1RUJ2

Rhinovirus 14 mutant with ser 1 223 replaced by gly (s1223g)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
molecule tags Virus
source organism Human rhinovirus 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
total genus 49
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruj200
1FPN1 4IV1A 5C8CC 5BNOB 4AEDC 4RS5B 2HWC2 2RS51 1COV2 4PDWC 1RUI2 1PO21 3ZFFA 5BNNA 1M06G 1PGL1 1ND3A 4YVWC 1R083 1PIV1 2R041 5BNPB 1HX6A 1QJU1 2HWB1 5BNNC 3ZFEB 4CDXA 3ZXAC 1WCDJ 5K0UC 1MQTB 1ND2B 1VRH1 3S6PA 4AEDA 5ACA2 4YVSB 4CDUB 1R093 5L7OA 2BBVA 1OOPA 1AYM2 4QPIC 5BNOA 2X5IB 4NWWA 3VBHC 4CEWC 3ZFEA 3VBOA 1HXS1 1OHFA 4N53A 1ZBA3 3VBOC 3J8F1 1AR61 2FZ1A 1MEC2 1TMF2 1PVC3 5CFCA 1RUG1 4JGYB 4Q4V1 4IV3A 1RUI3 1GFF2 1RUC2 1OOPB 4CDXC 2RM22 4Z92B 1R092 5FMOS 1VBE1 1TME1 1RUH3 4YVWA 2PLV3 5C4WA 1TMF1 1MEC1 1VBC2 4Q4W2 5DDJ3 2HWF3 1AR62 4RQPB 4N43C 1RMU1 1W39A 4IV3C 1TME3 1HXS2 4IV1C 5A32A 3JBG2 1MEC3 1V9U3 4QPGA 1AR93 1VRH3 1AYM1 2BUKA 1F8VA 1R1A1 1PO11 1IHMA 2R072 3VBRC 4CEWA 3LOBA 4IV1B 1VBA3 1HXS3 1X33A 1QJY3 1ZBE2 2HWB2 1ZBA1 4N43B 1ASJ2 2VQ0A 1BBT1 5J98B 1QJY1 4RR3B 2HWE1 1RUH2 3VBSC 1RUJ3 1HRI2 1OOPC 4SBVA 3HAGA 2MEV3 4RHV1 3VBUB 1FPN2 1VBD3 1PGW2 1ND3B 2RM23 3JD71 5C9AC 1EAH3 1K5MA 1Z7S2 2MEV1 1CD3G 1H8TC 1QJX3 1RMU3 1FOD3 1AYN3 2HWB3 1ASJ3 1NA1A 1RB8G 2PLV1 4QPGC 4RR3A 1TMF3 5L7OB 1FMD1 4Y5Z0 1RUD2 4QPIB 1NA1C 1ND2C 2R073 2RR12 1MQTC 3IDEA 5K0UB 4NWVA 1NA1B 3ZFEC 1BMV2 5BNNB 5L7OC 1NG0A 2HWF2 5A33B 1RUC3 2RS12 2ZTNA 3ZFGA 1RVF2 1RUJ1 1EV11 4YVSA 2HWC3 5C8CB 5CFDA 5C4WB 2WZR1 1Z7S1 1ND3C 1RHI3 2RM21 1VBE3 4LLFA 3J8F3 1HRV3 3VBUC 1POV0 5J96B 5AC93 1NCRC 3VBSB 2RS11 2X5IA 2RMU2 1AYN1 1VBB3 5C8CA 1BEV2 5A33A 5FOJB 4BCUA 3J8F2 1AR91 1AYM3 2RS53 1H8TA 5ACA1 1VRH2 5CFDB 5JZGB 3VBRB 1C8M3 4GMP1 1QQP2 5ACA3 4WM8C 1QJU2 1RUD1 2WFF3 3VDDC 1ZBE3 2BFUL 1PO22 3JB4C 1X36A 4CDWB 5ABJC 3CJIA 1AR83 4RQPC 2QQPA 2MEV2 4FSJA 2RMU1 1H8TB 2TBVA 4JGZC 1POV3 3ZFFB 4FTSA 2RS52 1Z7S3 3JD73 4WM7B 5C9AB 4RHV2 1BEV1 1TME2 1VBE2 4Q4Y3 1AYN2 1B35B 3M8LA 4Q4X3 4EJRA 1QJX1 4JGYC 1FOD1 2HWD2 1NCQC 1RVF1 1HRI3 4WM7C 1BBT2 2WZR2 3ZFFC 3NAPA 1NOVA 1D4M3 2GSYA 1RVF3 3VBUA 1E57A 2BPA2 3DPRB 1R1A2 1D4M1 3VBFB 3VDDB 1PO13 1HQNA 3FBMA 1OPOA 1D4M2 4WM8B 2Y26A 1FMD3 1BMV1 5GKAC 3NAPC 4GMP3 2RR11 5JZGC 5BNPA 1AL23 4JGYA 4IV3B 3TN91 2DF7A 3VBFA 2R042 1RUG3 1R091 1FMD2 3JBG3 1ND2A 4AEDB 3VBHA 3JD72 4QPIA 5BNOC 2RMU3 1PGW1 1QJX2 3VDDA 5A32B 1NCRB 4CDXB 1VB4A 2HWE3 1VBD2 5K0UA 3VBRA 4RQPA 5AC92 3CJIC 1RUH1 4CDUA 5C4WC 1QJZA 2WZR3 4FTEA 1K5MC 2GH8A 1HRI1 3VBOB 1ASJ1 2HWE2 2R043 4CEWB 4GH4C 2RS32 1R1A3 1AL22 2X5IC 1C8M2 1NCRA 1PO23 1ZBA2 1R082 3TN92 3VBSA 1ZBE1 1AR73 4WM7A 5DDJ1 4CDQA 2R061 1VBA2 1V9U2 1RMU2 3TN93 2ZAHA 1AR92 5BNPC 4JGZA 5JZGA 4YVWB 4GH4B 2R063 4QPGB 3JBG1 2WFF1 4PDWB 1RUE3 1F2NA 5ABJA 1PVC1 4RHV3 1RUC1 1FPN3 1AUYA 1EAH2 1EAH1 4CDQB 4CEYB 3CJIB 4PDWA 4WM8A 1RHI1 5D8AC 1RUJ2 1RUF3 4Q4V2 4RR3C 1RUG2 2HWF1 2RS13 1QJU3 4GB33 1PVC2 1AR82 2WS92 2XBO2 1SMVA 5C9AA 2R062 5CFCC 2WWSA 1B35A 4CEYA 1NCQA 1RUD3 3NAPB 1V9U1 1R081 3ZFGB 1C8M1 1VBA1 3VBFC 2RS31 1QQP1 5CFCB 2PLV2 3DPRC 1COV1 1AR63 5DDJ2 2HWC1 2WS91 1C8NA 2XBO1 1PIV2 2RS33 1PGL2 1AR81 1RUI1 4GMP0 3DPRA 4Y4YA 4Q4Y1 1DDLA 4CDQC 2WS93 1NCQB 2XBO3 5AC91 5D8AB 2ZZQA 4N53C 1MQTA 1BEV3 4CEYC 1B35C 4N53B 1RHI2 2BFUS 4FTBA 1QJY2 4Q4X1 1VBD1 2FZ2A 1HRV2 4JGZB 2XPJA 1RUF1 4CDWA 1EV12 4RFT0 3VBHB 4CDWC 1AR72 5ABJB 1AL0G 1VBB1 2IZWA 4GB31 2WFF2 1PO12 2R071 5D8AA 4GH4A 4CDUC 4YVSC 1VAKA 1PIV3 4N43A 1VBC3 4Q4W3 3ZFGC 1RUE2 2RR13 1NY72 1NY71 1COV3 1AR71 1RUE1 2WLPA 5CFDC 3JB8A 1VBC1 4Q4W1 1POV1 1FOD2 1QQP3 4GB32 1AL21 1VB2A 1VBB2 1EV13 4RS5C 5FMOL 4Q4X2 1K5MB 2HWD3 1RUF2 4RS5A 1HRV1 5LK7B 1BBT3 1A6CA 1CJDA 4Q4V3 4Q4Y2 2HWD1
chains in the Genus database with same CATH superfamily
4Z2WA 4BMEA 2Y0IA 1IS6A 5JXJA 5J7MA 3AK0A 4XUOA 2ZGKA 5JMOA 4FP2A 2RJ2A 3CU7A 4R4XA 3WNOA 5F5QA 2HWC2 1YJLA 1W8OA 4LE3A 3VHPA 3W5NA 5KXEA 4BOWA 1YO8A 2CAVA 2VQTA 2WNVC 4W6WA 3ZXGA 4CUCA 3U75A 4Z8BA 2R0HA 3MV11 1RUI2 4JKMA 1PO21 2VULA 3TAYA 2Q4SA 1MS0A 5T55A 1DQ0A 1R083 3GCXA 4Y1XA 5FY9A 1XC6A 2PAMA 4N7IA 4NE9A 5GZFA 3I3BA 4D7TA 2JIJA 1JYCA 2EVXA 3WHTA 4AVAA 3KCCA 2JX9A 4CDXA 1SCRA 2QJVA 3UV9A 3ZXAC 2WNVA 3D4KA 1WCDJ 5CVRA 3M4FA 2IFRA 2X05A 3WCSA 3KS7A 3WDXA 5K0UC 4NIDA 1LRHA 1PZ7A 3K3OA 4BQYA 3WD5A 4NJ4A 5ACA2 3T0DA 1W03A 2WSVA 4HLTA 4KG0A 2JKBA 5BNOA 4UAPA 2X5IB 3H3LA 1ULFA 4NWWA 2QDNA 5EJZB 3VBOA 4ASLA 1HXS1 3FHIB 1OHFA 2OUJA 4EROA 1JBCA 2VNGA 1N1SA 4WBBA 5F3GA 1NQJA 1BHGA 3WR0A 3ZYGA 3WT3A 3I2DA 3ABZA 2QQMA 4XCAA 4CUAA 4L9BA 4CCDA 4W4ZA 4CU7A 4KG8A 1LB2A 2EA7A 1OKQA 4Q4V1 4QWNA 1GU3A 5FBJA 5DAWA 3NJXA 1DGWX 5A3PA 2AR6A 2QQIA 2Z2SB 4HXCA 1DG6A 2GMEA 3SCGA 2EXJA 3CZJA 1RUC2 3UKNA 3N9NA 3QD6A 4RGKA 4RGAA 2WABA 4C0BA 2RM22 4Y26A 2G1MA 1GR3A 3GJBA 2YC2A 3OGVA 4XUQA 1FX5A 1TME1 1UMHA 3ME2A 4UFIA 3OD0A 2PLV3 5C4WA 2X10A 3T0AA 3SKJE 3WNPA 1WMFA 1S0EA 1IG0A 2PAKA 1Z0HA 5DDJ3 2W95A 4D69A 4CXXA 5CEHA 1WWYA 2G9FA 1UIKA 1SZBA 3ZXKA 2G4IA 2YHJA 5JOWA 3JBG2 5FLIA 2XG3A 4FT8A 2RDQA 5EFUA 5FDBA 2K46A 2WDBA 4QPGA 1A3KA 1JYXA 1AYM1 4QXCA 1JYNA 1GYKA 3WG4A 1F9KA 1R1A1 1PO11 2BERA 3ENRA 2W91A 4N9HA 2ZKLA 3HN3A 3NO8A 4GULA 3O1UA 2WT2A 1W90A 3Q9OA 1VBA3 4I01A 4YG3A 1HXS3 2VVFA 3PVOA 4GA9A 3WF1A 1FV3A 3B69A 1KDKA 1LAJA 1DYKA 1H2LA 1IS4A 1CAUB 1RJ8A 4CCKA 5FYSA 1BK1A 4IGQA 5J98B 2Z42A 3O5SA 2FMDA 3E6BA 1AXKA 1QH7A 1W9WA 4RR3B 1LOFC 4EN0A 3ZYRA 3M70A 4LHKA 2C0ZA 1GOFA 1OH4A 1RUJ3 2NLRA 1W2OA 3A0KA 5C3OA 5KHIA 2UY9A 2E51A 1IS5A 3ES4A 4YW7A 4N9IA 4RHV1 3BOPA 5FYCA 2XHNA 4NUBA 1VBD3 3WQBA 4DPNA 2BVVA 2O14A 3OF1A 4WVWA 2H6BA 2PMWB 5FP7A 3WINE 1EY2A 5C9AC 4JDNA 2J1VA 1GKBA 1EUTA 4P9YA 4XXPA 4XZPA 5I8TA 1K5MA 2VUJA 5FZKA 2PTMA 2VGDA 3AKRA 1OLQA 1BVP1 1E5IA 5AVPA 1QJX3 2ZEYA 3GJAA 4LKSA 3LZZA 5J36A 1NLSA 3U78A 5KR7A 2PLV1 4QPGC 1URXA 3C8XA 4KI5M 1QOOA 4TWTA 3ZR6A 1S0BA 4QKNA 3GHNA 5FWEA 3FWEA 2UU8A 2QDRA 4UBGA 2VQUA 4LLOA 4MADA 3BYWA 2WWJA 4KWKA 4ARXA 4MGIE 3BTXA 5K0UB 5G05L 1BLZA 1ENSA 2EXKA 1SCSA 4NWVA 4Q26A 1ZRCA 2YU1A 4MH0E 2QQLA 1RUOA 1BMV2 2OS2A 1ULPA 2JG8B 1V6MA 3KCYA 5GLWA 2ET1A 5FXVA 1UU5A 5CA6A 5T5JA 3NJYA 2DBNA 2HWF2 3HQRA 5FZOA 3ZYFA 2DCTA 2WNVB 1ZRFA 1RUC3 5IAXA 2ZTNA 4P08A 3RQ0A 3ZFGA 4CXYA 2F4PA 4QX3A 3KVAA 4IEUA 1JYTA 2G9ZA 2P1BA 5LATA 3RI9A 2HWC3 2LUWA 4RD7A 1CX4A 4J1XA 5BXXA 4Q8KA 5E6HA 3FE5A 4NOTA 1ZZBA 2ID4A 1VBE3 4YZ2A 2WNOA 2DVFA 3ALQA 3FX3A 1Q3EA 2JECA 4YZ3A 4Q5OA 1WZXA 1W6OA 2AENA 3WW4A 5A1FA 1VBB3 4XACA 5C8CA 3O7OA 3I3MA 4N8MA 2VZOA 3AJZA 2FDGA 1RYYA 1C5HA 2XKPA 1D4VB 1DYPA 4BCUA 3J8F2 5F1RA 3WNMA 3IIIA 4QXHA 4H14A 1DF0A 4IGOA 2ARCA 5ACA1 1REFA 1XPWA 1SQ4A 1VRH2 2JG8C 4AOCA 5JZGB 1GP6A 1QNWA 1H2MA 4KL1A 4AF9A 2E26A 3JUUA 4ZXEA 4OHVA 4U2AA 5FZBA 4RN5A 1Q8QA 3OCPA 4Y1UA 2R0FA 2Y8KA 1YFUA 2Q8EA 4C0HA 2DYCA 1RUD1 4FPJA 2JG9A 2WYSA 5JXHA 1ZBE3 2YMZA 5C3QA 2WAAA 1PO22 1J59A 2VZQA 1LOGA 3JB4C 4RYDA 4PIYA 4EYUA 5C3RA 1UYZA 1X36A 2Q0AA 5DAPA 5IW0A 3KMHA 4AAPA 4CDWB 3CJIA 1AR83 1PHMA 1QJEA 4RQPC 3SXWA 3LEIA 5FZCA 2RV9A 5CYYA 3E5XA 1US2A 2MEV2 3VZNA 5KXCA 2QQPA 1DQ6A 4L0PA 1Q56A 3MZHA 4JGZC 4NR1A 2CV6A 3ZFFB 2JG9B 3FHQA 1OQEA 1SFNA 1UZVA 3P3NA 4WM7B 2OZ6A 4XILA 5C9AB 1NLQA 1S2EA 1DQ5A 1VIWB 2WJSA 1V00A 3IM0A 4MHRA 4Q4Y3 5LCWL 4AI9A 5FY7A 2P5BA 3JCIA 1ULCA 5FKBA 2VW2A 1F5JA 4QU1A 2DCZA 1DQ2A 4H2AA 2HWD2 1WW6A 2W68A 4XHBA 4A45A 1HRI3 3AP4A 3IB3A 4W65A 4WM7C 1BBT2 4PCRA 2XVKA 2P6CA 3B93A 2JG9C 2WZR2 3AC0A 5F39A 5F8PA 2JEMA 2D44A 1TNFA 3SCHA 1LOAA 3K51A 2GSYA 1RVF3 1A78A 1ENRA 2RJKA 4QQLA 4O7XA 1ZZ8A 3UKVA 5FZ6A 1NUKA 2CGNA 2UYBA 3KT1A 1K12A 3SKVA 3HBZA 4FP3A 3MF6A 4XVHA 4LOSA 4OHWA 1JYIA 1WMDA 4E4DX 2BV4A 1MR5A 1OPOA 4FPGA 5LA0A 4META 3USUA 1MPXA 4A7ZA 4YGBA 1K3IA 1CWPA 2Y64A 4LJHA 1GZWB 3K4AA 5JZGC 3MPPG 1O3SA 3AP9A 3MYXA 3A0NA 1AL23 4Q8LA 3MFCA 1UMZA 4NPRA 4PLNA 5I0RA 4R9DA 1E5RA 4BU2A 2BVBA 2R042 2SLIA 2RE9A 1DP0A 2D40A 1UKGA 1LU1A 1R091 2FCUA 1SBEA 2IVIB 3JBG3 5HXMA 4UW5A 4BMBA 4OULA 3URFA 3GCWA 1IKPA 4QPIA 4CCNA 4W6XA 2QZ2A 1QJX2 3ECQA 1O3RA 3VDDA 1FT9A 5JOZA 5JVVA 4P5YA 1BCXA 3BTZA 3OG2A 5IAVA 3VBRA 4KH9A 3UGFA 5AC92 3MW2A 4GWMA 2W1SA 5L9VA 1LECA 4HANA 3LDKA 1L7RA 4JTNA 2JKXA 1K5MC 3RGBA 4I2OA 2BP6A 1ASJ1 1DFQA 1UD1A 3X29B 2PFWA 4MX3A 4DO0A 1UPIA 3VL9A 3PIJA 5EIYB 2FDIA 2R043 4GH4C 2NPIA 5LBEA 3ZIXA 5FAXA 5DUVA 4DUVA 1C8M2 3EB7A 1NCRA 3QOPA 3MW3A 3VZLA 4YGEA 4BLIA 2BRTA 3B00A 4XURA 3GALA 4OI0A 4ZONA 3KHBA 3LDBA 2EXHA 1UPSA 1W04A 5C7GA 4O9GA 1W6PA 3IT8A 2R061 3KQRA 2ETEA 1KD7A 3THCA 1W6MA 1W2AX 3ZKYA 2VMEA 3AKQA 2D93A 4OI4A 1W8HA 1H0BA 3JZVA 5BNPC 2A5ZA 1T6GC 4JGZA 3OBAA 4MGKE 1Q43A 3ZSJA 4GH4B 2ORZA 1D2SA 2R063 3I7DA 3JBG1 3RJRA 2A70A 2WFF1 4IXLA 4YW5A 3AM2A 4M3CF 2ZGTA 4ONUA 5TSWA 3AMNA 3V0AB 1NE4A 3LGRA 4GAZA 1S0CA 2JDYA 4K21A 1GQPA 2VO5A 5I0TA 3NMBA 3BIWE 1EAH2 4CDQB 3CJIB 2GU9A 3KWVA 1BVVA 4COWA 3LIHA 2VOKA 5DUUA 1RHI1 5FZ8A 2VZRA 3WVJA 4TN7A 4AHZA 3HT2A 4B4PA 5A3UA 4YM1A 3MBWA 1HB1A 3C2UA 3GZEA 1XRUA 1GNHA 1GNZA 3LSEA 4FO9A 3GYDA 5FIXA 3U11A 2D97A 2VOTA 1RJ7A 3AYCA 4XDOA 4GB33 3B7MA 4YYOA 2DWRA 1AR82 2FBEA 3FFZA 2IWGB 2V4AA 1H1IA 2WNEA 2O8OA 3MI8A 2WS92 1UYXA 2Y6KA 4JAAA 4R9BA 4E8DA 1KDMA 1ULGA 2PQQA 2VL4A 2ZHLA 2QFEA 3EYPA 4K3UA 5EJ1B 4BM8A 3U4XA 1IPJA 2GNDA 1LCLA 2EIEA 3NRUA 4MYEA 1Y9GA 1V9U1 1DIWA 3GF6A 3T4HB 5BPXA 4PLMA 5LY2A 3LIGA 3HNMA 2D6MA 1XSRA 3AZWA 2J22A 4RSUA 4CUBA 2XR4A 4PIZA 1QXRA 4LUKA 1COV1 1IQAA 1VR3A 2EICA 2OPKA 5FOBB 4Y33A 3IDAA 4XDPA 5A7WB 1JZ4A 2HWC1 1OFSA 1OPMA 4D94A 3SCFA 1C1LA 1C8NA 2WS91 5DXDA 3MIFA 2VOWA 3EMRA 1REDA 1QWRA 1RUI1 2PELA 4OLLA 4CSWA 1TE1B 5IFTA 5GLUA 2VMCA 5C71A 4XQ4A 3CKHA 4D6QA 1O3TA 4YM2A 2WS93 1NCQB 1Y7BA 1J3RA 2YROA 3K75B 3LA7A 4Y3OA 3P1IA 4N53C 1H2KA 5DQ0A 5F2WA 1N1YA 1MQTA 4V2WA 4XC9A 3VHRA 4LPLA 5CBLA 4AAXA 3OD4A 4OUMA 5FXWA 1RHI2 1JW6A 1OLME 1SACA 1PK6A 4HKLA 1W6MB 1VBD1 4XBLA 3KGZA 3ZM8A 2FCVA 1HRV2 1N3QA 4JGZB 1J3PA 1GV9A 4CCLA 2D3RA 3KQ4B 4PBOA 1EV12 4Y24A 3N7JA 5DN2A 3RSJA 4A7KA 3AKPA 1ALYA 2XWJB 4AVSA 3AP5A 3K4ZA 5ABJB 4LBQA 4P9WA 1QXJA 4FOVA 5KHHA 2C4XA 1AJOA 2ERFA 4GB31 4UI9L 4CP2A 2WSUA 1XSQA 2R071 1OXCA 4LMFA 3S7EA 5F3IA 2WFPA 2A75A 4N43A 1PK6C 2EAAA 3B01A 3BN6A 5F2SA 2XVGA 3R05A 1VBC3 3HBKA 1DLCA 4MXWA 4QMAA 4Y20A 3RG0A 3D0SA 3MDPA 3ZFGC 1GWMA 5F6KA 1JZ2A 1VALA 2RR13 4P9GA 2UY8A 4R9CA 4AFCA 3JU9A 5FO7B 1COV3 1KRIA 4MGZE 4AI1A 4K8RB 1KGYA 2JIGA 2YB7A 1NKGA 1U5YA 2XJUA 2JDAA 1POV1 3D5OA 2W0XA 1F35A 1Q8SA 5FZHA 4NIHA 1PZ9A 4I3GA 3KHCA 4NAOA 3VV1A 4LHNA 2FD8A 1EV13 1O8SA 3WHUA 1HDKA 2WYFA 4E2QA 4QHBA 2XWBB 3CNAA 1WCKA 5GZGA 4XZUG 3VKNA 5LK7B 3PU8A 4FXKB 4E2GA 1JYVA 1AXZA 4AXOA 2XDVA 2OPWA 2VVEA 1YEWA 3APBA 3MIDA 5JXIA 5CKQA 4Q4V3 4KQ7A 1N3PA 4BJ0A 5FLJA 2ZX3A 3V64A 3O1RA 5FZGA 2HKXA 2LTNA 2W1UA 2WN3A 3ILNA 3AFKA 1JOPA 1X8MA 4RS5B 3ZYBA 2DU0A 5HCAA 1YI7A 4BZ4A 4LBNA 1YNAA 5FJHA 1VAVA 5JAXA 1JXNA 2LM3A 4CPBD 3OBRA 3AXDA 3PU3A 4CVUA 4FOWA 5BNPB 3LOIA 5B2GB 5BNNC 1UYYA 3ZFEB 2OW4A 2VY0A 4P9LA 3IDCB 1W6QB 2HEVF 3J7NA 4LORA 5C5TA 3TRSB 5IYYA 1ND2B 1IKQA 2BWAA 4GWNA 4S2DA 5FO9B 4ES8A 5T5LA 3IN9A 4FPHA 1R093 2GC1A 3LE0A 5L7OA 5A70A 3VHNA 4ASKA 1UU6A 5JIUA 4BE3A 2QQJA 4MGTA 3VBHC 4GALA 3ZFEA 4NROA 3ZSKA 4DZGA 4JVAA 5A3NA 1O5UA 3ZYJB 1DGRN 1XYPA 2GC2A 1GUIA 1SLCA 1W05A 3HNYM 3ACGA 2BQPA 2B39A 5FV3A 1AR61 1W06A 1V6OA 3C7GA 4BQWA 1JMUB 4C1XA 4HG6B 1NQDA 3UJQA 1RL3A 1DZTA 1TVGA 5CFCA 1RUI3 2R7EB 4L97A 5FKCA 1QH6A 3SLIA 4DY3A 5A1LA 4YNIA 4EZHA 2JG8A 3PVEA 3AYAA 2PN5A 4QDRA 1H1AA 1R092 1VBE1 3CDZB 4TYSA 3LEGA 4C8DA 1J3QA 2K9ZA 3WUCA 4BK4A 4NN0A 5T3NA 2HWF3 4LIVA 1GSLA 5HPOA 5JR2A 2DVDA 2BOIA 3N9MA 4QAWA 1TME3 5IFPA 2JD4A 1HXS2 3AX4A 3H42B 5FZ3A 4NO4A 2OKXA 4EWDA 4DXSA 1W8TA 1CAWA 2P17A 1Y3TA 4OMCA 2VOVA 2B7YA 3TNPB 4XUTA 1F8VA 2R072 1CZTA 2E63A 5FTTC 4AQSA 3VBRC 3CBNA 4K6BA 1S1AA 1Q5OA 3LEKA 4DIQA 4AYUA 3DGTA 3W9AA 1XNBA 5A7OA 3ZYPA 3N35A 3RZMA 3OSDA 1L7LA 2XJQA 2HWB2 4UT5A 1ZBA1 4N43B 4PT6A 3DECA 3KF5A 4WVVA 3JQXA 3R6SA 3ZSEA 1BBT1 1QGLA 3AZYA 3PJYA 1LOBA 4Q0UA 4AGRA 2W1WA 4MG2A 2HWE1 1MS9A 1RIRA 4F3JA 3NNFA 3VBSC 2XQXA 1CAVA 5A7PA 1HRI2 4I09A 1YJKA 4NHLA 2KD7A 3UT0A 3H3UA 4IEPA 3EO6A 3HAGA 2X8KA 1UYPA 3IAQA 2A6WA 5T50A 4CZSA 3GGLA 3ZXDA 2JDNA 2W46A 1PGW2 1ND3B 2WN2A 3UNPA 4LTAA 2AC1A 1UKRA 2NZ9A 2YC4A 3O1VA 1ULDA 2QQOA 2BTVC 2BYVE 1CD3G 4Z1VA 5JSRA 4FI9A 2HWB3 1WCQA 2XHKA 4Q0PA 2VMDA 4LBQD 5FP4A 5L7OB 5D2AA 3EQEA 1RUD2 2Z79A 2J42A 2R30A 5DUWA 4AHWA 1EPWA 1NA1C 2CAUA 3OUIA 4XFGA 4XXAA 1H9PA 4Y22B 2W94A 1ULEA 1M4WA 2Q1ZB 1ZX5A 1GP5A 3WF0A 2QQKA 2JE8A 5FP8A 4GJZA 2A1XA 1WMXA 4FPKA 1NG0A 5A33B 4WVMB 2UWAA 3J7LA 3PUIA 3ACFA 1DGRA 1UXZA 3T1LA 3ZN4A 4HVOA 5FZ7A 5DMYA 2WZEA 1RVF2 4ATFA 3UETA 2VZ1A 3ZN6A 1Q8PA 4YVSA 3OY8B 1W2UA 3BPZA 3A22A 5CFDA 4K8FA 4FXGB 2RHPA 2GP3A 1UNBA 4EN9B 4OZXA 5IWFA 3NWKA 3J8F3 3VBUC 5I0SA 4XFHA 2DV9A 4HSLA 4XMAA 5F6LB 4MO3M 3TEXA 1N3OA 1NCRC 4DUXA 4XFFA 2RMU2 5IVEA 3TB0A 1YFYA 1VJ2A 2P37A 4DUWA 1RTVA 1BEV2 1GWKA 5A33A 5LY1A 1VAMA 4CU6A 3WZ1A 5LASA 3OUJA 3VDCA 1UU4A 3W59A 3R4SA 1JU3A 4H55A 2RS53 3M1HA 1H8TA 2F17A 4A2UA 4GIQA 2GC0A 2WWUA 4COZA 1GLHA 2BGCA 5CFDB 2WRAA 4LK6A 5JPNB 1S0IA 4MZUA 3ZIWA 3UKTA 2R6QA 3PJQA 4XIOA 2VZSA 4FAHA 1QQP2 3ZDVA 5ACA3 2JDMA 2FQPA 1I9RA 2WFF3 3VGIA 1GWLA 1CPMA 3VDDC 4R52A 5GLTA 1XXNA 2C24A 4HK8A 4HPKB 4XTPA 4GWIA 1ZRRA 3N9QA 4A6OA 1YQCA 5KXDA 4BYYA 1S55A 1O3QA 1JZ7A 4A4AA 4FSJA 2A6XA 2RMU1 1W9FA 1XE8A 2YPJA 3VUOA 4M3CE 4IE7A 5L19A 1UY3A 2WA3A 2ZHMA 3LKJA 4FTSA 2RS52 1G7YA 1OA3A 3JD73 1UZYA 5FZFA 1VMFA 3ST7A 1BEV1 1TME2 4DEQA 2AACA 2E6VA 1B35B 3H1WA 3I59A 1UIJA 3HN1A 4AVTA 1U12A 3MPBA 1AXYA 1GNYA 3IAPA 4I0BA 4Q4X3 1KITA 4Y1ZA 3OYWB 4YLZA 5FZEA 4EJRA 1FOD1 1X50A 2W5FA 5IUQA 3W21A 3ZN5A 5M0TA 2XMLA 3QH6A 4DEVA 2A71A 2VCAA 4N90A 4CYDA 1X82A 1DLLA 2H0VA 2B45X 3NAPA 1R1ZA 4I02A 1XNAA 1ULOA 2NN8A 1NOVA 1OA4A 1WW7A 4Q0VA 2BNNA 4B4QA 1D4M3 2VUDA 4MSVA 5F5AA 4PI0A 3LDRA 4LO4B 2ADEA 4XMIA 1E57A 1LGBA 1WD4A 3S5QA 1O5LA 1STMA 1OMIA 2ADDA 4OVEA 3DPRB 5FXZA 4AK3A 1W8UA 3WXPA 2UURA 3I3QA 2XL9A 1YRZA 4IW3A 3ZDSA 5JOXA 3PVBB 1QXPA 4AI2A 2BNMA 2PXJA 3WEZA 4AI3A 2VZPA 4G4FA 1UY2A 4JX0A 4B7KA 2AZ5A 3O1OA 1PVXA 2GH2A 4QX8A 2BZDA 1GQHA 4Y1YA 2CL2A 1K42A 1IG3A 1SLIA 3K48A 2A73B 4W6YA 4JZRA 1FMD2 3H3ZA 5FXXA 3WOGA 1WLCA 3FC0A 4LO8A 2VBDA 4AEDB 1SPPA 2XJPA 5KXBA 5BNOC 3NJZA 2RMU3 3H8XA 3EHKA 3T2TA 3KB5A 4E4HA 4PLOA 2J1UA 2Q5TA 4XJUA 5EP9A 3SC7X 2VUAA 1VBD2 4A3ZA 2QQNA 5F32A 4DRVA 1K45A 4OMDA 3RNSA 4AEKA 4LQRA 1JOJA 1QJZA 4ZY9A 4LT5A 2ZX2A 1AJKA 3K3NA 2ZBJA 4FOQA 5DAXA 4FTEA 1A8DA 4WV8A 4LHSA 2J7MA 1UOBA 4BK5A 2B9VA 5LB6A 4HVRA 2J1RA 3B9CA 4YW1A 3H9AA 3B94A 1C1FA 1JH5A 5FZLA 2HWE2 5GLVA 3PURA 3WDVA 3POIA 5FPVA 1SEFA 3C7OA 5GM0A 1ZRDA 1R1A3 1AL22 2X5IC 4OHXA 5FZAA 1PMIA 1PO23 1ZBA2 3GM8A 1PM4A 2W47A 3TN92 3VBSA 4CA9A 3PIGA 1AX1A 4LNVA 3ACLA 2YBSA 3CF6E 1F15A 2ARXA 2B5HA 1JN2P 2EIGA 4IERA 5CKMA 4YGCA 5C8WA 1V6JA 2OQ7A 3B3QE 4IESA 3BODA 3KT7A 1VBA2 4H7LA 3HT1A 5JCTA 4LO5B 5A7SA 1V9U2 3T09A 5LBFA 4FQZA 3SH3A 1AR92 2ZX0A 4B3NA 3VD9A 2YG0A 3Q8AA 3DUIA 2ZEZA 4CCCA 5LWBA 2Y6LA 4PDWB 2ENRA 3HOBA 5CAZA 1MZEA 1GMMA 3ZXFA 3BI3A 1G9CA 5ABJA 4HBNA 5D21A 1PVC1 4RHV3 4YGDA 3WSOA 1F4HA 1QKQA 2V5DA 1CAXA 3D8CA 2JDZA 4QQ2A 4R4ZA 4AR2A 1WA6X 1N1TA 1W6NB 1YHFA 3UGHA 3WF4A 1BZWA 1ODMA 3KGLA 4BISA 5IATA 3LFMA 1YQ6A 4WM8A 1HQWA 1UOJA 3L9JT 2ZGLA 2DCJA 4BA6A 5CZKA 5LK5A 1X8EA 1WGPA 2HBTA 1DZRA 1RUF3 3LF7A 3M3CA 4Q1PA 2Y34A 3VKFC 4C1WA 4EWEA 5A1AA 3I3DA 1CAVB 2BWCA 3FLPA 1LR5A 4K9SA 3IZOA 3SH5A 2GZWA 3MFAA 1OD3A 3SHRA 2VXJA 4MVTA 5FY5A 4AGVA 1SPPB 1ZNPA 4AVCA 2ZS6B 2R062 1RITA 4EN8B 3OY8A 5CFCC 5LRRA 1B35A 4P02B 3ZX7A 4CEYA 4EE2A 2YYOA 5CB7A 1QU0A 3FZ3A 1R081 2JB4A 5FY8A 1W9YA 3RZHA 5JPMB 3VBFC 4ZZ8A 1SBDA 2DUPA 3POYA 3N4MA 5E89A 4UW6A 1D7PM 4QPWA 1AR63 2DUOA 1ZYBA 4HN0A 4INDA 4XFAA 5C3SA 3LCPA 1LOCA 4V2VA 5FZDA 4OYUA 3JXSA 3GXUA 3SH4A 1PIV2 1KS4A 2G9GA 4FPFA 3RMYA 3HIFA 3NJVA 2D43A 3B9IA 1RC6A 3POWA 1BK0A 1UX6A 2DTYA 2R32A 3VD7A 1U5ZA 2XJRA 4YW6A 1OFNA 1SLBA 2V72A 3OEBA 3ETPA 5FZ9A 4BXSV 2XQRA 2ZGRA 3AXEA 2P3YA 2R49A 1VP6A 3OGSA 4L8QA 3D6EA 2DVAA 3ZO0B 3K77A 4CEYC 5KBFA 1QJY2 2BU9A 2GNBA 4DFSA 5A7NA 3AMHA 2BW8A 1R64A 1EYBA 4IE5A 5FR3A 1EPZA 3HPNA 1RUF1 4XJ8A 3HWJA 3SNMA 5FK8A 4ZU4A 1W6PB 4CDWA 5H9PA 5JLVA 3SQOA 3M3EA 3B5LB 4E4ZA 2QQVA 4Z82A 3O1TA 1AR72 1OKOA 4YG0A 2W52A 1AL0G 2D3SA 4NPMA 2IZWA 4NRQA 2VZTA 1OQ1A 3KD4A 1F31A 4GH4A 5FREA 4YVSC 1VAKA 3KV9A 3JQWA 5IVBA 4A6SA 2KA3A 3L2HA 4C90A 4D7SA 2WQ4A 4GD4A 4Q4W3 2XOMA 5HCFA 1IPKA 5FYZA 2VVDA 2V09A 3D3AA 1NY71 3SEPA 1S0DA 4TLGA 1QEXA 4Y1VA 4LK7A 4CUGA 2ES3A 3LAGA 3EXUA 4O9EA 2RJLA 2E31A 2XLGA 3PUQA 1VBC1 4JDOA 4QX0A 2ZJCA 1Q8VA 4OI1A 5FZ4A 3PUHA 4MLOA 4J6GA 1AL21 1VB2A 4QKFA 4QX1A 2Y6GA 3ZR5A 4BWOA 2CGPA 2A3WA 1YUDA 2OXBA 5FMOL 3BIEA 3LFIA 1WCSA 4FVVA 5FRAA 2VCBA 2HWD3 2TEPA 1QHDA 2ZGNA 4LKDA 4RS5A 2VW0A 2ZEXA 1ZM1A 3NNMA 1BBT3 1OVSA 2WAOA 1VE0A 4UW4A 1XBFA 1A6CA 3GBGA 1CJDA 3QLQA 5KHGA 3WP6A 2HWD1 2VAUA 3CIHA 4M4RA 3POSA 3LQCA 3UGGA 2VCCA 2Y6HA 3DL3A 5C8CC 5CADA 1SBFA 1YI9A 3WP3A 4M0HA 5BNOB 4LBJA 4ZXKA 4JV4A 5FY1A 1WCUA 4ZS2A 4CP9B 1COV2 2WNUB 1LHVA 1CJPA 3WDYA 4ORFA 3ZFFA 5FZ0A 1M06G 1ND3A 1GZWA 5HV4A 4H7MA 2MPFA 3TEZA 1HX6A 1QJU1 4LITA 1KEXA 1Y4WA 2ZEWA 4AQTA 2D5HA 1PGSA 2HWB1 2BGOA 3D82A 4M00A 2W3JA 4WVMA 1APNA 3I3EA 3C7FA 3Q8FA 1VRH1 3V0BA 3QCWA 4BQ1A 3RWKX 4CDUB 4S2HA 2JB8A 4I30A 4LKFA 3S5AA 3ZVXA 2VCMA 5FP9A 4LBKA 4XEZA 2D6KA 2E33A 3H8UA 3OJBA 4CEWC 4MV2A 4E8CA 3LSDA 3C7EA 1CQ9A 4N53A 3VZJA 2YBKA 2HEYF 1ZBA3 2OIIA 1GICA 3VBOC 4GWJA 3J8F1 4IL7A 2J1TA 4PF1A 5A80A 5HI0A 3VD5A 2SBAA 2FZ1A 1JYWA 2GN3A 4DRRA 4BH9A 1PX3A 3BPSA 1RUG1 3INAA 5IK7A 1US3A 2QCSB 1AF9A 2CU5A 3VZOA 1CAWB 2NQYA 4JGYB 1RGSA 3I2FA 1H30A 2UWCA 4IV3A 4M0NA 2RDNA 4KMQA 4PQQA 1JI6A 4QU2A 5G04L 4MUVA 1H9WA 1HJGA 5BNQA 3VKMA 4JRLA 1LOEA 1OOPB 3NKTA 4CDXC 3AVSA 1WLDA 3ILRA 4ITCA 5B4NA 3E97A 1OURA 2YY1A 1QF3A 1GQGA 2V5YA 4LEJA 3PTYA 4OHZA 3WY6A 1W9SA 4HSJA 4ATEA 3BU0A 1DHKB 1JHNA 1RUH3 2C6SA 3KLSA 1TMF1 1MEC1 1V6IA 2GDFA 5JI7A 5EYYA 1VBC2 1HN0A 2GMMA 1AR62 2GP5A 3GDBA 1MZFA 1G9AA 4SLIA 4BLJA 4UBHA 5FYTA 1YQ5A 4XBNA 4OI2A 3BTYA 1ST8A 4IV1C 1HV1A 4UW3A 5GJ6A 4AWDA 1VRH3 1CPNA 1OF3A 4AFDA 4JKKA 2JENA 4XCBA 4XAAA 2R1DA 5DG1A 2WO2A 4CU8A 5GZCA 1HQLA 1CAXB 2JE9A 4PIXA 4MOAA 3AYDA 1QJY3 2FHRA 1ZBE2 2UYAA 2A3XA 1WMEA 3GZTB 1JZ6A 4UXAA 1ASJ2 1TZOA 1UWWA 2DBIA 4O65A 3OGRA 2EIDA 1G9FA 3N7MA 5I8SA 2B46X 1LU2A 2Z5WA 3O1PA 1W2TA 1Q8OA 1QJY1 3RFRA 2VG9A 2EALA 1VMJA 2QUOA 1I6XA 1LGNA 5I0DA 2OZJA 3BOWA 4AQ6A 2YXSA 4COVA 4C91A 1OOPC 2HEWF 4SBVA 4XPVA 1MS8A 2WR9A 1KFUL 1SFYA 2Y0OA 3AP6A 3I2JA 2P3IA 3TWIA 3A23A 1W0NA 2K2SA 1FPN2 3VL8A 5IK8A 1UF2C 1U5IA 1UY1A 4OCTA 2RM23 2XJTA 4K40A 1C3HA 3E5UA 4P9IA 1NLRA 2Q8CA 4XFCA 2DCYA 5A3WA 1UAIA 1Z7S2 1MS5A 1V0AA 2DDUA 1H8TC 1OBNA 4QXBA 3ZSLA 1FOD3 1AYN3 4NVPA 2WC2A 4YG6A 4YW3A 2OUHA 1WUVA 5CG9A 1XNTA 1ASJ3 1TNRA 3FN9A 3K4DA 3KV4A 4H3WA 4RR3A 1TMF3 4Z07A 1C5IA 2YBPA 4IE6A 3WP5A 4EN6B 4XJ9A 4Y5Z0 3SMHA 1UXXX 4QPIB 4D0QA 3LPGA 2XL7A 3I2IA 4I0WB 1H4HA 4B4RA 4XQWA 4B8EA 3OUHA 2RR12 1MQTC 3TNQA 3IDEA 1KXGA 4A42A 4PJYA 1HLCA 2Z4FA 3IPVA 2KR2A 1PMHX 1NA1B 1ZA7A 2VH9A 1RUNA 2XLFA 4IUGA 3BUCA 2JJ6A 3T3YA 1GANA 2WZPP 2WO3A 1YXWA 2ARAA 3BB6A 4L92A 3ES1A 2WQZC 4URAA 4ZU7A 4OFGA 1NZCA 2ZHKA 1I3HA 1EV11 1LOFA 4AHXA 3N36A 5C8CB 4KU7A 5C70A 4W8JA 2VW1A 3CEWA 4TLFA 5C4WB 2WZR1 1G9BA 2QQWA 1ND3C 1RHI3 3KT4A 2QNKA 5CU1A 2RM21 4HT1T 2PYTA 4LLFA 1HRV3 3VZMA 4YZ1A 2Q1FA 3DKQA 3MIHA 4JKLA 2VMIA 5J96B 5H9SA 2Q1MA 5AC93 2CHHA 2RS11 2X5IA 3M3IA 5DUXA 4ZKTB 1W8NA 1AYN1 5A7WA 3WF2A 4BIOA 1I1EA 3OB8A 1V6LA 3FUOA 3I4IA 3O1MA 3PL0A 4M01A 4HK9A 3RVHA 1AR91 2CNAA 1YWKA 2DFCA 3ZN6B 4CP0A 1ZZ9A 1OI6A 4PQ9A 2BNOA 4X8NA 4HZFA 1AVBA 3I8TA 3Q8BA 3O0XA 2W08A 4QXKA 4WVZA 3MHZA 4EWAA 3POFA 3H0OA 3WNXA 4JCKA 4EZ4A 1C8M3 5C5UA 3V0AA 2IXLA 4WM8C 1FYUA 1QJU2 1CR7A 1I5ZA 5FCCA 4DB5A 2BFUL 5DZFA 3UJOA 1JUHA 2PHTA 2ZMNA 3MLLA 1CONA 2J1SA 3BGAA 3DF0A 4D8MA 5FQ0A 2R1BA 3R0RA 1H6YA 5B4XA 1H8TB 2XLAA 1LENA 4LKEA 4HETA 2TBVA 3V65A 1G6NA 2F6BA 4AZZA 1JZ5A 2XJVA 3NSTA 3IMNA 4A41A 1Z7S3 2Q8OA 2ZGSA 3NV4A 5KHJA 1CIYA 3TYJA 2W92A 2YDEA 1LODA 3A4UA 5FZMA 4BIFA 5KWRA 1VBE2 1AYN2 1XYNA 1MS1A 1QIQA 4X6QB 2VECA 4GKYA 4XJAA 5LBBA 3CL1A 4V1PA 4AFBA 4CRQA 3RRDA 3KVBA 3OBTA 4PI2A 4XIKA 4JGYC 1D2QA 2A3YA 2DUQA 1O6UA 4N7UA 4PBPA 3U0ZA 5FY4A 4EV0A 1W0OA 2HJIA 5FPXA 3GHMA 2YGMA 4P14A 5GALA 1CAUA 2JD9A 1UOFA 3ACHA 2ZOEB 1XJAA 3IBMA 1DQ1A 3CMGA 3HJRA 3RDIA 2FMYA 1FXZA 2B4KA 2E32A 3J9SA 1WW5A 2OT7A 3I2OA 3N9PA 1D4M1 3VN4A 1PO13 1HQNA 1U5XA 3WG3A 3OGGA 4X6RB 2YUEA 2Y26A 3MLJA 1FMD3 2D3PA 4WM8B 1WLWA 3RPQA 4E9KA 1BMV1 4CP9A 4NHKA 3NAPC 5GKAC 5FPBA 1JODA 4F83A 2RR11 4HN1A 4IETA 2CYFA 5BNPA 4YFZA 4F7ZA 1XOYA 2L9LA 4IV3B 4JC1A 3MUY1 4QGNA 2WO7A 2DF7A 3VBFA 4A44A 4CE8A 3TOJA 5I93A 2P3KA 3VDAA 5J37A 1LHUA 3FJSA 2BJSA 4QDSA 3RYRA 2ZMKA 4COYA 3VBHA 3GZUC 1UQXA 2P3JA 2ZX1A 1DYOA 4BQ4A 2RDSA 4FPOB 5SV8A 4A7YA 3T0BA 2RG4A 5K9YA 4XUPA 3WNNA 2HWE3 1Z78A 2PHDA 3DEMA 3CO2A 4Y5SA 1DZQA 2WQ8A 3W5MA 4MGYE 2VM9A 3MIGA 1J1LA 3I49A 4CDUA 5I91A 3QH7A 1MVQA 5JR7B 1JHJA 5C4WC 5IVJA 1BXHA 2WZR3 2KXLA 4QQOA 1H8VA 1F5FA 5FYYA 2GH8A 2ZKNA 2XVLA 2Z69A 3VBOB 4CCJA 4XFIA 4LIUA 3ZLIA 2CDPA 4HONA 2WLQA 3PUSA 2WO1A 4LE4A 5EV7A 3CZUA 3HEIA 1J58A 3MO4A 4CEWB 3WV6A 3J26N 4IE0A 5LEJA 2VMGA 1YYNA 2NM1A 3M2MA 4XF9A 5A6YA 1UZ0A 4DOUA 4BB3A 2Y6JA 1R082 3MEPA 4NIGA 1ZBE1 3I54A 1NT0A 1KJRA 1FI2A 4IEVA 5DDJ1 3ZXEA 1FAYA 1FATA 2WL1A 5HCHA 5FYHA 3HQXA 3IDBB 1O4TA 4KWLA 2NMOA 2VQAA 2B8MA 3KV5A 1GZ9A 2HYKA 1A8MA 2D6NA 1QOTA 3AJYA 4OUSA 4WZFA 2C5DA 3DKWA 3SISA 2C26A 4OHYA 1W6NA 5JZGA 4YVWB 4AI8A 1Y43B 1WBLA 1IZ3A 4JTOA 5A3OA 3ROUA 4DNYA 4XOGA 1JOBA 3I97A 4K20A 4Q1RA 5JWPA 2EIBA 2FDKA 1ONAA 1PX4A 2OA2A 1QOSA 1FNYA 1RUC1 3RJ2X 2X53S 2PAEA 4HFSA 1AUYA 3U10A 3AKTA 1NX9A 4FFFA 5E88A 4CEYB 2A6YA 2OVUA 2WNUA 3C7HA 4D7YA 4EN7B 1D0GA 1J84A 2B9UA 4HL0A 2VU9A 2ARBA 1RUJ2 3AMPA 3WP4A 1V6NA 2O8QA 2CY6A 3O14A 5F3EA 4KBZA 4Q4V2 3L2YA 1RUG2 3CQOA 3OPZA 1QJU3 3DV8A 1S0JA 3MGUA 4LUMA 1C57A 1DGLA 3AYEA 5FPZA 3PMSA 3TBDA 5ISLA 4ARYA 1PVC2 4G3YC 1HW5A 1Y9QA 1YC61 1VLNA 5FY0A 1ZRIA 3E6CC 5L73A 4B7EA 4CU9A 2XBO2 4XBQA 1SMVA 3H7JA 1KQRA 4FOYA 2WWSA 1UL9A 3U1XA 1WLTA 5E8AA 1CZSA 1AX0A 4ZU5A 3KZ4C 2GAUA 3ETQA 2IXIA 3NAPB 5EXOA 3OYWA 5JDBA 4NHYA 3RZLA 1OF4A 3CJXA 1VBA1 4LR4A 3T30A 3ACIA 2RS31 3AKSA 2BOJA 3Q8EA 3DPRC 5FBZA 4A3XA 2EAKA 3GNEA 5A3TA 5CFCB 4EQVA 1GZTA 2LW8A 5LZ6A 2P6HA 1UCXA 4XETA 1UW8A 2Q8DA 3WG1A 4LOTA 4JHZA 2XBO1 5LW9A 5FO8B 3VD3A 2RS33 4TSVA 1AR81 4Y22A 2OX0A 1OC1A 2DVBA 2VUCA 2VD7A 1W6OB 2VXRA 3DPRA 3MIEA 2E53A 4Y4YA 2I2SA 1OUSA 4GKXA 2XBO3 2ZZQA 4QHOA 5AVAA 4D3WA 2EF6A 5BV6A 5DZGA 3HMYA 1BEV3 3ZXLA 2Y60A 4YW4A 4AHYA 1LHWA 1V6KA 4NPLA 1WD3A 5F9TA 1CGPA 4IEQA 2E7QA 5A7QA 2P4EA 5FMDA 2FZ2A 5FMBA 1IOAA 3MF9A 3IKWA 2RDRA 2C9KA 2IFWA 2E7AA 2VNRA 4FFHA 3P5BA 4RFT0 1YLLA 2VZVA 2A6VA 3D0JA 4TXWA 3UESA 1JUIA 1D0HA 4Q0SA 4KBBA 1VBB1 2CDOA 1H4GA 5L36A 4XAEA 2WFF2 3QACA 5JSPA 4QQPA 3TEWA 2LROA 2VZ3A 2WA4A 3K2OA 3SEEA 4CDUC 1PIV3 1UOGA 3HVDA 2P2KA 5LBCA 1QDOA 4AE2A 3O1SA 3J7MA 1YIFA 5L9BA 3WNKA 4JQRA 2WBKA 4RA0A 1NY72 5FJKA 3V56A 1OH3A 3S7IA 5CKNA 4AFMA 3LA3A 1AR71 3G7DA 5FPUA 1RUE1 5K8SA 4UFKA 3VB9A 4FFGA 2WLPA 4KNCA 4QX2A 3JB8A 5BUVA 5J3UA 4Q4W1 1W28A 3ZKUA 2ZXQA 2OYZA 2IXCA 3MV01 1RXFA 4QKDA 3U37A 1XNKA 3MUZ1 3PVNA 1LULA 2ZCWA 3W20A 3NV1A 2OQ6A 5C6CA 4LBQB 3WQ7A 4RS5C 2ZA9A 3DXTA 4Q4X2 3NV2A 1YIPA 1K5MB 2VNVA 4XQDA 2GMPA 1RUF2 2JDPA 4HVQA 1K5JA 3NW4A 1J1TA 4HKWA 1SLLA 2J1AA 2ZPXA 1TQ5A 2ZMLA 4Q4Y2 1FOD2 3FBYA 3F95A 1O91A 1FPN1 4XJWA 4CCMA 4QGLA 4IV1A 4S2FA 3NNLA 4LBMA 4AEDC 5GZDA 4MHUA 1SLAA 2RS51 3RYPA 2RVAA 5HBAA 2J1EA 4PDWC 5BNNA 1PGL1 4YVWC 2WIIB 1PM7A 1PIV1 3NL1A 1OSGA 1H2NA 2R041 5E16A 3VHOA 3WQ1A 3VDBA 4AQ2A 5FK7A 1MQTB 1QNYA 4AEDA 3S6PA 2VTFA 4YFWA 3R4UA 2N7GA 2MNGA 4YVSB 2BBVA 1MZ5A 4B1LA 1OOPA 5JI9A 2QQUA 4LO7A 1AYM2 4L2NA 4QPIC 3BVCA 5EZWA 3VZKA 4CTEA 2X09A 4YRDA 1U0AA 5HV0A 3U07A 5IVYA 2PQSA 5KC6A 3VLBB 5APAA 2CTVA 4Y4RA 3MLKA 4JDMA 2YZ4A 1W2NA 2YC0A 2TNFA 1MEC2 1TMF2 5FZ1A 1PVC3 1CZVA 3PLQA 4BPZA 4DS0A 5IVVA 2VC9A 5FPAA 3T2OA 4I0AA 5T52A 1LNSA 4ZPIA 3AMQA 3E5QA 5ANNA 1HB4A 4L11A 1GFF2 5EWSA 1MS3A 1OT5A 5FWJA 1LJ7A 4PF5A 5LA1A 3O12A 2VJXA 1S0GA 1C4RA 1O7FA 3M7AA 3CHXA 2VBBA 3UL2A 3W58A 3RWNA 4Z92B 5BY5A 1A34A 4J1WA 4JRAA 5A6XA 3SITA 1GOHA 4HPKA 5FMOS 5E1RA 1IPSA 3GBWA 4IDZA 1CIWA 3A21A 4XUNA 4OUEA 4R8HA 4YVWA 5EQUA 5K4LA 4IEWA 4Q4W2 4YSFA 4RQPB 3MW4A 4N43C 1RMU1 4QX5A 2WUHA 5CNAA 1W39A 2DU1A 2XXZA 3LPFA 1NAEA 4IV3C 5ERLA 4QB6A 1T6BX 1WKYA 2Q30A 3S30A 3THDA 4NHMA 4XABA 5A32A 1OLMA 1LHOA 4UOJA 1MEC3 2D98A 2E9QA 1V9U3 3POEA 5HXVA 4K7JA 2UWBA 1X7NA 1AR93 2BUKA 2I45A 4XW3A 3WW2A 1W8WA 4P5HA 3OGJA 1IHMA 4DXTA 3BTAA 1HKDA 2ZAAA 2XKOA 4RL7A 5FLHA 5I0UA 3WX5A 4CEWA 3WG2A 4QT6A 4FQ4A 4KGGA 3LOBA 2Y33A 4IV1B 3WW3A 1X33A 3ILFA 5GZEA 5JXGA 1G9DA 3NQHA 4LXLA 3POGA 4DQAA 2VQ0A 1GBGA 3I2KA 3N7LA 2AEYA 3T4VA 5C3PA 5FYIA 1AHSA 1LGCA 3H1YA 4DXRA 3B02A 3HNBM 1RUH2 5HCBA 3A7QA 4E4SA 2EXIA 2VTXA 2JICA 4NIAA 3GZAA 1XU1A 3FUQA 2MEV3 1MS4A 3VBUB 1W6QA 4YZ4A 4LHLA 3JD71 1G8WA 3DN7A 2XJSA 3T1MA 4D6RA 3OTFA 3ZOIA 3FLTA 3H8OA 2Y38A 1EAH3 2MEV1 2IXKA 3O0WA 3ON7A 3PTRB 2JDUA 4L99A 3WF3A 3H8RA 2P34A 5F7UA 4LBOA 2PHWA 2HYXA 1RMU3 4KWUA 3THTA 3R4DB 5A6QA 3KM5A 5FZOB 1NA1A 2B42B 3EBRA 2GN7A 4NRMA 1RB8G 3KCXA 4QQHA 5F3CA 1PZ8A 2DFBA 5DABA 1FMD1 4IQPA 2GNTA 2VNOA 1CVNA 3IMMA 1HIXA 3NNGA 2VZUA 1FNZA 5DZEA 1ND2C 2R073 3KSCA 3Q8CA 1MVEA 4K1YA 3RZKA 1WA4A 1VPHA 3NV3A 4W50A 3UK9A 4ISRA 5KC5A 3AMMA 3USSA 3ZFEC 4Y5TA 1RINA 5BNNB 2W39A 1V70A 1W3VA 3N3HA 5CIRA 2CWMA 5IVCA 1ZREA 1OLRA 4MXVA 5L7OC 3ZPYA 1DBNA 4M3CA 2YV8A 1QY4A 4FPLA 2C9AA 4XF4A 3AP7A 4YWAA 1SDDB 2K0GA 2RS12 1JS9A 4BDVB 1KJLA 3RMXA 3U14A 1UO9A 1RUJ1 5IJRA 2IC1A 1TG7A 5D1IA 5AFEA 3S0MA 2FDFA 2W87A 4Z2AA 1DCSA 2QBXA 4M4PA 4IEXA 1Z7S1 3H7YA 3OPTA 4WZCA 3AFGA 4HOOA 1W0PA 1CESA 2XUMA 1PMJX 2GC3A 3USUB 1POV0 4YW2A 4MGSA 1NE6A 1L3JA 1T2XA 2VMHA 1X9TA 3ATGA 3BU7A 5LRSA 3BALA 5EYXA 4QB1A 3LD8A 3ASIA 3VBSB 5A3MA 1YQ8A 5SV5A 4FFIA 3VKLA 3AB0A 1B09A 4M3CB 5A3LA 1ODNA 2XONA 5FOJB 3IWZA 2W2IA 2XH6A 4TTGA 4OZOA 1OA2A 4QM8A 2IVJA 1AYM3 2DTWA 1S2BA 1CN1A 1NXD1 3P3PA 3POJA 4NRPA 3VD4A 2PHRA 1TEIA 1JU4A 5EHDA 2I07B 2YFUA 2PA7A 3VBRB 2PHLA 4TZDA 4GMP1 3OBZA 4LA3A 2X29A 3N7KA 2CWSA 1OD5A 2CSGA 1BYHA 3PMEA 5LA9A 3ZMOA 1WW4A 1PK6B 1SHWB 1J83A 3WQ0A 4YZ5A 3AVRA 5LEKA 5FYUA 2W1QA 1HJFA 1O4ZA 3HD8B 3RYKA 4AEJA 3WDTA 4AEMA 3WNLA 5ABJC 3MIBA 3WCRA 5F5CA 3DYPA 1W9TA 2NMNA 5JOYA 5FUPA 5FUNA 1AZDA 4MXWB 1XE7A 4KWJA 3ORJA 4NIIA 4YPJA 3WDUA 2AUYA 3WW1A 1POV3 2QZ3A 2I74A 3ZSMA 5FZIA 4IEZA 2WT0A 4RHV2 5FFOC 3LB9A 2PHUA 5BYNA 2DURA 3M8LA 1XYOA 3OOXA 1O8PA 3E1F1 4Y20B 1WBFA 3ZYIB 2LALA 2E7TA 1QJX1 3BCWA 4PHZA 2F4LA 1HN1A 3ZPOA 1QDCA 2G19A 1NCQC 1RVF1 4B29A 4G9SB 3THPA 2YFZA 5IT6A 5H9RA 1XQNA 4MGQA 2HBUA 3C3VA 3ZFFC 5A6ZA 2FDHA 4P00B 2FCTA 1W8FA 4GJYA 2DVGA 5H9QA 5KHKA 3ZYHA 3V0BB 3VBUA 2ATFA 5T5OA 2O0OA 2AREA 1LKNA 4GXLA 5I8YA 2QE3A 4Q2FA 2BPA2 2BGPA 2VR4A 5F37A 1R1A2 1YCIA 4K1ZA 4UF0A 3I59B 2ZGMA 1S0FA 3AZVA 3VBFB 3VDDB 4D6SA 1W99A 3FBMA 3I2HA 1D4M2 4Q0QA 1S2KA 2BDRA 3DYMA 2D5FA 4LBLA 2PHXA 5C33A 2ZZJA 4HMZA 4GMP3 1IGOA 1LESA 3N9OA 5DAQA 1YFXA 1VRBA 2AYHA 3AL5A 3DCQA 1RXGA 4NMIA 3ITQA 2VE1A 1UX7A 4NAMA 5FYMA 4CXWA 4JGYA 4COUA 3RZZA 1OVPA 1XE0A 2HLEA 3TN91 3IIAA 1DU3D 1RUG3 2JE7A 4XE9A 2QTWB 3VKOA 1ZZCA 2BBAA 4AG4A 1ND2A 3U4SA 3LA2A 4ZHNA 1CX1A 3JD72 3RZJA 3AL6A 4UFMA 1PGW1 4UF0B 4ASMB 1E5SA 2LRPA 4IE4A 5A32B 1NCRB 2ET7A 2AH2A 1UZWA 4CDXB 4CP1A 1VB4A 5J1XA 3BKZA 1VMHA 3ZXJA 1YQ2A 5K0UA 4RQPA 4E2SA 3CJIC 1RUH1 2D6PA 2JWPA 4P9XA 5FP3A 3HQUA 2ZGPA 4QX7A 4XTMA 2C1FA 1KFXL 1HRI1 1XNCA 2AEZA 3H50A 2BEOA 4E27A 4BXFA 1JZ3A 1YFWA 2XB6C 1IS3A 4DY5A 3M3QA 4GQ7A 1ENXA 4FPEA 2A7AA 2XUEA 4CPBA 1EUUA 5LA2A 2RS32 1BKZA 5T54A 2NP0A 4RGGA 3S57A 4GZ9A 4IGPA 4OQ9A 2PHFA 2WZ8A 1AR73 1UZZA 3DYOA 4WM7A 5K7PA 4XJZA 1ZA4A 2GALA 3TEYA 2KM2A 3FMGA 4CDQA 1UMIA 3ZMNA 4ZS3A 1XNDA 4FCAA 4UFLA 1W3XA 1ACCA 4UWDA 1Y9MA 5L9RA 1RMU2 3TN93 2ZAHA 4ET7A 3NKGA 2ZGUA 5DG2A 4CCEA 2IUWA 1X9PA 1QJFA 4CCOA 4ISQA 1POQA 4QPGB 3T2QA 1HV0A 2ZHNA 2YU2A 1AX2A 2O1QA 2WNUC 3PHMA 5J48A 1P8JA 4QGMA 1RUE3 1F2NA 2QVSB 5GLZA 2LS6A 3KV6A 4QDQA 5CG8A 5EJ3A 2A6ZA 1MZ6A 5J09A 1I5PA 1UN1A 4UFHA 1LEDA 4XHXA 1FPN3 3M3OA 1UY0A 4HKOA 3F2ZA 1PNGA 4XYXA 3RS6A 2ORXA 1F4AA 2D6OX 1EAH1 3LWCA 4KU8A 1OUXA 4IEYA 4PDWA 4P9JA 3RZGA 1SLTA 2JDKA 3UYJA 5D8AC 2CGOA 1MACA 4NHXA 3T08A 4U36A 3KF3A 4Q27A 3PNAA 4RR3C 4QM9A 2HWF1 2RS13 4FBFA 4YM0A 3IPVB 2V4VA 1SG3A 5JUVA 3FLRA 2R16A 4KGQA 4JHTA 2WKKA 4UYBA 4LO6B 1IQDC 1C28A 2VPVA 4J25A 4B1MA 1W8ZA 4QB2A 5C9AA 1EP0A 4ZZ5A 5JSOA 1JZ8A 3CLPA 4ES9A 1BJQA 1NCQA 4Q29A 1RUD3 3EJKA 3FHAA 5IK4A 1NXMA 1JTZX 2IXJA 3ZFGB 1ZZ6A 1C8M1 1GZCA 3ELNA 4XF3A 2D7FA 4JQTA 3GBFA 4AFAA 4FPCA 4AL9A 1QQP1 4FAGA 2PLV2 3O0VA 2AGSA 1ENQA 4XF1A 2YPDA 3AZXA 3N9LA 5DDJ2 1LHNA 3PUAA 3NNJA 4AW7A 2TUNA 2XGXA 1FV2A 1GP4A 2VBPA 5T5PA 1NYWA 2WT1A 1N47A 4QKBA 1PGL2 4QHZA 2V73A 3FL7A 4QD2A 4GMP0 4URTA 4DXZA 5DPNA 1PNFA 4Q4Y1 1NZIA 1DDLA 1XB9A 1BQPA 5IVFA 3RI8A 5AC91 4AI0A 2ZX4A 5D8AB 5DAVA 4LULA 1H6XA 5IHRA 1GOGA 1LTEA 2HH9A 2VOXA 3K46A 4RFRB 5FYVA 4DINB 4LA2A 3QBQA 2H6CA 4YARA 4QPYA 3MICA 1B35C 4N53B 4FTBA 2BFUS 2FDJA 3WDWA 4F8AA 4Q4X1 3J7HA 5FPLA 4IEOA 1HB2A 3G6JB 1KS5A 2ZABA 1LEMA 4R9AA 4BQ3A 5JMCA 1ZZ7A 2XPJA 3J4UH 4BQ2A 5JIAA 1QMJA 1H1MA 4S2GA 1G86A 3VBHB 4CDWC 1SDWA 1OQDA 1PO12 4UFJA 5D8AA 2MHFA 2VTXJ 4AVBA 1O59A 2D6LX 3WLUA 3WUDA 4BQ5A 1E5HA 2GNMA 1SFPA 1RUE2 5IK5A 3DXUA 2ILMA 1O4YA 3NVCA 3P6BA 4XF0A 5FUIA 1S4CA 2YGLA 4OQ8A 2JDHA 1ZVFA 1HB3A 2IXHA 4O61A 5CFDC 3E6DA 1QQP3 2WINB 2H0BA 3FFQA 3POBA 3AZZA 2QKDA 2Y6FA 5FYBA 4GB32 4AVVA 4I3PA 4YM3A 1VBB2 4BQXA 2ZACA 5CISA 3T2PA 5F5IA 4XFBA 1REEA 4DMIA 1XU2A 2ZGQA 1DQ4A 3H1MA 4X8PA 2W9XA 3I2GA 5ANQA 3OEAA 4FPYA 4XDQA 1HRV1 1L7QA 5FMCA 4BHPA 1UY4A 2NYYA 1N1VA 4AGGA 2DCKA 2JXAA 3HR9A 3OPWA 3PDQA 3LEMA 5AFBA 5FQ0B 4CDQC 5EPAA 1DGWA 2VMFA 2ZGOA
chains in the Genus database with same CATH topology
4Z2WA 4BMEA 2Y0IA 1IS6A 5J7MA 3AK0A 2ZGKA 4FP2A 3CU7A 4R4XA 5F5QA 2HWC2 1YJLA 4LE3A 3VHPA 5KXEA 4BOWA 1YO8A 2CAVA 2WNVC 4W6WA 3ZXGA 4Z8BA 2R0HA 3TAYA 1RUI2 1PO21 2VULA 2Q4SA 1MS0A 5T55A 1DQ0A 1R083 4Y1XA 5GZFA 2PAMA 4N7IA 4D7TA 1JYCA 2EVXA 3WHTA 4AVAA 3KCCA 2JX9A 4CDXA 1SCRA 2QJVA 3UV9A 3ZXAC 2WNVA 3D4KA 1WCDJ 5CVRA 3M4FA 2IFRA 3WCSA 3WDXA 3KS7A 5K0UC 1LRHA 1PZ7A 3WD5A 5ACA2 2WSVA 4HLTA 4KG0A 2JKBA 5BNOA 2X5IB 1ULFA 4NWWA 2QDNA 3VBOA 4ASLA 1HXS1 3FHIB 1OHFA 2OUJA 4EROA 1JBCA 2VNGA 1N1SA 4WBBA 1NQJA 3WR0A 3ZYGA 3WT3A 3I2DA 4L9BA 4KG8A 1LB2A 2EA7A 1OKQA 4Q4V1 1DGWX 2AR6A 2Z2SB 1DG6A 2GMEA 3SCGA 2EXJA 1RUC2 3UKNA 3QD6A 4RGAA 4C0BA 2RM22 4Y26A 1GR3A 1FX5A 1TME1 3ME2A 3OD0A 2PLV3 5C4WA 1WMFA 1S0EA 2PAKA 4D69A 1Z0HA 5DDJ3 2G9FA 1UIKA 3ZXKA 2G4IA 2YHJA 5JOWA 3JBG2 5FLIA 2XG3A 4FT8A 5EFUA 5FDBA 4QPGA 1A3KA 1AYM1 1GYKA 3WG4A 1F9KA 1R1A1 1PO11 3ENRA 4N9HA 2ZKLA 4GULA 3NO8A 2WT2A 3Q9OA 1VBA3 4I01A 4YG3A 1HXS3 2VVFA 3PVOA 4GA9A 1FV3A 3B69A 1KDKA 1DYKA 1H2LA 1IS4A 1CAUB 1RJ8A 1BK1A 5J98B 2Z42A 3O5SA 2FMDA 3E6BA 1AXKA 1QH7A 4RR3B 1LOFC 4EN0A 3ZYRA 3M70A 4LHKA 2C0ZA 1RUJ3 2NLRA 3A0KA 5KHIA 2UY9A 2E51A 1IS5A 3ES4A 4N9IA 4RHV1 3BOPA 4DPNA 1VBD3 2BVVA 3OF1A 4WVWA 2H6BA 3WINE 1EY2A 5C9AC 4JDNA 4XZPA 1GKBA 4XXPA 4P9YA 5I8TA 1K5MA 2VUJA 2PTMA 2VGDA 3AKRA 1OLQA 1BVP1 5AVPA 1QJX3 5J36A 3LZZA 1NLSA 2PLV1 4QPGC 1URXA 1QOOA 4TWTA 1S0BA 3GHNA 3FWEA 2UU8A 2QDRA 4UBGA 4LLOA 4KWKA 4MGIE 5K0UB 1ENSA 2EXKA 4NWVA 1SCSA 4Q26A 1ZRCA 4MH0E 1RUOA 1BMV2 2JG8B 1V6MA 3KCYA 5GLWA 2ET1A 5CA6A 1UU5A 5T5JA 2HWF2 2DCTA 2WNVB 1ZRFA 1RUC3 2ZTNA 3RQ0A 3ZFGA 2F4PA 4IEUA 3RI9A 2HWC3 2LUWA 4RD7A 1CX4A 4J1XA 5BXXA 4Q8KA 3FE5A 4NOTA 1ZZBA 1VBE3 4YZ2A 2DVFA 3ALQA 3FX3A 1Q3EA 2JECA 4YZ3A 1W6OA 2AENA 3WW4A 1VBB3 5C8CA 3O7OA 3AJZA 1C5HA 2XKPA 1D4VB 1DYPA 4BCUA 3J8F2 5F1RA 4H14A 1DF0A 5ACA1 1REFA 1SQ4A 1VRH2 2JG8C 5JZGB 1QNWA 1H2MA 4KL1A 4AF9A 3JUUA 4OHVA 4U2AA 1Q8QA 3OCPA 4Y1UA 2R0FA 4C0HA 1YFUA 2DYCA 1RUD1 4FPJA 2JG9A 1ZBE3 2YMZA 1PO22 1J59A 1LOGA 3JB4C 4PIYA 2Q0AA 1X36A 3KMHA 4CDWB 3CJIA 1AR83 1PHMA 4RQPC 3SXWA 5KXCA 2QQPA 3E5XA 2MEV2 3VZNA 1DQ6A 1Q56A 3MZHA 4JGZC 4NR1A 2CV6A 3ZFFB 2JG9B 1OQEA 1SFNA 3P3NA 4WM7B 4XILA 2OZ6A 5C9AB 1VIWB 3IM0A 1DQ5A 2WJSA 1V00A 4Q4Y3 3JCIA 1ULCA 2VW2A 1F5JA 2DCZA 1DQ2A 2HWD2 1WW6A 2W68A 4XHBA 1HRI3 3AP4A 4WM7C 4W65A 1BBT2 4PCRA 2XVKA 3B93A 2JG9C 2WZR2 2JEMA 2D44A 1TNFA 3SCHA 1LOAA 3K51A 2GSYA 1RVF3 1A78A 1ENRA 2RJKA 4QQLA 1ZZ8A 3UKVA 2CGNA 2UYBA 3KT1A 3HBZA 4FP3A 3MF6A 4OHWA 1JYIA 1WMDA 4E4DX 1MR5A 1OPOA 4FPGA 4META 3USUA 4A7ZA 4YGBA 1GZWB 5JZGC 1O3SA 3MPPG 3AP9A 3MYXA 3A0NA 1AL23 4Q8LA 3MFCA 1UMZA 4NPRA 4PLNA 5I0RA 4R9DA 2BVBA 2R042 2SLIA 2RE9A 1UKGA 2D40A 1LU1A 1R091 1SBEA 3JBG3 4UW5A 4BMBA 4OULA 3URFA 1IKPA 4QPIA 4W6XA 2QZ2A 1QJX2 3ECQA 1O3RA 3VDDA 1FT9A 5JOZA 5JVVA 1BCXA 3VBRA 4KH9A 5AC92 3MW2A 4GWMA 1LECA 4HANA 4JTNA 1K5MC 4I2OA 1ASJ1 1DFQA 1UD1A 3X29B 2PFWA 4MX3A 1UPIA 3VL9A 2R043 4GH4C 2NPIA 3ZIXA 5FAXA 5DUVA 1C8M2 3QOPA 1NCRA 3MW3A 3VZLA 4YGEA 4BLIA 3B00A 3GALA 4OI0A 2EXHA 1UPSA 4O9GA 1W6PA 3IT8A 2R061 3KQRA 2ETEA 1KD7A 1W6MA 3AKQA 2D93A 4OI4A 1H0BA 3JZVA 5BNPC 2A5ZA 1T6GC 4JGZA 4MGKE 1Q43A 3ZSJA 4GH4B 1D2SA 2R063 3I7DA 3JBG1 3RJRA 2A70A 2WFF1 4IXLA 4YW5A 3AM2A 4M3CF 2ZGTA 4ONUA 5TSWA 3AMNA 3V0AB 1NE4A 3LGRA 1S0CA 4K21A 5I0TA 3BIWE 1EAH2 4CDQB 3CJIB 2GU9A 1BVVA 4COWA 2VOKA 5DUUA 1RHI1 4AHZA 3WVJA 4B4PA 3HT2A 4YM1A 3C2UA 1XRUA 1GNHA 1GNZA 3LSEA 4FO9A 3GYDA 3U11A 2D97A 1RJ7A 3AYCA 4GB33 3B7MA 4YYOA 2DWRA 1AR82 2FBEA 3FFZA 2IWGB 1H1IA 2WNEA 2O8OA 3MI8A 2WS92 4JAAA 4R9BA 1KDMA 1ULGA 2PQQA 2ZHLA 2QFEA 4K3UA 4BM8A 3U4XA 1IPJA 2GNDA 1LCLA 4MYEA 1V9U1 1DIWA 3GF6A 5BPXA 4PLMA 2D6MA 3AZWA 4RSUA 4PIZA 1QXRA 4LUKA 1COV1 1IQAA 1VR3A 2OPKA 5FOBB 2HWC1 1OFSA 1OPMA 4D94A 3SCFA 1C1LA 1C8NA 2WS91 5DXDA 3MIFA 2VOWA 1REDA 1QWRA 1RUI1 2PELA 4OLLA 1TE1B 5GLUA 4XQ4A 1O3TA 4YM2A 2WS93 1NCQB 1Y7BA 1J3RA 2YROA 3LA7A 4N53C 1H2KA 1N1YA 1MQTA 3VHRA 5CBLA 3OD4A 4OUMA 1RHI2 1JW6A 1SACA 1PK6A 4HKLA 1W6MB 1VBD1 4XBLA 3KGZA 1N3QA 1HRV2 4JGZB 1J3PA 1GV9A 2D3RA 4PBOA 1EV12 4Y24A 3N7JA 3RSJA 4A7KA 3AKPA 1ALYA 2XWJB 4AVSA 3AP5A 5ABJB 4LBQA 4P9WA 1QXJA 4FOVA 5KHHA 1AJOA 2ERFA 4GB31 4CP2A 2WSUA 2R071 3S7EA 2WFPA 2A75A 4N43A 1PK6C 2EAAA 3B01A 2XVGA 3R05A 1VBC3 4MXWA 4QMAA 4Y20A 3RG0A 3ZFGC 3D0SA 3MDPA 5F6KA 1VALA 2RR13 4P9GA 2UY8A 4R9CA 4AFCA 3JU9A 5FO7B 1COV3 1KRIA 4MGZE 4AI1A 1U5YA 2XJUA 1POV1 3D5OA 2W0XA 1Q8SA 1PZ9A 4I3GA 3VV1A 4LHNA 1EV13 3WHUA 1HDKA 4E2QA 4QHBA 2XWBB 3CNAA 1WCKA 5GZGA 3VKNA 5LK7B 4FXKB 4E2GA 1AXZA 4AXOA 2VVEA 3APBA 3MIDA 4Q4V3 4KQ7A 1N3PA 5FLJA 2ZX3A 3V64A 2HKXA 2LTNA 3ILNA 3AFKA 1X8MA 4RS5B 2DU0A 5HCAA 1YI7A 4BZ4A 4LBNA 1YNAA 1VAVA 5JAXA 1JXNA 2LM3A 3OBRA 3AXDA 4FOWA 5BNPB 3LOIA 5B2GB 5BNNC 3ZFEB 2OW4A 2VY0A 4P9LA 3IDCB 1W6QB 2HEVF 3TRSB 1ND2B 1IKQA 2BWAA 4GWNA 4S2DA 5FO9B 4ES8A 5T5LA 3IN9A 4FPHA 1R093 2GC1A 5L7OA 3VHNA 1UU6A 5JIUA 4BE3A 3VBHC 4GALA 3ZFEA 4DZGA 3ZSKA 4JVAA 1O5UA 3ZYJB 1DGRN 1XYPA 2GC2A 1SLCA 2BQPA 2B39A 1AR61 1V6OA 4C1XA 1NQDA 3UJQA 1RL3A 1DZTA 5CFCA 1RUI3 4L97A 1QH6A 4DY3A 4YNIA 2JG8A 3PVEA 3AYAA 2PN5A 1H1AA 1R092 1VBE1 4TYSA 1J3QA 2K9ZA 3WUCA 4NN0A 5T3NA 2HWF3 1GSLA 2DVDA 1TME3 2JD4A 1HXS2 3AX4A 4NO4A 4EWDA 1CAWA 2P17A 1Y3TA 2VOVA 2B7YA 3TNPB 1F8VA 2R072 2E63A 5FTTC 4AQSA 3VBRC 4K6BA 1S1AA 1Q5OA 4AYUA 3DGTA 3W9AA 1XNBA 3ZYPA 3N35A 2XJQA 2HWB2 1ZBA1 4N43B 3R6SA 4WVVA 3JQXA 3ZSEA 1BBT1 1QGLA 3AZYA 3PJYA 1LOBA 4Q0UA 4AGRA 2HWE1 1MS9A 1RIRA 4F3JA 3VBSC 1CAVA 1HRI2 4I09A 1YJKA 4NHLA 3H3UA 4IEPA 3EO6A 3HAGA 2X8KA 5T50A 2A6WA 4CZSA 3ZXDA 1PGW2 1ND3B 4LTAA 1UKRA 2NZ9A 1ULDA 2BTVC 2BYVE 1CD3G 4Z1VA 5JSRA 2HWB3 2XHKA 4Q0PA 4LBQD 5L7OB 3EQEA 1RUD2 2Z79A 2R30A 5DUWA 4AHWA 1EPWA 1NA1C 2CAUA 4XFGA 4XXAA 1H9PA 4Y22B 1ULEA 1M4WA 2Q1ZB 1ZX5A 4FPKA 1NG0A 5A33B 4WVMB 2UWAA 1DGRA 3T1LA 3ZN4A 4HVOA 1RVF2 4ATFA 3ZN6A 1Q8PA 4YVSA 3OY8B 1W2UA 3BPZA 5CFDA 4K8FA 4FXGB 2RHPA 4EN9B 4OZXA 3NWKA 3J8F3 3VBUC 5I0SA 4XFHA 2DV9A 4HSLA 4XMAA 5F6LB 1N3OA 1NCRC 4XFFA 2RMU2 3TB0A 1YFYA 1VJ2A 2P37A 1RTVA 1BEV2 5A33A 1VAMA 3WZ1A 1UU4A 3W59A 3R4SA 4H55A 2RS53 3M1HA 1H8TA 4A2UA 4GIQA 2GC0A 5JPNB 4COZA 1GLHA 2BGCA 5CFDB 1S0IA 4MZUA 3ZIWA 3UKTA 2R6QA 3PJQA 4XIOA 4FAHA 1QQP2 5ACA3 2FQPA 1I9RA 2WFF3 3VGIA 1CPMA 3VDDC 4R52A 5GLTA 1XXNA 4HK8A 4HPKB 4XTPA 1ZRRA 5KXDA 4BYYA 1S55A 1O3QA 4FSJA 2A6XA 2RMU1 1XE8A 2YPJA 3VUOA 4M3CE 5L19A 2WA3A 2ZHMA 3LKJA 4FTSA 2RS52 1G7YA 1OA3A 3JD73 1UZYA 3ST7A 1BEV1 1TME2 2E6VA 3H1WA 1B35B 3I59A 1UIJA 3HN1A 4AVTA 1U12A 3MPBA 1AXYA 4I0BA 4Y1ZA 4Q4X3 1KITA 4YLZA 3OYWB 4EJRA 1FOD1 1X50A 5IUQA 3ZN5A 3QH6A 2A71A 4N90A 4CYDA 1X82A 1DLLA 2H0VA 2B45X 3NAPA 1R1ZA 4I02A 1NOVA 2NN8A 1OA4A 1WW7A 4Q0VA 2BNNA 4B4QA 1D4M3 4MSVA 4LO4B 4XMIA 1E57A 1LGBA 1WD4A 1O5LA 1OMIA 4OVEA 3DPRB 4AK3A 3WXPA 2UURA 2XL9A 1YRZA 3ZDSA 5JOXA 3PVBB 1QXPA 4AI2A 2BNMA 4AI3A 4G4FA 4B7KA 2AZ5A 1PVXA 2GH2A 1GQHA 4Y1YA 2CL2A 1SLIA 3K48A 2A73B 4W6YA 3WOGA 1FMD2 3H3ZA 1WLCA 3FC0A 4LO8A 4AEDB 2XJPA 5KXBA 5BNOC 3NJZA 2RMU3 3EHKA 3T2TA 3KB5A 4PLOA 2Q5TA 4XJUA 2VUAA 1VBD2 4DRVA 3RNSA 4AEKA 1JOJA 1QJZA 4LT5A 2ZX2A 1AJKA 4FOQA 2ZBJA 4FTEA 1A8DA 4WV8A 4HVRA 3B9CA 4YW1A 3H9AA 3B94A 1C1FA 1JH5A 2HWE2 5GLVA 3WDVA 1SEFA 5GM0A 1ZRDA 1R1A3 1AL22 2X5IC 4OHXA 1PMIA 1PO23 1ZBA2 3VBSA 3TN92 1AX1A 4LNVA 3ACLA 3CF6E 2ARXA 2B5HA 2EIGA 1JN2P 4IERA 4YGCA 5C8WA 1V6JA 4IESA 3B3QE 3BODA 3KT7A 1VBA2 4H7LA 3HT1A 5JCTA 4LO5B 1V9U2 4FQZA 3SH3A 1AR92 2ZX0A 4B3NA 3DUIA 4PDWB 2ENRA 5CAZA 1MZEA 3ZXFA 1G9CA 5ABJA 4HBNA 1PVC1 4RHV3 4YGDA 1QKQA 1CAXA 3D8CA 2JDZA 4QQ2A 4R4ZA 1YHFA 1N1TA 1W6NB 1BZWA 3KGLA 4WM8A 1HQWA 3L9JT 2ZGLA 2DCJA 4BA6A 5LK5A 1X8EA 1WGPA 1DZRA 1RUF3 3M3CA 4Q1PA 3VKFC 4C1WA 4EWEA 1CAVB 2BWCA 3FLPA 1LR5A 4K9SA 3SH5A 2GZWA 3MFAA 3SHRA 4MVTA 4AVCA 4AGVA 1ZNPA 2ZS6B 2R062 1RITA 4EN8B 3OY8A 5CFCC 5LRRA 1B35A 3ZX7A 4CEYA 2YYOA 5CB7A 1QU0A 3FZ3A 1R081 5JPMB 3VBFC 1SBDA 2DUPA 3POYA 3N4MA 5E89A 4UW6A 1AR63 2DUOA 1ZYBA 4HN0A 4INDA 4XFAA 3LCPA 1LOCA 3SH4A 1PIV2 1KS4A 2G9GA 4FPFA 3RMYA 3HIFA 2D43A 3B9IA 1RC6A 3POWA 1UX6A 2DTYA 2R32A 1U5ZA 2XJRA 1OFNA 1SLBA 2ZGRA 3AXEA 2R49A 1VP6A 4L8QA 3ZO0B 3D6EA 2DVAA 4CEYC 5KBFA 1QJY2 2GNBA 4DFSA 3AMHA 2BW8A 1EYBA 1EPZA 1RUF1 4XJ8A 3HWJA 3SNMA 4CDWA 4ZU4A 1W6PB 5H9PA 5JLVA 3M3EA 3B5LB 4E4ZA 4Z82A 1AR72 4YG0A 2W52A 1AL0G 2D3SA 2IZWA 1OQ1A 3KD4A 1F31A 4GH4A 5FREA 4YVSC 1VAKA 3JQWA 2KA3A 3L2HA 4C90A 4D7SA 2WQ4A 4Q4W3 5HCFA 1IPKA 2VVDA 2V09A 1NY71 1S0DA 4Y1VA 2ES3A 3LAGA 3EXUA 4O9EA 2RJLA 2XLGA 4JDOA 1VBC1 2ZJCA 1Q8VA 4OI1A 4MLOA 4J6GA 1AL21 1VB2A 2CGPA 4BWOA 2A3WA 1YUDA 5FMOL 1WCSA 4FVVA 5FRAA 2HWD3 2TEPA 1QHDA 2ZGNA 4RS5A 2VW0A 1ZM1A 1BBT3 4UW4A 1A6CA 3GBGA 1CJDA 3QLQA 5KHGA 3WP6A 2HWD1 3POSA 3DL3A 5C8CC 5CADA 1SBFA 1YI9A 3WP3A 4M0HA 5BNOB 4LBJA 4ZXKA 4JV4A 1COV2 2WNUB 1LHVA 1CJPA 3WDYA 4ORFA 3ZFFA 1M06G 1ND3A 1GZWA 4H7MA 2MPFA 1HX6A 1QJU1 4AQTA 2D5HA 1PGSA 2HWB1 3D82A 4M00A 4WVMA 1APNA 1VRH1 3V0BA 3QCWA 4BQ1A 4CDUB 4S2HA 4I30A 3ZVXA 4LBKA 4XEZA 2D6KA 3H8UA 3OJBA 4CEWC 4MV2A 3LSDA 1CQ9A 4N53A 3VZJA 2HEYF 1ZBA3 2OIIA 1GICA 3VBOC 3J8F1 4IL7A 5HI0A 2SBAA 2FZ1A 2GN3A 4DRRA 4BH9A 1RUG1 3INAA 5IK7A 2QCSB 1AF9A 3VZOA 1CAWB 2NQYA 4JGYB 1RGSA 4IV3A 1H30A 2UWCA 4M0NA 4QU2A 3SLIA 4MUVA 1H9WA 5BNQA 3VKMA 4JRLA 1LOEA 1OOPB 3NKTA 4CDXC 1WLDA 3ILRA 4ITCA 3E97A 2YY1A 1QF3A 1GQGA 2V5YA 4LEJA 3PTYA 4OHZA 3WY6A 4HSJA 4ATEA 1DHKB 1JHNA 1RUH3 3KLSA 1TMF1 1MEC1 1V6IA 2GDFA 5JI7A 5EYYA 1VBC2 2GMMA 1AR62 1MZFA 1G9AA 4SLIA 4BLJA 4UBHA 4XBNA 4OI2A 4IV1C 1HV1A 4UW3A 5GJ6A 4AWDA 1VRH3 1CPNA 4AFDA 2JENA 2R1DA 5DG1A 5GZCA 1HQLA 1CAXB 2JE9A 4PIXA 3AYDA 1QJY3 2FHRA 1ZBE2 2UYAA 2A3XA 1WMEA 3GZTB 4UXAA 1ASJ2 1G9FA 3N7MA 5I8SA 2B46X 1LU2A 2Z5WA 1Q8OA 1QJY1 2VG9A 2EALA 2QUOA 1I6XA 1LGNA 2OZJA 3BOWA 4AQ6A 2YXSA 4COVA 4C91A 1OOPC 2HEWF 4SBVA 4XPVA 1MS8A 1KFUL 1SFYA 2Y0OA 3AP6A 2P3IA 3TWIA 2K2SA 1FPN2 3VL8A 5IK8A 1UF2C 1U5IA 2RM23 2XJTA 4K40A 1C3HA 3E5UA 4P9IA 1NLRA 4XFCA 2DCYA 1UAIA 1Z7S2 1MS5A 1H8TC 3ZSLA 1FOD3 1AYN3 4NVPA 2WC2A 4YG6A 4YW3A 2OUHA 1WUVA 5CG9A 1ASJ3 1TNRA 4H3WA 4RR3A 1TMF3 4Z07A 1C5IA 4EN6B 3WP5A 4XJ9A 4Y5Z0 3SMHA 4QPIB 2XL7A 4I0WB 1H4HA 4B4RA 4XQWA 4B8EA 2RR12 1MQTC 3TNQA 3IDEA 1KXGA 4PJYA 1HLCA 3IPVA 1NA1B 2VH9A 1RUNA 2XLFA 2JJ6A 1GANA 2WZPP 1YXWA 3BB6A 4L92A 3ES1A 2WQZC 4ZU7A 4OFGA 1NZCA 2ZHKA 1I3HA 1EV11 1LOFA 4AHXA 3N36A 5C8CB 4KU7A 2VW1A 3CEWA