1RUJ2

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj200
2ZAHA 5ABJB 1AR63 1ND3C 4GB33 1AR73 1RUJ1 1OOPC 4PDWB 2R043 1R081 4WM7A 2XPJA 1AR83 1RUE3 1RUD3 1PGL2 4SBVA 1AYN3 2MEV2 5C4WA 2IZWA 2WFF3 1RVF1 1AL22 4FTBA 5AC92 2HWB1 3VBHC 1POV3 5BNNB 3FBMA 5JZGA 1MEC3 3CJIB 1AR91 4JGZA 2RMU2 1QQP1 5CFDA 1HRI2 1TME2 2BBVA 4JGYB 3VBRC 1FPN1 1RUC3 1X36A 1R1A2 5AC93 2RM22 4CDQA 4RHV1 4IV1A 2RS33 5FMOL 2HWC1 3ZFFB 4CEYB 3ZFGA 4Q4V2 1HRV2 1VB2A 4FTEA 1TME3 1RVF3 1ZBA2 3JD72 1PO12 5DDJ2 1VBB2 1POV0 1QJX2 2HWB3 5D8AC 5C8CA 2RS12 1AYM3 1RUI2 1H8TC 4CDXC 4GMP1 1BEV2 1K5MA 5C9AA 2FZ1A 4Q4V3 4CEWC 1ZBE2 1C8M2 1VBD1 1B35A 5DDJ3 1ND3B 1VBB3 4RFT0 1QJX3 3ZFEA 4NWVA 1OOPB 4RHV3 4CDWC 2VQ0A 1CD3G 1NG0A 4YVSA 4RS5C 1VBE1 1SMVA 4YVWB 1V9U1 1BBT1 1PIV3 1C8M3 1HX6A 1NA1A 1QJY2 3VBHB 4GMP3 4WM8C 1EV11 3VBOA 3JBG1 3VBSA 1NOVA 3J8F2 2PLV3 1RUG1 3VBRB 3JB4C 1FOD1 4Q4X2 2X5IC 5BNPC 1R092 1VBA2 3TN91 3VBFA 2WZR3 1V9U3 1RMU2 4WM7C 5CFCB 2WS91 3J8F3 1ND2B 3DPRC 5ACA3 1NCRA 4GMP0 5D8AB 4Q4X3 4RS5A 5C4WC 1H8TB 3JBG3 4CDXB 4Z92B 2DF7A 1MQTA 4CEWB 1F2NA 1NY72 4RQPA 5JZGC 1AR62 4GB32 1VRH1 1AR72 1X33A 4JGZC 4CDWB 3NAPA 2RS51 2R042 3TN93 1EAH1 2R063 2HWD3 1AR82 1BMV1 2HWE1 2WS93 1NCQC 1RUE2 1RUD2 4CDQC 1PGW1 2X5IA 4IV1C 1PVC1 1QJU1 3ZFGC 2WFF2 1COV3 5A32B 4WM8B 1RB8G 5C8CC 1MEC2 3DPRA 1FMD3 2HWF1 2ZTNA 5C9AC 1K5MC 3LOBA 5A33A 1EAH3 4N43C 1RUC2 5BNPB 1CJDA 1B35C 2HWE3 4GH4C 2RS32 3ZFEC 4QPGA 4Q4Y1 4WM7B 2MEV1 1RVF2 1RUJ3 4YVSC 3M8LA 2WLPA 2HWB2 1R083 1AYM2 5C4WB 1NCQA 1AR92 1PO21 1NA1C 2RMU1 1RHI1 1HRI1 4FSJA 1AL0G 3VBOC 5JZGB 1F8VA 4JGZB 5CFDB 1R1A1 4RHV2 3VBSC 2RM21 1Z7S1 2RR11 1WCDJ 1AR93 5L7OA 1QQP3 3JB8A 5BNOA 4QPIA 3S6PA 2BFUS 4CDQB 4N43A 4IV1B 4EJRA 3VBFC 3ZFGB 1FPN3 1PIV2 1TMF1 4GH4A 1PO23 4LLFA 4Q4W1 1RUI1 2HWC3 1NCRC 1RHI3 1OPOA 1VB4A 1BEV1 5C8CB 1VBD2 2WWSA 2PLV2 5C9AB 1K5MB 4FTSA 1MQTC 4IV3A 4RQPC 1B35B 4CDUA 2R071 2GH8A 1RUF1 3ZFEB 3NAPC 2WZR2 1V9U2 4AEDA 1TMF3 1VBD3 4BCUA 4YVSB 5ACA2 4Q4W3 1VAKA 1QJY1 1DDLA 3JBG2 1NA1B 1VBE3 5LK7B 1RUG2 1BBT3 4RR3A 3VBOB 3VDDA 4N53A 1ASJ1 3VBSB 4Y5Z0 1VBA1 3TN92 1HXS1 4NWWA 1EV13 2R062 2HWD2 1RMU1 2WS92 1RUG3 2XBO1 1FOD3 4QPGC 3VBFB 1RUH1 2BPA2 1VBC1 1COV2 3VBUA 3CJIC 1NCRB 4RS5B 1FMD2 1D4M1 1AR61 1ASJ3 4GB31 1AR71 1MQTB 1EAH2 4RQPB 5ABJA 2HWE2 1AR81 2XBO3 1RUE1 3NAPB 1RUD1 1PVC2 1QJU2 1AYN1 1RUH3 1VBC3 2WFF1 1VRH3 1RUJ2 5L7OC 2RS53 5BNOC 4QPIC 1R082 2ZZQA 2X5IB 1POV1 2HWF2 1D4M3 1PGL1 1PVC3 1QJU3 1M06G 5BNNA 3CJIA 3DPRB 1RUC1 1AL21 5AC91 4JGYA 2RS31 4Q4Y2 5A33B 4YVWC 2HWF3 4IV3C 1QQP2 1TME1 1A6CA 4CDUC 3ZFFA 4CEYA 4QPGB 1HQNA 1FPN2 4AEDC 1OHFA 5K0UC 1AYM1 1GFF2 1PO22 1AUYA 2HWC2 1RHI2 1C8NA 4Q4Y3 1IHMA 2MEV3 4Q4V1 1HRV1 1NCQB 1ZBA1 3JD71 1AL23 1PO11 5DDJ1 1VBB1 1QJX1 1Z7S2 2RS11 2RR12 4RR3C 3VDDC 1ND3A 5CFCC 2RMU3 4N53C 1HRI3 1OOPA 1ND2C 2GSYA 1TMF2 1ZBE1 1PIV1 1C8M1 5GKAC 5L7OB 1R1A3 4Q4W2 2RM23 5BNOB 4QPIB 1Z7S3 4YVWA 4N43B 2RR13 1HRV3 4GH4B 1W39A 1VBE2 3VBUC 1ZBA3 3JD73 1PO13 3VBHA 2PLV1 1BBT2 5K0UA 2RS13 1RUI3 3HAGA 2R072 5J98B 1RUF2 3VBRA 1BEV3 1EV12 2WZR1 4IV3B 1ZBE3 5ABJC 3J8F1 4CDUB 5FMOS 5ACA1 4Y4YA 1FOD2 4PDWC 4Q4X1 4AEDB 5CFCA 5K0UB 1R091 5J96B 1ND2A 2R073 2TBVA 1RUF3 2Y26A 5D8AA 1H8TA 4CDXA 1ASJ2 3IDEA 1QJY3 4CEWA 1HXS2 5BNNC 4RR3B 2R061 2HWD1 3VDDB 4N53B 4CDWA 2XBO2 4JGYC 1RUH2 1VBC2 1NY71 1VRH2 1COV1 1R093 2RS52 1VBA3 1HXS3 2R041 3ZFFC 4CEYC 1BMV2 1RMU3 2FZ2A 1FMD1 1D4M2 5FOJB 3VBUB 4PDWA 1PGW2 3ZXAC 5CFDC 5A32A 4WM8A 1QJZA 1E57A 2BUKA 2BFUL 2QQPA 1AYN2 5BNPA 1MEC1
chains in the Genus database with same CATH superfamily
4XEZA 2OPWA 1UX7A 3SMHA 5JXJA 5ABJB 1U5ZA 1ND3C 3SITA 1AR73 4RGGA 3WW3A 2B45X 4DB5A 2WYSA 3J7LA 3CNAA 1QGLA 4IE5A 1LCLA 1R081 2GU9A 2D6LX 2YV8A 4CUBA 2XPJA 3LA7A 1P8JA 2P37A 2ID4A 3MUZ1 1ALYA 1CN1A 3VL8A 1W03A 4R9AA 4CXWA 2A3YA 1RUE3 1V6OA 5SV8A 1WD4A 2J1VA 4Y22B 4QQ2A 2MEV2 2WFF3 5FOBB 2CDPA 1GOFA 4Y33A 3AJZA 1AL22 1WMDA 3AYAA 3VV1A 4CTEA 4B8EA 4XQWA 5FJHA 3VBHC 1C5HA 3AKQA 5BNNB 4XBLA 3PU3A 2WSUA 4LJHA 2BBVA 3GBWA 5IVJA 5FXVA 1WLDA 3WW1A 3WNNA 2PQSA 2FDFA 4AGVA 2AH2A 4HN0A 2D3RA 4GWMA 5EJ3A 5KHIA 3AZWA 1X36A 5AC93 5JUVA 3FUOA 4BLJA 1OLMA 5FMOL 1LNSA 1IPKA 3WUCA 3ZFFB 3ZFGA 2V09A 3JXSA 4FPJA 4DIQA 4FXGB 3N9MA 2PN5A 2Q8EA 2BRTA 4QB1A 1RVF3 4FPGA 4NIAA 4FTEA 1OQEA 2C0ZA 5DDJ2 1NX9A 3AKPA 4LITA 5I0UA 2HWB3 1QJX2 2JDUA 5DABA 2BNOA 2G9FA 1MZEA 4HMZA 3HOBA 4K21A 1GP5A 4NRMA 4ZZ8A 1UY3A 2XXZA 1AYM3 3OB8A 5GZGA 3BODA 3FFZA 1GNZA 2J1TA 3I3QA 4MXWA 4XIKA 2WINB 1H8TC 3ACFA 2ZEXA 1YIPA 2QZ2A 2JE8A 1BEV2 2YG0A 1D0GA 1F5FA 3LDRA 1DP0A 2VR4A 4Q4V3 3DN7A 3ZR6A 2PTMA 1WMFA 3LIHA 3FFQA 3OUJA 4TN7A 4X8NA 4XACA 3WNPA 1ND3B 4BZ4A 1LHUA 5C5UA 2WR9A 4RHV3 3UJOA 2GDFA 4LO8A 4CU6A 4K3UA 1YIFA 4FFFA 4HSLA 3AFKA 1OH3A 1SG3A 5LATA 4URAA 1PK6C 4KWKA 1JI6A 1D2QA 2R30A 4P9LA 4Y1VA 1VBE1 3LGRA 3ZXGA 4YVWB 5FZEA 5FY5A 4CUGA 1SBDA 1BBT1 3NJVA 1OURA 3TNQA 1HX6A 1BZWA 1JMUB 4BHPA 3PVBB 3N4MA 3GBGA 2VNGA 4TLFA 4BXSV 4B29A 1QJY2 3CO2A 4GMP3 3VBHB 5FPBA 5FPUA 1F9KA 1XE7A 1EV11 2WYFA 4LMFA 4AF9A 1GQGA 3ZYFA 5A3LA 1HB4A 3J8F2 1ENXA 2WO1A 4QM9A 4Y20B 3AVSA 2ZGPA 4LORA 1PNGA 4D94A 4NO4A 3GHMA 4PI2A 1KFXL 1R092 1UZWA 1Z0HA 3O1SA 2XJRA 1GWLA 4A41A 5EZWA 3TN91 3UESA 1RMU2 5CFDB 3IBMA 3BN6A 3M1HA 3ST7A 4PHZA 2ARXA 2MPFA 2XH6A 2KD7A 3ACHA 3FHIB 5ACA3 2HYXA 4JDNA 2UY9A 4Q4X3 4RD7A 3WOGA 1N3QA 3OY8A 5JSPA 1KRIA 4KU8A 1RXFA 3ZYHA 1DG6A 1H8TB 1RGSA 3HVDA 2EAAA 1QF3A 2YU1A 1J1LA 1MQTA 3O0XA 5H9PA 3UT0A 4Z8BA 1SCRA 3JQWA 2GALA 1F2NA 1QDOA 3N3HA 2YHJA 1O3TA 2C24A 3SNMA 1AR62 1W2AX 1VRH1 2WNVA 4XFIA 1ZRIA 3NAPA 4E4SA 4OHVA 2HWD3 3MW4A 1O4TA 1PK6B 5JOXA 1AR82 3B69A 5FIXA 2JDAA 4BPZA 2CGOA 3TEZA 1ENSA 5FY1A 1YWKA 2X5IA 4RN5A 4XDOA 4UBGA 4MGTA 1MS5A 1QJU1 2Y0IA 4LUKA 4WVZA 5D2AA 3H50A 3ZFGC 3K51A 4EWEA 5JMOA 3D82A 4NIHA 3I2JA 2OZ6A 2HBUA 2WQ4A 3PMSA 4YM0A 4NMIA 3PUAA 4FFHA 1F4AA 3RJ2X 3LSEA 2RJLA 3MHZA 5CAZA 4YW6A 2NLRA 4FOVA 3SXWA 4BLIA 3AXEA 2J1AA 3F95A 2VZQA 2P1BA 1ZZ8A 3OBRA 4WVMB 5H9RA 3ZYGA 1E5RA 2EVXA 4JHTA 3PJYA 3LOBA 5DAVA 4ZU4A 1EAH3 1RUC2 4Y1YA 1YQ6A 2DVBA 1YQ2A 1Q8QA 1RJ7A 3EO6A 1V0AA 3GXUA 3N9PA 3QCWA 2BOJA 4GH4C 4MHUA 2RS32 4Q1RA 2A6YA 1YXWA 2C9AA 1IG0A 1KS4A 2MEV1 4CP9A 3ES4A 2P6CA 2VULA 4Z07A 2Y34A 1PHMA 5CADA 2WLPA 2H6BA 1V00A 2Y33A 1R083 2UWCA 2NZ9A 4KWJA 5F37A 2ADEA 2VCBA 3I97A 2AEYA 1S0GA 4A3ZA 2VZVA 1AR92 2VQUA 3QH7A 1H4HA 4Q0VA 2XONA 1K3IA 4L97A 2DV9A 2VY0A 4QKBA 4XFGA 1AL0G 1UZYA 3KLSA 3OBZA 5BPXA 3CDZB 4CUAA 5A3PA 2AENA 5JXHA 4MO3M 1Y4WA 1YHFA 1ZZ6A 2VMGA 2YZ4A 3FHQA 3H8RA 3CF6E 3SEEA 3QOPA 4Y5SA 4HKLA 2D44A 1AVBA 2RR11 3GCWA 4DUWA 3I2IA 1WMXA 4BQ1A 3ZO0B 4MUVA 4YNIA 1N47A 3Q8CA 1G9AA 3N9QA 5HXVA 1ENQA 1YO8A 4LA3A 2V5DA 2BFUS 3AMPA 3S6PA 4AFCA 2XB6C 3G6JB 1N1YA 4XFHA 1VIWB 2AR6A 3ZFGB 1PIV2 3T0BA 2GMEA 1J83A 1F5JA 1JH5A 3ZXFA 4JC1A 5LA0A 1OPOA 1BEV1 2VPVA 2VXJA 1ZZ7A 3VZKA 1SACA 2OZJA 4QX7A 2WN2A 5EYYA 1W0OA 3VHRA 1S0FA 4EROA 4XXAA 1L3JA 4MXWB 2WWSA 2VVEA 1O5UA 2QZ3A 2O1QA 3RZJA 5FPVA 3VZLA 2TNFA 1UQXA 5FZCA 5JOYA 1MQTC 2W08A 3AC0A 5I0TA 1CWPA 2UURA 2GAUA 5IFTA 4M3CE 1WMEA 4XFAA 4CDUA 2R071 4XJAA 2WNVC 3A21A 4QWNA 2BNNA 5FK8A 3NAPC 3VZJA 2WZR2 1V6JA 3I4IA 1V6IA 1V9U2 4AEDA 3BTZA 4BCUA 1X9TA 1YNAA 5LCWL 3THDA 5IVFA 3BPZA 3V64A 3KMHA 2EIDA 3RMXA 3WQ1A 4O7XA 1SDWA 1QJY1 1IS6A 1C28A 5FUNA 4AFMA 1DHKB 5T5OA 1YJKA 4XTMA 4EWAA 4HLTA 2NMNA 3JBG2 1VBE3 2ZGOA 4TYSA 4XJ9A 2Y64A 3VHNA 2Y8KA 5KHHA 1BBT3 2A3XA 3LF7A 1LOFA 3ETPA 3HBKA 1WD3A 2FBEA 4E2SA 5C3SA 3RZHA 3H3ZA 4NUBA 4C8DA 3RZMA 4N53A 2PHXA 1Y9MA 2Q4SA 3AZVA 4UOJA 5A3UA 2WFPA 5JR7B 1G9CA 3WXPA 1EV13 4Z1VA 4OHYA 2R0HA 3GDBA 3VDAA 1RMU1 1W8TA 2WS92 3BYWA 2QBXA 3I3BA 4XBQA 4DXSA 2E7QA 2XBO1 4CCKA 3UNPA 3AMMA 5A3WA 5DAPA 4XTPA 1GZWB 2A6ZA 5LBCA 1JYXA 1COV2 1XYPA 3SKVA 5FYSA 2GC1A 3C2UA 3WDVA 4XE9A 2C6SA 4AHXA 3B02A 3V56A 2JDPA 1O91A 4IERA 1Q8OA 2A1XA 2LROA 2VTFA 4QHZA 3OY8B 1DGLA 3I2FA 1NXMA 3E1F1 1GNHA 1J3QA 1D4M1 4UW3A 1K12A 3ON7A 1AR61 2FDJA 5F8PA 4TLGA 1MZFA 3JUUA 4J1XA 3M3OA 2OW4A 1GMMA 1MQTB 2PFWA 1CAUA 3B9IA 3E6BA 4JHZA 5FREA 3GZEA 1DYOA 3LAGA 5CYYA 1DZQA 2HWE2 1AR81 1K42A 1U0AA 2VQAA 2WNVB 5KHGA 2XG3A 3GZAA 3NAPB 2JICA 3UK9A 3IPVA 5F9TA 5IATA 4XFCA 5IK7A 1VBC3 4LBLA 3IAPA 4FOQA 1VRH3 1RUJ2 5EP9A 1OH4A 2X5IB 1LGCA 2XLFA 1NLSA 3MIEA 1BKZA 5EFUA 1WW7A 3MF9A 3J4UH 1PGL1 3V65A 1QJU3 5FYMA 1DLCA 5F3GA 3THPA 4EE2A 3Q8AA 5FR3A 3LEKA 3GCXA 1NZIA 4DEQA 1RUC1 4KGGA 2CL2A 5IK5A 3CIHA 4NHYA 5HCFA 4ZY9A 4AEMA 1UF2C 2YC4A 3H0OA 4WVWA 3NRUA 2RS31 4YW3A 4EZ4A 3A0NA 1PX4A 3HNYM 4MOAA 4Q4Y2 1NZCA 5GZDA 4BIFA 5LZ6A 4I02A 4CDUC 3FUQA 4NROA 3LKJA 4G9SB 4MSVA 1OUSA 1VLNA 4UFIA 5FJKA 3EJKA 2ZEWA 4L8QA 4AEDC 3ZKUA 5K0UC 4CP9B 1AHSA 1PO22 1UY2A 5FBZA 5FUIA 1XC6A 2CTVA 1C8NA 1RHI2 2HWC2 2XLGA 1XB9A 2YPJA 4W50A 2G19A 2X29A 3D0JA 5FZGA 3OPWA 4YZ4A 2MEV3 3IZOA 1EYBA 4R9BA 2XMLA 2VZTA 3BPSA 4W6XA 4Y1ZA 4XDQA 3I59A 1D4VB 1GKBA 1ZBA1 3JD71 1AL23 3P1IA 2C26A 4JKMA 4D6RA 4XYXA 3ZSMA 2IXIA 2Q8OA 1Z7S2 2VBBA 2RS11 2XVKA 1LOFC 4B4QA 1ULGA 3I2KA 2VBDA 4HVRA 1QH7A 3CL1A 4N53C 4D69A 1OOPA 1LKNA 1IS4A 4LQRA 1ZBE1 5FMDA 1UOBA 3OEBA 1PIV1 1C8M1 3POGA 5GKAC 5JDBA 5JSRA 2OXBA 4B7KA 2Q30A 3U78A 2NP0A 1A34A 4BQYA 3HD8B 2RR13 1W6PA 3VD3A 3RYPA 1PMHX 3ACLA 4XZPA 4G3YC 5A6QA 4PBOA 5L9VA 2PHRA 2A70A 5JIAA 4OI0A 4LK6A 1YFUA 1REFA 4LE3A 4M4PA 4PI0A 5IVVA 1F4HA 1U5YA 4XCAA 1O7FA 3AL6A 5EYXA 2VU9A 5J98B 1LHOA 3WZ1A 1BEV3 2XJPA 3MGUA 1LEDA 4XFBA 2WZR1 5FZBA 3TEWA 1IPJA 4YW7A 5AVAA 4ZS3A 3WQBA 4DY3A 1DZRA 2VMFA 2XUEA 3H9AA 5EWSA 4CDUB 3W21A 1ZVFA 2CWSA 4PDWC 3I3DA 2GP3A 1T6BX 5KXCA 4AEDB 5CFCA 1XXNA 5K0UB 5FY7A 2DBIA 3W58A 1ND2A 3JQXA 2XDVA 2R073 2TBVA 4H2AA 4KBZA 4ORFA 3AVRA 2HYKA 4QX5A 4UWDA 1JZ4A 5FYBA 4HANA 4V2WA 3OYWA 3U75A 4NVPA 3AP7A 4A4AA 2GNDA 1SFPA 5F32A 1H2MA 1ASJ2 4L99A 2A5ZA 3C7EA 1QJY3 1XJAA 4F83A 2VGDA 4D3WA 3B93A 4BXFA 5B2GB 1QEXA 4N53B 3IT8A 2LS6A 1YC61 3ACGA 3W9AA 1HW5A 2CGNA 4ZXEA 1W2NA 4COZA 5JMCA 2OUJA 4IEPA 3ZVXA 1COV1 4EV0A 1R093 2B4KA 1SLAA 1IG3A 2RS52 4AEJA 2VO5A 1SBEA 3FLPA 1UCXA 3JZVA 4FOYA 4Q5OA 1RMU3 1XYNA 3AMHA 3LWCA 2Y6KA 2Q8DA 3CHXA 2MHFA 1CVNA 2J1SA 5ANQA 4YW1A 3D3AA 4WM8A 2WWUA 2IXLA 4LIUA 4ARYA 3SCGA 2ADDA 5C4WB 2RDQA 3TRSB 2JG8A 4GJZA 2BUKA 5A70A 2ARBA 2BEOA 1NLRA 3IIIA 3KV6A 3V0BA 1XSQA 4NHXA 4IEVA 4ONUA 3HN1A 2RDSA 4P5YA 4QGMA 5IT6A 1MEC1 2HEWF 2PHFA 1CAUB 3DCQA 2ZAHA 4DS0A 4LKEA 5DUVA 4YG0A 1AR63 1RUJ1 4LKDA 4UF0A 1DYKA 4Q2FA 3I2OA 1OOPC 4PDWB 4E8CA 1PVXA 2YBKA 4AQ6A 2XJVA 1W8NA 3IPVB 4ATFA 1YQ8A 1AR83 3OBAA 4JTOA 1S2KA 1Y3TA 4CPBA 1ZRDA 3V0AA 2N7GA 2Z79A 1XU2A 3OPTA 4QX0A 5DN2A 3BIWE 3ZR5A 4AFBA 3O1UA 3VDBA 3PNAA 2D5FA 1ZRRA 1UYYA 1RVF1 1SQ4A 3N35A 4FTBA 2HWB1 2E33A 1XYOA 1FV3A 3WCSA 1T6GC 3ZPYA 3FBMA 2J1UA 2VOXA 5JZGA 5FP3A 5C5TA 3MBWA 4MLOA 4UXAA 4DRRA 3I7DA 4LULA 5IAVA 4M0NA 1HRI2 1TME2 1SFYA 2WL1A 3ETQA 4A42A 1S1AA 4HT1T 3IN9A 5T5PA 4NRQA 2VOWA 3N9LA 1RUC3 2R1BA 1VALA 2RM22 3B9CA 3HT1A 2Q1ZB 4RHV1 2VG9A 2W0XA 2RS33 4IV1A 2HWC1 4QHOA 2LW8A 5ANNA 4ZU5A 5FZHA 1JZ3A 3BUCA 4Q1PA 3CZUA 4GALA 3O1TA 5LEJA 1PO12 1VBB2 1POV0 2C4XA 1BLZA 3MPPG 5C8CA 1IKPA 3MICA 4MX3A 4NIIA 5DXDA 4CE8A 4D6QA 3I59B 1W6QA 2E7TA 4BQ3A 1EUUA 4UFKA 4K40A 1XE8A 4GMP1 5C9AA 1VAMA 1BK0A 2O8QA 5E1RA 1F35A 3PIJA 2FZ1A 4GWIA 2GH2A 2D43A 4FXKB 2DYCA 4QXKA 3WQ7A 5CEHA 1EUTA 4RFT0 2XVGA 4NWVA 1OOPB 1DF0A 5KBFA 5CNAA 2VQ0A 4E9KA 1CX1A 3SQOA 4ASLA 1H9WA 2W87A 1CD3G 5FZMA 1QH6A 5IVEA 1WCQA 5KHKA 3OJBA 2K2SA 1PIV3 1C8M3 3BB6A 2ZGKA 2ZGTA 3NV1A 3PUSA 5A7QA 3VD7A 5HCAA 1VAVA 2WRAA 4HFSA 1VMJA 3BIEA 1LOEA 2A71A 2BVVA 3KV4A 5J36A 4WM8C 2FDKA 1V6NA 3VBOA 2W1UA 3MEPA 3ZIXA 3LDBA 4KMQA 4GKXA 1N1VA 2VNRA 5J37A 2JG8C 2ZAAA 1RUG1 1G9BA 2QTWB 4PLNA 3K4ZA 4XJWA 2X05A 1O4ZA 2C1FA 2G9GA 5IW0A 3TAYA 3H8XA 4L9BA 4MH0E 4QDQA 2WZR3 4AVVA 4YFZA 1V9U3 5FP8A 1UPIA 5AFEA 4UAPA 5CFCB 3VD9A 2YU2A 2VUAA 5FWEA 5LY2A 2CHHA 3DYOA 1ND2B 2VTXJ 1JBCA 2XHNA 1JYNA 2XJQA 1REDA 2DCJA 4W65A 4B1LA 2ZX2A 2W94A 3OYWB 1WLWA 1ZM1A 5FKCA 3RYKA 3KB5A 3WF3A 3JBG3 3HN3A 2MNGA 5FPZA 1Y7BA 3VZNA 4AE2A 4ZPIA 4D0QA 1Y9QA 3UKVA 1FT9A 5F7UA 4Z92B 3R4SA 1SEFA 4RQPA 4FP3A 5JZGC 5FYVA 4PF5A 3ES1A 1YRZA 1G9DA 1EPWA 1AF9A 2RS51 3UYJA 1FX5A 2LUWA 4Q27A 4QXHA 5CBLA 1EAH1 1SBFA 3W59A 4V1PA 4JZRA 2RJ2A 5FZ6A 2WS93 2E9QA 1NCQC 3MIFA 3ZOIA 4IV1C 5CKMA 1DGWX 1PVC1 2BYVE 2WO2A 1W0PA 3C7FA 5F5CA 4XAEA 2YGMA 3SH5A 1COV3 3VLBB 2EA7A 3T0AA 1JZ5A 4NE9A 4OHWA 2XWJB 1W6NA 3K2OA 4INDA 2WN3A 3PVOA 1QOTA 4WM8B 4ZZ5A 1W0NA 3IMMA 5C8CC 3RYRA 1IOAA 4OHXA 5DG1A 2PXJA 3UKTA 4OUMA 1C5IA 2EIBA 4AL9A 4IE6A 3CBNA 2JG8B 2YBSA 2X10A 2R7EB 1DU3D 5J48A 3V0BB 5C9AC 2F17A 5A33A 4N43C 2Y6JA 2EXJA 2DCZA 4FCAA 4ITCA 5FY0A 2BP6A 3J7HA 2E32A 2HWE3 4LBMA 4UW5A 3KF3A 1ZREA 5T55A 5IJRA 4UF0B 1WGPA 2ZZJA 5DQ0A 3OG2A 4RL7A 2WNOA 4RA0A 5IHRA 2TEPA 3AP5A 4XF4A 4AK3A 1RUJ3 1EY2A 5FP4A 5A7PA 3V0AB 1C57A 1DGRA 3WG4A 2WZ8A 4BA6A 1E5SA 1AX2A 3MYXA 5FYHA 1DBNA 1O8PA 1XNKA 1LR5A 2JE9A 3JCIA 3WX5A 3ZYPA 4A6SA 1HRI1 5F5AA 3U1XA 5EHDA 2D6MA 3VBOC 5JZGB 1F8VA 5HXMA 3URFA 4NRPA 2YGLA 3B94A 1LOAA 2RM21 2SLIA 3AKTA 4PBPA 3WG3A 2YB7A 3EMRA 4Q8LA 4PCRA 1R64A 2JWPA 3KVBA 4AGRA 1ULFA 4YYOA 1BQPA 3VDCA 5L7OA 3H3LA 2C5DA 5F6KA 4I01A 1H0BA 4LBOA 5BNOA 2P17A 3KGLA 4IV1B 4W4ZA 1HB2A 2OVUA 3H42B 4NPLA 3T08A 1UKGA 1JTZX 2D6KA 3INAA 1QIQA 4GH4A 2VCAA 4GJYA 4XW3A 1PO23 5CIRA 4OI2A 1SLIA 1UXXX 2HWC3 1RHI3 1QHDA 3DECA 4EN8B 1HDKA 2BJSA 3RI9A 4IE4A 1O8SA 5C8CB 3OGSA 4KWUA 1UL9A 5EJZB 2ZGSA 3WVJA 4IW3A 1OVPA 2DFCA 1OA2A 2VZUA 1VBD2 3OGJA 4HKWA 2UY8A 1W6QB 2PLV2 1Q8SA 1W06A 3HT2A 3NJYA 4M3CF 2A6XA 5C9AB 1DLLA 3KCXA 5GJ6A 4FTSA 1CQ9A 4K8FA 4IV3A 2WKKA 4R9CA 4XUOA 3H3UA 5LBFA 4RQPC 1URXA 4N9HA 1TNRA 1H2LA 4LEJA 5JPNB 2GH8A 4Y4RA 1V6KA 1HKDA 5I0RA 3RMYA 3T30A 2VQTA 3WP4A 1MS3A 3O1RA 3NQHA 3ENRA 4AI2A 1O6UA 3LQCA 2FDIA 1KD7A 2D3PA 3GALA 4B3NA 1PMIA 3B5LB 3RVHA 1I1EA 1GP6A 4LHSA 4NIDA 2XWBB 1UKRA 1WCSA 4IGOA 4Q8KA 1DDLA 2DDUA 4CP0A 3VHOA 3A0KA 1GZWA 2DCKA 3ZKYA 1S0EA 1W90A 1X7NA 2XR4A 3LE0A 3VBOB 2D97A 4IEZA 2WT0A 2CU5A 1GR3A 4FPCA 1GBGA 2VJXA 1HB1A 1HXS1 5FYUA 4ISQA 5LK5A 2R062 2VW0A 5FXZA 4CP2A 4OULA 3D6EA 4XCBA 2OIIA 3R4DB 4OI1A 1JOBA 3LA2A 3HPNA 3NO8A 3UETA 1RUG3 3AMQA 5LBBA 4AHYA 2FCUA 3BOWA 4Z2WA 4MGQA 1YQCA 1KS5A 1VBC1 2YYOA 3U10A 1JYVA 3VUOA 4KU7A 4XJZA 1UOGA 3WSOA 1HJFA 4BK5A 4LTAA 3CJIC 3T3YA 3BOPA 1MPXA 4XF9A 4LA2A 4OI4A 4R52A 1G6NA 3UGGA 2QQKA 2JKBA 1FMD2 1KFUL 2ZHMA 2B7YA 3T0DA 4A6OA 3ILFA 2ZX4A 2F4PA 5FKBA 3ZXLA 1ASJ3 4EN7B 2Y6LA 1QKQA 1LULA 1UW8A 3MW3A 4GIQA 4K7JA 1AX0A 1O5LA 2ERFA 1OT5A 3VD5A 4RQPB 1I9RA 5I8TA 2IVJA 3OOXA 3PVEA 1H9PA 1S55A 3S5QA 4KH9A 4N9IA 1TQ5A 1S2BA 5FQ0A 1AYN1 2WIIB 1QOSA 2D93A 2AZ5A 1KITA 5L7OC 3BCWA 5E89A 4I2OA 2B8MA 2RS53 4BQXA 2CSGA 3EXUA 3WD5A 4ZKTB 5BNOC 1UY4A 4B4PA 1POV1 1ULPA 5FV3A 4NHMA 4QQOA 2HWF2 3RS6A 2UYBA 1QWRA 4IEXA 1MS0A 1PVC3 1W6NB 3ZLIA 4B4RA 5TSWA 1M06G 2GC2A 2K9ZA 1DQ0A 1ZZ9A 2JX9A 2ARCA 4XJ8A 1AL21 1YI9A 1GU3A 4A7YA 2QQIA 4BE3A 4JGYA 1PM7A 4JDMA 3LB9A 1XBFA 5DPNA 3RPQA 3N7KA 4YM2A 5A33B 2O14A 2VNOA 1NE6A 1UNBA 4IV3C 2AEZA 2GNBA 2QDNA 2ZGMA 3I3MA 2B9UA 1A6CA 2VAUA 4PLOA 1JZ6A 3ZYIB 4MVTA 1TG7A 4CEYA 3NNJA 1S4CA 4HK8A 4XDPA 2KXLA 1OHFA 5DG2A 5GLWA 3DYMA 5CKQA 3W5NA 5K8SA 4Y3OA 1LRHA 1AUYA 2ET1A 2Z42A 1K5JA 2E53A 1I3HA 4IETA 3T2TA 3G7DA 4YARA 5LEKA 1LOBA 3ZMNA 2XQRA 3HEIA 2DU0A 1RL3A 1FI2A 1QMJA 1ODMA 4KNCA 4KG8A 4BOWA 5DDJ1 2E51A 1QJX1 4XZUG 5AFBA 1HIXA 4OCTA 2JIGA 3M3CA 2R16A 5GZCA 1KEXA 1A8DA 5DAWA 3P6BA 3M70A 4CCCA 4D8MA 3P5BA 2E6VA 1HRI3 1MS1A 4AWDA 1LESA 2XOMA 3ABZA 4OYUA 5E8AA 3WP6A 3C3VA 2WT2A 3IMNA 2GSYA 3QD6A 2ZKLA 1GICA 1TMF2 4QQHA 5FZOA 3WG2A 3ZSLA 5L7OB 4Q4W2 1QXJA 2WDBA 2RM23 5BNOB 1OQ1A 3KWVA 2B42B 3ZDSA 4UI9L 3RZLA 1N1SA 3WLUA 2VZ1A 3WDYA 4CU9A 2VE1A 4GH4B 4XHXA 4P14A 1CAVA 2QDRA 1F15A 1OMIA 1PO13 3O0VA 4XC9A 5C3PA 2PLV1 1WWYA 5K0UA 3PUQA 5G04L 5FO8B 4N7UA 2P3YA 3NWKA 4IQPA 4QGNA 4EZHA 4CZSA 2BNMA 1W2TA 1YYNA 1RUF2 3VBRA 5FYCA 2CGPA 4LIVA 5GALA 1PZ7A 4FPEA 5JI9A 3EB7A 4IV3B 2G9ZA 2L9LA 4J6GA 2ILMA 4OVEA 4Q0QA 3J8F1 4QB2A 1RINA 3AKSA 3KZ4C 1Y9GA 4Y4YA 3S57A 4IDZA 1W9TA 5A6XA 4L2NA 1SCSA 3P3NA 3D4KA 1R091 4NPRA 2D6OX 5D8AA 1E5IA 1Y43B 2IC1A 2P4EA 1LHVA 2RDRA 3CU7A 4LHNA 2HEYF 4AZZA 4DOUA 2WO7A 2JXAA 1OVSA 4E4ZA 3ZN4A 3DYPA 3IDEA 4DINB 2UWBA 1NKGA 3KT7A 5GM0A 2R061 4N7IA 4XIOA 1H6YA 1MVEA 4X6RB 4QB6A 2ZCWA 4CDWA 4A45A 2AC1A 3VKMA 3ZYRA 1A3KA 4JGYC 3M3EA 2WWJA 1RUH2 5FFOC 1T2XA 3O1PA 4YFWA 1XNAA 1TE1B 3WNXA 4E2GA 1WW6A 4RFRB 4CA9A 3DKWA 1HXS3 1WA6X 4CEYC 2PAEA 2D6NA 4AVSA 1BMV2 3ZN6A 5I0SA 1FMD1 2GMMA 5KWRA 3SC7X 1JZ7A 5A7NA 3IWZA 1PGW2 4PDWA 1YCIA 2VZ3A 5CFDC 1ULCA 2QCSB 2QQJA 1QJZA 3KV9A 2JDKA 4Y1XA 5A32A 2AYHA 1UD1A 2Y60A 3HQUA 3IAQA 1PX3A 4C1XA 2B39A 4BISA 1UIKA 2UU8A 3GNEA 2CAUA 2NPIA 3ELNA 2QQPA 4D7SA 1RIRA 2BWAA 2KM2A 3T2PA 1SDDB 5BNPA 3E6CC 3E5UA 1RITA 5T3NA 1TNFA 1OLRA 4LHKA 4XPVA 4LO6B 1YEWA 1MVQA 1REEA 5FQ0B 5LA2A 4HVQA 1DQ6A 3O7OA 5FTTC 1UU6A 2ZHLA 4YGDA 1NXD1 1AYN3 4P02B 4QX3A 4FFIA 1SLLA 3O1VA 4DY5A 1AXZA 1JUHA 2DUQA 4D7TA 5AC92 3POYA 1POV3 1OA4A 3AP6A 2VVDA 4BDVB 5FZ8A 5AVPA 5FUPA 4YW2A 3RSJA 4UT5A 1AR91 1LECA 2RMU2 2VW2A 1VP6A 3ZX7A 2PQQA 2VMDA 1JHNA 5IFPA 3KSCA 4QAWA 4JGYB 4GKYA 3VBRC 3WV6A 3KV5A 3W5MA 1CAWA 1QDCA 3WY6A 2CAVA 1GYKA 3Q8FA 3U14A 3B00A 2B5HA 2ZMNA 4L11A 1JZ8A 4CEYB 1GWMA 5FDBA 3T1MA 4Q4V2 1HRV2 1W6MA 1VB2A 4XBNA 3EYPA 1JYTA 1QY4A 2RVAA 4CU7A 4XOGA 3J7NA 4K1ZA 4QGLA 5D8AC 1VMHA 3HIFA 3OGVA 4OMCA 1NLQA 4IEQA 3WNOA 1D2SA 2QFEA 4AI3A 4ES8A 2BZDA 5EV7A 4AHWA 1RUI2 1H4GA 3WR0A 1GZTA 5H9QA 5FY4A 3U11A 5F6LB 5C70A 4GQ7A 1OD3A 1L7LA 2A6VA 4BK4A 1JODA 1GSLA 2JIJA 2WA4A 3S7EA 5DDJ3 2WA3A 2GC0A 1QJX3 3NNMA 3ZFEA 4CDWC 2FCTA 5F3CA 4CXYA 1UMZA 4TZDA 4LBKA 4Q0UA 2PYTA 1TVGA 1NE4A 2NN8A 4YVSA 4RS5C 5FZOB 4F8AA 1MR5A 3MDPA 3O0WA 4QX1A 1OQDA 5IVBA 1SMVA 2QQWA 4HKOA 2RE9A 2CV6A 4MHRA 4LLOA 4XJUA 2XHKA 5CB7A 1V9U1 3ILRA 2ZHKA 3MUY1 5FBJA 1GQPA 5C33A 4Y26A 1CAVB 1CX4A 1JXNA 3T1LA 3WUDA 5I8YA 3MV11 4YLZA 2DCYA 2B46X 4XUTA 2ZMKA 3UL2A 3ZSEA 1XNDA 2WO3A 1N3PA 2RG4A 4PIXA 2GNMA 3JBG1 5SV5A 1UMHA 3VBSA 4K9SA 1MS4A 2PLV3 3BALA 3C7GA 4D7YA 5K9YA 4S2FA 1AXKA 3VBRB 3LEMA 4AHZA 1OFNA 3VB9A 4Q4X2 1IS3A 1PMJX 2A7AA 4P9IA 4DUVA 5BNPC 2VCCA 2DTWA 5FLHA 3SH3A 5A1FA 3NL1A 4HVOA 3E6DA 5KC6A 2BVBA 1KDKA 1VBA2 4E4DX 3GYDA 1LTEA 3E97A 5J09A 3ZMOA 1TEIA 2XL7A 3EQEA 4AAXA 3S0MA 3OUHA 4H7MA 1HN0A 4JX0A 3RFRA 3B01A 5L9RA 2WS91 2HH9A 3I2GA 3J8F3 3DPRC 4Q0PA 4FPFA 4AVTA 4Q26A 3NJZA 3ZIWA 1UXZA 1XE0A 1GANA 2HLEA 5D8AB 5K7PA 1YFYA 3AXDA 2ORZA 1CIWA 4Q0SA 5C7GA 2BWCA 3NNFA 3PHMA 3APBA 2YPDA 1S0CA 5E6HA 4M4RA 4AGGA 5B4XA 1NY72 5FZ9A 3AKRA 3UV9A 1LEMA 4K20A 4GB32 1X33A 4CDWB 2NMOA 2YFZA 3ZYBA 2VZOA 4C90A 1JZ2A 3ZYJB 2R042 3I49A 5GLTA 2R063 4FO9A 5CG8A 3WF1A 2E26A 2JDNA 4ASKA 1H1AA 1BMV1 2HWE1 4QQLA 4GZ9A 2OKXA 1LJ7A 4F7ZA 4QXCA 1OF3A 4A2UA 1RUD2 1W8FA 1PGW1 5A7OA 4UYBA 2VNVA 1UWWA 1OXCA 4NJ4A 3I3EA 3ZN6B 3THCA 1VJ2A 4LBQD 3POWA 1OKOA 2LTNA 3FLRA 5A32B 4JCKA 3PLQA 4JAAA 1MEC2 1FMD3 2ARAA 3NV2A 2VL4A 3OD0A 3ZXDA 2WT1A 4LBNA 2W47A 3WP3A 2WABA 5FXWA 3H7YA 4P9YA 4TTGA 2I07B 5CG9A 3L2HA 4IESA 5BNPB 1WLTA 1CJDA 1JU3A 4IGQA 4OZXA 5CU1A 2GN3A 2WC2A 4UW6A 4AW7A 5FWJA 4P9XA 4QPGA 3ZFEC 1SPPA 3C7OA 5JVVA 3VHPA 4Q4Y1 1D0HA 2WNUA 2X8KA 3AB0A 5FMBA 4IUGA 5EXOA 2VMIA 3VL9A 2P3IA 4YVSC 1KJRA 1DGWA 4WZFA 2CYFA 4FAHA 3TNPB 3GJAA 4NIGA 4PIZA 2GN7A 4LPLA 2Q5TA 1YI7A 1NCQA 3N7MA 4PQQA 5LRSA 1ZX5A 1PO21 5CISA 1G8WA 2ZX0A 3AZZA 2RMU1 1RHI1 3WW4A 3H7JA 1WUVA 3N7LA 4PLMA 3ZN5A 1WW4A 4DNYA 1QJFA 4OHZA 3HNBM 4AFAA 5I0DA 1CJPA 2PHLA 5A7WA 3PU8A 3T4HB 5D1IA 3VBSC 1H30A 4A3XA 3OSDA 5BY5A 5LW9A 3FBYA 1SHWB 1YJLA 1Z7S1 3VKFC 4COWA 3HJRA 4E2QA 3POSA 4AR2A 1WCDJ 1J3RA 2P2KA 4YZ1A 1AR93 1XNCA 5C3QA 1CAWB 3LFIA 1KGYA 3O5SA 3WDTA 2H0BA 2OQ6A 2PA7A 4N43A 2ZKNA 3WW2A 3AZYA 1W8HA 4EJRA 1PZ9A 5F39A 5A6YA 2IUWA 3FE5A 1ZZBA 2FDGA 2OUHA 2ZA9A 1AJKA 4N90A 1W6MB 3QH6A 4Z82A 4MXVA 3K75B 4PT6A 4YM3A 5KXBA 1RUI1 5LRRA 1WKYA 3FWEA 3H8UA 2ZJCA 1VB4A 2ZPXA 4O9EA 3T4VA 1GOHA 4AVAA 5FPLA 3IDBB 2R0FA 4JDOA 4N8MA 4L92A 2W46A 2FDHA 3MLKA 2V4AA 2ZACA 5LY1A 5HV0A 2XJSA 4I3PA 4YSFA 4JV4A 5I91A 1NUKA 4CYDA 1W3VA 1W9YA 3MIDA 2OT7A 1YUDA 5A3MA 4FPKA 3ZFEB 3CJXA 5BUVA 1VE0A 2ES3A 2VUJA 3U37A 3WT3A 4U2AA 3I54A 1TMF3 5J1XA 2V73A 1OI6A 2Z4FA 2ZX3A 3M3IA 4XETA 4YVSB 5CA6A 1LB2A 2P5BA 3H1YA 2FHRA 4Q4W3 4AQSA 2VCMA 4DMIA 2YBPA 1RTVA 3LIGA 5F2SA 5GZFA 2JD9A 3TEXA 4BYYA 5CZKA 1LGNA 5F3EA 3DXTA 4WVVA 3IB3A 2B9VA 5LK7B 2QNKA 1JUIA 1IGOA 4BQ2A 5A3NA 2WBKA 4QT6A 2VVFA 1UZVA 3AP9A 2VM9A 1X50A 4BU2A 2Y6GA 3DXUA 3N36A 2XKOA 4LR4A 3VDDA 4CCJA 5HV4A 3ZXKA 1W6OA 2ZEZA 1ASJ1 2XGXA 4LUMA 3AM2A 4PIYA 3JU9A 2D6PA 3AMNA 4Q29A 4Y5Z0 3VBSB 1VBA1 1L7QA 4NWWA 3TN92 1HN1A 4TWTA 1GQHA 4W6WA 2W68A 1JHJA 2QUOA 2RDNA 3DF0A 2RHPA 4HG6B 5JAXA 3E5QA 3POJA 3CQOA 4QPGC 4MGZE 5T50A 1MS9A 2WNUC 4GAZA 1A78A 1YLLA 1PZ8A 3LA3A 5I8SA 3VBUA 3T2QA 3WEZA 3WHUA 4KWLA 3VGIA 1MS8A 2JJ6A 3F2ZA 2W39A 4BIOA 2GZWA 1O3RA 3K77A 3LPGA 5FZ7A 3WDXA 1F31A 1ZYBA 1S0DA 5DUWA 4I3GA 4XFFA 2WAOA 3ITQA 1UOJA 4GB31 2YUEA 4LE4A 5FP9A 5JOZA 1HV1A 4JKLA 2IWGB 2GC3A 4PQ9A 1VMFA 3TWIA 2VH9A 1OLQA 1PNFA 2A75A 4DO0A 4XQ4A 5EJ1B 4COVA 2W5FA 1JS9A 2JB8A 1RUD1 5APAA 1QJU2 2EICA 1RUH3 2ZBJA 4DFSA 1HQWA 1HV0A 2Y6HA 4YGEA 4OLLA 3MZHA 4YZ3A 3M3QA 1UY1A 4I30A 5LB6A 3OF1A 3WF0A 2VECA 2ZZQA 2QQNA 2Y6FA 4FPOB 5DUXA 4Y1UA 1LU1A 3FJSA 3T2OA 3U4SA 1MZ5A 2W91A 5T52A 4FPYA 4I0WB 1IS5A 3C8XA 2XVLA 1GNYA 1RXGA 2RV9A 4BWOA 4HK9A 3CJIA 2XQXA 2D40A 5L36A 3WINE 1J1TA 4FVVA 5FZAA 5BNQA 1AXYA 4B7EA 1A8MA 4YVWC 1DQ2A 4AYUA 3UJQA 2DVGA 1QQP2 4H14A 3AK0A 4LO5B 1TME1 2BOIA 3KHCA 3HMYA 5E88A 4QPGB 1HQNA 1SPPB 1W9FA 2IFWA 2XJUA 1FPN2 1U5XA 3NNLA 3P3PA 5C6CA 2WNUB 5F1RA 5IYYA 3HQRA 3WG1A 3SCFA 3POEA 4QU2A 4AVBA 3ALQA 3LEGA 3DV8A 3HQXA 2JG9A 3POIA 4MGKE 3PUIA 4Q4Y3 1CR7A 1IHMA 3I2HA 2BBAA 1DGRN 2WUHA 1NCQB 4I0BA 4QQPA 2BW8A 1PO11 2QE3A 1S0JA 3R05A 1VBB1 1LOGA 5G05L 2X53S 1S0IA 1BCXA 4K6BA 2RR12 1FNYA 5IVCA 3QACA 3RWNA 3VDDC 2EXIA 1UYPA 4QKFA 1O3SA 4LBJA 2RMU3 1GZ9A 2VUDA 2XJTA 5A7WB 4YWAA 4BH9A 4CCLA 1J59A 4S2DA 1HB3A 3LCPA 3EHKA 2E31A 2VBPA 4LNVA 1WLCA 5FZ3A 3MFCA 2V72A 2Z69A 3OBTA 3O1OA 2DFBA 4QD2A 2Q1MA 1CZSA 4HBNA 1Z7S3 3R4UA 2KR2A 1W2UA 3NVCA 4N43B 1D7PM 3K3OA 3M2MA 1HRV3 2BGPA 4WV8A 4META 3VBUC 1MACA 4IEOA 5HI0A 5BYNA 5KXEA 3WNMA 1GUIA 3UGHA 3MO4A 1RUNA 3L9JT 2XKPA 3B3QE 1FYUA 1OPMA 1ENRA 1XPWA 3OD4A 3DKQA 1RUI3 3HAGA 1LAJA 2R072 3SEPA 3PL0A 1Q56A 1W9SA 3PVNA 4BMBA 3ZSKA 5FZKA 1Q5OA 2EIEA 3RDIA 5M0TA 5ERLA 4CCNA 4FPHA 1LODA 5F5IA 5C3OA 1SLCA 5FMOS 2I74A 4ES9A 1O59A 1FOD2 1ULDA 3UGFA 5J3UA 4J25A 3HR9A 4UBHA 2V5YA 2F6BA 4EQVA 2WZEA 2NQYA 2BGCA 5J96B 1LHNA 3MLLA 3TEYA 1W8OA 3ZDVA 2Y0OA 2JKXA 4IGPA 2DUOA 5CKNA 1W8ZA 5FLJA 2FMYA 3HNMA 1IKQA 4FAGA 4AI0A 5E16A 4CDXA 3A7QA 4I09A 1WBLA 5J7MA 1O3QA 1CGPA 4HXCA 4GXLA 4Y5TA 5JWPA 3FZ3A 5FRAA 4CEWA 4B1MA 4P00B 1DFQA 3NKGA 2HBTA 3OGGA 3VDDB 3LOIA 3KS7A 5K4LA 1GWKA 1UZZA 3VZMA 1W6OB 4QM8A 2XBO2 4OZOA 4XHBA 1ZRCA 2VZRA 2C9KA 3AL5A 3ZSJA 1IPSA 1RYYA 4YRDA 3LPFA 4FP2A 4PJYA 4FBFA 2XUMA 1W8UA 2W52A 1AZDA 2DVFA 2YROA 4COYA 1CAXA 1UMIA 1VBA3 2DURA 3QBQA 2H6CA 2ZS6B 1LU2A 3N7JA 1EP0A 1DZTA 2FZ2A 3CZJA 1D4M2 1K45A 1KXGA 2J7MA 3HBZA 3KCCA 3VBUB 3ZXAC 3TBDA 3BVCA 3O14A 1UY0A 2IFRA 2PAMA 2JG9C 4OQ9A 4HL0A 2AUYA 4X8PA 2ATFA 2QJVA 4FI9A 1E57A 5FZ0A 4AEKA 2CWMA 2BFUL 4XF3A 4TXWA 1OKQA 4JVAA 4MADA 1C4RA 2P3KA 4YW5A 3FLTA 3OUIA 5FYZA 2VD7A 4HSJA 3U0ZA 4O65A 4A7ZA 4XILA 2OQ7A 5IAXA 4GB33 2P34A 3FL7A 3MI8A 2R043 5FZLA 2FMDA 4WM7A 3KVAA 3D8CA 2NYYA 3GZUC 3IM0A 3CEWA 3J7MA 3RZZA 1LOCA 3TYJA 1UU4A 3X29B 1NYWA 4CRQA 1RUD3 2A73B 5FZ4A 4UFLA 4RGAA 3J9SA 4UFJA 4SBVA 5LA9A 4ZHNA 1PGL2 1QJEA 3KGZA 3SH4A 2I45A 2IZWA 2W2IA 5C4WA 4FQZA 3GHNA 2YXSA 2DVDA 3T09A 2W1QA 3USUA 2W95A 3K3NA 4HOOA 4LHLA 1LGBA 1Q3EA 3SKJE 5KC5A 5FXXA 3Q8BA 3RRDA 1MEC3 3SISA 3KQ4B 3CJIB 1S2EA 4RYDA 1RUOA 4JGZA 5CFDA 1BXHA 1QQP1 1V6LA 1U12A 3C7HA 1G9FA 4JQRA 5DUUA 5HPOA 3DL3A 1UAIA 2PMWB 1XRUA 2BERA 1NAEA 1FAYA 1WZXA 2DVAA 3Q9OA 3MIHA 1FPN1 4YZ2A 4S2HA 2E7AA 4K1YA 1CONA 4AAPA 1R1A2 3D5OA 1L7RA 4CDQA 1UIJA 5GLZA 1SLTA 2ZGRA 2KA3A 1UO9A 1OF4A 5BXXA 3KT4A 4ATEA 3K4AA 1TME3 1ZBA2 1AX1A 3JD72 5JOWA 1DQ4A 4KI5M 3AYCA 1RC6A 2JG9B 4DXRA 4XUNA 2RS12 5DAXA 2ENRA 4FT8A 4DQAA 4XURA 1IZ3A 3WDWA 1IQDC 4UW4A 4LO7A 4CDXC 3PTYA 1I6XA 4GA9A 1K5MA 3USSA 5L9BA 2OS2A 1JN2P 4CEWC 2JDZA 4OUEA 4YZ5A 1ZBE2 4O61A 3PUHA 1W2OA 1C8M2 1VBD1 1B35A 4SLIA 5FZFA 4GD4A 4NOTA 5FYIA 1VBB3 3I2DA 3NSTA 4XXPA 2AGSA 3FHAA 4C1WA 5KR7A 5HCHA 1H2KA 1NG0A 4EN6B 5HBAA 5JIUA 1JU4A 3H1WA 5IVYA 1DCSA 4BQWA 2EXKA 4LOTA 1ONAA 5JI7A 1W05A 3I8TA 3AX4A 1NA1A 4HETA 2IXJA 3MLJA 4QPWA 3OGRA 1W04A 2OYZA 2HJIA 3NNGA 2ZX1A 4DRVA 3FC0A 4DUXA 1US2A 2PHUA 1C1LA 2XLAA 3BTAA 4MV2A 4NHLA 1NOVA 4HN1A 5L19A 3N9NA 3GZTB 5FO9B 3JB4C 1FOD1 3K46A 2X5IC 4NPMA 4XUPA 1HLCA 4WZCA 3WHTA 1J84A 1XQNA 2TUNA 3VBFA 5FCCA 4BQ4A 4MG2A 5EIYB 4QKDA 1OC1A 1OUXA 3H8OA 1VPHA 4WM7C 4ET7A 2AACA 2JECA 2VXRA 1TZOA 1NCRA 1HJGA 4GMP0 3ECQA 3PIGA 4KG0A 5LBEA 3AJYA 1RJ8A 1X8MA 4RS5A 3RGBA 3EBRA 4KQ7A 5C4WC 2GMPA 4R8HA 4E27A 1CPMA 2O0OA 1JYIA 4CDXB 3ME2A 2Z2SB 3KQRA 4H55A 5JXGA 2DF7A 1H6XA 4CEWB 4QHBA 1J58A 5FYTA 2EXHA 2YC0A 3HWJA 4QXBA 3TB0A 4CVUA 4LKFA 1CESA 5C8WA 4I0AA 1AR72 4JGZC 3BU7A 4P08A 5L73A 4S2GA 3TN93 1N3OA 4XVHA 2ORXA 5EQUA 1B09A 1W99A 1HQLA 4GWJA 3NW4A 2VTXA 4H7LA 4CUCA 4EYUA 1EPZA 3IDAA 1J3PA 1RUE2 1CAXB 4CDQC 2ZOEB 3N9OA 2PHWA 4K8RB 1XU1A 3WP5A 4UFHA 2WFF2 3RZGA 5A1LA 2JDHA 4IEUA 4M3CA 1POQA 4Y24A 1ZRFA 2LM3A 3IDCB 5IK8A 1RB8G 5I93A 2YC2A 1G7YA 3O12A 3WNKA 3DPRA 1ULEA 5FP7A 3A4UA 3ZXEA 4AQTA 2HWF1 2ZTNA 4CSWA 4NHKA 3J26N 1K5MC 1O4YA 1ZZCA 2VOTA 2R49A 4AXOA 4RSUA 3BI3A 2D7FA 3ORJA 1B35C 4HPKA 1Z78A 1OSGA 4NR1A 1YFXA 3BTXA 2D98A 2K0GA 1SFNA 1UPSA 2OPKA 2YFUA 4WM7B 3R6SA 4DXZA 1RVF2 5A3OA 3M8LA 4M00A 1BVVA 2HWB2 3PMEA 1WW5A 2W9XA 1OD5A 1UOFA 5GZEA 4AVCA 1PM4A 1AYM2 3AYDA 2BDRA 1XSRA 2WAAA 3NV4A 4L0PA 4AOCA 4DEVA 2D3SA 1BYHA 1FNZA 1ZA7A 2DBNA 2PELA 4YGBA 5B4NA 1NA1C 2BGOA 3THTA 4ZU7A 2A6WA 1ACCA 3USUB 2Z5WA 5DAQA 4FSJA 1SLBA 4P5HA 3E5XA 3VKOA 2YMZA 1DYPA 1QNYA 2ZGNA 4JGZB 3RJRA 1UYXA 1R1A1 1ZA4A 2CY6A 3POBA 3QLQA 4QX2A 4RHV2 5FY8A 2QQVA 3RZKA 2QVSB 2F4LA 5DZFA 2J1RA 3AP4A 4EN9B 2Y38A 1QQP3 2ET7A 2VZSA 3NKTA 3JB8A 4FQ4A 4X6QB 3LSDA 4QPIA 4CDQB 5KHJA 2OX0A 4AFDA 3CLPA 5T54A 3VBFC 2FCVA 5DZGA 3GM8A 1FPN3 1TMF1 4YPJA 4AI1A 4C0HA 2WSVA 4HZFA 5FY9A 1KDMA 5DMYA 1QU0A 4JTNA 4LLFA 4Q4W1 5IWFA 5C3RA 5KXDA 4FPLA 2DU1A 1NCRC 3NJXA 2R1DA 2ZXQA 3FMGA 1UN1A 2ZGQA 4MZUA 4CCEA 2EF6A 1OFSA 1G86A 1OA3A 5A6ZA 3TOJA 1K5MB 4MYEA 3ZM8A 2JDMA 4BM8A 4ARXA 1FXZA 4JRAA 3R0RA 3PTRB 1B35B 2DWRA 2H0VA 1RUF1 3U4XA 1N1TA 1QXPA 2IXKA 2VW1A 5JR2A 2P3JA 3KM5A 1NQDA 2RJKA 3LFMA 1VBD3 2JE7A 3AZXA 1JOJA 4OUSA 4ZS2A 5JSOA 1US3A 5JPMB 3LZZA 3BGAA 4P9GA 5ACA2 2QQMA 2CNAA 1VAKA 3IKWA 3WQ0A 3WNLA 1C3HA 2VMEA 1NA1B 3RG0A 1ST8A 3KT1A 1KQRA 1RUG2 2PHDA 4MGIE 4RR3A 2BTVC 4ZONA 4E8DA 1JOPA 3ILNA 5JLVA 2AREA 4XMAA 1W8WA 2J1EA 5FO7B 2ZEYA 3SHRA 4LBQA 3K48A 3WF4A 2HWD2 1YQ5A 1GV9A 4JKKA 5GLVA 4DPNA 4AI9A 2W92A 4XAAA 4QKNA 1FOD3 2PAKA 4LK7A 1XNTA 1RUH1 3VBFB 3UKNA 2BPA2 3CKHA 1GP4A 4IE0A 1W3XA 2NM1A 4O9GA 4CP1A 4M0HA 2YY1A 3LD8A 4P9WA 4IL7A 2CDOA 4LT5A 1U5IA 4JQTA 2GNTA 3MF6A 4KBBA 3WF2A 3H1MA 1NCRB 2EAKA 1Q8PA 5JCTA 1OBNA 4NN0A 4RS5B 3MPBA 2ZGLA 4KGQA 4ISRA 2O8OA 1UZ0A 5A7SA 4GULA 1AR71 3AYEA 3DUIA 5CVRA 2IXCA 2EALA 2Q0AA 2IVIB 1EAH2 4QDSA 1I5ZA 5FZ1A 5ABJA 4BJ0A 4QPYA 2XBO3 1RUE1 2VOKA 3D0SA 2V4VA 3KD4A 1X9PA 5IUQA 1PVC2 5FYYA 5EPAA 1WCUA 5H9SA 1Q8VA 3KF5A 4QMAA 4R4XA 2WFF1 1H8VA 4CCOA 1SZBA 3GF6A 3PDQA 4XMIA 3RNSA 3MIGA 4QPIC 4Y22A 2WNEA 5FZIA 3WDUA 1NT0A 1AJOA 1R082 4YGCA 1CIYA 1WCKA 2WJSA 4UFMA 2ZGUA 4CCDA 1D4M3 1H1IA 4M3CB 4A44A 1WA4A 1APNA 5FMCA 3RI8A 4E4HA 1W9WA 1C1FA 1QXRA 2YDEA 2OA2A 3M7AA 3MW2A 5DZEA 1ULOA 5BNNA 1UX6A 1X8EA 3FX3A 3DPRB 3S30A 3VKNA 4EWDA 2HKXA 2EIGA 2JDYA 4LXLA 2Q1FA 5AC91 2R6QA 3GBFA 3KCYA 3M4FA 4XABA 1VRBA 2XL9A 1ZNPA 3ACIA 1V70A 2HWF3 2P6HA 2DUPA 4G4FA 1XOYA 4HPKB 5F3IA 3ZFFA 1GOGA 2DTYA 1QNWA 5ISLA 5LWBA 4XUQA 4YM1A 4TSVA 1YFWA 4R9DA 3ROUA 2WQ8A 3PJQA 1AYM1 4DXTA 1GFF2 4XF1A 4XQDA 5A1AA 1UYZA 2ZMLA 3O1MA 4DZGA 3U07A 4Q4V1 1HRV1 2GP5A 1R1ZA 4CU8A 4PF1A 4YG3A 2ETEA 3S7IA 1DIWA 2WQZC 4RGKA 4OQ8A 3Q8EA 3ATGA 5GLUA 3OTFA 4RR3C 3VZOA 1W28A 1VR3A 3MV01 4CPBD 3A23A 1ND3A 5CFCC 1E5HA 3ZXJA 5A3TA 1FV2A 1ND2C 1STMA 5A80A 2R32A 2ZABA 4A7KA 2G1MA 2BQPA 3RWKX 4AI8A 4JRLA 4AQ2A 3AFGA 1R1A3 4P9JA 2VMHA 4QPIB 3WCRA 1X82A 4YVWA 3OEAA 1H2NA 1LENA 4OMDA 3NV3A 1KJLA 5D21A 5IK4A 3OCPA 3DEMA 1GZCA 4F3JA 1W39A 3ASIA 5JXIA 4IEYA 1VBE2 1ZBA3 2LALA 1CZVA 3JD73 5FPXA 2VZPA 1LHWA 2FQPA 3VBHA 1BBT2 1IQAA 2D5HA 2ZHNA 4GWNA 2FD8A 2JB4A 4QDRA 5FK7A 1BVP1 2RS13 3W20A 1XNBA 3K4DA 2Q8CA 4BMEA 4HONA 3BTYA 2VC9A 5FZDA 4QU1A 3SCHA 4W8JA 4Y20A 3RQ0A 2PHTA 2QQOA 1UU5A 3POFA 1EV12 3L2YA 2I2SA 4NAMA 1W6PB 1ZBE3 3MFAA 4BB3A 1DQ1A 1ODNA 1PGSA 2VOVA 4WBBA 4YW4A 1S0BA 5LASA 2BU9A 5T5LA 4CCMA 5ABJC 4NAOA 5ACA1 4D6SA 4EN0A 3BKZA 3FN9A 3CMGA 1CPNA 2UWAA 4AG4A 5FLIA 3OPZA 2W1WA 4Q4X1 4C91A 3A22A 4IE7A 4V2VA 5F5QA 3VKLA 4URTA 1GLHA 1V6MA 2K46A 2BV4A 3LDKA 4QX8A 4J1WA 1RUF3 2A3WA 2Y26A 4LKSA 3VD4A 1CZTA 2VUCA 2QQLA 4M01A 4YG6A 2LRPA 4OFGA 2E63A 1H8TA 4U36A 2W1SA 1I5PA 2UYAA 4ASMB 1HXS2 1WBFA 2VMCA 5BV6A 1BJQA 5BNNC 4RR3B 1FATA 1M4WA 1Q43A 2HWD1 1QOOA 3LEIA 3VN4A 1JW6A 4H3WA 4CXXA 2WLQA 4Z2AA 1DQ5A 5T5JA 4LO4B 4LBQB 3NMBA 3GGLA 2X09A 3PURA 4R4ZA 1VBC2 1NY71 3KHBA 1PK6A 1VRH2 4FOWA 5FAXA 5LA1A 2JEMA 3B7MA 4IEWA 2J22A 4BQ5A 1MZ6A 1JYWA 2R041 3DGTA 3ZFFC 1OLME 2QKDA 1BK1A 4FFGA 4LOSA 4COUA 5HCBA 5FOJB 2IXHA 2G4IA 1JYCA 3ZPOA 3BU0A 2JD4A 3MIBA 5F2WA 4IXLA 1BHGA 4ZXKA 5C71A 4MGSA 4XF0A 4MGYE 5FPAA 4C0BA 4WVMA 2J42A 4W6YA 2WZPP 3SLIA 2SBAA 2JENA 2W3JA 2HEVF 3S5AA 3GJBA 1H1MA 3IIAA 2QQUA 2DCTA 1AYN2 4KL1A 1NQJA
chains in the Genus database with same CATH topology
4XEZA 3SMHA 5ABJB 1U5ZA 1ND3C 3SITA 1AR73 4RGGA 3WW3A 2B45X 4DB5A 3CNAA 1QGLA 1LCLA 1R081 2GU9A 2D6LX 2YV8A 2XPJA 3LA7A 2P37A 1ALYA 1CN1A 3VL8A 4R9AA 2A3YA 1RUE3 1V6OA 5SV8A 1WD4A 4Y22B 4QQ2A 2MEV2 2WFF3 5FOBB 3AJZA 1AL22 1WMDA 3AYAA 3VV1A 4CTEA 4B8EA 4XQWA 3VBHC 1C5HA 3AKQA 5BNNB 4XBLA 2WSUA 2BBVA 3GBWA 1WLDA 3WW1A 4AGVA 2AH2A 4HN0A 2D3RA 4GWMA 5EJ3A 5KHIA 3AZWA 1X36A 5AC93 3FUOA 4BLJA 5FMOL 3WUCA 1IPKA 3ZFFB 3ZFGA 2V09A 4FPJA 4FXGB 2PN5A 4FTEA 1RVF3 4FPGA 1OQEA 2C0ZA 5DDJ2 3AKPA 5I0UA 2HWB3 1QJX2 2BNOA 2G9FA 1MZEA 4HMZA 4K21A 1AYM3 3BODA 3FFZA 1GNZA 4MXWA 4XIKA 2WINB 1H8TC 1YIPA 2QZ2A 1BEV2 1D0GA 1F5FA 4Q4V3 3DN7A 2PTMA 1WMFA 3FFQA 4X8NA 4BZ4A 1ND3B 1LHUA 4RHV3 3UJOA 2GDFA 4LO8A 4K3UA 1YIFA 4HSLA 3AFKA 1PK6C 4KWKA 1D2QA 2R30A 4P9LA 4Y1VA 1VBE1 3LGRA 3ZXGA 4YVWB 1SBDA 1BBT1 3TNQA 1HX6A 1BZWA 3PVBB 3N4MA 3GBGA 2VNGA 4TLFA 4B29A 1QJY2 3CO2A 4GMP3 3VBHB 1F9KA 1XE7A 1EV11 4AF9A 1GQGA 5A3LA 3J8F2 1ENXA 4QM9A 4Y20B 2ZGPA 1PNGA 4D94A 4NO4A 3GHMA 1KFXL 1R092 1Z0HA 2XJRA 5EZWA 3TN91 1RMU2 5CFDB 3IBMA 3M1HA 3ST7A 2ARXA 2MPFA 2XH6A 3FHIB 5ACA3 4JDNA 2UY9A 4Q4X3 4RD7A 3WOGA 1N3QA 3OY8A 5JSPA 1KRIA 4KU8A 1DG6A 1H8TB 1RGSA 2EAAA 1QF3A 1J1LA 1MQTA 3O0XA 5H9PA 4Z8BA 1SCRA 3JQWA 2GALA 1F2NA 1QDOA 3N3HA 2YHJA 1O3TA 3SNMA 1AR62 1VRH1 2WNVA 4XFIA 3NAPA 4E4SA 4OHVA 2HWD3 3MW4A 1O4TA 1PK6B 5JOXA 1AR82 3B69A 4BPZA 2CGOA 1ENSA 1YWKA 2X5IA 4UBGA 1MS5A 1QJU1 2Y0IA 4LUKA 4WVZA 3ZFGC 3H50A 4EWEA 3K51A 3D82A 2OZ6A 2WQ4A 3PMSA 4YM0A 3RJ2X 3LSEA 2RJLA 5CAZA 2NLRA 4FOVA 3SXWA 4BLIA 3AXEA 3OBRA 4WVMB 1ZZ8A 3ZYGA 5H9RA 2EVXA 3PJYA 3LOBA 4ZU4A 1EAH3 1RUC2 4Y1YA 2DVBA 1Q8QA 1RJ7A 3EO6A 3QCWA 4GH4C 4Q1RA 2RS32 2A6YA 1YXWA 2C9AA 1KS4A 2MEV1 3ES4A 4Z07A 2VULA 1PHMA 5CADA 2WLPA 2H6BA 1V00A 1R083 2UWCA 2NZ9A 4KWJA 1S0GA 1AR92 3QH7A 1H4HA 4Q0VA 4L97A 2DV9A 2VY0A 4XFGA 1AL0G 1UZYA 3KLSA 5BPXA 2AENA 1YHFA 1ZZ6A 2VMGA 2YZ4A 3CF6E 3QOPA 4HKLA 2D44A 1AVBA 2RR11 4BQ1A 3ZO0B 4MUVA 4YNIA 1N47A 1G9AA 5HXVA 1ENQA 1YO8A 4LA3A 3S6PA 2BFUS 3AMPA 4AFCA 2XB6C 3G6JB 1N1YA 4XFHA 1VIWB 2AR6A 3ZFGB 1PIV2 2GMEA 1F5JA 1JH5A 3ZXFA 4JC1A 1OPOA 1BEV1 2VPVA 1ZZ7A 3VZKA 1SACA 2OZJA 5EYYA 3VHRA 1W0OA 1S0FA 4EROA 4XXAA 1L3JA 4MXWB 2WWSA 2VVEA 1O5UA 2QZ3A 2O1QA 3VZLA 2TNFA 5JOYA 1MQTC 2W08A 5I0TA 2UURA 2GAUA 4M3CE 1WMEA 4XFAA 4CDUA 2R071 4XJAA 2WNVC 2BNNA 3NAPC 3VZJA 2WZR2 1V6JA 3I4IA 1V6IA 1V9U2 4AEDA 4BCUA 1YNAA 3BPZA 3V64A 3KMHA 3RMXA 3WQ1A 1SDWA 1QJY1 1IS6A 1C28A 4AFMA 1DHKB 5T5OA 1YJKA 4XTMA 4EWAA 4HLTA 2NMNA 3JBG2 1VBE3 2ZGOA 4TYSA 4XJ9A 3VHNA 5KHHA 1BBT3 2A3XA 4E2SA 1LOFA 1WD3A 2FBEA 3H3ZA 4N53A 2PHXA 2Q4SA 3AZVA 2WFPA 5JR7B 1G9CA 3WXPA 1EV13 4Z1VA 4OHYA 2R0HA 1RMU1 2WS92 4XBQA 2E7QA 2XBO1 3AMMA 4XTPA 1GZWB 2A6ZA 1COV2 1XYPA 2GC1A 3C2UA 3WDVA 4XE9A 4AHXA 3B02A 3V56A 1O91A 4IERA 1Q8OA 3OY8B 1DGLA 1NXMA 1GNHA 1J3QA 1D4M1 4UW3A 1AR61 1MZFA 3JUUA 4J1XA 3M3OA 2OW4A 1MQTB 3B9IA 2PFWA 1CAUA 3E6BA 5FREA 3LAGA 1DZQA 2HWE2 1AR81 1U0AA 2VQAA 2WNVB 5KHGA 2XG3A 3GZAA 3NAPB 2JICA 3UK9A 3IPVA 5F9TA 4XFCA 5IK7A 1VBC3 4LBLA 4FOQA 1VRH3 1RUJ2 2X5IB 1LGCA 2XLFA 1NLSA 3MIEA 1BKZA 5EFUA 1WW7A 3MF9A 3J4UH 1PGL1 3V65A 1QJU3 3THPA 1RUC1 4KGGA 2CL2A 5IK5A 5HCFA 4AEMA 1UF2C 4WVWA 3H0OA 2RS31 4YW3A 3A0NA 4Q4Y2 5GZDA 4BIFA 1NZCA 4I02A 4CDUC 3FUQA 3LKJA 4G9SB 4MSVA 1VLNA 3EJKA 4AEDC 4L8QA 5K0UC 1AHSA 1PO22 5FBZA 2CTVA 1C8NA 1RHI2 2HWC2 2XLGA 2YPJA 2X29A 3D0JA 4YZ4A 2MEV3 1EYBA 4R9BA 4W6XA 4Y1ZA 4XDQA 3I59A 1D4VB 1GKBA 1ZBA1 3JD71 1AL23 4XYXA 3ZSMA 2IXIA 2Q8OA 1Z7S2 2RS11 2XVKA 1LOFC 4B4QA 1ULGA 4HVRA 1QH7A 3CL1A 4N53C 4D69A 1OOPA 1LKNA 1IS4A 1ZBE1 5JSRA 5JDBA 1PIV1 1C8M1 5GKAC 4B7KA 2Q30A 2NP0A 3HD8B 2RR13 1W6PA 3RYPA 3ACLA 4XZPA 4G3YC 4PBOA 2PHRA 2A70A 5JIAA 4OI0A 1YFUA 1REFA 4LE3A 1U5YA 1O7FA 5EYXA 2VU9A 5J98B 1LHOA 3WZ1A 1BEV3 2XJPA 3MGUA 1LEDA 4XFBA 2WZR1 1IPJA 5AVAA 4DY3A 1DZRA 3H9AA 5EWSA 4CDUB 1ZVFA 2CWSA 4PDWC 5KXCA 4AEDB 5CFCA 1XXNA 5K0UB 3W58A 1ND2A 3JQXA 2R073 2TBVA 4ORFA 4QX5A 2HYKA 4HANA 3OYWA 4NVPA 3AP7A 2GNDA 1H2MA 1ASJ2 4L99A 2A5ZA 1QJY3 4F83A 2VGDA 4D3WA 3B93A 5B2GB 4N53B 3IT8A 3W9AA 1HW5A 2CGNA 4COZA 5JMCA 2OUJA 4IEPA 3ZVXA 1COV1 4EV0A 1R093 1SLAA 2RS52 4AEJA 1SBEA 3FLPA 1UCXA 3JZVA 4FOYA 1RMU3 1XYNA 3AMHA 3LWCA 2MHFA 1CVNA 4YW1A 4WM8A 2IXLA 3SCGA 3TRSB 2JG8A 2BUKA 2ARBA 2BEOA 1NLRA 3V0BA 4ONUA 4IEVA 3HN1A 4QGMA 5IT6A 1MEC1 2PHFA 2HEWF 1CAUB 4DS0A 2ZAHA 5DUVA 4YG0A 1AR63 1RUJ1 1DYKA 4Q2FA 1OOPC 4PDWB 1PVXA 4AQ6A 2XJVA 3IPVB 4ATFA 1AR83 4JTOA 1S2KA 1Y3TA 1ZRDA 3V0AA 2N7GA 2Z79A 1XU2A 4AFBA 3BIWE 3PNAA 2D5FA 1ZRRA 1RVF1 1SQ4A 3N35A 4FTBA 2HWB1 1XYOA 1FV3A 3WCSA 1T6GC 3ZPYA 3FBMA 2VOXA 5JZGA 4MLOA 4UXAA 4DRRA 3I7DA 4LULA 4M0NA 1HRI2 1TME2 1SFYA 2WL1A 3ETQA 1S1AA 4HT1T 3IN9A 5T5PA 2VOWA 1RUC3 2R1BA 1VALA 2RM22 3B9CA 3HT1A 2Q1ZB 4RHV1 2VG9A 2W0XA 2RS33 4IV1A 2HWC1 4ZU5A 4Q1PA 4GALA 5LEJA 1PO12 1VBB2 1POV0 5C8CA 3MPPG 1IKPA 3MICA 4MX3A 5DXDA 3I59B 1W6QA 2E7TA 4K40A 1XE8A 4GMP1 5C9AA 1VAMA 2O8QA 5E1RA 2FZ1A 2GH2A 2D43A 4FXKB 2DYCA 4QXKA 3WQ7A 4RFT0 2XVGA 4NWVA 1OOPB 1DF0A 5KBFA 5CNAA 2VQ0A 4E9KA 4ASLA 1H9WA 1CD3G 1QH6A 5KHKA 3OJBA 2K2SA 1PIV3 1C8M3 3BB6A 2ZGKA 2ZGTA 3NV1A 5HCAA 1VAVA 4HFSA 1LOEA 2A71A 2BVVA 5J36A 4WM8C 1V6NA 3VBOA 3MEPA 3ZIXA 4GKXA 1N1VA 2VNRA 5J37A 2JG8C 2ZAAA 1RUG1 1G9BA 4PLNA 4XJWA 1O4ZA 2C1FA 2G9GA 3TAYA 4L9BA 4MH0E 4AVVA 2WZR3 4YFZA 1V9U3 1UPIA 5AFEA 5CFCB 2VUAA 1ND2B 1JBCA 2XJQA 1REDA 2DCJA 4W65A 2ZX2A 3OYWB 1WLWA 1ZM1A 3RYKA 3KB5A 3JBG3 4AE2A 2MNGA 5FPZA 1Y7BA 3VZNA 1Y9QA 3UKVA 1FT9A 4Z92B 3R4SA 1SEFA 4RQPA 4FP3A 5JZGC 4PF5A 3ES1A 1YRZA 1G9DA 1EPWA 1AF9A 2RS51 1FX5A 2LUWA 4Q27A 5CBLA 1EAH1 1SBFA 3W59A 4V1PA 2WS93 2E9QA 1NCQC 3MIFA 4IV1C 1DGWX 1PVC1 2BYVE 1W0PA 3SH5A 2YGMA 1COV3 3VLBB 2EA7A 4OHWA 2XWJB 1W6NA 4INDA 3PVOA 1QOTA 4WM8B 5C8CC 3RYRA 1IOAA 4OHXA 5DG1A 3UKTA 4OUMA 1C5IA 2JG8B 1DU3D 5J48A 3V0BB 5C9AC 5A33A 4N43C 2EXJA 2DCZA 4FCAA 4ITCA 2HWE3 4LBMA 4UW5A 1ZREA 5T55A 1WGPA 2ZZJA 4RL7A 4RA0A 2TEPA 3AP5A 4XF4A 4AK3A 1RUJ3 1EY2A 3V0AB 1C57A 1DGRA 3WG4A 4BA6A 1AX2A 3MYXA 1DBNA 1XNKA 1LR5A 2JE9A 3JCIA 3WX5A 3ZYPA 1HRI1 2D6MA 3VBOC 5JZGB 1F8VA 3URFA 2YGLA 3B94A 1LOAA 2RM21 2SLIA 3AKTA 4PBPA 3WG3A 4Q8LA 4AGRA 4PCRA 1ULFA 4YYOA 1BQPA 5L7OA 2C5DA 5F6KA 4I01A 1H0BA 4LBOA 5BNOA 2P17A 3KGLA 4IV1B 2OVUA 1UKGA 1JTZX 2D6KA 3INAA 4XW3A 4GH4A 1PO23 5CIRA 4OI2A 1SLIA 2HWC3 1RHI3 1QHDA 4EN8B 1HDKA 3RI9A 5C8CB 3WVJA 1UL9A 2ZGSA 2DFCA 1OA2A 3OGJA 1VBD2 4HKWA 2UY8A 1W6QB 2PLV2 1Q8SA 3HT2A 4M3CF 2A6XA 5C9AB 1DLLA 3KCXA 5GJ6A 4FTSA 1CQ9A 4K8FA 4IV3A 2WKKA 4R9CA 3H3UA 4RQPC 1URXA 4N9HA 1TNRA 1H2LA 4LEJA 2GH8A 1V6KA 1HKDA 5I0RA 3RMYA 3WP4A 1MS3A 3ENRA 4AI2A 1KD7A 2D3PA 3GALA 4B3NA 1PMIA 3B5LB 1I1EA 2XWBB 1UKRA 1WCSA 4Q8KA 1DDLA 4CP0A 3VHOA 3A0KA 1GZWA 2DCKA 1S0EA 1X7NA 3VBOB 2D97A 4IEZA 2WT0A 1GR3A 4FPCA 1GBGA 1HXS1 5LK5A 4ISQA 2R062 2VW0A 4CP2A 4OULA 3D6EA 2OIIA 3R4DB 4OI1A 3LA2A 3NO8A 1RUG3 3AMQA 4AHYA 3BOWA 4Z2WA 1KS5A 1VBC1 2YYOA 3U10A 3VUOA 4KU7A 4XJZA 4LTAA 3CJIC 3BOPA 4XF9A 4LA2A 4OI4A 4R52A 1G6NA 2JKBA 1FMD2 1KFUL 2ZHMA 2B7YA 3ILFA 2ZX4A 2F4PA 3ZXLA 1ASJ3 4EN7B 1QKQA 1LULA 1UW8A 3MW3A 4GIQA 4K7JA 1AX0A 1O5LA 2ERFA 4RQPB 1I9RA 5I8TA 3PVEA 1H9PA 1S55A 4KH9A 4N9IA 1TQ5A 1S2BA 5FQ0A 1AYN1 2WIIB 1QOSA 2D93A 2AZ5A 1KITA 5L7OC 3BCWA 5E89A 4I2OA 2B8MA 2RS53 5BNOC 3EXUA 3WD5A 4ZKTB 4B4PA 1POV1 4NHMA 4QQOA 2HWF2 3RS6A 2UYBA 1QWRA 4IEXA 1MS0A 1PVC3 1W6NB 4B4RA 1M06G 5TSWA 2GC2A 2K9ZA 1DQ0A 1ZZ9A 2JX9A 4XJ8A 1AL21 1YI9A 4A7YA 4BE3A 4JGYA 1PM7A 4JDMA 3LB9A 3RPQA 3N7KA 4YM2A 5A33B 2VNOA 1NE6A 4IV3C 2GNBA 2QDNA 2ZGMA 2B9UA 1A6CA 4PLOA 3ZYIB 4MVTA 4CEYA 4HK8A 2KXLA 1OHFA 5DG2A 5GLWA 5K8SA 1LRHA 1AUYA 2ET1A 2Z42A 2E53A 1I3HA 4IETA 3T2TA 3G7DA 4YARA 5LEKA 1LOBA 3ZMNA 2DU0A 1RL3A 1FI2A 1QMJA 4KNCA 4KG8A 4BOWA 5DDJ1 2E51A 1QJX1 5AFBA 1HIXA 3M3CA 2R16A 5GZCA 1A8DA 3M70A 2E6VA 1HRI3 1MS1A 4AWDA 1LESA 5E8AA 3WP6A 3C3VA 2WT2A 3IMNA 2GSYA 3QD6A 2ZKLA 1GICA 1TMF2 4QQHA 3WG2A 3ZSLA 5L7OB 4Q4W2 1QXJA 2RM23 5BNOB 1OQ1A 2B42B 3ZDSA 1N1SA 3WLUA 3WDYA 4GH4B 4XHXA 4P14A 1CAVA 2QDRA 1OMIA 1PO13 3O0VA 2PLV1 5K0UA 5FO8B 4N7UA 3NWKA 4IQPA 4QGNA 4CZSA 2BNMA 1YYNA 1RUF2 3VBRA 2CGPA 5GALA 1PZ7A 4FPEA 5JI9A 4IV3B 4J6GA 2ILMA 4OVEA 4Q0QA 3J8F1 1RINA 3AKSA 3KZ4C 4Y4YA 4L2NA 1SCSA 3P3NA 3D4KA 1R091 4NPRA 2D6OX 5D8AA 1Y43B 2IC1A 4LHNA 1LHVA 3CU7A 2HEYF 4DOUA 2JXAA 4E4ZA 3ZN4A 3IDEA 4DINB 2UWBA 3KT7A 5GM0A 2R061 4N7IA 4XIOA 4X6RB 1MVEA 2ZCWA 4CDWA 3VKMA 3ZYRA 1A3KA 4JGYC 3M3EA 1RUH2 5FFOC 4YFWA 1TE1B 3WNXA 4E2GA 1WW6A 3DKWA 1HXS3 4CEYC 2PAEA 2D6NA 4AVSA 1BMV2 3ZN6A 5I0SA 1FMD1 2GMMA 5KWRA 3IWZA 1PGW2 4PDWA 1YCIA 5CFDC 1ULCA 2QCSB 4Y1XA 1QJZA 5A32A 2AYHA 1UD1A 4C1XA 2B39A 1UIKA 2UU8A 3GNEA 2CAUA 2NPIA 3ELNA 2QQPA 4D7SA 1RIRA 2BWAA 2KM2A 5BNPA 3E6CC 3E5UA 1RITA 5T3NA 1TNFA 1OLRA 4LHKA 4XPVA 4LO6B 1MVQA 1REEA 5FQ0B 4HVQA 1DQ6A 3O7OA 5FTTC 1UU6A 2ZHLA 4YGDA 1NXD1 1AYN3 1SLLA 4DY5A 1AXZA 1JUHA 2DUQA 4D7TA 5AC92 3POYA 1POV3 1OA4A 3AP6A 2VVDA 5AVPA 4YW2A 3RSJA 1AR91 1LECA 2RMU2 2VW2A 1VP6A 3ZX7A 2PQQA 1JHNA 3KSCA 4JGYB 4GKYA 3VBRC 3WV6A 1CAWA 1QDCA 3WY6A 2CAVA 1GYKA 3B00A 2B5HA 2ZMNA 4L11A 4CEYB 5FDBA 3T1MA 4Q4V2 1HRV2 1W6MA 1VB2A 4XBNA 1QY4A 4XOGA 4K1ZA 4QGLA 5D8AC 3HIFA 4IEQA 1D2SA 2QFEA 4AI3A 4ES8A 5EV7A 4AHWA 1RUI2 1H4GA 3WR0A 5H9QA 3U11A 5F6LB 4GQ7A 2A6VA 2WA4A 1GSLA 3S7EA 5DDJ3 2WA3A 2GC0A 1QJX3 3ZFEA 4CDWC 1UMZA 4TZDA 4LBKA 4Q0UA 2PYTA 1NE4A 2NN8A 4YVSA 4RS5C 4F8AA 1MR5A 3MDPA 3O0WA 1OQDA 1SMVA 4HKOA 2RE9A 2CV6A 4LLOA 4XJUA 2XHKA 5CB7A 1V9U1 3ILRA 2ZHKA 5C33A 4Y26A 1CAVB 1CX4A 1JXNA 3T1LA 3WUDA 5I8YA 4YLZA 2DCYA 2B46X 3UL2A 2ZMKA 3ZSEA 1XNDA 1N3PA 4PIXA 2GNMA 3JBG1 5SV5A 3VBSA 4K9SA 1MS4A 2PLV3 3BALA 4D7YA 5K9YA 4S2FA 1AXKA 3VBRB 4AHZA 1OFNA 4Q4X2 1IS3A 2A7AA 4P9IA 5BNPC 2DTWA 5FLHA 3SH3A 3NL1A 4HVOA 3E6DA 5KC6A 2BVBA 1KDKA 1VBA2 4E4DX 3GYDA 1LTEA 3E97A 5J09A 3ZMOA 1TEIA 2XL7A 3EQEA 3S0MA 4H7MA 3B01A 2WS91 3J8F3 3DPRC 4Q0PA 4FPFA 4AVTA 4Q26A 3NJZA 3ZIWA 5D8AB 5K7PA 1GANA 1YFYA 3AXDA 1CIWA 4Q0SA 2BWCA 3PHMA 3APBA 1S0CA 4AGGA 1NY72 3AKRA 3UV9A 1LEMA 4K20A 4GB32 1X33A 4CDWB 2NMOA 4C90A 3ZYJB 2R042 5GLTA 2R063 4FO9A 5CG8A 1H1AA 1BMV1 2HWE1 4QQLA 4F7ZA 1LJ7A 4A2UA 1RUD2 1PGW1 3ZN6B 1VJ2A 4LBQD 3POWA 2LTNA 3FLRA 5A32B 4JCKA 3PLQA 4JAAA 1MEC2 1FMD3 3NV2A 3OD0A 3ZXDA 2WT1A 4LBNA 3WP3A 3H7YA 4P9YA 2I07B 5CG9A 3L2HA 4IESA 5BNPB 1WLTA 1CJDA 4OZXA 5CU1A 2GN3A 2WC2A 4UW6A 4AW7A 4P9XA