5HPOA 1ZZBA 1E5RA 2P3JA 2XPJA 3JQWA 2K0GA 1CWPA 4BQ5A 1IKQA 1H6XA 2OX0A 5J37A 1K5JA 4IEPA 2ET7A 2XJSA 4CEWC 1D4M1 3BTAA 2OUHA 3AYAA 3FFZA 4LMFA 5DUWA 5FY9A 1JZ4A 4OI4A 1X36A 4EZHA 4XFFA 1A8DA 4XBQA 4OFGA 3ZFGB 2WQ4A 3N9QA 1K3IA 1AHSA 1LAJA 3K4ZA 2JD9A 5JZGB 4FFFA 1HV1A 3KV6A 4W50A 4YNIA 3USSA 2ERFA 4WZCA 5J98B 1KEXA 5DAPA 1HRI1 3UJQA 3IM0A 3PJYA 3SITA 3I49A 3WQ0A 2B46X 3OEAA 5H9QA 5LASA 1MZEA 2IXKA 2J1UA 4IGQA 4IE5A 5A1AA 3KCXA 4B3NA 1RMU1 1UIJA 1HQLA 3O0VA 1RUF3 4KQ7A 5FPVA 4CA9A 5JXGA 4CEYA 1AR82 2BRTA 4AEMA 4P00B 2OS2A 4EN9B 3TEWA 3AXEA 1ULGA 1S0IA 2WA3A 2J1RA 5FYUA 3BOPA 4QX1A 2JE9A 4QKFA 2CGNA 3E6DA 3N4MA 1S2EA 3KVBA 1Q43A 1QGLA 3P3NA 2R0HA 5FMOS 4BK4A 5BNNA 5IHRA 4X6QB 1IOAA 3LGRA 4EWEA 1CZTA 3WZ1A 5D2AA 1W3XA 3A4UA 3AP7A 2OZ6A 3DYPA 4AAXA 4IESA 1ZRDA 3MBWA 4PHZA 5FPLA 2G1MA 4Y22A 5DUUA 4KU7A 3VZLA 4K20A 1XC6A 2W2IA 4Y3OA 4HN0A 3GNEA 5B2GB 3HR9A 1XRUA 2SBAA 4QXBA 4COYA 2P6CA 4UFJA 1FXZA 2B9VA 1K5MB 1DBNA 3WG1A 3V0BA 2CWMA 1OQDA 4ZXEA 3O1PA 4O9GA 2ID4A 5DUVA 2VM9A 4W6XA 5AC91 4JKLA 1DGRA 1O59A 1S2BA 5A7OA 2R073 1FNZA 1VBC1 4I0BA 4F8AA 4DXZA 4LE4A 1GOFA 3NV1A 2H6BA 1RVF1 2OW4A 2XUEA 2C1FA 5DZFA 3BGAA 1ZBA3 3IB3A 3CO2A 5KHJA 3S5AA 2RDNA 4N7IA 3HAGA 5I0UA 4LE3A 1IGOA 3WDVA 1LOGA 2HWD1 2YC0A 3RRDA 4N90A 4AHXA 4CDQB 5LRRA 5F9TA 3V0AA 4R4XA 2PAEA 4AVAA 5FRAA 2PAMA 2IFRA 2WNVA 4YW6A 4YLZA 5FZ9A 5IFPA 5FZ6A 4FPGA 4IUGA 5J36A 1TME1 4NVPA 2GMPA 3WT3A 1IZ3A 1GSLA 4IE4A 3ZFFC 2Y33A 2O8QA 3QH7A 4BJ0A 5A6ZA 2FBEA 3Q8CA 3NNGA 1AX1A 1U5ZA 2YC4A 4MV2A 1BLZA 3LE0A 2XONA 5FJKA 4NIIA 3TEYA 4AK3A 3GBGA 3LDKA 3J7LA 2XHKA 4YVWA 1C4RA 1QDCA 3OTFA 3HBZA 3I59B 1UN1A 4FQZA 4LLFA 4LO5B 2WWJA 3ZXFA 4PBPA 5JMCA 1SLIA 2NLRA 1LOCA 2QZ3A 4KWLA 1W05A 3ACLA 2WAOA 5F5IA 1ZRIA 4HN1A 2EXHA 4CU9A 1YFWA 4Y33A 4LBNA 4COUA 4KWKA 4Z1VA 3MV11 1FAYA 4YPJA 1HRV1 1PMJX 3VUOA 2XJVA 2PHLA 3ZFGC 3SCGA 5EV7A 5DDJ2 1K12A 3TEXA 3DEMA 3SCFA 4MH0E 1YUDA 1GZCA 1H2MA 5JZGC 4LHKA 1QJEA 4FPKA 2X5IB 2D6OX 3HOBA 1K45A 1N1VA 1EYBA 1XU2A 4GAZA 3TYJA 2VOTA 1I9RA 5BUVA 3T2PA 2PHDA 1CAWB 4MGKE 4JKMA 4QPIB 4H3WA 5GLUA 4GH4A 4HVQA 3OOXA 4LOSA 1PIV3 1W2TA 1UW8A 4QXCA 4UF0B 4TLGA 2IFWA 5CNAA 3WX5A 4P5HA 5FOJB 1VRH1 5F1RA 1W6PA 2PFWA 2W68A 2VZVA 2P5BA 4A45A 4B1MA 1V70A 5F7UA 4MZUA 3VKMA 4CDWB 4TWTA 5J3UA 2RDQA 2Z42A 3MW4A 1HJFA 2KD7A 4HVOA 5HXVA 2WIIB 3SNMA 2FQPA 4D7TA 1BEV3 1RUC1 1SACA 2RS31 3KQRA 4XCAA 1KS5A 3WDYA 2F4PA 4JTOA 3WQ7A 1TE1B 3B9IA 2ZX1A 2XBO2 3U75A 1FYUA 3JD71 2ZZQA 4KG0A 3TAYA 2HWB3 2D44A 3KF3A 4KGGA 1BMV1 4B4QA 5I0TA 2VD7A 2VMDA 2D6NA 2ZABA 1J3PA 1WMXA 1B35A 2ZGOA 2AEZA 3QH6A 3NAPA 1NLRA 1IPKA 2VBDA 1K5MC 2VCCA 3KB5A 4IQPA 4I0WB 4CPBD 1N1SA 4B8EA 3POFA 3WHTA 3ZFEC 1GICA 3D3AA 3I2OA 5IVJA 4JRLA 4YVSB 1HXS2 3N9PA 3WSOA 4LO4B 5GZEA 1OH4A 5A6QA 2E53A 1JXNA 1KRIA 3RZLA 3BIWE 4AFCA 1OPMA 2XQRA 5JSOA 2XLGA 3CJIC 5FZ1A 3T2OA 3TEZA 4LHLA 2HH9A 3ES4A 4KU8A 3PU8A 3L9JT 1QWRA 3PIJA 4CDQC 2CTVA 2JD4A 3EQEA 3G7DA 3T3YA 4AYUA 2R061 2ZX0A 3J8F2 1WZXA 4E8DA 1W8WA 2HEVF 3BB6A 3NVCA 3ZYJB 5C3RA 4NIDA 3UETA 2AR6A 4IV1C 4UOJA 3LDRA 1FATA 5JSPA 1KDMA 1W2UA 1G9DA 2F17A 2VZ3A 2WWUA 2XH6A 4PCRA 1O91A 1LULA 1O5LA 2WS91 1CIWA 1CR7A 3RFRA 3WNNA 1WMDA 4NIGA 3AKSA 2XJRA 5ACA1 5ABJA 2QQIA 5FZGA 1Y4WA 2XJUA 2PLV1 2QQJA 3IPVA 4FCAA 5FPZA 3D82A 3AZYA 1ZRFA 5FZCA 3H50A 5FMCA 5L36A 1PVC3 2XWJB 5FPXA 2Z5WA 1H8VA 3BTYA 1JHJA 1YFUA 3AMHA 3WUDA 4FPOB 5FZ7A 3AKQA 5FZOA 2EA7A 2VW0A 3GBFA 2E26A 4JHZA 5GALA 5G04L 5KXCA 1BJQA 2WFF2 4LQRA 5DPNA 5LB6A 1QEXA 4BIFA 2ET1A 3WF0A 4A2UA 5CFCA 1W6MA 1H30A 2MHFA 1RUD1 2YROA 3I2KA 3UGGA 4HPKB 2VZOA 4IE0A 4UFLA 1LJ7A 1XNDA 4GWMA 3GZUC 1ZZ6A 1ND2A 1C1FA 1VBC3 3CL1A 1VBB1 3N9LA 2DU1A 4JGZA 1XSRA 1CAUB 3ZXLA 4OI2A 4M01A 2W52A 4Q4Y3 3ASIA 1MS0A 4WVMB 4UBGA 4NRMA 4SBVA 3RGBA 5HXMA 1EAH2 2DFBA 3AFGA 4WVZA 2P2KA 2X5IC 1GBGA 2J22A 3VL9A 4CU8A 5HI0A 2XR4A 1AR61 4XIKA 3PUSA 5J1XA 3BCWA 5F5AA 3BIEA 4OYUA 1O8SA 4KGQA 3N35A 5KHGA 1E5SA 4OZOA 2VNOA 1XNCA 5C3OA 3ZXAC 2RS51 1LOFC 2OVUA 2ZTNA 4NRPA 2QNKA 4QPIC 1F5JA 4AQ6A 5KHKA 4ITCA 1LU1A 3VZKA 2E33A 3K3NA 2PELA 1AR71 3NV2A 4MUVA 1UY4A 4XFAA 5DQ0A 3VBHA 4NROA 4Q0QA 2DYCA 5JR7B 3WP4A 4CDWC 2WZ8A 4LO7A 1YQ8A 2CAUA 1W90A 1TMF1 1UIKA 2PA7A 3IDEA 1UYYA 3JCIA 1JZ2A 4K1YA 1LENA 3J9SA 1H6YA 5FKCA 1XE7A 4QB2A 4QAWA 1AZDA 5F3EA 2WNUB 3T09A 1RJ7A 3D0SA 1TQ5A 1AJOA 2JEMA 2PHFA 1ZNPA 1PGW2 4L0PA 2WT0A 4XF1A 3NL1A 1AYN3 1MS4A 1SDWA 5KHIA 1QH7A 1MZ5A 4JQRA 1AXKA 2YGMA 5EQUA 2Q8DA 5C71A 1V9U1 1O3SA 4NMIA 1JTZX 2R0FA 4L11A 4XE9A 4ZU5A 3THPA 4ASKA 1LGNA 1H9WA 1OT5A 4MSVA 1H9PA 1OD5A 3N7KA 4YVSC 3AMMA 1MEC3 4QPWA 4B1LA 3BTXA 4YW5A 4OMCA 3USUA 1OHFA 1COV3 2RV9A 1W6QB 1YXWA 1GKBA 2VCMA 3M3EA 3LIHA 3POSA 1HIXA 3J4UH 3KMHA 1UXZA 2W46A 4CDXA 3BN6A 4YFZA 1GWKA 2GH8A 3BOWA 4RD7A 5A3PA 2ILMA 2NMNA 3JQXA 3Q8AA 4IXLA 2BNNA 4FOWA 3I2JA 3ZIWA 5FKBA 1LGCA 1S2KA 3O1TA 4ATFA 2W1SA 2V5DA 1RINA 4BISA 1UY1A 2XMLA 3CZUA 1QJU2 5FQ0B 5A32A 4HL0A 2DBNA 1ASJ2 5FUNA 2AREA 4HMZA 2A71A 2E7QA 1ALYA 2F6BA 2PXJA 4NUBA 3M2MA 4I02A 1ZRRA 2FDJA 1T6GC 3WF1A 3EJKA 1LR5A 3DGTA 1VBD3 2RM22 4EV0A 4OULA 4R9BA 3VDCA 3H1MA 3RZKA 1PNFA 1VBA3 4MYEA 4YW4A 4N9IA 3M3OA 3B02A 3NNJA 2A70A 1W28A 3FHQA 4Q4V2 5FAXA 2V4AA 3CBNA 1PHMA 4NIHA 1WW7A 2RR12 2ZEZA 3K51A 3OEBA 2I45A 4GB33 2WZR1 4QU1A 5H9PA 3OY8B 3KF5A 3WLUA 1CN1A 2DVGA 2XJQA 4XDOA 3H1YA 3KZ4C 5FY8A 4IETA 3FJSA 2HWC1 4NJ4A 5FBZA 4FXGB 2VPVA 3I2HA 3O14A 3ATGA 3IKWA 2JDZA 4RGKA 4N53A 5L19A 3PUQA 4HSJA 3O1UA 1UOFA 2FDGA 5C33A 4LBQA 4AAPA 3O0XA 1RUJ1 1OOPA 3NV4A 4FO9A 3UK9A 1UKRA 1J3QA 4LIVA 1QJY1 4LNVA 4NE9A 3ZYHA 3KT1A 3I54A 2E51A 1BZWA 2GU9A 2YXSA 2UY9A 4BDVB 1W0OA 1YJKA 3TN91 5DXDA 1JYXA 2ZGKA 5IVCA 1HRI2 3AZXA 4X8PA 1ULPA 1UPSA 3NNMA 3ACHA 1DYOA 3MZHA 2JG8B 2I07B 4UI9L 3AZWA 4MG2A 5HCHA 2RHPA 3KT7A 3M8LA 2RMU1 4Z07A 4M00A 1L7RA 1LOEA 2ZHMA 3LPGA 2BERA 1H0BA 2OQ7A 3MIDA 1JOPA 1HB3A 2E31A 2WSUA 5CA6A 2BBAA 3I3QA 5GLZA 2FMYA 1Q5OA 2RJLA 2WNUC 4LBJA 2BZDA 2Y6HA 1VAKA 2VBPA 1D7PM 2BOIA 1GMMA 2VOWA 3AJYA 1MQTA 1UZYA 4Y4RA 4DB5A 5K4LA 3J26N 1RJ8A 4O9EA 4GKYA 1A78A 2DCYA 2ZBJA 4HONA 5KHHA 5CBLA 2A7AA 2YC2A 4FOQA 4EE2A 5FYIA 3DV8A 5F3CA 2WNEA 4NR1A 4UFKA 1CAVA 2GP3A 5FBJA 4AFDA 3F95A 1I5ZA 4M3CB 3M7AA 2YHJA 1BBT1 4Y1ZA 5ANNA 1C3HA 4F7ZA 1PX3A 5IUQA 1AL0G 3WQBA 3VBSB 2OPWA 3I3EA 1M4WA 3JXSA 4QPGA 4AEJA 5LA2A 2TUNA 1GR3A 4OQ8A 2D40A 1AXYA 2WR9A 1ZREA 1NG0A 3ZN6A 5CKMA 5AC92 1GOGA 4KI5M 1XSQA 1VBC2 3QOPA 4LO6B 1R091 1RVF2 3Q8EA 4EZ4A 4FSJA 4ORFA 3LAGA 3PURA 4Q4Y2 4V2VA 1ZZ9A 3AYCA 3LKJA 3AX4A 4Q4W1 4U36A 1OD3A 3C2UA 2WA4A 2AEYA 2WYSA 5JIAA 5DN2A 1V6NA 2HWD2 1YCIA 4LK6A 5IAVA 1CIYA 3AXDA 3NV3A 1W2AX 2ZJCA 3LPFA 5T5OA 1W6OB 5DZEA 1H8TA 3NJXA 4UW6A 3VZMA 4XF0A 1TME2 2BQPA 4GIQA 1QXRA 2P34A 5A7WA 1MS9A 3KWVA 5CYYA 5DZGA 3P5BA 3WUCA 4YM0A 4AW7A 3WW4A 2JKBA 2DUPA 2VW2A 4SLIA 3E6CC 3PVEA 2LM3A 3AKTA 4P08A 1NCRA 2QKDA 3FZ3A 4Y1VA 4XILA 4Y1YA 4Q5OA 4DFSA 3UNPA 1FT9A 3WNLA 4FT8A 3V65A 1NQJA 1UY2A 1V9U3 1W8UA 5JPNB 1YO8A 3H8XA 3WOGA 4XJWA 2G9FA 4ARXA 1XNTA 4JGYB 3ZDSA 1WLDA 1S0FA 2UWAA 2QQOA 1EUTA 1W3VA 5FZKA 1QJX1 2XGXA 2YBKA 5TSWA 4CEWA 4R8HA 1DU3D 1URXA 2HEWF 4PBOA 4EN0A 1QOOA 2RDRA 3C7EA 3H3LA 1DCSA 5JVVA 1W9SA 2R16A 3HNYM 1J84A 4L97A 5CKNA 4RSUA 2AACA 1PK6C 3SMHA 2DVDA 4NHLA 1LNSA 2WDBA 5ERLA 2XJPA 2CWSA 1ZZ8A 1TZOA 2VQ0A 4Q0UA 3ORJA 5FOBB 1FI2A 2AH2A 1V6JA 2VTXA 4DXRA 3PHMA 5E16A 1RUE1 1SLLA 3E1F1 1NYWA 1W9FA 4OHZA 4A4AA 5JOWA 5IK8A 2JG8C 5K8SA 2PHWA 3B9CA 1FOD3 1JOJA 1U0AA 3MW2A 2ZACA 3ZXDA 1PO11 4COWA 3THCA 3H8RA 2QE3A 2DCJA 4WM8B 1VRH2 4AQTA 1OA4A 1MZ6A 3RNSA 3SQOA 5JWPA 5FMBA 1VB4A 3H9AA 1QJZA 3GCXA 3LEKA 4M0NA 2DV9A 1H1AA 1JOBA 2WZR3 1HB1A 2JE7A 2ZGUA 4LXLA 2VAUA 3WNKA 2EIEA 1WBLA 2D98A 1GP6A 1O4TA 1RUC2 3MPPG 1RUH1 2RS32 4CCNA 4YZ5A 1PGSA 1VBD2 4FOVA 5CVRA 3JD72 1G7YA 4DIQA 5JOZA 1ND3B 5FR3A 1BMV2 4YZ2A 4RN5A 4QQLA 1YFXA 4RS5B 4X8NA 1NY71 4XACA 4E8CA 1F4AA 1AUYA 1W2NA 2E63A 3MIGA 5FP7A 3VBSC 4XMIA 3KT4A 1Y43B 2BYVE 1S0GA 3KHBA 4YGDA 2O8OA 3ZYPA 3DXTA 2HLEA 4CCKA 3ME2A 2XDVA 2GNBA 4Q4X3 1LECA 2DUOA 1DIWA 4LKFA 2YYOA 2KM2A 2RS13 5A3OA 3MFCA 4LIUA 4BXSV 1W6NA 4JTNA 5CFDB 3JBG1 5E6HA 4UFIA 1HLCA 2RDSA 4IEZA 2JDNA 4XJUA 1QNYA 2HWF1 4OHWA 4AXOA 2R062 2NMOA 2ZA9A 2XBO3 3R4DB 4CCCA 5FWEA 4D8MA 3WNOA 5B4XA 1IS5A 1VRBA 1N3PA 4HG6B 3ZFFA 4WVVA 1OUSA 2WS92 1NE6A 3PTYA 4GWIA 4HBNA 1CJDA 1Q8VA 3PLQA 1RUG1 4QXKA 3ZKUA 3QBQA 2QQKA 5ACA2 2HWE1 5A7SA 4G3YC 1H2LA 1YEWA 1HXS3 3OGJA 4GMP1 3WP6A 2PLV2 5FZBA 4TZDA 3C3VA 1SBEA 4XEZA 4AFAA 3UV9A 4R52A 3C8XA 2RG4A 4MX3A 1DQ0A 1WCUA 3MIBA 1PMIA 4JGYC 4OUEA 3J8F3 2XL9A 4S2FA 4K8FA 3M70A 2E6VA 2QCSB 1RUD2 3I2DA 4H55A 4QKDA 1R1ZA 4FPJA 4QU2A 4AEDB 3HPNA 2EXKA 3NMBA 4OHYA 3V56A 4XURA 1XE8A 1VBB2 1GUIA 1X7NA 1I3HA 1QNWA 1WCKA 3ZFGA 2Y26A 4A7ZA 1QIQA 1YQCA 4QKNA 3FFQA 1UU6A 4NIAA 3T1MA 5JZGA 4MO3M 3VHOA 3WD5A 3GALA 2BU9A 3K4DA 4TLFA 1N3QA 5EZWA 3AJZA 3OSDA 3Q8BA 2GDFA 1GWMA 4LLOA 4EN8B 4JRAA 1SFNA 1F8VA 1JS9A 3MGUA 3AB0A 3UL2A 1R081 2WFF3 1UCXA 4ONUA 4RL7A 1ZZ7A 2NM1A 2VVDA 4AF9A 1W06A 3NO8A 3BI3A 2DFCA 4DZGA 2RS52 1VPHA 1AR91 1WLWA 3D4KA 3FWEA 1JZ3A 2IZWA 1DQ4A 3LWCA 3AL5A 4XBNA 5D21A 4NWWA 3NNLA 1MS1A 4Q1RA 3R0RA 4WM8C 1FMD1 1S0EA 1GU3A 3WXPA 1AJKA 2CL2A 5JOXA 4OZXA 2N7GA 5GZGA 5FUPA 4DXSA 1QY4A 4Q26A 1TMF2 4LOTA 1W9TA 3FX3A 1SLBA 5GM0A 3OGGA 3S7IA 3NKTA 1EAH3 1Y3TA 1UY0A 3GZEA 3NNFA 3PL0A 5SV5A 3TBDA 3WG4A 5A1FA 2G9ZA 2BBVA 4JC1A 4NO4A 1XNKA 1ULOA 4ZY9A 1NUKA 3ZFEB 3ZOIA 2YB7A 5F6KA 4AHYA 3W5NA 4UAPA 3RZZA 1ND3C 3FBMA 1QKQA 3ZSMA 4K6BA 3U11A 4AL9A 1ZX5A 3S7EA 2DVBA 3LEGA 1K5MA 3B94A 4RS5C 4CE8A 3U14A 3FL7A 5CISA 3CJIB 2CV6A 3ZR5A 4QQ2A 3LDBA 5BNOB 5BV6A 1V9U2 2ARXA 3VDDB 5JPMB 1SPPB 4KMQA 4LTAA 2E7AA 2O1QA 1JYTA 4PDWB 1NE4A 4I3PA 4ZZ8A 5ANQA 1LHOA 3DN7A 4I30A 4XF9A 3ZXEA 4IV1B 4XPVA 3D8CA 4AVCA 4CDQA 4IEVA 5CFDC 3BU0A 3RWNA 1S55A 2VZPA 3OBRA 4JQTA 4EJRA 1MS3A 3WF2A 1JUIA 1SDDB 3KM5A 1JZ6A 4BB3A 1PO21 4EN6B 1PO13 3POYA 2SLIA 4AHWA 2I2SA 2HBTA 5LK7B 5FYVA 2BGOA 4BMEA 3O0WA 1C1LA 1UZ0A 2XG3A 4Q29A 1GZ9A 1QOTA 2PTMA 2GC2A 3VHPA 4P14A 3N9OA 3GCWA 1UNBA 2QDRA 3HT2A 3RSJA 1GOHA 3P6BA 2C0ZA 3NJVA 5F39A 1JHNA 1PZ8A 1GZWB 1SZBA 2V5YA 4QPYA 3I59A 2KR2A 2C26A 2WABA 3P3PA 4ZS2A 1ZBE1 1I1EA 2IXCA 1FOD2 2Y0OA 4V1PA 5GZCA 4Y5TA 5I0DA 1OUXA 1GZTA 2R043 5IAXA 5A3WA 1QXPA 2J1VA 3GXUA 3NSTA 4FPEA 3LA7A 1DZRA 3BYWA 4O61A 4LORA 4PIYA 3WQ1A 1O3RA 4WBBA 2DF7A 4IEWA 4AVBA 4UW5A 1QMJA 2CDOA 1YQ5A 2WZR2 3T30A 1QJU3 4URTA 2ADDA 1XBFA 3OBTA 1VB2A 1ASJ3 4AEDC 4JAAA 3VHRA 2HWC2 1RHI1 2IVJA 5KBFA 4BQXA 3ELNA 1SLAA 2PN5A 3VBOB 5KWRA 3KV9A 4QGLA 2EALA 2WO2A 5EYYA 4BIOA 4M4RA 3ZX7A 1FPN1 5J09A 2OT7A 1LHVA 2B39A 2X5IA 2ZCWA 4YYOA 2GC1A 2GC0A 4XTMA 2RM23 4FXKB 2R32A 4DOUA 5FYMA 4XJ9A 4A44A 1RUJ2 2WT1A 1JBCA 1QJY2 1R1A1 2KA3A 5AVPA 4M3CF 1LOFA 5CAZA 3HT1A 2NZ9A 1CAWA 5FY5A 1NLQA 3K46A 2LROA 5L9RA 2ZHNA 1DYPA
chains in the Genus database with same CATH topology
2RR13 3RYKA 1SQ4A 4MVTA 3TN92 2RS12 1J58A 2EXJA 4HZFA 3T1LA 2YDEA 4JDNA 4CDWA 4HETA 1O7FA 1Z7S1 3WG3A 1OLRA 2RMU2 4AI0A 1Z78A 4PIXA 4BHPA 1X33A 1S1AA 2YY1A 1D4M3 1LODA 3O5SA 4NHKA 3VBFB 2WC2A 4AHZA 4J6GA 1V6KA 3SH4A 2E7TA 1CESA 2JJ6A 3FLPA 1LOAA 4J1XA 3SISA 4AE2A 3W58A 2DU0A 4S2DA 4PLMA 4ZXKA 3IDCB 1DQ1A 3IWZA 1HRI3 5BNOC 4AEKA 1HDKA 2ZMNA 1VIWB 3VDDC 4ASLA 4YVSA 1PGL1 1RMU3 4PDWC 1UKGA 2KXLA 2PQQA 3LA2A 4MGIE 3MIFA 3KCYA 2VNRA 1Z0HA 2D6MA 5C4WB 1RUOA 1R083 1H1IA 4P9GA 3KD4A 1R092 3LSDA 4Y1XA 1WW4A 3B69A 4IEXA 4X6RB 1HQNA 4Q4W2 4FPHA 1ENQA 3AMNA 1ENXA 3M3QA 4K1ZA 2WWSA 4S2GA 4LBQD 2A3XA 4FOYA 5KXDA 5LK5A 4K7JA 5C8CB 1Q8PA 1RIRA 3GF6A 1MVQA 3KGLA 3ETQA 2A6VA 2D97A 4PIZA 2FMDA 1HW5A 5T54A 3TRSB 3H3UA 1G9CA 4LULA 5AC93 2VVEA 4E4SA 2PHXA 3MYXA 3KCCA 1YHFA 4HKLA 1IQAA 1RVF3 2D3SA 4PJYA 2JXAA 3RJ2X 2AZ5A 4RHV1 3MIEA 4CDUB 2K9ZA 3HN1A 4HPKA 1C8NA 1WBFA 4E9KA 5D8AB 1PZ7A 2QFEA 3HD8B 5T5LA 1QU0A 2HWD3 3D5OA 2ZX4A 3R6SA 5KC5A 1F31A 1CAUA 5T5JA 1WMEA 2R6QA 2YV8A 2C9AA 3QD6A 1TME3 4WVMA 3VBOC 3WCRA 1QJX2 2UYBA 1KITA 3L2HA 4LEJA 1KDKA 4YM3A 1GNHA 3EBRA 5FO8B 1F9KA 4DINB 3AFKA 1V6OA 2E9QA 4P9LA 5I8SA 2FZ2A 1YIFA 1OA2A 1RB8G 4E2QA 3BALA 2ZMLA 4N7UA 4B4PA 4Z8BA 1YFYA 5I0RA 3ST7A 4OI1A 4AG4A 4FPFA 4RFT0 1RUE2 4AI8A 2WQZC 2ZZJA 2B8MA 2AUYA 2Q1ZB 1IPJA 2FZ1A 2K2SA 2ZGQA 2OPKA 3OD0A 4LA3A 1MACA 1PO12 2BUKA 2DURA 4AFBA 4EWDA 3H7YA 1AF9A 2WNUA 4XHXA 2DVFA 3MF6A 2R49A 1HRV3 3VBFC 4DY3A 3H3ZA 1N3OA 1C8M1 1Q8OA 1QXJA 2QUOA 1WD4A 3UKTA 1POV1 3M4FA 4UXAA 3FLRA 3IBMA 4A3XA 4I2OA 4LT5A 4QQPA 1RUH2 2GZWA 4WM7B 2I74A 3MDPA 5JDBA 3ZVXA 2R042 4D3WA 1DGWA 4YG0A 2UURA 2XWBB 1IHMA 4Q1PA 2QQPA 2NN8A 1W6QA 2VECA 1BKZA 1CJPA 1QH6A 5K0UB 1AYM1 4Q4X2 2CYFA 1R1A3 1VRH3 3KLSA 2AYHA 5C4WC 1QQP1 3MI8A 3RG0A 3VBUB 4IEYA 5KXEA 1O5UA 1XQNA 5FQ0A 3DF0A 4ES8A 3OYWB 5A3MA 1RUC3 2WL1A 2RS33 5E8AA 2X8KA 4META 1F5FA 2A6WA 2HWF2 3MW3A 4PF5A 5EJ3A 2MEV1 3ZYRA 2XL7A 3DPRB 3JD73 1RUNA 3VHNA 5C8CC 4RR3B 1UZZA 1NLSA 2WKKA 1UAIA 2BTVC 4NPRA 5A33B 2H0VA 5JLVA 2DCTA 5J96B 3ZXJA 1G8WA 2VG9A 3JB8A 2HWE2 3AK0A 2ZPXA 3OJBA 5EYXA 3WW1A 4KWJA 1RUI1 1Y9QA 2O0OA 4YG3A 1OFSA 2CNAA 4Q2FA 3OY8A 1EPWA 3N7MA 2QVSB 4CDUC 1A6CA 2Q0AA 2V09A 4LR4A 5D8AC 1D4M2 5JAXA 1DHKB 2R063 1PK6B 4FPLA 3E6BA 3S30A 3X29B 5C9AB 4EWAA 5I8YA 5DDJ1 1VAVA 3O7OA 4C1WA 1KD7A 1X8EA 1YWKA 3WR0A 2WS93 1REFA 2GALA 1ULDA 3DUIA 3NJZA 4XJAA 1NXD1 5ACA3 1E57A 1LCLA 5BNPB 1PZ9A 4AGGA 2R1BA 2PLV3 3MLKA 4XETA 1RMU2 2GMMA 4AVVA 3R05A 1OKQA 3SXWA 2EAAA 2MNGA 1G6NA 1ZZCA 4N43B 2W39A 4COZA 2JG8A 2ZX2A 3IDBB 1R082 1DQ6A 1ULEA 3WDUA 3SH3A 4MXWB 2BWCA 4FAHA 1AR92 4YRDA 4XFHA 2DCZA 1RUD3 3ZN5A 3VN4A 2IXJA 3CLPA 4NHMA 1VBB3 3GZAA 4S2HA 1VLNA 1MR5A 4FVVA 3SCHA 3U07A 3AZVA 2Q4SA 5KXBA 5BYNA 4KH9A 1YIPA 3D0JA 4R9AA 4XJ8A 4COVA 1WLTA 4WM7C 1AR63 3GZTB 1O3TA 3UJOA 4M3CE 2BFUL 3PVNA 4M3CA 4C1XA 5BXXA 5AFBA 3VKNA 2ZGLA 2RS53 3VBSA 5GKAC 1IS4A 3RI9A 1QF3A 4YGCA 3N7JA 3RPQA 2IXLA 3PVOA 5HCBA 4FP2A 5K0UC 4Y20B 1NCQB 1AR73 1XYPA 2P3KA 4MGZE 4FQ4A 3VBUC 2H0BA 1KFXL 2XLAA 1TMF3 3LZZA 4BA6A 4B29A 3RDIA 1O4YA 4Q0VA 5CB7A 4E2GA 3CEWA 4CYDA 1L3JA 1W6OA 4MGYE 2VY0A 3DPRC 2ZGTA 1PO22 4NWVA 4OUSA 4RR3C 1SFYA 1NOVA 2EVXA 1RUF1 4IV3B 4UW4A 2AGSA 3TB0A 4B4RA 1FV2A 1V6LA 5F6LB 4BMBA 3OCPA 2NQYA 1AX0A 4YGBA 3MLLA 4ZKTB 4Q0PA 1QDOA 4BZ4A 4XFGA 5T3NA 1ZBE2 2A6ZA 4YM1A 5F5QA 4Q8KA 5FCCA 3DKWA 2OUJA 4JGYA 1EV11 4FP3A 4YW2A 1HRV2 3RMXA 4XXPA 2WFPA 4E4ZA 3GHMA 3RYRA 5C9AC 4IEQA 1DYKA 3ECQA 2ZKLA 1KJRA 2UY8A 2UYAA 1X82A 1RHI2 2G4IA 4EROA 4OHXA 3WW2A 2R071 2P3IA 2Y0IA 1FPN2 5EFUA 5BNPC 1ONAA 1Q8SA 1NA1B 5GJ6A 4FTEA 1CAXB 1ZBA1 3JUUA 5H9SA 3WHUA 1DGWX 4RQPB 2VNGA 4QGNA 1R1A2 1U12A 3JZVA 4N43C 2JICA 1U5XA 1O3QA 4LBOA 4IL7A 2A3YA 1H2KA 4K40A 4WZFA 1EP0A 3OF1A 3E5XA 4QMAA 3TNQA 4WM8A 3WCSA 1G9BA 5FLHA 4AVSA 1N47A 1N1TA 2HWC3 3AZZA 3IIAA 1Z7S2 3VZNA 5E88A 5HCFA 1J1TA 1JUHA 3QCWA 3ZO0B 4BM8A 1TEIA 3FE5A 4GXLA 1CPMA 5JI9A 1RUJ3 4YZ4A 4QPIA 4AGVA 1ND3A 1QJY3 2GNDA 4M0HA 5I8TA 5FFOC 4RS5A 4LUKA 1S0CA 3TN93 4CZSA 1EPZA 2DUQA 2WLPA 1WW6A 1WCSA 1WUVA 1OSGA 4FBFA 4NN0A 1D4VB 1FNYA 1LEMA 1NCQC 2VOVA 5L7OB 3AP5A 4Y5Z0 1REEA 2RMU3 3AYEA 5CFDA 3B3QE 1KFUL 2JG9B 4TSVA 2D3RA 2QJVA 4P9IA 4RA0A 3VBRB 2XKPA 2H6CA 1BVP1 2VU9A 4F3JA 4L99A 2ZGRA 3R4SA 5LRSA 4IV3C 1PIV1 2NYYA 4QHBA 4A7YA 4DMIA 4DY5A 2GN3A 1VAMA 3WW3A 1BBT3 1TNFA 3O12A 4XHBA 4H7MA 1BVVA 4BH9A 2AENA 3SLIA 3ZSLA 1BEV1 2VMHA 3WDXA 1D0HA 1R093 2P17A 4RHV2 2CY6A 2HWB1 3BODA 1XU1A 4Q27A 4Q4W3 4AEDA 2Z79A 4BYYA 4AQSA 1WCDJ 3RMYA 3ZSKA 3TOJA 1AR62 1CPNA 4DRVA 1BK1A 2BVVA 1DGLA 4Z92B 1OPOA 4Z2WA 2WZPP 1NA1C 4XF4A 4AGRA 5FO9B 1PM7A 2DCKA 4CEYB 2TEPA 4E27A 2D7FA 2UWBA 5JSRA 4RQPC 3HQXA 2XLFA 4CP1A 1AR72 2G9GA 2IWGB 4IERA 1D2SA 1EY2A 3WP3A 5CG8A 5BNNB 4OUMA 5FO7B 3CJXA 3SH5A 1UD1A 3BU7A 1ENRA 3RJRA 5C8WA 4L8QA 4Y22B 3S6PA 4BLIA 4DRRA 2XKOA 5JIUA 1QJX3 1GNZA 2B9UA 1C5IA 3LCPA 5DUXA 4HKWA 3N3HA 3NWKA 1KS4A 1EV13 1PVC1 1SLCA 3WNXA 3TWIA 1H4GA 3ZFEA 2DTYA 3V0BB 4GULA 2BEOA 1C8M2 3RQ0A 2YZ4A 2LUWA 1YJLA 1JW6A 4MXVA 4ES9A 3MFAA 1RTVA 4XIOA 3CJIA 5BNOA 1SMVA 3VDDA 2DTWA 3AMPA 1MVEA 3LB9A 4D69A 1RUE3 1WA4A 2BWAA 4U2AA 3RYPA 3ZSEA 4PDWA 4WVWA 3V0AB 5IK4A 3H7JA 1LGBA 5L7OC 5GZDA 4IV1A 3IMNA 4Q4Y1 2WNVB 4QT6A 2BNMA 2GNMA 1RITA 2YUEA 2JG9C 4P9WA 1AYM2 4OVEA 2LTNA 2OA2A 1QQP2 1ULFA 4W6YA 2VMGA 1SCRA 3VBRC 1C5HA 4AI1A 3ZMOA 1SBDA 1DQ2A 1JYIA 3ZYIB 3QLQA 4P9XA 5GLTA 1GLHA 2PAKA 1G86A 1RUH3 1AL21 1SBFA 3FHIB 4YVWB 2MEV2 5HCAA 4HVRA 1HKDA 1MS5A 2CAVA 2HJIA 2R1DA 1GZWA 4FAGA 4UBHA 4ZU7A 2ETEA 4L9BA 4BE3A 1WW5A 1RUI2 3MPBA 3B5LB 1WMFA 2B7YA 1ULCA 3U4XA 5EWSA 3LOIA 5J48A 2ZHLA 2JENA 1KXGA 3JBG3 4ZU4A 5DG1A 1UMZA 1AYN1 1N1YA 1UPIA 2HWF3 4LA2A 4KG8A 3VBOA 1H2NA 4B7KA 1O4ZA 2A6XA 3UKNA 3KS7A 4AWDA 2YPJA 4BPZA 1MEC1 3S0MA 4D7YA 3EO6A 1OA3A 1ZM1A 2GN7A 2HYKA 4H7LA 1COV1 5J7MA 1RUG3 1M06G 1A8MA 4GH4B 5T5PA 4CEYC 3WVJA 1NXMA 1FV3A 4BQ1A 2HWE3 1YLLA 4GMP3 4QGMA 5FMOL 3AYDA 1W6PB 3FC0A 2B45X 1IS6A 1DGRN 4HFSA 4W65A 5BNNC 2LALA 3GHNA 1GQGA 3LSEA 4BLJA 5C6CA 2EXIA 1JH5A 2CGOA 3PMEA 4GMP0 4NOTA 2B5HA 5GZFA 4HANA 2ATFA 5BY5A 4QQOA 1DLLA 4XQDA 1HQWA 2R30A 1U5IA 4W6WA 1KQRA 4OLLA 2HKXA 3VBFA 4B7EA 1AX2A 4LBKA 1B35B 1VBD1 2EF6A 3RS6A 3NAPB 1VBA1 4QM9A 4D7SA 2A75A 2VXRA 3KGZA 5JCTA 2BW8A 4CRQA 2WSVA 1BBT2 1V6MA 1DDLA 1VBE1 1MZFA 1LHNA 2VGDA 4GB31 3W9AA 4I0AA 2VQAA 3E5QA 2GNTA 2EAKA 4PLOA 4Y4YA 3TNPB 1AR93 2ES3A 4K9SA 3FUQA 3APBA 3AP9A 4INDA 2WNVC 4XOGA 5C4WA 4AQ2A 4OI0A 1DG6A 1FMD3 3ILRA 3GYDA 1DZQA 4XTPA 4AI3A 4GA9A 2X53S 1J1LA 3FMGA 2JX9A 5GLVA 5GLWA 4C0HA 1X50A 3KSCA 4J1WA 4ATEA 5ABJB 5H9RA 2A73B 2OYZA 3IPVB 4YW3A 2UU8A 3OD4A 3WG2A 4XW3A 4YVWC 5C8CA 5I0SA 1CONA 1IKPA 2PHTA 1DFQA 3MICA 3ZPYA 3ILNA 1RUF2 3WY6A 1RGSA 2Z2SB 1UU5A 1APNA 1YI7A 5CFCB 1W6MB 1D0GA 1G9AA 3MEPA 1AVBA 1Y7BA 3FLTA 1NZCA 3ENRA 1LU2A 1ND2B 3N7LA 4LHNA 5K9YA 1DQ5A 4CDUA 4GWNA 3VL8A 4JGZB 2D5HA 5D8AA 1NQDA 2OIIA 2P37A 3B7MA 1ZVFA 1EV12 3ALQA 3WDWA 2VW1A 3B01A 2BGCA 1PO23 3MF9A 3AMQA 1SLTA 2NPIA 5FLJA 4KBBA 1AR81 2ENRA 1D2QA 1XYOA 3U10A 5FLIA 4GH4C 5FTTC 5EXOA 2R072 3ZIXA 2TBVA 3VBHB 1OLQA 1X8MA 1AL23 2XVGA 3POWA 1ZBE3 1ZBA2 3ROUA 3AM2A 3G6JB 4DQAA 3M3CA 4ASMB 1WD3A 2ZS6B 4DS0A 3I8TA 4BOWA 3R4UA 1BCXA 2WT2A 1YI9A 2IC1A 2D3PA 1OQEA 4EN7B 4YZ3A 2BNOA 3MIHA 3WP5A 3THTA 5T55A 3B93A 1B09A 1LRHA 1RHI3 1B35C 3M1HA 4TYSA 3CF6E 2GH2A 5JOWA 4HK8A 1HX6A 2W08A 3NAPC 4JDMA 4FPYA 4F83A 2X29A 1FPN3 1PNGA 4LBLA 1NY72 4YSFA 1QOSA 4WM7A 3CU7A 2D93A 4IEUA 5HBAA 4FTBA 3USUB 4UW3A 4XQ4A 3I7DA 4CDXB 1LKNA 2W0XA 2ZOEB 3QACA 2VOXA 2BFUS 4XFIA 1LB2A 1YYNA 5K0UA 5T50A 3VKLA 3FUOA 2VH9A 3JBG2 5A32B 3VBUA 1Z7S3 4A7KA 2VMIA 2VVFA 2C5DA 4QX5A 3VLBB 1VALA 1DF0A 1S0DA 3OYWA 3M3IA 2OZJA 1J59A 5ABJC 3LOBA 3JU9A 2VUJA 2ZGMA 4Y24A 1OQ1A 2A5ZA 1GV9A 4XDQA 3H0OA 4HK9A 4OHVA 1CD3G 3DPRA 1XYNA 1RUG2 3HMYA 1IS3A 4P9YA 4RR3A 4XFCA 4MLOA 3VKOA 5A33A 3HWJA 1FOD1 1S0BA 4LBMA 3HIFA 1PIV2 5E1RA 5CIRA 3D6EA 4PQ9A 1W39A 5CFCC 1CGPA 4Y26A 1LESA 2WINB 5I93A 1ND2C 1VBE3 4YW1A 4KNCA 4QM8A 3N36A 4JGZC 1WLCA 4R9DA 4C91A 3BPZA 1ZA4A 2Z69A 3ES1A 1W0PA 5LEKA 1BEV2 4N53B 1PK6A 1C28A 4IEOA 4G9SB 4LBQB 5FREA 5C9AA 4H14A 4DNYA 1OOPB 1LTEA 3Q9OA 4HT1T 2HWB2 4FTSA 2ZGPA 2PYTA 2WJSA 2HEYF 4XYXA 4YM2A 3E97A 2XJTA 5JI7A 5D1IA 4E4DX 5BNPA 5CADA 1JYCA 4XQWA 4C0BA 1ZYBA 1REDA 3ILFA 5K7PA 1RL3A 4Q4X1 1V6IA 3VBHC 4AVTA 1GQHA 2RS11 2QDNA 4N43A 3ZN4A 3NKGA 3T2TA 1UU4A 1FMD2 4MXWA 1GFF2 4Y1UA 2A6YA 3VZJA 2XBO1 4YARA 5I91A 2XVLA 4RHV3 4HSLA 1JN2P 1U5YA 4I09A 4PLNA 4RGAA 2BPA2 1I6XA 4I3GA 3CNAA 1MQTB 3WDTA 2YMZA 3EXUA 1ENSA 5L73A 4YZ1A 2GAUA 5E89A 1SEFA 2DVAA 2RE9A 3H1WA 1S0JA 1UF2C 1CAVB 4R9CA 1HXS1 1YRZA 3LA3A 1GYKA 3PMSA 4YG6A 2VOKA 2RJKA 5BPXA 1PVC2 2ZKNA 2XB6C 3UKVA 1KJLA 4QD2A 4QPGB 3IN9A 1LHWA 2ARBA 3E5UA 1UX6A 3ZN6B 3ZSJA 4CDXC 2D5FA 3J8F1 2PHRA 3EHKA 1UL9A 3B00A 1AR83 2DWRA 4CP2A 4Y20A 1NCQA 4XBLA 4JV4A 3VKFC 3DL3A 1HV0A 3JB4C 1PVXA 5AFEA 2PHUA 2D6PA 1H8TB 2QZ2A 1TNRA 4K21A 1G9FA 2YGLA 2D6LX 3AKRA 4E2SA 1ZRCA 2A3WA 3L2YA 1C8M3 4CTEA 2WFF1 2GC3A 1NCRB 1POV3 5A3LA 4IV3A 4GQ7A 1AL22 4G4FA 3GBWA 3INAA 3AP4A 4K3UA 3AKPA 1F2NA 1A3KA 1CQ9A 1POV0 4ISQA 4CP0A 1Q56A 4XJZA 1FX5A 1AYM3 4CEWB 4L2NA 2D43A 5LEJA 1EAH1 3K48A 4JVAA 2Q1MA 2IXIA 1QQP3 1YNAA 4N53C 2Q8OA 4ISRA 4YFWA 4XMAA 1OOPC 5SV8A 5IK5A 3NW4A 2V73A 1H1MA 3WV6A 3U0ZA 2D6KA 1V00A 5BNQA 5DG2A 1AYN2 4GKXA 1OI6A 5KC6A 3AP6A 2MEV3 4HLTA 1NA1A 4Q8LA 4D94A 4AFMA 2B42B 4N9HA 1CAXA 3WINE 4LO8A 4BWOA 1MEC2 4YGEA 2JECA 4RQPA 3V64A 1XNBA 2ZGSA 1COV2 4P9JA 5FDBA 1H4HA 4DPNA 1VJ2A 4WV8A 1RUI3 1BQPA 1VR3A 4XZPA 2ZGNA 2Q30A 3SHRA 3ZXGA 1BXHA 1PGW1 2UWCA 2GMEA 1LHUA 1MQTC 4JDOA 2GSYA 2MPFA 2ZX3A 3A0NA 5JOYA 2ZAHA 5DDJ3 3FBYA 1C57A 1BYHA 1Q8QA 3VGIA 3OPZA 2XUMA 4I01A 3PNAA 2TNFA 4C90A 3VZOA 1LOBA 1VBA2 2R041 4QPGC 4FPCA 1Q3EA 1AXZA 4AI2A 4Z82A 1PGL2 2FHRA 1CVNA 3RI8A 2ZAAA 1VBE2 1VP6A 4GALA 4GB32 3PVBB 1QJU1 2Y38A 4RGGA 1W6NB 4HKOA 4R4ZA 2CGPA 5L7OA 1ASJ1 3PJQA 3IT8A 1RC6A 3ZYGA 2VULA 3H8UA 4LUMA 4L92A 1XXNA 4XF3A 2JG9A 2XVKA 2ZHKA 1OFNA 1QHDA 2EIGA 1H8TC 1OMIA 4BCUA 2BVBA 2Q5TA 3ZFFB 2RM21 1GANA 4XFBA 3I4IA 3VBRA 4Q0SA 4QQHA 4JCKA 5IK7A 2NP0A 1WGPA 1LEDA 4KL1A 2IXHA 4XXAA 1J3RA 1CX4A 3URFA 1NCRC 4Q4V1 3VV1A 2WLQA 3A0KA 3ZMNA 2RR11 2ZMKA 5T52A 5IT6A 3MLJA 1DZTA 1SCSA 5CU1A 3ZXKA 5CG9A 3W59A 2VUAA 5AVAA 1MS8A 1ZZBA 2P3JA 3JQWA 2K0GA 1IKQA 5J37A 4IEPA 2ET7A 2XJSA 4CEWC 1D4M1 3BTAA 2OUHA