1RUJ2

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj200
2R042 2HWB3 3VBUB 1PO21 4GB32 4Y4YA 1AYN1 1RMU2 2WFF1 1VBA3 4GMP0 3VBSC 1RUI3 3VBUC 1RUD3 1RUJ2 4QPGB 1V9U3 3JBG3 1R1A3 1RUH1 4WM7B 2WZR3 1AR83 1RUF3 4JGZB 3NAPA 4QPGC 4YVWB 1H8TA 2DF7A 4WM7C 3JB4C 4JGZC 5LK7B 4FTSA 1TMF3 2RMU3 1FMD3 1R081 4YVWC 2IZWA 1PO11 1COV2 2HWF3 4Q4V3 1QQP1 2R061 1K5MA 3CJIB 1PIV1 1EV13 1D4M3 2BPA2 1C8M3 2RS33 3S6PA 1AYM3 1E57A 3J8F3 2HWD2 4CEWA 2PLV3 2XBO1 1AYN2 3DPRB 1W39A 1AR73 1VRH3 5ACA3 1FOD3 4Q4X1 1Z7S1 1RUG2 4N53B 5A33A 2FZ2A 2HWE1 2RS52 1ND3C 3ZFFA 1AUYA 1QJY3 3TN93 1NOVA 3DPRC 4Q4W3 1RUE1 1CJDA 2RM22 1RUH2 4N53C 4CDUB 4CDQA 2RS12 1PO23 1A6CA 1BBT1 1MEC2 1X33A 2WFF3 4CDUC 4GH4A 2R041 1NY72 5CFDB 3JB8A 3VBHA 1X36A 1QJU1 2WS92 4GB31 1PO12 1RMU1 5BNPA 5CFDC 1VBC2 1PIV2 1PVC1 5BNOB 4PDWB 1B35A 1TME2 1QJX2 1R092 2X5IB 4AEDA 5BNOC 1ND2B 5JZGB 4PDWC 1VAKA 1R083 1ZBE2 3FBMA 2X5IC 5C8CA 1QQP3 1ND2C 2R063 2QQPA 5GKAC 1COV1 1OPOA 1VBB2 2HWE2 3JD73 3IDEA 3ZFGA 1NA1B 1H8TB 5AC92 3VDDA 1RHI2 4RR3A 5ABJA 2XPJA 1NA1C 1RVF3 1EAH2 2HWC3 1BBT2 1VBE2 1VB4A 2XBO3 1H8TC 1POV0 1HQNA 1MQTA 1AL21 1Z7S3 1QJU2 5C9AA 1ZBA2 1AR62 1K5MB 5DDJ3 1ASJ2 2FZ1A 2RR12 1VBD1 4YVSB 3ZFEA 1BEV1 5FMOL 3ZXAC 1RUG1 1K5MC 4YVSC 1PVC2 2RS51 4CEYA 4CEWB 2RM21 1R1A2 2TBVA 2MEV3 5J98B 2WZR2 1AR92 5CFCA 1QJZA 4RHV3 2RS11 1HRI1 2R071 3VBFB 2R043 4CEWC 4IV1A 4GB33 4CDWA 1MEC1 5A33B 1RMU3 1NY71 3VBFC 4QPIA 2WLPA 2WS91 3VBOA 1TMF2 1OHFA 1RUJ3 5BNNB 1VBC1 2BUKA 5K0UA 4Q4Y2 4GH4B 5BNNC 1F8VA 4RS5B 3VBHB 1TME1 1OOPA 1QJX1 1R091 3J8F2 5FMOS 4RQPA 1AL22 4Y5Z0 2PLV2 4GH4C 1SMVA 4RS5C 3VBHC 1COV3 1ND3B 1VBD2 1ZBE1 2GSYA 1BEV2 3VBUA 5ACA2 1NCQA 1VBB1 5C4WA 4AEDB 4Q4W2 1RUC2 5AC91 2HWD3 1RHI1 4QPGA 1HRI2 2R072 4JGYB 5L7OA 1EAH1 4AEDC 1VBE1 1HRV2 1AYN3 4GMP1 3ZFGB 4NWWA 1NCRB 1IHMA 2HWB1 4JGYC 1AR61 1ZBA1 1HXS2 1ASJ1 2RR11 4WM8B 1RUI1 3ZFGC 1NCRC 2ZAHA 2RM23 1RUD1 1RUH3 4CDXB 1MQTB 2RS13 1V9U1 4RR3C 3VBRB 1PGL1 5ABJC 4WM8C 3CJIA 1R1A1 2WZR1 1MEC3 1AR91 4CDXC 1RUF1 1MQTC 3VBRC 2ZZQA 2WS93 5A32A 1PO13 1PGW1 1NG0A 4N43A 1F2NA 1VBC3 1TMF1 1PIV3 1FMD1 3JD72 5CFCB 4Q4V1 3NAPB 4IV1B 4CDWB 1QJX3 1R093 4Q4Y1 1FPN2 5CFCC 3NAPC 2RS31 4IV3A 4IV1C 3VBOB 1CD3G 1AYM1 4CDWC 1ZBE3 3J8F1 4BCUA 2PLV1 4Q4X3 2HWB2 3M8LA 5DDJ2 3VBOC 2HWE3 1VBA2 5CFDA 1RUI2 5ACA1 1FOD1 1RUE3 1RUD2 1DDLA 5AC93 4RQPB 1V9U2 1PGL2 4Q4W1 1EAH3 3JBG2 1BBT3 1RUC1 1VBE3 1AR82 1RUF2 4RHV2 5BNOA 4FTBA 4GMP3 4RQPC 4PDWA 2BFUL 1NCQB 1AR63 1QJU3 1ZBA3 1ASJ3 2RR13 1HRV1 5D8AA 2X5IA 1PGW2 4NWVA 3ZFFB 5C4WB 1ND2A 5JZGA 1NCQC 1HXS1 2RMU2 1FMD2 1PVC3 2HWF2 3ZFFC 4Q4V2 5C4WC 4CDQB 5L7OB 1BMV2 1EV12 1AR93 1NA1A 1WCDJ 4FTEA 1D4M2 4CDQC 5L7OC 1C8M2 2RS32 1AYM2 2Y26A 5BNPB 3VBSA 5BNPC 1M06G 1AR72 1VRH2 1FOD2 4YVSA 1B35B 4Q4Y3 3JD71 1QJY2 3TN92 2BFUS 3LOBA 3CJIC 1B35C 5A32B 1POV1 1FPN1 1AL23 1RB8G 4N43B 5C8CB 1RVF1 2HWC1 5FOJB 1PO22 4WM7A 1VBD3 1BEV3 2WFF2 4JGZA 3VBFA 4N43C 5C8CC 4YVWA 1RUG3 4RFT0 5DDJ1 2RS53 4FSJA 3VDDB 1VBA1 4RR3B 5ABJB 1RUC3 4Z92B 4IV3B 3VDDC 1HRI3 2R073 5BNNA 3HAGA 3JBG1 2ZTNA 2MEV1 5C9AB 1AL0G 1AR81 1HRV3 2VQ0A 4IV3C 3ZFEB 4EJRA 4RHV1 1GFF2 4RS5A 1HXS3 1R082 5C9AC 4CEYB 3ZFEC 1QQP2 2R062 2RMU1 1ND3A 1RUJ1 3DPRA 4CEYC 4SBVA 2HWF1 1TME3 4N53A 4LLFA 1BMV1 1EV11 2GH8A 5D8AB 1VB2A 1D4M1 1RVF2 1C8M1 2HWC2 4QPIB 2XBO2 4CDUA 5D8AC 4JGYA 4Q4X2 5JZGC 1Z7S2 4QPIC 1C8NA 1VBB3 5K0UB 1NCRA 1AR71 1VRH1 1RUE2 1OOPB 2WWSA 1POV3 5K0UC 1RHI3 1QJY1 3TN91 1FPN3 5J96B 4WM8A 2BBVA 4CDXA 2MEV2 2HWD1 1OOPC 3VBSB 3VBRA 1HX6A
chains in the Genus database with same CATH superfamily
4H2AA 1SFNA 3VBUB 5FLJA 1S0BA 1PO21 3R0RA 4UAPA 2WAOA 3LEMA 3SC7X 3BTXA 2VW2A 3OPZA 3RI9A 4KH9A 1REEA 4XUQA 1CAUB 1O4TA 1RUD3 1OURA 1S55A 1SACA 1VR3A 4Y1YA 5DAQA 1RUJ2 5A7WB 3T4VA 3TYJA 3PVBB 2OPKA 1OT5A 4YGDA 5I91A 3N36A 2R0FA 3JBG3 2P3KA 4A4AA 1AR83 5DQ0A 2IXHA 5FP4A 4BPZA 4AF9A 2UWCA 2ARBA 4UI9L 4CCOA 4M0HA 4MGZE 2CWSA 1SLCA 2D98A 4A7ZA 2HEYF 2EIEA 1DQ1A 3RZMA 5T50A 4JGZC 5LK7B 4B4RA 4PLOA 4Q27A 2AUYA 4FFGA 1C5HA 1FMD3 1R081 4YVWC 1PO11 4LO4B 1EPZA 4ZZ8A 1W8HA 1V6LA 1YEWA 2GN7A 3O5SA 3OBZA 3MGUA 4XBLA 5DZEA 1JU4A 1PIV1 2JKBA 4H7LA 1JZ6A 1K45A 4BK5A 4BLIA 2VD7A 3BODA 1D4M3 2P5BA 3ILNA 4NO4A 5FZMA 2WIIB 3S6PA 4AVAA 1AYM3 5SV5A 4UFLA 3J8F3 2HWD2 1DIWA 3HBKA 3T2QA 2QKDA 2QJVA 3M3QA 4CEWA 3TEYA 4ZXEA 1CQ9A 2L9LA 3FMGA 3PUHA 3DYOA 2XBO1 1F15A 3IAQA 2BOJA 2VR4A 3DPRB 5FY7A 5T55A 1AR73 3Q8CA 1VRH3 3RZHA 4Q4X1 1POQA 1RUG2 2RDSA 3HD8B 3ZYBA 4N53B 2FDHA 2Q1FA 2FZ2A 1XE8A 3CO2A 4AL9A 2R0HA 3LPGA 4FPKA 4XCAA 2RM22 4JQTA 2J1AA 1QIQA 4L97A 5AFEA 1BYHA 2ZHKA 2ZZJA 1GNYA 3Q9OA 5FZ6A 2JB8A 4XYXA 1W8NA 1LTEA 2HEWF 2ORZA 2PHRA 4D7SA 2EAAA 5FPXA 1PO23 4E9KA 1AHSA 4AAPA 1MEC2 1X33A 2OQ6A 4C90A 2D44A 2O0OA 1WCUA 3AZXA 4CDUC 2R041 4MGTA 1NY72 3MLJA 2Y8KA 1RMU1 1KDMA 1V6NA 5IUQA 3IDAA 3AZZA 2ZX3A 4I09A 3HNMA 2WA3A 1LEMA 1VBC2 2P6CA 3J26N 5J3UA 3GNEA 4JAAA 4CPBA 1S4CA 1KS5A 2B4KA 4ZZ5A 3NNGA 3MW4A 3I54A 4Q26A 3WEZA 2WWUA 1R092 2JECA 1ULEA 4PI0A 3WDWA 2X5IB 1YXWA 3ES1A 3H50A 5IFPA 5A1FA 3WG2A 5BNOC 3D4KA 1CAVA 3H3ZA 1R083 4F83A 1ZBE2 3CL1A 1H0BA 3DV8A 1GKBA 4Q0UA 5T5JA 4HVQA 1ND2C 1UU6A 4FPGA 4K21A 4XJUA 2QQPA 3U14A 1BK1A 1OLRA 4QKDA 4WBBA 4AFMA 1SPPA 3JD73 3VD4A 4GWJA 1IKPA 4YZ3A 1FNZA 1VLNA 2AC1A 3B9CA 4XJ9A 1UY3A 2EXKA 1GZTA 2Y0IA 4YLZA 3MPPG 4LKEA 5AC92 3U11A 1ZZ9A 3VUOA 4Y5SA 1YNAA 1XNCA 1YJKA 4QX1A 3VD5A 4OHYA 2VPVA 4Q8KA 2XBO3 4DIQA 1H8TC 1POV0 4HVOA 4R4XA 3IIAA 3ZDSA 3U0ZA 2J7MA 1W6NA 1ZZCA 4UW4A 1ZBA2 2VUAA 2VUJA 4YVSB 3WVJA 3ZFEA 1QHDA 3V56A 3ZIWA 4BMEA 4EN6B 1N3QA 1UXXX 4A3ZA 3RQ0A 4MH0E 5FMOL 1XOYA 3T30A 5DUUA 4OUEA 4IGPA 1UOGA 3T4HB 1K5MC 3LDKA 5HBAA 3GZAA 4CEWB 1ZZ6A 5C4WB 1PGSA 2ARCA 3OOXA 4AXOA 2TBVA 2RJLA 1O91A 1AVBA 1ODMA 3H42B 2Y6JA 2W0XA 3SITA 5LEJA 5JI9A 1QJZA 4RHV3 5JXGA 3I2FA 4XUTA 1HRI1 3PIGA 2R043 3GYDA 3NJZA 3I3MA 5IAVA 5CYYA 1JW6A 2RDNA 3FL7A 1XNDA 1RMU3 2I45A 3HN1A 5GZFA 3UKVA 5FP3A 1SFPA 4H55A 4QPIA 2WLPA 2WS91 3UT0A 1TMF2 2PHTA 1OHFA 1GSLA 2OVUA 2YPDA 5D2AA 2PHXA 1PM4A 4XHBA 2FDIA 3IIIA 5L9BA 2WNUC 4AI3A 1OLMA 2XDVA 4LKDA 2WBKA 2NPIA 5FXZA 2JENA 4Q4Y2 4XAEA 5F6LB 4LO5B 3ZDVA 1TNFA 2GNMA 2B42B 3NNFA 5BNNC 2XG3A 3UESA 3OY8B 4YG6A 4RS5B 1OOPA 1QJX1 4LLOA 1Y9MA 1FATA 1JN2P 5FMOS 4MV2A 2PHLA 1AL22 1CPNA 4Y5Z0 2PLV2 5EPAA 3C7OA 4QPYA 4D69A 5ANNA 1U5IA 2VNOA 5F5IA 4KGGA 2GSYA 1BEV2 3MV01 5FLHA 2JX9A 4X8PA 1JYTA 2PHUA 2QQWA 1YIFA 2VCMA 3UKTA 2X8KA 4LNVA 2JDHA 4IEVA 1BZWA 1UCXA 2LALA 3VZOA 5K4LA 5DUVA 1QEXA 1LULA 4QXBA 1CAVB 1UMHA 4AVTA 3O1VA 2JG9A 3VKMA 4D8MA 3KGZA 1YFWA 1OA3A 2WRAA 4QPGA 1CESA 2YY1A 3AC0A 3NQHA 4B4PA 2R072 5KXBA 3HQXA 3T3YA 2ADDA 2OA2A 3JCIA 2EIDA 3B5LB 2ZXQA 4XFGA 1SPPB 5FIXA 1I5ZA 3PU8A 4GMP1 4NWWA 2G19A 1IHMA 5E6HA 3INAA 5FP9A 5LRRA 3E5UA 2VCCA 4K8FA 3WG3A 1ASJ1 1EP0A 2CY6A 1TNRA 2RR11 2QQOA 1GNZA 2GZWA 2BWAA 5HXVA 4XF0A 1RUI1 4AI1A 3N9NA 4BM8A 2DDUA 2J1UA 4AGGA 1RUH3 1XNBA 3OEBA 4OUMA 3LAGA 4QHZA 5FXWA 4BQ1A 4R52A 3I4IA 2GAUA 1W2AX 1VMHA 4C1XA 3O0VA 3QACA 5ABJC 2A3XA 4BQWA 1R1A1 1W2NA 1W6NB 2VBBA 5FYMA 1D2SA 2GDFA 2G9ZA 4HSJA 3ZX7A 1RUF1 2C4XA 5F39A 5CEHA 2Z79A 3LKJA 3VBRC 3UGFA 2ZZQA 2FMYA 3R4UA 1CWPA 3BPZA 3N35A 3WG4A 2WS93 3RI8A 1KDKA 3LD8A 1NG0A 4OHVA 1D7PM 4N43A 4Q0VA 4C91A 2GC3A 1JXNA 4OLLA 4A7YA 3ORJA 2YROA 4AE2A 1RJ7A 2P34A 4ZHNA 1U12A 3J7HA 4YZ1A 2DUQA 2KA3A 5KC5A 2SBAA 1BJQA 4FPJA 1QJX3 1UO9A 1BCXA 3VDCA 3GHNA 1T2XA 4L2NA 2FBEA 2GH2A 5I0UA 2JDYA 5GZEA 1RXFA 3KCXA 2RG4A 1Q8PA 3WNXA 4IV1C 1CD3G 1MVEA 1PNGA 3M2MA 4I0AA 1PNFA 2BQPA 3PIJA 4FFFA 4IETA 4LBKA 2CWMA 3GJAA 4WVVA 3ACLA 1OQDA 1UZVA 3LEIA 4QQOA 3M8LA 5FYYA 4COYA 3VBOC 1DGLA 2HWE3 2VY0A 4HETA 4OHZA 3R05A 4P14A 3I49A 1FI2A 3K51A 4CCKA 5ACA1 4K20A 2DVGA 4A2UA 3BU0A 1RUD2 4MXVA 5IWFA 2JDUA 4Y26A 3MW2A 1OUSA 2PXJA 5LCWL 1NKGA 1SFYA 1PX3A 1PGL2 4YW6A 5FZ4A 1BHGA 4R9CA 3JBG2 1MS3A 1Z78A 5FZHA 4F8AA 3J9SA 2GC0A 2WSVA 4H7MA 1AR82 3VZLA 1JYXA 2LM3A 3GCXA 2AACA 3V65A 2YV8A 5IYYA 4TTGA 1XU2A 4GMP3 3T0DA 4XF4A 2E53A 2WFPA 4PDWA 1TEIA 1QJU3 3MYXA 2D5HA 1ASJ3 3P1IA 2RR13 2BOIA 4HOOA 3WXPA 5D8AA 4A42A 5EFUA 4CA9A 2JG8B 3HR9A 4W65A 1JS9A 1YLLA 5FYZA 5JVVA 5LBFA 2XR4A 5JZGA 5JIAA 4DPNA 4Z07A 1FMD2 1PVC3 3LF7A 3OPTA 2JG9B 2VQAA 3AMNA 1XB9A 1YCIA 3NSTA 4CDQB 4CXXA 1IS3A 4AVCA 3MDPA 5FO9B 3BGAA 3K3OA 3WT3A 3U4XA 5FV3A 1AXZA 2NMOA 3A23A 1UKGA 1GLHA 4YW1A 4FTEA 4W6XA 1D4M2 4XQDA 1S0FA 4CU9A 3WP6A 3K4DA 5A7OA 1UMZA 1AYM2 4JDOA 5BNPB 1VPHA 5CG8A 2DYCA 2DURA 2YZ4A 4QB1A 2DU1A 5C33A 4C0BA 1NAEA 1NZIA 3PUQA 1JYIA 3ZM8A 4PJYA 2D3RA 5I93A 2XJPA 1QU0A 4B1LA 2O8OA 1AR72 4MGIE 1VRH2 3WHUA 1F5FA 2AH2A 2PAMA 5I8SA 1OKOA 1DP0A 2VMGA 4AGRA 4AQTA 2QQNA 2P6HA 2ZGOA 2RJKA 2ZGUA 1DGWX 4R9AA 3CLPA 3OJBA 4TN7A 1GMMA 1OFSA 2A7AA 2XH6A 4AQSA 1HQLA 4MGSA 4QGLA 1HV1A 2Y60A 2QNKA 2BZDA 3WF3A 2YC0A 1LENA 4ZS2A 3L2YA 1FV3A 3WG1A 4N43B 1ENQA 2VZ1A 1RVF1 2PQSA 5C8CB 5FY8A 1PO22 3ECQA 2WN2A 1VBD3 1KRIA 5FY0A 3MUZ1 1NX9A 4JGZA 5FZFA 2XLGA 3RRDA 4QX2A 2IVIB 1JH5A 1UZWA 1C3HA 1RUG3 1YFYA 3HJRA 2ZBJA 2BEOA 4YVWA 4AI9A 4JHZA 5CVRA 4N7UA 4BYYA 2X05A 3OD4A 3POIA 1US2A 5IVVA 5JXHA 2J1TA 4ASKA 1VMJA 5JIUA 2GN3A 1SCSA 4FQ4A 1F4AA 3H7YA 4PIXA 2XGXA 1OVPA 3LB9A 5LW9A 2X53S 5CBLA 2Y64A 3Q8EA 2GC1A 1XBFA 4FP3A 2DCZA 3L9JT 3AMMA 3HAGA 4OHWA 4IGQA 2ZTNA 1CR7A 2NMNA 4ZY9A 5C5TA 1AL0G 1JOBA 3RS6A 3A7QA 2EVXA 5C9AB 4EROA 4KI5M 4CP9A 2NQYA 3WSOA 2C9AA 3KWVA 2VVEA 2VMEA 4PLNA 1GFF2 2WA4A 1M4WA 4AGVA 2OT7A 3SHRA 4ONUA 3H0OA 1R082 4G4FA 2W2IA 4XMAA 3NW4A 3ZFEC 1AXKA 3DKWA 3ZPOA 4XFFA 1KJRA 2FCUA 3I2JA 2QCSB 1YI9A 3LEGA 5D1IA 3V0BA 4OI1A 3W5MA 2HEVF 2HWF1 4MXWA 3VHPA 3BOPA 1ENSA 1LU2A 1DU3D 3BN6A 3JQWA 4LLFA 5JOWA 3GDBA 4DZGA 2GNTA 1BMV1 4IERA 1GP4A 5D8AB 5GLTA 5A3WA 4QKNA 1NUKA 2V5YA 1LHNA 2XBO2 4D94A 5EYYA 4KGQA 3ZYRA 2BVBA 1X9PA 4CDUA 4XZPA 3SKVA 2BBAA 4QMAA 3VZJA 2ZPXA 4JGYA 4Q4X2 5GM0A 1QDCA 1UWWA 4QPIC 4DINB 2ERFA 2DCTA 1MS5A 1L7QA 1JYVA 1NCRA 2JKXA 3RZJA 3VGIA 4E8CA 1LR5A 2YHJA 1VJ2A 4KNCA 2P3IA 1YC61 4LKSA 4R4ZA 4HKLA 2ATFA 2E6VA 3RJRA 4L0PA 4WM8A 3BTZA 2Q1MA 1J3PA 5FMBA 3W20A 4FAGA 1Z0HA 3JQXA 1ZNPA 4CDXA 3TEZA 2YUEA 4Q8LA 3B3QE 4CZSA 4YSFA 1OOPC 2UY9A 4P9GA 3I97A 5FR3A 5FYIA 4AI2A 3BIEA 2R042 4KL1A 2D40A 3IM0A 4FXKB 1RITA 1YFUA 2YDEA 1YRZA 2VMDA 3AYAA 4NRPA 1OH4A 4DRVA 4MZUA 1STMA 3ZXFA 1AYN1 1NT0A 1RMU2 3BOWA 2WFF1 3WDXA 4GMP0 3VBSC 4QXCA 3FC0A 1V6MA 4WZFA 4DXZA 3L2HA 3RZLA 2CHHA 3KV4A 3NNLA 1WMFA 1ZRFA 1OSGA 4XC9A 4ZS3A 1XE7A 1V9U3 2KM2A 3N7LA 4LBJA 1W9FA 2RE9A 4XBNA 5E89A 4AW7A 3M3CA 5FPAA 3LQCA 4BQ4A 3ASIA 3KZ4C 1AXYA 4JGZB 3NAPA 4GXLA 4HG6B 4QPGC 3O14A 4FXGB 3LOIA 4CCMA 4YVWB 1H8TA 1JBCA 2DF7A 4WM7C 3RYKA 3ZSMA 3GJBA 3Q8BA 2W52A 2WAAA 1Q5OA 4AI0A 4AEJA 4DEVA 2BNNA 5GJ6A 4FTSA 1NQJA 1TMF3 1U0AA 2IZWA 2WL1A 4NROA 3ZVXA 3MLKA 2HWF3 2P3YA 3AVSA 4Q4V3 1LGNA 1QQP1 3N9PA 4DUVA 2MPFA 2VC9A 3AZVA 4E4ZA 4YZ5A 5LK5A 2JICA 1K5MA 2KR2A 3CJIB 3NO8A 4CSWA 4BXSV 4RA0A 3POWA 3TWIA 4CP9B 4ZPIA 3D5OA 3J7MA 4FPCA 4IEOA 4OI2A 2RS33 3ZN4A 4NPMA 5FZAA 2RVAA 3PTRB 4YW4A 5FWJA 5JAXA 1S0DA 5FZIA 3ME2A 4KU7A 4RYDA 1H2MA 1WLDA 2PLV3 2WYFA 4LA3A 5IJRA 5JPNB 3MF9A 3FBYA 1K42A 4HPKA 1ZM1A 3AMHA 1REFA 4SLIA 1S2KA 1C5IA 1H1MA 1SG3A 4URTA 4QHOA 1FOD3 5FDBA 1JTZX 3DECA 2WT1A 1ND3C 3K48A 1NOVA 2WNUA 3AP9A 5F3EA 3ZMNA 5JOYA 4Y1VA 1CJDA 4LKFA 1RUH2 4DY5A 3M4FA 2CGNA 1OBNA 1OVSA 2R16A 4P02B 4TWTA 5FZEA 1PMIA 2VUDA 2DBNA 3E6BA 4CDUB 1CAXA 5L36A 1W6PA 2A70A 1V6KA 4YW3A 3RSJA 3WF2A 3TEXA 1BBT1 2W68A 5DPNA 3ZPYA 1WW6A 3S5AA 4QT6A 3I3QA 1MZFA 2WFF3 1Y9QA 3KS7A 2VE1A 2IXKA 3ILFA 3UV9A 3KSCA 1R1ZA 3UJQA 3FUQA 1X36A 2EIBA 3USSA 2BGOA 2WS92 3VL8A 4OI0A 3MW3A 4GULA 3MICA 2ZA9A 5FYTA 3O1RA 1HJFA 5FO8B 3B00A 4NPLA 1WKYA 5CB7A 5I0SA 2WQ4A 3K4AA 4JRLA 1G9BA 4GJZA 4LHKA 4IEXA 2OX0A 5LBEA 1OPMA 1K3IA 2A75A 5FMDA 5BNOB 4COWA 1ULFA 3ITQA 2Y33A 2X09A 5FOBB 3P3NA 1V6IA 1QJX2 3LDRA 2EXJA 3ACHA 1J58A 3M3OA 4ET7A 3RJ2X 1ND2B 2J1EA 2HYKA 3KF3A 4HL0A 4XXAA 2ZS6B 4I0BA 4PDWC 1VAKA 3WOGA 4DUXA 1IS6A 2FMDA 4IEUA 1REDA 3THDA 2JE8A 4YW5A 1XE0A 3VD9A 2V73A 1QQP3 2MNGA 4KWKA 2VZOA 5E8AA 4QX5A 3IMNA 4Z1VA 1UYZA 2HWE2 4IGOA 3MZHA 1MS8A 1OQEA 3WDYA 5J1XA 5JPMB 3T1LA 4MO3M 3VDBA 3ZXJA 1DYOA 2Q5TA 4A7KA 1LECA 2VZRA 2ZGPA 3LGRA 2IXIA 4DNYA 2WNEA 1H8TB 3QH7A 3H7JA 5ABJA 2XPJA 4LBMA 3F95A 1G8WA 1LOEA 2XVGA 4LUKA 4UWDA 3USUA 2DTYA 3LWCA 1VB4A 2VVFA 3FUOA 3U78A 3IPVB 2Q1ZB 2BRTA 2WQZC 3W5NA 2XOMA 4Q1PA 1RUNA 3D82A 5JLVA 4BQXA 1QJU2 3LSDA 1K5MB 1ASJ2 2FZ1A 2RR12 3EQEA 3OYWA 4QDRA 3LCPA 5H9QA 1BXHA 1UY4A 3WP5A 1DCSA 2H6CA 1CVNA 3AXEA 2VMHA 4JHTA 5LA0A 2C26A 5FP7A 1YQ2A 1LGCA 4XILA 4W6WA 4BIFA 1XC6A 1O3SA 1L7LA 1PX4A 1PVC2 2RS51 3SXWA 2G1MA 1GNHA 3LEKA 4QU1A 2WABA 1DG6A 2VBPA 3HT2A 2AGSA 1R1A2 3R4SA 4HPKB 1WLWA 5CZKA 5J98B 1LOBA 2YYOA 3PVEA 3TB0A 4MUVA 2XUMA 4YZ4A 2LUWA 4FPHA 2WO2A 4LO7A 1NZCA 2O8QA 1TQ5A 4IV1A 4N90A 3SLIA 1OQ1A 1W6MA 3H1WA 3EYPA 3AP7A 5C6CA 3BALA 1UOFA 1W03A 2WNUB 2A3WA 4AZZA 4ISQA 2W95A 3VBOA 3NNMA 4UFHA 2WZEA 4S2GA 4UT5A 3HPNA 5BNNB 1W6PB 1UX6A 2QQVA 2BUKA 3LA2A 3SMHA 1SLAA 1C1FA 5K0UA 3UGHA 4UBGA 4UBHA 5JXJA 4RFRB 1L7RA 1W2UA 4LOSA 4XURA 1TME1 5FRAA 4OQ9A 4BHPA 4W6YA 2PQQA 3ACIA 4IEPA 4UW5A 4X6RB 4FP2A 1Y7BA 3DEMA 4P9JA 3SISA 1GWMA 5HCFA 3VBHC 1GZWB 4AFCA 1JYNA 1VBD2 3D0JA 4M3CE 1CX1A 1CZSA 2OW4A 2FDGA 5ACA2 1W8FA 1UX7A 3NV1A 2K0GA 3KHBA 3B94A 4NHLA 3S30A 1Y9GA 3ON7A 5A1LA 2X29A 1H30A 5GLZA 2C24A 2J22A 3NJXA 4BQYA 4IE7A 3WV6A 2W92A 3PVNA 5F6KA 1YQ8A 4CU6A 5JR2A 5EP9A 3O1UA 1RHI1 4FOQA 4QD2A 4CPBD 4XVHA 5KHGA 1FX5A 1EAH1 2EIGA 3T2OA 4AEDC 3T0AA 2VH9A 5C3OA 1VIWB 2VQUA 1LHOA 3BUCA 4K7JA 5HI0A 4E2GA 2YGMA 4JRAA 2HWB1 4JGYC 1PZ8A 1NLSA 4JCKA 1DZQA 1AR61 1JU3A 3WNMA 3JXSA 3B7MA 1JI6A 1UY2A 2BWCA 4E4DX 3QCWA 3RWNA 4NUBA 1WLCA 3ZXDA 3ZFGC 4KU8A 1NCRC 2HH9A 1CZVA 4QB6A 1A8MA 2E7QA 3VV1A 3IMMA 1DGWA 2ZGRA 1WCQA 3N9OA 3VBRB 1HDKA 4RR3C 5I0DA 3WNNA 1H2LA 4WM8C 3POFA 3FX3A 4F7ZA 4NMIA 4L8QA 2ADEA 2WZR1 4MX3A 3ZIXA 2VBDA 1AR91 3MIDA 4CDXC 3OYWB 3T1MA 2CGPA 2NN8A 2WZ8A 4F3JA 2OYZA 3POBA 2BDRA 3QH6A 4JKMA 3GZUC 5IHRA 3ZXKA 3CQOA 2EICA 5A32A 3LFMA 1PO13 1ZRIA 1DZTA 4O61A 3B69A 4XF1A 1JODA 1PGW1 4XUNA 5EJ3A 5HCAA 5JDBA 5AVAA 3RYPA 1ZRCA 5J09A 1LOCA 1RXGA 3ZYPA 1PIV3 1UPIA 2WC2A 4LHSA 1OLQA 5IAXA 2J1VA 4FPFA 4AWDA 1ACCA 2CAVA 4OFGA 4ES8A 3HWJA 4IV1B 4KG8A 5CKQA 1UZZA 4Q0SA 3KQ4B 2WWJA 3FHAA 3NAPC 2UWBA 2D7FA 5GZDA 1O8SA 3ZLIA 1WD3A 3VBOB 2N7GA 3AMQA 1JYCA 2GNDA 2VQTA 2RHPA 4W8JA 1XSQA 4FOYA 2R30A 2XJVA 4Q4X3 4UFJA 5I8YA 1V00A 1PZ9A 3CMGA 3THTA 5A7NA 2HYXA 4PBOA 3S0MA 1VE0A 4CP2A 5HCHA 4QU2A 5CFDA 1A34A 3NMBA 4NR1A 4L9BA 5FFOC 1N1VA 2Y6KA 2WYSA 2ZGNA 1LCLA 3PL0A 3WF0A 5A70A 1MPXA 1QGLA 1W8TA 1V9U2 5CKNA 4Q4W1 3M3IA 1EAH3 1H1IA 2D6NA 4JZRA 4GWNA 4BB3A 2JE7A 3N7KA 3KLSA 4FTBA 1LODA 1HJGA 3PURA 4PI2A 4Q0PA 4AVBA 1NE6A 3EJKA 1YQCA 4V1PA 2BFUL 2R7EB 4WZCA 1AR63 1SDWA 4K1ZA 4V2WA 2WDBA 3ST7A 4V2VA 1HRV1 2D43A 2IUWA 5FBJA 4CCEA 2CV6A 4EE2A 4ITCA 2IXCA 3A22A 1XXNA 4UW3A 5FWEA 4YM3A 1G9AA 1HXS1 3B01A 3KGLA 3ENRA 2GC2A 1ONAA 1RGSA 2HWF2 2QQIA 1HIXA 4Q4V2 4RSUA 3PUAA 3RGBA 3UNPA 2BGPA 4YZ2A 1XNKA 5DXDA 3H8OA 2YB7A 3H8UA 3NV2A 4META 5FZKA 4AQ2A 2QVSB 2W47A 3PHMA 3O1SA 4Z8BA 1AR93 3D0SA 1BMV2 2E7TA 3AX4A 3SCGA 2BNMA 3O1OA 1NA1A 2AREA 1QOOA 1WCDJ 3MIGA 3OF1A 5DAXA 1JZ2A 4OMCA 3IDCB 5A80A 5L7OC 3ZSJA 1Y3TA 1U5XA 2P2KA 2RS32 2E26A 3ELNA 3IDBB 4ZONA 5FY5A 4BZ4A 1KFUL 1SDDB 3G7DA 3LA3A 4CU8A 5FQ0A 3RZZA 2RDRA 4YM1A 5KXEA 4IQPA 4YNIA 4ATFA 2BJSA 2I2SA 1VALA 4QQPA 3VBSA 5LA1A 2P3JA 1W99A 2VUCA 5JSPA 1FOD2 4L11A 1JZ7A 3O12A 4DUWA 2ZGLA 2RV9A 5F3GA 3CZJA 4K40A 5FTTC 2BFUS 3HOBA 1S2BA 5GLWA 3H8XA 3WF4A 5T5PA 1CJPA 1O4YA 5A32B 3SCFA 1OF3A 3ZXLA 4G9SB 1FPN1 4Q1RA 5D21A 1DFQA 2HWC1 5FOJB 1S0EA 1BK0A 1PMHX 4TLFA 4WM7A 2XJUA 4NJ4A 5FPUA 1SLBA 3V0AA 2XHNA 2WFF2 2XJSA 5CIRA 3VBFA 1JHJA 1UY0A 2ZEXA 1JZ3A 5DDJ1 3BI3A 1V6JA 3A0NA 1WLTA 4RN5A 3I7DA 5F5QA 1VBA1 3SEEA 5EIYB 4W50A 3N7JA 2GNBA 4Q2FA 1UQXA 3AKQA 3SH4A 1WW4A 3WW1A 4YGCA 3FFQA 4XTMA 2G9FA 4KQ7A 1HRI3 2XHKA 2QDNA 3C8XA 5F5CA 2A6XA 3J7NA 3MUY1 2MEV1 4BH9A 5CAZA 1HRV3 2XVKA 3ZFEB 3ZO0B 3SH3A 1DF0A 5E88A 1GZCA 3I8TA 4Y22A 2VZ3A 4KMQA 2CYFA 4WVZA 1IQAA 1YJLA 2Y34A 3F2ZA 1HXS3 3I59A 2YU1A 1O5LA 2P17A 5FZCA 5JCTA 2DUOA 1QQP2 2YC2A 4LORA 4NRQA 4UOJA 1SEFA 4ZKTB 5AFBA 5FY4A 4LHNA 1UF2C 1ND3A 1SZBA 1RUJ1 2WZPP 3NKGA 2HBTA 4IUGA 4SBVA 1RL3A 1J59A 3S5QA 5C3PA 1SLIA 2Y6HA 2CAUA 1EV11 2YBSA 2ZGMA 4LHLA 1C57A 1D0HA 2XONA 3DN7A 3D8CA 3AKSA 1EY2A 4CE8A 4PIYA 1C8M1 2ZX0A 4QPIB 1SBDA 2WJSA 4CUBA 4AFBA 1QDOA 5F37A 5A1AA 1QOSA 1W3VA 2VTXJ 1UZ0A 2WT0A 4PF1A 4LK7A 4JX0A 1HKDA 3POGA 3UKNA 2NYYA 1W04A 3LIGA 2F6BA 3NL1A 3I2GA 1LU1A 4RGKA 5F5AA 3T2TA 1WD4A 1H2NA 3H8RA 3OTFA 1T6BX 2VOXA 5DABA 4D0QA 2FDFA 1GP6A 3C2UA 1R64A 2DU0A 2IXJA 2XUEA 3GZEA 1OOPB 3OGRA 5A3LA 5K0UC 3TN91 1FPN3 2VAUA 1OF4A 4AHWA 1LJ7A 5H9PA 1I3HA 2ARAA 2PHDA 4JDNA 2BBVA 1OKQA 2HWD1 4M3CA 3VBSB 1WA6X 4WVMA 1SHWB 3TNQA 4QX8A 5A3PA 3TAYA 2EF6A 3O0XA 1GICA 4Y4YA 1CIWA 3V64A 1VBA3 5G05L 4EWEA 1RUI3 2DFCA 5C7GA 4XFCA 4CUAA 4HN1A 5FZBA 4M4RA 1EUUA 2WR9A 1WZXA 3U07A 4L92A 5FMCA 4QGMA 4QPGB 5FYUA 2VTXA 5T3NA 5IVBA 3MV11 1S0CA 1ULOA 2H0VA 2WUHA 4EZHA 1OH3A 1R1A3 1IS5A 3T0BA 3GM8A 4WM7B 1W2OA 4ZU7A 3MLLA 2E33A 5A3NA 1RUF3 3CEWA 3V0AB 5FZLA 3E6DA 2YXSA 4QQLA 3SCHA 3ATGA 1YWKA 5FJHA 4RD7A 2Z42A 2TEPA 1B09A 2VG9A 3JB4C 4XF3A 3ZYGA 1LAJA 4BA6A 1IG0A 2CGOA 2ZEWA 1VP6A 1E5IA 4LIVA 3WNKA 5G04L 4B29A 1HB3A 4Y5TA 2YMZA 2VOTA 1RIRA 2PTMA 1EV13 1VAVA 2KD7A 4Y22B 3GALA 3URFA 1C8M3 1I1EA 1HLCA 1HQWA 3AB0A 4LPLA 1A8DA 1E57A 3I59B 3LIHA 3MHZA 4MYEA 4EN0A 2VZQA 1MR5A 4Z82A 1ZZ8A 2B39A 4M01A 1PK6C 3KV9A 1DQ0A 2QUOA 4AVVA 1HV0A 4XJZA 3O0WA 2YPJA 4OYUA 3OGJA 2CL2A 2PFWA 4R9DA 1W39A 5E1RA 2QZ3A 4Y20A 4XBQA 5J7MA 5ACA3 3BKZA 4NIHA 3JU9A 3QBQA 1Z7S1 3KV5A 1WUVA 2PN5A 3CU7A 4Q29A 5FREA 5A33A 2RS52 1W9TA 3MFCA 1AUYA 3TN93 3ZFFA 4H14A 3WQ1A 3WLUA 2GMEA 4LO6B 5HPOA 1RUE1 3BCWA 2QTWB 3NJVA 5FZOA 5LBBA 3VKOA 5HV4A 5JSRA 4BQ2A 3AVRA 4J1WA 2H6BA 3O1PA 3VHOA 2BTVC 1LB2A 4DB5A 3H1MA 4J25A 2ET7A 1U5ZA 5BUVA 1OXCA 4AHYA 4TZDA 5IATA 3RZKA 2WQ8A 3JB8A 3VBHA 2GU9A 3THCA 4GB31 2Z2SB 1PO12 2PAKA 3AL6A 3KT7A 4AG4A 1K5JA 1DYPA 1W8ZA 2H0BA 4TSVA 4YWAA 5CFDC 3P3PA 1OD5A 4LE3A 1PIV2 1BVVA 5A7PA 4QQHA 2J42A 5IK5A 5EJ1B 5FAXA 4WVMB 1LHVA 1QOTA 3OUIA 1B35A 1ZX5A 1TME2 4LEJA 4PDWB 4Y3OA 1ALYA 2JB4A 3N9QA 5CNAA 4URAA 1IS4A 3UGGA 2XQRA 3OGGA 2JDKA 1GBGA 2ZMKA 1JUIA 2HBUA 3G6JB 4J1XA 2E31A 2EA7A 4NHKA 4QKFA 2WINB 4TXWA 4AEDA 4C1WA 2WNVA 3WCRA 5JZGB 1K12A 4X6QB 2F4LA 3AFKA 4UXAA 1MVQA 3FBMA 4EV0A 4XXPA 1CPMA 2D3PA 5FZ9A 1DLCA 3VKLA 1LOGA 4TYSA 1GQPA 3DYPA 2ET1A 3VLBB 5GKAC 1UW8A 1AX1A 2OZ6A 1COV1 1OPOA 5BV6A 3MBWA 4YYOA 4XIKA 5LASA 1C1LA 4LULA 1HB4A 2HKXA 3ZFGA 4QXKA 3WQ7A 4QDSA 4QX7A 1NYWA 4OZOA 2XJQA 3VDDA 1RHI2 4RR3A 4B3NA 3GHMA 1NA1C 1UZYA 3ZYFA 1RVF3 1WW7A 1EAH2 1HB2A 2LTNA 3KV6A 4P5YA 4LBQA 5DG2A 4CU7A 4INDA 2Q4SA 2ZX4A 2BU9A 1UYYA 1HQNA 4NE9A 1X50A 1AL21 4AFAA 5FCCA 1Z7S3 1IPSA 4OVEA 4B1MA 1AR62 1WMXA 3R4DB 2JIJA 4JV4A 2VZPA 2XLAA 2D6LX 1BEV1 2YFUA 5IK8A 2GMPA 3WNPA 2EXIA 5DN2A 1D2QA 4I0WB 2J1RA 2UURA 1ENXA 3KD4A 4CEYA 1WMEA 3KCYA 4DS0A 5A3UA 4IW3A 1UKRA 5B2GB 2Y6GA 3NVCA 4UFIA 1YQ6A 2P37A 1PMJX 5HXMA 2WZR2 1AR92 5FXVA 5CA6A 4IEYA 2RS11 3WR0A 2R071 4PLMA 4Y20B 5LY1A 4XEZA 2R49A 3U1XA 1CAWA 4GB33 2EXHA 4IESA 5A33B 1JMUB 3WUCA 2F4PA 2GP5A 3VBFC 2UU8A 3IBMA 3FLTA 2FCVA 2WKKA 5FK8A 4FAHA 2DVBA 4HN0A 4AFDA 5FZOB 3ABZA 1AF9A 1W0OA 5DG1A 4MSVA 1UU4A 3S7IA 3MF6A 3OUHA 4AK3A 2VVDA 2XKOA 5FPVA 5KHKA 2E63A 3W59A 2D6KA 3FWEA 4M4PA 4JVAA 3IWZA 5I8TA 3VKNA 3VBHB 2YGLA 4B4QA 1W0PA 3QOPA 1F5JA 3GBFA 3FHIB 3WHTA 3ACGA 3PLQA 3I2IA 2OZJA 2VOVA 4XHXA 3DUIA 1MS4A 5M0TA 4CCDA 5LRSA 4GH4C 1X7NA 4IE4A 3WDTA 2ES3A 3V0BB 1G7YA 4PIZA 4I02A 3WNLA 1COV3 1GR3A 1LHUA 4XUPA 4GKXA 3NKTA 2A1XA 4MXWB 3VBUA 1S0JA 1WBLA 1XRUA 2XWBB 3RZGA 5JMOA 1Y4WA 1KITA 1VBB1 5FZ0A 2VMCA 3SNMA 5TSWA 5F8PA 2O1QA 1PVXA 3IZOA 4Q4W2 1CAUA 4AEDB 1XNAA 5T54A 3WUDA 4UFMA 5A7WA 5A3MA 3EO6A 3KHCA 1H9WA 4CUGA 1HRI2 4JGYB 2HJIA 2VZSA 3PVOA 5L7OA 1YO8A 5KHHA 3AKRA 1VBE1 1HRV2 1T6GC 1AYN3 2VXJA 1X8MA 2VW1A 2DFBA 3C3VA 5IT6A 3ZFGB 5I0RA 1NCRB 1XQNA 2CDOA 3VZMA 1LOAA 3GZTB 2FD8A 2D5FA 5F32A 1HXS2 4IEQA 4MOAA 3MIHA 2ZKLA 3WW3A 3ZKYA 4FCAA 4WM8B 4MGYE 1APNA 2VCBA 2D6OX 1RUD1 5C3RA 4JTOA 3FE5A 4FPOB 2XJTA 4A45A 4CDXB 3RNSA 1O5UA 2OQ7A 2Z69A 4IEWA 2RS13 1PGL1 1G9FA 2JDNA 2XJRA 4YGBA 2GMMA 5FZ3A 1RTVA 4IE6A 4I2OA 3LSEA 4DFSA 1J3RA 5HV0A 3WY6A 1LOFA 1KD7A 4I3GA 3GBGA 1MQTC 3WQBA 2MHFA 2VTFA 2I74A 3SH5A 5EWSA 2QQKA 4N9IA 2JDZA 5DZFA 3T09A 2QQMA 4LE4A 1J3QA 3SQOA 2ZHMA 1KQRA 1GWLA 1F2NA 2PELA 4LUMA 1FMD1 4KBBA 4A6OA 3WW2A 4H3WA 3NAPB 2Q8DA 4QWNA 4FPLA 4P9YA 5C3SA 4YM2A 5GALA 4FFHA 4QX0A 1PHMA 2XWJB 1CAWB 3E5QA 4LBLA 1FYUA 2OIIA 3MEPA 4S2DA 5H9RA 2LS6A 2R1DA 5LBCA 3WP4A 4BXFA 1XYOA 1FPN2 3ZYHA 3RYRA 3WW4A 2LROA 5CFCC 4HBNA 1ULDA 1TZOA 2DVDA 5BPXA 1BVP1 1AYM1 2KXLA 3VZNA 4CDWC 3J8F1 4E4HA 4BCUA 5BNQA 3K2OA 2IWGB 4ZU4A 4XE9A 4JQRA 5APAA 5KXCA 5DDJ2 1WBFA 2C5DA 2YBKA 1VBA2 4QX3A 4U36A 1QNYA 1J84A 1RUI2 3I3BA 4E2QA 5IK4A 4XAAA 3SKJE 1UNBA 1DDLA 1Q56A 3LA7A 3OSDA 4X8NA 4CYDA 4DRRA 4PQQA 4CUCA 3ETPA 1AJKA 1CIYA 2D3SA 2ZOEB 3U75A 5F7UA 1RUOA 4YGEA 1BBT3 1RUC1 1VBE3 4TLGA 2R32A 4CVUA 4DOUA 4PF5A 2VU9A 3AP4A 1RUF2 3KVBA 1O4ZA 3PU3A 4DEQA 3EHKA 4RQPC 1UAIA 2V4AA 2ZX1A 4A3XA 2YU2A 2CU5A 2X5IA 4P08A 4NWVA 2A71A 5KHIA 1YI7A 4PQ9A 1QMJA 1SLLA 1NXMA 3AP5A 3FHQA 2E32A 1NCQC 5FZDA 1XYNA 1AX2A 2G4IA 2XKPA 4LIUA 1DBNA 2DVFA 4YG3A 3NWKA 5C4WC 3ZFFC 1O6UA 2BERA 2LRPA 4I3PA 5ERLA 1CAXB 3RDIA 2VZVA 5DAVA 4A44A 5L7OB 4OCTA 4D3WA 1GOHA 3QLQA 2ZEYA 1EV12 4Y24A 1RC6A 4FO9A 4N7IA 3NJYA 4XJAA 3S57A 1UXZA 4E27A 3D6EA 3I2OA 3H3LA 2E7AA 2B8MA 1C8M2 4P9WA 1IGOA 4DO0A 1GOFA 2Y26A 5FJKA 1G9DA 3LZZA 2E51A 2P1BA 3HNYM 4GALA 1UOJA 3FZ3A 5LEKA 4D6RA 3HVDA 4Q5OA 4XJWA 1DGRN 2JXAA 1W90A 5I0TA 5C8WA 1J1TA 5FYCA 3AJZA 4YVSA 2QDRA 3A21A 2OKXA 2VNVA 2UYBA 1QXRA 3JD71 2JDMA 1S2EA 5FKCA 3TN92 5LZ6A 4FFIA 4BIOA 3WP3A 2ZMLA 1SCRA 3LOBA 1TG7A 1VAMA 3C7EA 3CJIC 1B35C 3O1TA 3I2KA 4QQ2A 1I9RA 4HXCA 5JI7A 3VB9A 5KBFA 3KB5A 5JR7B 1RB8G 4OZXA 4ZU5A 2K9ZA 4BDVB 5F3CA 2WNVC 1F9KA 5AVPA 2EAKA 5EZWA 4EZ4A 5FUPA 3WNOA 1W6OA 2Q8OA 4GKYA 1QXPA 4MGKE 5BYNA 1US3A 4RFT0 5EYXA 4CP1A 4IEZA 2RS53 4FSJA 1FXZA 3X29B 5LWBA 4AVSA 3AP6A 5ABJB 5FP8A 3VD7A 3IAPA 3Q8FA 1RUC3 3MIEA 3USUB 4NOTA 3VDAA 1J83A 1ZA4A 2WN3A 4P5HA 1NE4A 3VDDC 3VHNA 3UL2A 4JKKA 1O7FA 1ULPA 1OFNA 3EBRA 3WD5A 3OGSA 2JDAA 4D6QA 2P4EA 2VQ0A 2XXZA 3C7FA 4IV3C 4EJRA 1DYKA 1W0NA 2YG0A 4RHV1 4B8EA 4BOWA 3BVCA 4O65A 5L9VA 1PK6A 4AI8A 3OY8A 5IFTA 3KF5A 4RS5A 1UD1A 2AR6A 1XNTA 3HT1A 4NVPA 2OUHA 3POJA 1YQ5A 1ULCA 3SEPA 4QGNA 4XCBA 1W8UA 3HQRA 2CDPA 3RMXA 2ARXA 4QM8A 1BQPA 1DZRA 1HW5A 2RMU1 4YW7A 5CG9A 3ZKUA 4CEYC 2VMFA 1H8VA 1AZDA 3CIHA 1UIJA 5FPZA 1X82A 3IB3A 1UU5A 3AKPA 1TME3 3CHXA 4HZFA 3CZUA 3PJYA 2GH8A 1ST8A 1E5RA 4D7YA 1DHKB 4DXSA 1W6MB 1GUIA 1VB2A 3H1YA 5EQUA 3E6CC 3CBNA 1OUXA 1RVF2 3N9MA 4K6BA 2ZX2A 3ZN5A 3W58A 2ORXA 2BP6A 1KJLA 2Z4FA 4Z2WA 4ISRA 5FYBA 3GXUA 1O8PA 2Y6LA 1Z7S2 2XVLA 1SBEA 3DGTA 1C8NA 2PYTA 5K0UB 4ARYA 1W28A 1OD3A 2DBIA 1KGYA 4HK9A 2NP0A 4M00A 5FO7B 1A78A 1RUE2 2I07B 1TVGA 5C70A 3DCQA 4XACA 4N8MA 1PM7A 2WWSA 2B46X 1H4GA 1QJY1 1RHI3 3KT4A 3Q8AA 5FY9A 3CNAA 5J96B 1P8JA 2FQPA 4YFZA 5DUWA 2VO5A 3RFRA 3DF0A 4XFHA 5FPLA 3GBWA 2CSGA 2W87A 3CJXA 4IE5A 1W9YA 2HWB3 1UOBA 2C0ZA 3UJOA 2D6PA 4GB32 4XTPA 2WO3A 5A3TA 5J48A 4YARA 1WW5A 1MZ6A 5JSOA 3GF6A 4I01A 2A6YA 3I2DA 2NM1A 3VBUC 4BK4A 3EB7A 2CNAA 4NHXA 1ZYBA 2VJXA 1YUDA 4BE3A 4AEKA 5A7SA 2WO7A 1RUH1 1W8WA 4HMZA 2W1QA 4XQ4A 2WZR3 4O7XA 3IT8A 3HEIA 2PA7A 4HLTA 4JKLA 5JMCA 2IFWA 3HNBM 4RGGA 1W6OB 1CZTA 2B9UA 2W5FA 2VMIA 3HMYA 4NN0A 5FXXA 2J1SA 3OBTA 5EJZB 4BWOA 4EN7B 3U4SA 1UYPA 4NIGA 1WCKA 2VZTA 5T5LA 2RMU3 4QB2A 1COV2 1UYXA 2VULA 4ORFA 3ALQA 3GGLA 1H9PA 2R1BA 4W4ZA 5FYVA 5L73A 2R061 2W3JA 1ULGA 2G9GA 2ZGKA 3FFZA 3OCPA 3EXUA 4QAWA 3BTAA 4FQZA 5KHJA 2HLEA 4BQ5A 2XMLA 1RINA 4IDZA 4WV8A 2Q30A 1PK6B 5FUIA 1O3TA 2BPA2 1G86A 2LW8A 2ZMNA 4M3CF 4QKBA 4ATEA 1HN0A 3LE0A 4L99A 3ZMOA 2YC4A 2W9XA 1LOFC 3WDVA 4K3UA 1QJFA 1Q8OA 4UF0A 3DL3A 2W1SA 1ZVFA 2W08A 4YFWA 4U2AA 4BISA 1AYN2 4Z2AA 5DZGA 1L3JA 1MACA 1GWKA 4XDQA 1CN1A 4GWIA 3A0KA 2BW8A 2FCTA 1ZZBA 3GCWA 2HWE1 1WWYA 3JZVA 5F1RA 4Y1ZA 2JG8A 1QJY3 3P5BA 2ZACA 3K75B 3DPRC 2DV9A 4XOGA 4HVRA 4MHRA 5LA9A 4AHZA 4Q4W3 4BU2A 3NNJA 3AYDA 4LO8A 5A6QA 4CTEA 1XU1A 1O59A 4N53C 4AAXA 2VW0A 1V70A 1SQ4A 4QPWA 4ASMB 3OGVA 3PNAA 1H6XA 4ASLA 5FZ7A 2RS12 4CDQA 4KG0A 3H3UA 5T52A 4CCCA 1A6CA 3BYWA 4QHBA 1LRHA 3FLPA 3IKWA 1H1AA 4B7KA 4DMIA 1HN1A 3HQUA 1W9WA 4UYBA 4GH4A 4HONA 2XLFA 5CFDB 1RYYA 4LMFA 4K9SA 1QJU1 2QQLA 1XYPA 1C28A 5F2WA 1GP5A 5BNPA 3VN4A 5CKMA 2IXLA 1IOAA 3FLRA 4IL7A 1GQHA 3WCSA 2VM9A 3WQ0A 3J4UH 5JWPA 4RL7A 3CKHA 2TNFA 1PVC1 2Q8EA 1GV9A 1QF3A 3TEWA 3POSA 4NPRA 3TNPB 1N3PA 1FV2A 2QZ2A 1X8EA 1W6QA 3S7EA 4LR4A 4CP0A 1SBFA 2DCYA 4XDPA 3WF1A 4Y33A 4E2SA 2NLRA 3HBZA 4LK6A 4XJ8A 1EYBA 4JTNA 4S2FA 2X5IC 5C8CA 3PUSA 2W1WA 2R063 5FZ1A 3KM5A 3DXTA 3B93A 1LEDA 1VBB2 2K2SA 2Y6FA 1GQGA 3IDEA 3IN9A 1NA1B 4MLOA 4ZXKA 1QWRA 4QXHA 4BJ0A 2A73B 3C7GA 5H9SA 3ZSEA 2ENRA 1KS4A 1LGBA 4GJYA 1QH6A 5FQ0B 3APBA 2GP3A 4PHZA 1OA4A 1KEXA 1BKZA 2HWC3 2A6WA 3A4UA 3UETA 1BBT2 4BMBA 1VBE2 5LB6A 5FKBA 2EALA 1MQTA 4LXLA 4FPYA 5C5UA 4ARXA 3K4ZA 3ZSLA 3C7HA 4J6GA 4MGQA 1ZREA 1DQ6A 3AK0A 1SLTA 3B02A 3POEA 5C9AA 1JZ4A 3AYEA 5DDJ3 2QFEA 3HIFA 1VBD1 2VOKA 4C0HA 4XFBA 5A6ZA 1HB1A 1OMIA 1Y43B 3AM2A 4MHUA 1RUG1 3ZXAC 4CXYA 5ISLA 4XABA 5GLUA 4YVSC 1JUHA 5KXDA 1JHNA 2VOWA 5FZGA 3BU7A 1D4VB 3JUUA 4AOCA 1YFXA 3M70A 2RM21 4UF0B 2MEV3 4IXLA 3K77A 3QD6A 4PCRA 5EXOA 4XPVA 5CFCA 5IK7A 1GZ9A 4LT5A 4CEWC 2JJ6A 3VBFB 3EMRA 2QQUA 4XZUG 5F3IA 3U37A 1V6OA 4KWUA 5E16A 3N7MA 4CDWA 1MEC1 3W21A 4DY3A 4WVWA 5DAWA 4EN8B 4NRMA 3P6BA 1Q3EA 3T08A 4P00B 4XIOA 1NY71 2Q0AA 4D6SA 2BV4A 1RUJ3 2V72A 3KQRA 5IVCA 4MG2A 5HCBA 5FYHA 2PHWA 4NIIA 5C71A 2XL7A 2V5DA 3AFGA 1VBC1 3MIBA 3AZYA 3E97A 4GIQA 2Y38A 4JC1A 1ZA7A 4XFAA 4GH4B 1F8VA 2PMWB 5FY1A 2VNGA 2WLQA 3ZSKA 4DXRA 2DTWA 5K9YA 3M3EA 1R091 3J8F2 5FLIA 4CCNA 1W8OA 1AX0A 4RQPA 3O7OA 1Q8SA 2DCJA 4YM0A 3ROUA 1UPSA 4HK8A 1SMVA 4RS5C 3E5XA 1ND3B 1MZEA 1ZBE1 2JE9A 3OUJA 3O1MA 4A6SA 3BB6A 5BXXA 5K8SA 4HFSA 4M0NA 2SLIA 3WX5A 1NCQA 2DWRA 1GANA 4PT6A 3RWKX 3WINE 5J37A 4DQAA 5FPBA 1W6QB 4UFKA 4NAMA 5C4WA 3E1F1 4XW3A 2WSUA 1UL9A 2D6MA 1OC1A 4G3YC 4KWJA 1NLQA 1WGPA 5B4NA 1RUC2 5A6XA 4RGAA 2IC1A 2XB6C 5AC91 2HWD3 5BY5A 1DQ5A 4FVVA 1G9CA 1UN1A 1VRBA 3RPQA 1LHWA 2B7YA 2JEMA 4XMIA 1UMIA 1IKQA 4FPEA 1F35A 3ZR6A 3AYCA 4OI4A 5DUXA 4COVA 3ILRA 4GD4A 2FHRA 2W46A 5J36A 1ZBA1 1J1LA 2XL9A 3ZXGA 2ID4A 3WZ1A 4NIDA 3ES4A 4NHMA 3VL9A 3AMPA 5A6YA 1W3XA 4FT8A 1MZ5A 2D93A 3ACFA 2ZAHA 4MVTA 2RM23 2C9KA 3N4MA 1QXJA 3AJYA 3LPFA 3TOJA 4EN9B 2AEYA 4XDOA 4EQVA 1MQTB 5GZCA 4M3CB 1UY1A 5IW0A 1MS0A 1DQ4A 1V9U1 4Q0QA 5K7PA 1LNSA 3CJIA 5F9TA 4GA9A 1IG3A 4FOVA 3M1HA 5LA2A 1MEC3 1N1YA 4NIAA 3PUIA 3LDBA 3R6SA 4DXTA 3OG2A 2AEZA 5LATA 1JOPA 2D97A 1N1SA 4O9EA 4A41A 4LBQD 5KC6A 4JDMA 5IVYA 5JUVA 3AZWA 2PAEA 2IFRA 4YPJA 3OPWA 1I6XA 1VBC3 2UYAA 1TMF1 1QY4A 2OS2A 3JD72 3OB8A 5CFCB 4Q4V1 1Q43A 4LBOA 2AZ5A 2QE3A 1F4HA 2ZEZA 5SV8A 3ZOIA 4AEMA 5IVFA 4LQRA 3ZN6A 5IVJA 4CDWB 4Q4Y1 1R093 2A3YA 1PZ7A 2DVAA 4FOWA 2AYHA 1N3OA 1LESA 2RS31 4OUSA 5C3QA 4IV3A 1CX4A 1H4HA 4BQ3A 1ZBE3 2YFZA 3AKTA 2ZKNA 1JOJA 2DUPA 1E5HA 2PLV1 1Q8VA 3MFAA 4OHXA 2HWB2 4N9HA 1EUTA 4FBFA 1O3QA 1KFXL 2WO1A 1OI6A 3PMEA 4GAZA 5CU1A 2YBPA 2AENA 2TUNA 4NHYA 4CRQA 2BNOA 5DMYA 1S0GA 4K1YA 2VGDA 1G6NA 1FOD1 3MIFA 2WNOA 1RUE3 5JOZA 2ZABA 5AC93 4E8DA 4LTAA 2GALA 2RDQA 1W9SA 1N47A 1D0GA 2W1UA 4RQPB 5IVEA 2ETEA 4CCLA 3PMSA 1QJEA 3DXUA 3FN9A 4LITA 4RHV2 1DGRA 4P9IA 2JWPA 5BNOA 2FDJA 4O9GA 1DLLA 1NCQB 1QNWA 3LFIA 1ZBA3 5B4XA 3D3AA 1AJOA 1N1TA 2X10A 1PGW2 1TE1B 3ETQA 3ZFFB 1MS1A 2C1FA 4YRDA 1ND2A 3I3DA 4QDQA 4PBPA 3MI8A 5FYSA 1C4RA 1NQDA 2RMU2 4R8HA 3BIWE 1UIKA 2C6SA 1E5SA 3T2PA 1ZZ7A 2JG8C 3TBDA 1FT9A 3H9AA 4E4SA 1ENRA 1W2TA 2JD4A 1S1AA 1NLRA 2R6QA 2ZHNA 1IZ3A 1F31A 1WA4A 2OXBA 4OULA 1YHFA 3M7AA 3W9AA 2NZ9A 2JG9C 3NV3A 3PTYA 3VHRA 5L9RA 3FJSA 4CDQC 4OQ8A 4COZA 4LBNA 4GQ7A 3BTYA 1RJ8A 1W05A 2PHFA 5KR7A 1JYWA 5CADA 1GU3A 3VKFC 3ZXEA 2O14A 1DQ2A 2A5ZA 2QBXA 2VECA 2W39A 3DKQA 4YG0A 4HSLA 5JXIA 3AXDA 3IPVA 3NV4A 2JDPA 3I2HA 1QKQA 4LJHA 1VMFA 5BNPC 1M06G 2ZGSA 1S0IA 1NXD1 1IPJA 1O3RA 2ZAAA 4KBZA 5JOXA 1B35B 3OD0A 4LOTA 4S2HA 5L19A 1CGPA 4Q4Y3 2ZGTA 1QJY2 4CCJA 4I30A 4P9XA 1YIPA 1V0AA 2WNVB 4AYUA 2A6ZA 2CTVA 2BGCA 1POV1 2Z5WA 4YW2A 3B9IA 1AL23 1FAYA 1EPWA 2DCKA 2UY8A 4AR2A 3PJQA 5A7QA 4C8DA 3OBAA 4COUA 2OPWA 4HANA 4UW6A 1JZ5A 4XQWA 2VNRA 1H2KA 1OA2A 4EWDA 2IVJA 1BEV3 3NRUA 4AQ6A 4LA2A 1BLZA 3ZR5A 4N43C 3I3EA 4GWMA 5C8CC 5EV7A 4IE0A 3ZN6B 2E9QA 5EHDA 2VL4A 3U10A 4ES9A 3KVAA 1XJAA 2W91A 4P9LA 3VDDB 4RR3B 1JZ8A 4XF9A 2ZCWA 5GZGA 2B45X 4Y1XA 5ANQA 1X9TA 5DAPA 4Z92B 4IV3B 4LBQB 5LY2A 4NAOA 3CF6E 4AHXA 5BNNA 2R073 5CISA 3TRSB 4Y4RA 3AL5A 1OLME 3CDZB 3JBG1 3MO4A 3HN3A 4XETA 1GYKA 1AR81 1H6YA 4B7EA 4KWLA 1ZRDA 3RG0A 2XQXA 4EWAA 5F2SA 2JD9A 5A3OA 3RMYA 5C9AC 2WT2A 1IPKA 3J7LA 4CEYB 1MS9A 4OMDA 3THPA 3WDUA 2Q8CA 1URXA 4R9BA 2R062 2VZUA 4BLJA 4CXWA 1XPWA 2QQJA 1GZWA 1YYNA 2B9VA 3ZYIB 3KT1A 3DPRA 3PDQA 4HKWA 3K3NA 5GLVA 1QH7A 4GZ9A 1XSRA 2ZHLA 3RVHA 4FI9A 3KMHA 4N53A 4QM9A 5FUNA 1LKNA 2BVVA 3ZYJB 4Y1UA 2ZJCA 4HKOA 2OUJA 1D4M1 2W94A 5FBZA 2VCAA 1KXGA 5T5OA 2HWC2 3K46A 2B5HA 3N3HA 2JIGA 2VXRA 5D8AC 3N9LA 1U5YA 2Y0OA 5JZGC 5FK7A 2FDKA 1I5PA 3OEAA 1A3KA 1IQDC 2BYVE 3MPBA 3UYJA 1VBB3 2V09A 4MADA 2ZGQA 2RJ2A 3UK9A 1AR71 1Q8QA 1VRH1 3OBRA 3KCCA 3DYMA 4HT1T 1GOGA 4K8RB 3POYA 5FZ8A 1ODNA 4D7TA 1POV3 2F17A 1FNYA 2K46A 3BPSA 3VD3A 2A6VA 4EYUA 2UWAA 2MEV2 4XFIA 2V4VA 1CONA 1W06A 1WMDA 5KWRA 4XUOA 3VBRA 1ZRRA 3VZKA 1HX6A 1WCSA 2ILMA
chains in the Genus database with same CATH topology
1SFNA 3VBUB 5FLJA 1S0BA 1PO21 3R0RA 2VW2A 3OPZA 3RI9A 4KH9A 1REEA 1CAUB 1O4TA 1RUD3 1S55A 1SACA 1VR3A 4Y1YA 3TYJA 1RUJ2 3PVBB 2OPKA 4YGDA 5I91A 3N36A 2R0FA 3JBG3 2P3KA 1AR83 2IXHA 4BPZA 4AF9A 2UWCA 2ARBA 4M0HA 4MGZE 2CWSA 1SLCA 2D98A 4A7ZA 2HEYF 1DQ1A 5T50A 4JGZC 5LK7B 4B4RA 4PLOA 4Q27A 2AUYA 4YVWC 1C5HA 1FMD3 1R081 1PO11 4LO4B 1EPZA 1V6LA 2GN7A 3O5SA 3MGUA 4XBLA 5DZEA 1PIV1 2JKBA 4H7LA 4BLIA 3BODA 1D4M3 3ILNA 4NO4A 2WIIB 3S6PA 4AVAA 1AYM3 5SV5A 3J8F3 2HWD2 1DIWA 4CEWA 2QKDA 2QJVA 3M3QA 1CQ9A 3FMGA 2XBO1 3DPRB 5T55A 1AR73 1VRH3 4Q4X1 3HD8B 1RUG2 4N53B 2FZ2A 1XE8A 3CO2A 2R0HA 4FPKA 2RM22 4L97A 5AFEA 1BYHA 2ZHKA 2ZZJA 3Q9OA 4D7SA 4XYXA 2HEWF 1LTEA 2PHRA 2EAAA 5FPXA 1PO23 4E9KA 1AHSA 1MEC2 1X33A 4C90A 2D44A 2O0OA 3AZXA 4CDUC 2R041 1NY72 3MLJA 1RMU1 1KDMA 1V6NA 5IUQA 3AZZA 2ZX3A 4I09A 2WA3A 1LEMA 1VBC2 3J26N 5J3UA 3GNEA 4JAAA 1KS5A 3MW4A 3I54A 4Q26A 1R092 2JECA 1ULEA 3WDWA 2X5IB 1YXWA 3ES1A 3H50A 3WG2A 5BNOC 3D4KA 1CAVA 3H3ZA 1R083 4F83A 1ZBE2 3CL1A 1H0BA 3DV8A 1GKBA 4Q0UA 5T5JA 4HVQA 1ND2C 1UU6A 4FPGA 4K21A 4XJUA 2QQPA 1BK1A 1OLRA 4WBBA 4AFMA 3JD73 1IKPA 4YZ3A 1FNZA 1VLNA 3B9CA 4XJ9A 2EXKA 2Y0IA 4YLZA 3MPPG 5AC92 3U11A 1ZZ9A 3VUOA 1YNAA 1XNCA 1YJKA 4OHYA 2VPVA 4Q8KA 2XBO3 1H8TC 1POV0 4HVOA 4R4XA 3IIAA 3ZDSA 3U0ZA 1W6NA 1ZZCA 4UW4A 1ZBA2 2VUAA 2VUJA 4YVSB 3WVJA 3ZFEA 1QHDA 3V56A 3ZIWA 4BMEA 4EN6B 1N3QA 3RQ0A 4MH0E 5FMOL 5DUUA 1K5MC 5HBAA 3GZAA 4CEWB 1ZZ6A 1PGSA 4AXOA 4C1XA 2TBVA 2RJLA 1O91A 1AVBA 5LEJA 2W0XA 3SITA 5JI9A 1QJZA 4RHV3 1HRI1 2R043 3GYDA 3NJZA 1JW6A 1XNDA 1RMU3 2I45A 3HN1A 5GZFA 3UKVA 4H55A 4QPIA 2WLPA 2WS91 1TMF2 2PHTA 1OHFA 1GSLA 2OVUA 2PHXA 4XHBA 2WNUC 4AI3A 2NPIA 2JENA 4Q4Y2 5F6LB 4LO5B 1TNFA 2GNMA 2B42B 5BNNC 2XG3A 3OY8B 4YG6A 4RS5B 1OOPA 1QJX1 4LLOA 1FATA 1JN2P 5FMOS 4MV2A 2PHLA 1AL22 1CPNA 4Y5Z0 2PLV2 4QPYA 4D69A 1U5IA 2VNOA 4KGGA 2GSYA 1BEV2 5FLHA 2JX9A 4X8PA 2PHUA 1YIFA 3UKTA 2X8KA 4LNVA 4IEVA 1BZWA 1UCXA 2LALA 3VZOA 5DUVA 1LULA 1CAVB 4AVTA 2JG9A 3VKMA 3KGZA 1YFWA 1OA3A 4QPGA 1CESA 2YY1A 4B4PA 2R072 5KXBA 3HQXA 2OA2A 3JCIA 3B5LB 4XFGA 1I5ZA 4GMP1 4NWWA 1IHMA 3INAA 5LRRA 3E5UA 4K8FA 3WG3A 1ASJ1 1EP0A 2CY6A 1TNRA 2RR11 1GNZA 2GZWA 2BWAA 5HXVA 4XF0A 1RUI1 4AI1A 4BM8A 4AGGA 1RUH3 1XNBA 4OUMA 3LAGA 4BQ1A 4R52A 3I4IA 2GAUA 3O0VA 3QACA 5ABJC 2A3XA 1R1A1 1W6NB 1D2SA 2GDFA 4HSJA 3ZX7A 1RUF1 2Z79A 3LKJA 3VBRC 2ZZQA 2FMYA 3R4UA 3BPZA 3N35A 3WG4A 2WS93 3RI8A 1KDKA 1NG0A 4OHVA 4Q0VA 4N43A 4C91A 2GC3A 1JXNA 4OLLA 4A7YA 2YROA 4AE2A 1RJ7A 2P34A 1U12A 4YZ1A 2DUQA 2KA3A 2SBAA 1BJQA 4FPJA 1QJX3 1BCXA 3GHNA 4L2NA 2FBEA 2GH2A 5I0UA 5GZEA 3KCXA 3WNXA 1Q8PA 4IV1C 1CD3G 1MVEA 1PNGA 3M2MA 4I0AA 1PNFA 2BQPA 4IETA 4LBKA 2CWMA 4WVVA 3ACLA 1OQDA 4QQOA 3M8LA 4COYA 3VBOC 1DGLA 2HWE3 2VY0A 4HETA 4OHZA 3R05A 4P14A 1FI2A 3K51A 5ACA1 4K20A 2DVGA 4A2UA 1RUD2 4MXVA 4Y26A 3MW2A 1SFYA 1PGL2 4R9CA 3JBG2 1MS3A 1Z78A 4F8AA 3J9SA 2GC0A 2WSVA 4H7MA 1AR82 3VZLA 2LM3A 3V65A 2YV8A 1XU2A 4GMP3 4XF4A 2E53A 2WFPA 4PDWA 1TEIA 1QJU3 3MYXA 2D5HA 1ASJ3 3WXPA 2RR13 5D8AA 5EFUA 2JG8B 3HR9A 4W65A 5JVVA 1YLLA 5JZGA 5JIAA 4DPNA 4Z07A 1FMD2 1PVC3 2JG9B 2VQAA 3AMNA 1YCIA 3NSTA 4CDQB 1IS3A 4AVCA 3MDPA 5FO9B 3WT3A 3U4XA 1AXZA 2NMOA 1UKGA 1GLHA 4YW1A 4FTEA 4W6XA 1D4M2 4XQDA 1S0FA 3WP6A 1UMZA 1AYM2 4JDOA 5BNPB 5CG8A 2DYCA 2DURA 2YZ4A 2DU1A 5C33A 4C0BA 1JYIA 4PJYA 2D3RA 5I93A 2XJPA 1QU0A 2O8OA 1AR72 4MGIE 1VRH2 3WHUA 1F5FA 2AH2A 2PAMA 5I8SA 4AGRA 2VMGA 4AQTA 2ZGOA 2RJKA 2ZGUA 1DGWX 4R9AA 3CLPA 3OJBA 1OFSA 2A7AA 2XH6A 4AQSA 1HQLA 4QGLA 1HV1A 2QNKA 2YC0A 1LENA 3L2YA 1FV3A 3WG1A 4N43B 1ENQA 5C8CB 1RVF1 1PO22 3ECQA 1VBD3 1KRIA 4JGZA 2XLGA 3RRDA 1JH5A 1YFYA 1C3HA 1RUG3 4YVWA 2ZBJA 2BEOA 5CVRA 4N7UA 4BYYA 3OD4A 5JIUA 2GN3A 1SCSA 4FQ4A 3H7YA 4PIXA 2XGXA 3LB9A 2X53S 5CBLA 2GC1A 4FP3A 2DCZA 3L9JT 3AMMA 3HAGA 4OHWA 2ZTNA 1CR7A 2NMNA 5C9AB 1AL0G 3RS6A 2EVXA 4EROA 2NQYA 2C9AA 4PLNA 2VVEA 1GFF2 2WA4A 1M4WA 4AGVA 3SHRA 4ONUA 3H0OA 1R082 4G4FA 4XMAA 3NW4A 3ZFEC 1AXKA 3DKWA 4XFFA 1KJRA 2QCSB 1YI9A 5D1IA 3V0BA 4OI1A 2HEVF 2HWF1 4MXWA 3VHPA 3BOPA 1ENSA 1LU2A 1DU3D 5JOWA 3JQWA 4LLFA 1BMV1 4DZGA 2GNTA 4IERA 5D8AB 5GLTA 2V5YA 1LHNA 2XBO2 4D94A 5EYYA 4KGQA 3ZYRA 2BVBA 4CDUA 4XZPA 3VZJA 4QMAA 2ZPXA 4JGYA 4Q4X2 5GM0A 1QDCA 4QPIC 4DINB 2ERFA 2DCTA 1MS5A 1NCRA 3VGIA 1LR5A 2YHJA 1VJ2A 4KNCA 2P3IA 4R4ZA 4HKLA 2ATFA 2E6VA 3RJRA 4WM8A 2Q1MA 1J3PA 4FAGA 1Z0HA 3JQXA 1ZNPA 4CDXA 2YUEA 4Q8LA 3B3QE 4CZSA 1OOPC 2UY9A 4P9GA 4AI2A 2R042 4KL1A 2D40A 3IM0A 4FXKB 1RITA 1YFUA 2YDEA 1YRZA 3AYAA 4DRVA 4MZUA 3ZXFA 1AYN1 1RMU2 3BOWA 2WFF1 3WDXA 4GMP0 3VBSC 3FC0A 1V6MA 4WZFA 4DXZA 3L2HA 1WMFA 1ZRFA 1OSGA 1XE7A 1V9U3 2KM2A 3N7LA 4LBJA 2RE9A 4XBNA 5E89A 4AW7A 3M3CA 3ASIA 3KZ4C 1AXYA 4JGZB 3NAPA 4GXLA 4QPGC 3O14A 4FXGB 3LOIA 4YVWB 1H8TA 1JBCA 2DF7A 4WM7C 3RYKA 3ZSMA 2W52A 1Q5OA 4AI0A 4AEJA 2BNNA 5GJ6A 4FTSA 1NQJA 1TMF3 1U0AA 2IZWA 2WL1A 3ZVXA 3MLKA 2HWF3 4Q4V3 1LGNA 1QQP1 2MPFA 3AZVA 4E4ZA 5LK5A 2JICA 1K5MA 3CJIB 3NO8A 4RA0A 3POWA 3TWIA 3D5OA 4IEOA 4FPCA 4OI2A 2RS33 3ZN4A 4YW4A 5JAXA 1S0DA 3ME2A 4KU7A 1H2MA 1WLDA 2PLV3 4LA3A 5JPNB 3MF9A 3FBYA 4HPKA 1ZM1A 3AMHA 1REFA 4SLIA 1S2KA 1C5IA 1H1MA 4URTA 1FOD3 5FDBA 1JTZX 2WT1A 1ND3C 3K48A 1NOVA 2WNUA 3AP9A 3ZMNA 5JOYA 4Y1VA 1CJDA 1RUH2 4DY5A 3M4FA 2CGNA 2R16A 4TWTA 1PMIA 4CDUB 3E6BA 5L36A 1CAXA 1W6PA 2A70A 1V6KA 4YW3A 3RSJA 1BBT1 2W68A 3ZPYA 1WW6A 4QT6A 1MZFA 2WFF3 1Y9QA 3KS7A 2IXKA 3ILFA 3UV9A 3KSCA 1R1ZA 3UJQA 3FUQA 1X36A 3USSA 2WS92 3VL8A 4OI0A 3MW3A 4GULA 3MICA 2ZA9A 5FO8B 3B00A 5CB7A 5I0SA 2WQ4A 4JRLA 1G9BA 4LHKA 4IEXA 1OPMA 2A75A 5BNOB 4COWA 1ULFA 5FOBB 3P3NA 1V6IA 1QJX2 2EXJA 1J58A 3M3OA 3RJ2X 1ND2B 4HL0A 2HYKA 4XXAA 2ZS6B 4I0BA 4PDWC 1VAKA 3WOGA 1IS6A 2FMDA 4IEUA 1REDA 4YW5A 2V73A 1QQP3 2MNGA 4KWKA 5E8AA 4QX5A 3IMNA 4Z1VA 2HWE2 3MZHA 1MS8A 1OQEA 3WDYA 5JPMB 3T1LA 3ZXJA 2Q5TA 4A7KA 1LECA 3LGRA 2ZGPA 4DNYA 2IXIA 4YZ5A 2WNEA 1H8TB 3QH7A 3H7JA 5ABJA 2XPJA 4LBMA 4LUKA 1LOEA 1G8WA 2XVGA 3USUA 2DTYA 3LWCA 2VVFA 1VB4A 3FUOA 3IPVB 2Q1ZB 2WQZC 4Q1PA 1RUNA 3D82A 5JLVA 1QJU2 3LSDA 1K5MB 1ASJ2 2FZ1A 2RR12 3EQEA 3OYWA 3LCPA 5H9QA 1BXHA 3WP5A 2H6CA 1CVNA 3AXEA 2VMHA 1LGCA 4XILA 4W6WA 4BIFA 1O3SA 1PVC2 2RS51 3SXWA 1GNHA 1DG6A 3HT2A 2AGSA 1R1A2 3R4SA 4HPKB 1WLWA 5J98B 1LOBA 2YYOA 3PVEA 3TB0A 4MUVA 2XUMA 4YZ4A 2LUWA 4FPHA 4LO7A 1NZCA 2O8QA 1TQ5A 4IV1A 4N90A 3SLIA 1OQ1A 1W6MA 3H1WA 3AP7A 5C6CA 3BALA 2WNUB 2A3WA 4ISQA 3VBOA 4S2GA 5BNNB 1W6PB 1UX6A 2BUKA 3LA2A 3SMHA 1SLAA 1C1FA 5K0UA 4UBGA 4UBHA 1W2UA 5FRAA 1TME1 4BHPA 4W6YA 2PQQA 4IEPA 4UW5A 4X6RB 4FP2A 1Y7BA 4P9JA 3SISA 3VBHC 5HCFA 1GZWB 1VBD2 3D0JA 4M3CE 2OW4A 5ACA2 3NV1A 2K0GA 3B94A 4NHLA 3S30A 2X29A 1H30A 5GLZA 3WV6A 3PVNA 5F6KA 1RHI1 4FOQA 4QD2A 5KHGA 1FX5A 1EAH1 2EIGA 4AEDC 2VH9A 1VIWB 1LHOA 4K7JA 5HI0A 4E2GA 2YGMA 4JRAA 2HWB1 4JGYC 1PZ8A 1NLSA 4JCKA 1DZQA 1AR61 3B7MA 2BWCA 4E4DX 3QCWA 3RWNA 1WLCA 3ZXDA 3ZFGC 4KU8A 1NCRC 1A8MA 2E7QA 3VV1A 1DGWA 2ZGRA 3VBRB 1HDKA 4RR3C 1H2LA 4WM8C 4F7ZA 3FX3A 4L8QA 2WZR1 4MX3A 3ZIXA 3MIDA 1AR91 4CDXC 2CGPA 3OYWB 3T1MA 2NN8A 4F3JA 2OYZA 3QH6A 3GZUC 3ZXKA 5A32A 1PO13 5EJ3A 1DZTA 3S7IA 3B69A 4XF1A 1PGW1 5HCAA 5JDBA 1ZRCA 5AVAA 3RYPA 5J09A 1LOCA 3ZYPA 1PIV3 1UPIA 2WC2A 1OLQA 4FPFA 4AWDA 2CAVA 4OFGA 4ES8A 3HWJA 4IV1B 4KG8A 1UZZA 4Q0SA 3NAPC 5GZDA 2UWBA 2D7FA 1WD3A 3VBOB 2N7GA 3AMQA 1JYCA 2GNDA 2RHPA 4FOYA 2R30A 2XJVA 4Q4X3 5I8YA 1V00A 1PZ9A 3THTA 3S0MA 4PBOA 4CP2A 4QU2A 5CFDA 4NR1A 4L9BA 5FFOC 1N1VA 2ZGNA 1LCLA 1QGLA 1V9U2 4Q4W1 3M3IA 1EAH3 1H1IA 2D6NA 4GWNA 2JE7A 3N7KA 3KLSA 4FTBA 1LODA 4Q0PA 4AVBA 1NE6A 3EJKA 4V1PA 2BFUL 4WZCA 1AR63 1SDWA 4K1ZA 3ST7A 1HRV1 2D43A 2CV6A 4ITCA 2IXCA 1XXNA 4UW3A 4YM3A 1G9AA 1HXS1 3B01A 3KGLA 3ENRA 2GC2A 1ONAA 1RGSA 2HWF2 1HIXA 4Q4V2 4RSUA 4YZ2A 1XNKA 5DXDA 3NV2A 3H8UA 4AQ2A 4META 1BMV2 2QVSB 3PHMA 4Z8BA 1AR93 3D0SA 2E7TA 3AX4A 3SCGA 2BNMA 1NA1A 2AREA 1QOOA 1WCDJ 3MIGA 3OF1A 3IDCB 5L7OC 3ZSJA 1Y3TA 1U5XA 2P2KA 2RS32 3ELNA 3IDBB 4BZ4A 1KFUL 3G7DA 3LA3A 5FQ0A 3RZZA 4YM1A 5KXEA 4IQPA 4YNIA 4ATFA 2I2SA 1VALA 4QQPA 3VBSA 2P3JA 5JSPA 1FOD2 4L11A 3O12A 2ZGLA 4K40A 5FTTC 2BFUS 1S2BA 5GLWA 5T5PA 1CJPA 1O4YA 5A32B 3SCFA 3ZXLA 4G9SB 1FPN1 4Q1RA 1DFQA 2HWC1 5FOJB 1S0EA 4TLFA 4WM7A 2XJUA 1SLBA 3V0AA 2WFF2 2XJSA 5CIRA 3VBFA 5DDJ1 1V6JA 3A0NA 1WLTA 3I7DA 5F5QA 1VBA1 3N7JA 2GNBA 4Q2FA 3AKQA 3SH4A 1WW4A 3WW1A 4YGCA 3FFQA 4XTMA 2G9FA 4KQ7A 1HRI3 2XHKA 2QDNA 2A6XA 4BH9A 2MEV1 5CAZA 1HRV3 2XVKA 3ZFEB 3ZO0B 3SH3A 1DF0A 5E88A 1GZCA 3I8TA 4Y22A 2CYFA 4WVZA 1IQAA 1YJLA 1HXS3 3I59A 1O5LA 2P17A 5JCTA 2DUOA 1QQP2 1SEFA 4ZKTB 5AFBA 4LHNA 1UF2C 1ND3A 1RUJ1 2WZPP 3NKGA 4SBVA 1RL3A 1J59A 1SLIA 2CAUA 1EV11 2ZGMA 4LHLA 1C57A 1D0HA 3DN7A 3D8CA 3AKSA 1EY2A 4PIYA 1C8M1 2ZX0A 4QPIB 1SBDA 2WJSA 4AFBA 1QDOA 1QOSA 2WT0A 1HKDA 3UKNA 2NYYA 3NL1A 2F6BA 1LU1A 3T2TA 1WD4A 1H2NA 3OTFA 2VOXA 3C2UA 2DU0A 2IXJA 5A3LA 1OOPB 5K0UC 3TN91 1FPN3 4AHWA 1LJ7A 5H9PA 1I3HA 2PHDA 4JDNA 2BBVA 1OKQA 2HWD1 4M3CA 3VBSB 4WVMA 3TNQA 3TAYA 2EF6A 3O0XA 1GICA 4Y4YA 1CIWA 3V64A 1VBA3 4EWEA 1RUI3 2DFCA 4XFCA 4HN1A 3U07A 4L92A 5T3NA 4QGMA 4QPGB 1S0CA 2H0VA 1R1A3 1IS5A 4WM7B 4ZU7A 3MLLA 1RUF3 3CEWA 3V0AB 3E6DA 2YXSA 4QQLA 3SCHA 3ATGA 1YWKA 4RD7A 2Z42A 2TEPA 1B09A 2VG9A 3JB4C 4XF3A 3ZYGA 4BA6A 2CGOA 1VP6A 4B29A 2YMZA 1RIRA 2PTMA 1EV13 1VAVA 4Y22B 3GALA 3URFA 1C8M3 1I1EA 1HLCA 1HQWA 3AB0A 1A8DA 1E57A 3I59B 4EN0A 4MYEA 1MR5A 4Z82A 1ZZ8A 2B39A 4M01A 1PK6C 1DQ0A 2QUOA 4AVVA 1HV0A 4XJZA 3O0WA 2YPJA 4R9DA 3OGJA 2CL2A 2PFWA 5J7MA 1W39A 5E1RA 2QZ3A 4Y20A 4XBQA 5ACA3 3JU9A 3QBQA 1Z7S1 4Q29A 1WUVA 2PN5A 3CU7A 5FREA 5A33A 2RS52 3MFCA 3ZFFA 1AUYA 3TN93 4H14A 3WQ1A 3WLUA 2GMEA 4LO6B 1RUE1 3BCWA 3VKOA 5JSRA 4J1WA 2H6BA 3VHOA 2BTVC 1LB2A 4DB5A 3H1MA 2ET7A 1U5ZA 5BUVA 4AHYA 4TZDA 3JB8A 3VBHA 2GU9A 4GB31 2Z2SB 1PO12 2PAKA 3KT7A 4AG4A 1DYPA 2H0BA 4TSVA 5CFDC 3P3PA 1OD5A 4LE3A 1PIV2 1BVVA 4QQHA 5IK5A 5FAXA 4WVMB 1LHVA 1QOTA 4PDWB 1B35A 1ZX5A 1TME2 4LEJA 5CNAA 4YSFA 1ALYA 1IS4A 3OGGA 1GBGA 2ZMKA 1JUIA 3G6JB 4J1XA 4AEDA 2EA7A 4NHKA 5JZGB 2WINB 4C1WA 2WNVA 3WCRA 4X6QB 3AFKA 4UXAA 1MVQA 3FBMA 4EV0A 4XXPA 1CPMA 2D3PA 3VKLA 1LOGA 4TYSA 2ET1A 3VLBB 5GKAC 1UW8A 1AX1A 2OZ6A 1COV1 1OPOA 5BV6A 4YYOA 4XIKA 1C1LA 4LULA 2HKXA 3ZFGA 4QXKA 3WQ7A 1NYWA 2XJQA 3VDDA 1RHI2 4RR3A 4B3NA 3GHMA 1NA1C 1UZYA 1RVF3 1WW7A 1EAH2 2LTNA 5DG2A 4LBQA 4INDA 2Q4SA 2ZX4A 1HQNA 1X50A 1AL21 4AFAA 5FCCA 1Z7S3 1AR62 4OVEA 3R4DB 4JV4A 2XLAA