1RULL

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 50
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulL01
2ADFH 1RUQH 2HJKA 1F3DJ 3IDYB 5KTEL 2ADGB 1OTUD 2R4RL 4YR6A 3BIBX 3RWCB 3O3EB 4XP4L 4WI9A 1FYTE 4HFWB 2GTWA 1NGQL 5CD5C 4LGPB 3C5SB 4ODUA 3MZTA 4ONHB 1INDL 4PJCB 3PXJA 1JYNA 2PF6A 1CCZA 2ZUQC 5JDJA 1D6VH 4I18A 1SBSL 3ROLB 3P4OA 4NC1C 1U3HB 2VDRH 3MUZ1 4TYUA 4PB9L 4UILH 4PJHF 4Y88A 2ENYA 4LNRA 5ADPL 3T0BA 4OCLC 4CGTA 3KLAB 4ESKA 3HAEG 1AGFB 2OTUB 3SDAD 1U95B 4MD5A 3KJ6H 1S3KH 1KCRH 4I0KA 4P9HC 5E7BA 4APQC 1U8MA 3D69B 4U4BA 1DL7L 5CZXC 2D3VA 2WANA 5D5ME 4OGXH 4BSVB 2CIKA 3D39B 3IU3A 1M7DA 4GG8B 5DR5H 2BSRA 1ODAA 5IMMB 1RZKC 1GGIL 5F71A 1KF9B 2B1AH 3F58H 4Z5RA 2Y36L 3U6RA 4HGKC 2DWDA 3DPBA 4AIZB 3I6KA 4M4RA 4LSTL 5E2TL 1TTFA 2YPVL 1E4KC 2E3VA 2XWBA 4XMPL 3MREA 2NY7H 4MNQE 5KBNC 3FCTA 1Y18A 3LIZL 1KLGA 4ZUWA 4X80L 1FBIH 4YPGA 4LLDB 2J4WL 3CFEB 4F15B 1UM5H 5ELIA 2J4WH 1G6VK 4M43L 1AJ7L 3LY6A 4HKJB 5BRZE 3AM8A 3MLZH 3KPRE 1IAKA 1TNNA 5T33L 4IMLA 1WCBA 4KI5F 3BW9B 1MFEL 4OKVA 4DKFL 2Q20A 3BZFA 1FNLA 1JK8A 4PV8B 3SQOL 4RQQB 5IQ9A 2H26A 5CEZD 3V79C 1L6ZA 4X5WB 4CU8A 3UTZA 1YMHA 1U8NB 3O6LH 1ETZB 5ALBH 4YXHL 4XWOC 4KJQC 2Z8VC 3L9RA 4OD3L 1Z0NA 2J3SA 1IAIH 3VGHA 3V6FB 3HMXA 2KZWA 1CZ8L 3ESVF 1WICA 4TNWF 1RJLA 4KQ4H 1I7UB 2D0GA 4PJGA 5DZLA 4OI7A 3QWRA 4U1SA 4ZFOA 4IIQB 4J4PD 1BFOB 1I1AC 4KY1H 3WUWB 2EDFA 4LF3B 4M03A 1UYWL 3DHJA 3V2AR 1L7IH 1KJ2H 3WJLA 1G7QA 2BNQE 5ADOL 3NGBB 5AG8A 4ETYA 5KS9E 1FL6A 4DWHA 4K7PY 2ZG2A 1RZGB 2P5ED 4QRUB 3O45B 3O2VH 3LRSB 4MD4B 1S9VB 1TJGL 2N4IA 3DXAB 2WUBH 3OHXB 1I8KA 1T1ZA 3QJFA 3ZE0E 1FGVL 3QQ4A 4UB0H 3OF6A 1U8HB 2R8SH 1K4DA 1QUNA 2ITCB 3D0VA 3WV0A 2WV3A 2NTSP 3W9EA 4WWKB 5IBUG 1BVZA 5C2UB 1DN0A 3DSNA 2VJXA 5CCKH 5CCKL 1NDGA 2ADGA 4PJHE 5FEBA 1QBBA 3QG6A 3CLFH 4K7PX 5IB2A 2V5MA 4JJ5B 4XNXL 2P7TA 1KNOA 2GKIA 4NQTA 4GW4A 2YKLL 2OBGA 4M6OL 2HG5A 1FO0H 1WWCA 3PWPA 3D25B 6FABH 3MBED 2D4FA 3I2CH 3VXNB 4Y1AB 4DGIH 3P2TA 4JDVA 6FABL 4XH2A 4ODBD 2HT2C 1IMHC 1L7TH 3WNOA 5FCUL 2IPTH 4WI5A 2EIDA 2NXZD 1KN2H 5D7SL 3P0YH 3X14A 1A7NH 3H0TA 2LE9A 1A64A 5I9QC 4JFDE 3RU8L 4LRNL 4X99A 2AJZB 4UBDC 3HMXH 3VG0H 2EE3A 4YZFF 4L8CB 3HC3L 1BD2D 3DRQA 2AJSH 5I1EH 1Z9OA 4GMSL 3HNSH 4JFYB 4MXQC 2WLZA 1KLFA 1NCUA 2YXFA 3U7WL 2PYEB 2CD0A 2XA8H 3U7WH 2QHRH 2VABB 4PJDA 3UTQA 5CD3A 2GJZA 2MQ0A 3GMPB 4HJ0C 3G5YA 1G84A 1WIUA 4KXZH 2IH1B 2YHGA 5E9DA 1TVDA 3OX8A 2HRLA 4JGJA 3LEVH 2M26A 1MHPL 5E99L 3RWIA 4IRJA 3B9EA 3O3AA 4DN3H 3V7MA 5D7JB 3MRQB 1UVQA 3BHBA 4JY5L 1I7ZB 2C1PB 4NM8H 5ISZB 5GS0D 3GB7B 4ELME 3MV9B 5E2VH 3RDTC 1AHWB 3H9YA 4DGIL 5CINH 4M6NL 4LFHG 4KXZI 2BRRL 3GHBL 5E2WL 2CSPA 3BE1H 4OI9A 5I1KL 4PUBL 2OR9H 4MSWB 25C8L 3JTSB 4OQ1A 5M7QA 1V8HA 4G5ZL 1J8HB 5DYOB 5JW4Q 2EICA 2ATKB 4RIRA 2XQBH 3PG2A 5LAXB 2VERN 2SEBB 3IVKA 1FVEA 3FTGA 3MLTA 4IMKC 3LKOB 2UYLB 4YIQA 3HNSL 2VLMD 4XPBL 4PLOB 1HZHH 4JHAL 3QNXA 2BNUB 1A7RL 3QUKA 3M1BB 4NDMA 4DVRL 4MXWL 2GY7B 2XZCL 4J6RH 3QNZB 3V0VB 3PJSA 1DQLH 4OIIL 1DFBL 4OCXH 3RX5A 4PRNA 4WHCA 5F72S 3OMZA 2X1XR 5EU5B 3G6DH 3ZE1E 1GOGA 5ETUB 5JPMB 2UV3A 4OFYD 3L3OB 3VFVB 2ICES 3TT3H 3QUMA 1ORQA 4HBQA 4ZMAT 1ORSA 4FG6D 1FC1A 1UA6H 1DANT 4V2BA 2ZUXA 2OQJA 2Q76B 4OCWL 5FFLA 1F8TH 3TO4A 4WNQB 2GAZA 5HVGB 1A7PL 3RVTC 4X4YB 5EBMB 3O3BB 1U3ZA 1H5BA 1KTLB 3VFNB 4LPWA 4I13B 4NO2A 4WFHD 3C08L 3J8F7 4GRLA 1XFPA 1EERB 4WJ5B 1MY5A 2R0ZH 3QDHA 3P9MB 4ODVH 3O4LA 5F6HJ 2BY3A 3SPVA 4WW1A 5B8CB 1JTTA 1WUNT 4G80A 5T3XH 5GRUL 1U58A 4NKIH 1EFXB 4ZYKA 4JRYD 5D1QC 4IRJD 2F74B 4RAUA 5SX5H 3GSNL 4J1UB 4UOW1 1KCSH 1X4YA 3VGGA 5K33A 2BJMH 2EE9A 1AGBA 4EUPB 3FB8A 3V5DB 2CR3A 4QCIB 4N9GA 5DK0A 4RGMB 4L4JA 1JGVH 4OM1H 5SWQB 1I3UA 2D9QB 4U1KA 2E7LC 2VLKD 4L3CB 4E41B 3LKRB 3OAUL 2P8MB 3W2DH 1YYLH 2NXZC 1GL4B 3PP3K 4HG4K 4GRLC 4MAYD 1NCCH 4HW6A 1YEFH 1EEUA 4CJ0A 3UX9B 4LCCA 1OSZA 2PYFB 3BP7B 1GGTA 1PY9A 4QEGA 4D94A 2XTLA 3IGAA 2CRIA 3P77B 3EO1B 1VACA 5FO9A 4KQ3L 3CVHL 4W70A 4BK5A 1TXKA 3MBEA 4UQ3A 3ZTJH 4IMLB 3OL2A 5D1XA 5I1AA 1T22B 3RWHB 3BZFB 2CGRL 5DJ8B 2PN5A 5LWYH 1T0PB 2W1NA 1D5IL 5HGAA 4HJ0D 3BDYL 4YFDB 5EU7E 3QUYC 4RMUA 3UTOA 3HNTL 5MENA 1DN2A 4O5LH 3UYPA 4Y5YC 3RWIB 3X11A 2YPKA 3P9LA 2IANE 3U4EA 4NM4H 4XNMA 1D3CA 4G43A 1DP0A 4V1DE 5TH2A 1JZ8A 3QXWA 3C60D 2VR4A 3UPRB 2C1PA 1T5WA 1L0QA 4CDHA 2AXGA 4R0LC 3B6SB 1A8JH 4YDIL 3U30B 2VAAA 3B9KB 4KAQL 4R90H 4UT7H 3EOAB 3ARPA 5DEGB 2ADJA 1FPTL 4XP1L 4ERSL 4KAQH 1S9WA 3DVNA 4R90L 4WW2C 4KHTL 4UINL 1FL6B 3MXVL 4CUCA 5HDQH 2CK0L 4BJLA 5LQBH 4XMKL 5T1LD 5DFVD 2VUOA 1RI8A 4F80A 3WEXB 5IVXE 1HDMB 2W65A 4MJ6B 1N6QL 3LS4H 3JUYA 1FNGA 2FHBA 3FAXA 2WZPD 1G7JA 4NN7B 3FB5B 5EU4A 1TVBB 1WK0A 1WZLA 1S7RB 2JJVA 3DGGA 4J4PA 5F44A 3GRWH 1HCFX 5CEYB 4LL9A 1CDYA 5IBLD 5DJAB 2NYYD 4H88L 3O8XB 4YHZL 5FUOH 5JXEC 1XF4A 4JQIH 3P30L 5F8RC 4NQVA 4ZFOL 3QBTB 5FKPB 3GSRB 3B9AA 4GW5B 4YXHH 4NFBA 2QR0A 1KJ3H 2JELH 2LV4A 3HHRB 4XH2B 5BV7B 4OFKA 1XH3B 3MZGB 4DVBB 4KK9D 4K3JL 1HOCA 2ICEA 2HG5B 1EGJA 2HJKB 1AI1H 4NC2B 3Q5OA 3VFUB 4NSKA 1JGLL 5E9DD 3S96A 1WF5A 3MUGB 2AI0H 5L2KD 4RGNC 4D3CL 1R5WA 2R0KL 4TSCL 3O2DH 4UT6L 5ID0B 3JBG7 1D5XB 1MPAL 3O9WC 3L7FA 4PLKC 1YEEH 3RBSA 4R2GC 3H0TB 1BZ7A 3RIAF 4XBGB 2FZ3A 4E42B 3VXUA 3SDDD 5TDPA 5JQHC 4O58L 3VJ6A 3LS5L 3TP4A 2Z31C 4XVTH 2WBJD 1X5LA 5C0IB 4LLQB 2APWA 3T3PF 4MDIA 3GJFH 4L8DA 4LHUA 4JFYA 3V5KB 5C09A 4M6ML 3V4PL 1BJMA 3QT2A 3MLSL 4WY7H 4OIAA 4ZFZB 2QJDA 4AYFA 2W07A 2YWYA 4M9OA 2AK4B 1HH9A 5D2LB 5FUZH 3FONB 4UNVA 3K2UL 4LKCB 3UTTB 2HN7A 4HUNB 3Q6GL 1WISA 1A3RH 2R0WL 4W4OC 2HYMA 3SKMA 1BBJB 3VXOA 4FFYL 1A1OB 4K3JH 4BUHA 1QD0A 1ZA6A 3GSUA 4MAYC 1MAJA 1S8DA 1T5XA 1W0VB 2OS7A 4LDOB 1KTRL 43CAB 3D3VB 1YPZA 2FR4B 2ARWA 1S7WA 1OAZH 4HFUH 4WO4A 3FFCB 1RZGA 1HE7A 3EO1A 4BELD 1UACH 2DQTH 3W0WA 5D7SH 2FB4H 2V17L 4F33B 5A2KH 2FB4L 4LSDA 4UTAH 1ONQB 5DSCA 2X1PA 1A6PA 2R1WB 3AROA 1IEAB 5T33H 1OT1A 4X7SL 5C08B 1OP5H 1BZQK 1D5BB 1YECL 5IQ7L 3QHFH 5BQ7B 3RNQA 4GG6E 3WS6A 2CLZA 1YY9D 3OKNA 4M7KH 3VWKB 5SWZD 5CUSH 2QSCH 5HI3D 3VFVA 1U8LA 4TPRH 1JV5B 5DVKA 4JG0H 5DRXA 4ODTH 4TPRL 3WFEL 4JFXA 1MIEL 4ZG1A 4Z78A 2KUTA 2D7PA 4F9LC 1IEBA 3ILPA 3B8YA 3R8BB 2OJZL 5F97E 3QDMD 3H6JA 5C92A 1RURH 4UU9B 5JHDE 4K2UL 3DXAD 4F7MA 3ZYOA 2YOCA 3T2NH 3JWDL 3HZVA 4PGCA 4Q0XH 4YHIB 2DQHL 3JWDH 1BP3B 2BOBB 1Q9KA 3HC4L 2D7TL 4MJ4A 3L3GB 1MFDH 1F4YL 3EYUL 4ISVA 4NJAH 5GRJL 4CDGC 4QHKI 4FA8A 4ZFGL 1VADA 3GMMB 3SCMD 5E08H 1BD2B 3QIBA 3WE6B 3MV9E 2V9QA 5KAQG 4LSQL 5EUOE 1LGVA 2NCMA 2AABH 4JG1H 5IOPA 1NAML 2D7NA 1AGCA 4F7TA 5F7EL 4S0SD 5MEPA 5F3BA 1YECH 5IQ7H 4KU1A 3FB8B 4GXUM 3DBXB 5HYQA 3EYSL 3C6LB 4L29A 3TA3D 3SGDI 1YYML 3BP5B 1PZUB 1UKSA 5F6HI 1CR9L 1QACA 3QIUC 5F1IA 3OKLA 3F7VB 5E9DB 1ZHNA 3KYMB 4P46A 1ZHKA 4LIQL 2Z8WC 1T7XA 2NW3B 4DVBA 2GJZB 3H42L 1EEZA 1AD9A 4PJ8A 5CIPH 3KR3H 4JQVA 4JRWA 2L0DA 1J1OH 5I1DB 1JZ5A 4NQXB 3E6HA 4PG2A 4G6JL 2D7OA 3HZKA 4YBHA 1A9EB 2XT1B 4Z7VF 2WW8A 4NN7C 1QLEL 5FYLE 2OP4H 1CDUA 1S7XA 1Y6KR 4N0UB 3H3PL 5HYJE 1QBML 3KJ4C 3LAFA 4PUBH 5DMYA 3P0YL 1C5CL 3HFMH 4R3SB 3ALWA 3BEWA 1CVSC 2SEBA 5IVNA 2XRAH 2P5EB 1U8IA 3KYNB 3U30C 1AP2B 1J8HA 1TNMA 3QHFL 5ISZD 1PY4A 5IESL 1CI5A 1A6UL 4RX4A 1ZANH 1ZVSA 3BP6A 5FB8B 1NC4B 4I77H 5H37H 3U4AA 4Q9BA 1PYWB 5F9JA 1NH6A 1P4IH 2X40A 2V5YA 4MXWH 5DUBA 4MHHI 5F1KC 1WITA 3VFOB 2LAAA 1MRCH 4HGWA 2AEPH 1ES0A 2VRAA 4RQQA 1T89C 2ICWI 5SX5K 3SCMB 5IW1A 2YA1A 2PW1B 1N2RB 1HK6A 5EOQL 3BD5A 5JHLL 3D39E 2X4RA 2PUQT 1ND0A 1DUZB 3TBYA 3KYKH 3PL6C 2DIBA 1DBAL 2CIIA 1N64L 3UTSB 3IAGC 4Z77B 1KACB 5GRJH 1HSBA 1QPXA 3ETBF 3KLHC 3LDBC 1LO5A 3OR7B 2IGFH 1JE6A 5I1IL 3SDXB 5CGYC 1G7QB 5SX4H 1N5YH 2M8XA 3MRMA 3GMNB 2NXZB 3KNBB 1U8OB 4O9HH 1T83C 4ZTOL 2YRLA 4P4KB 1DSFL 4K3HA 1X7QA 4FQXD 4HD9A 3VI4E 4KVNH 1EAJA 4AL8H 1MIMH 1MUJB 4O00A 4NBXB 1WBZA 3NZ8A 1QQDA 3VFWB 1XZ0B 3EZ8A 2NW2B 5HY9A 4PJIA 2E7BA 4M1GL 4MZ2A 4I2XE 2A6KA 1AGFA 3UPAA 3QAZC 2BNRB 1TJIH 4WV1C 5FO8B 5EDXA 1HQRA 5HGBA 5I73C 1QFWL 1H5BC 3I75A 1K5NB 5IFHL 4NSKB 4MDJB 3HZVB 4LCYB 1J5OL 2FH6A 1G7HB 3A6CL 4LASL 4QHKJ 1LP9B 2OL3B 1NFDB 4RFOL 1WZKA 3TJEH 3O9WA 4ZO6A 1WAAF 4QXWA 2E27L 4BKLB 3I02A 5F7UA 1CD1B 1MJJA 4JY4A 4P4RA 4O4YL 2DTSA 5E1HB 5I66A 3Q0HA 1HHJA 1K9TA 2A6IB 4QHNB 3FFDB 4MA8L 2ZKHH 3ZTNH 4TQEL 2Z91B 3ILQC 1UZ6F 5DJ8A 2XKUA 1HEZB 3PHQB 2EYRA 1SY6H 4K23L 4PRHE 3KXFA 4QRPE 1RK1B 1DLHB 2R1XA 3V6OC 3H9SB 2QADD 1IC7L 3ZE2E 3FO1B 4A2LA 3WXWL 5KSBB 1KC5L 4GLRI 5A1AA 1XEDA 3W9DB 3M8OH 3TF7C 4AM0A 5KJRH 4EOWH 2EKJA 3UC0H 1P4IL 2YZ8A 1QKZL 4L8CA 3OGOE 2FJGA 4UIMB 4WFHE 3MJ9A 3UEZA 3ZMRA 4YDVA 3NFNA 1V3JA 2EDDA 4AJ0A 3BUYB 4PRIB 1S5HB 2LFGA 4IHOA 3NCJH 4OZFB 4LLWB 1CXEA 1TZIA 4EZMA 2VABA 5FECB 3KPMB 5MI0C 1FCCA 3ZDZE 4QCIA 3KVQA 3FQUB 2VUYA 3ULUH 4PJIE 5DWUH 4YHYC 3K81A 1X5ZA 4MXVE 3OZ9H 3HCVA 5CSZB 4XNYL 3RZCD 3HE7D 4OGAD 3WFBL 5D5MB 1MREH 4CW1A 4HHAB 1LO3L 1NUDA 2OLDA 4U1SB 1T6VN 1MRFH 2I07A 1KIRB 3WIIL 4QNPE 4MCZA 4QRSB 4ZNEE 4EI6A 2BY1A 4ZS7L 3LV3B 1U6AH 2B7DT 5D1XD 4J8RA 3ET9F 1DEEA 2NY4C 3DUUA 5JMOC 3IYLW 1NCNA 1Q9WB 1MFEH 5IB1A 5LWYL 4JRXB 5C0CD 1ACYH 3HN3A 5IMKA 1K6QL 2IPKB 3BWAA 3WIHA 3TJHD 4XAWL 3E1F1 3GO1H 3IETB 4PJ5B 4DK6A 5HGDA 4K9EL 4MJ2A 4XWGH 3B8SA 4I0PB 3STLB 4P5TD 4Q6IB 4Z7QF 2R56L 2D7QA 1MI5D 1TETL 1LO2H 3CSYA 1I1FB 5E1AB 3HR6A 1J88A 4H20H 4X6CA 3L5IA 1S7VA 5BXFA 1VADB 2GCYA 4YHIA 1WBYA 1QFHA 2Z93A 2HTKD 4U1HA 4UIKL 5I9QB 5D6CA 5F21B 1KNOB 4KTEH 5E03A 1UWEH 4Z0BH 1MCFA 4B50A 5JIHA 3GMNA 1CTNA 4S11A 4ISVB 1CXIA 4R2GD 5ICXA 1INDH 2BK8A 3EO9L 3LIZH 4ONOA 5ERWB 3BGFC 1X7QB 3LN9A 4Y8AA 3CZFA 4JHWL 4GAFB 3C60B 4IRZH 3GK8H 1KPRB 4P57A 4AEFA 5E70A 4G9FA 2NY2B 3L7FB 5C0BB 1D7FA 5B39A 5F9WC 3P9MA 3TBSA 2GFBA 1YY8A 5HHMD 2KL6A 2V2XA 5D1QA 1ZHKB 1K4CA 1ZSDB 5IVXA 4JDTL 3UC0L 4PJ8B 2G5BB 3UJTH 3SO3B 4JM2F 3O3DB 1OCWH 5HJ3A 3O6LL 1ZHNB 3KYMA 4TULH 5EZJB 5J06A 4P99A 4KK5D 5DUPL 2AEWA 5FYLH 5J57B 1EEYA 1RJCA 1S7QA 1RZ7L 4GAGL 4L8SA 4MA3B 4U6YB 4TVSa 1XR8B 4AIOA 4WFGE 3OXSA 2BC4A 4GQ9L 3LQAH 2CDFB 4P0DA 3ZE2F 1T5XB 4P9HL 4PJBB 5D7KE 3DURB 5IJKC 5D2NC 5DMIL 4C57C 1FFOB 2WQRA 3W81A 1R6VA 4Y2DB 1X5IA 2XKSA 3G5ZA 1I1AB 4CADB 5FCUH 3MLUL 1D9KC 2DLHA 5DZOA 1UZ8B 5JLZB 2HMIC 5LCVL 2D03L 4TSAL 4PREA 5E6IC 5FM4A 3CUPB 1RIHH 5B38B 5LCVH 5F96L 1CQYA 3NCBB 3K0WA 3EJYC 5C08D 4JM2C 4YGAB 4PJFB 2JB5L 2XWJB 4P3DA 3DWTA 3OAYK 4KK6C 3RY6C 5AWNL 1BVKB 3RVWD 5HI3C 3VDCA 5IB5A 1U8LB 1MOEA 1G9NC 1PLGL 3P30H 2OXGA 2Q6WA 3SGEH 5IKCB 1AO7E 4TRPH 3NTCL 2E8YA 2VDLL 2IPUK 3D85D 1OGAD 1XIWA 1MNUL 3HAEA 5HGAB 4LIQH 5C86A 2E9JA 2Q87A 2C3VA 3U82B 1RURL 5T5NF 2WBJB 1IILE 1DDHB 3A6BL 5CEZL 2ICWJ 2ARJQ 2ESVA 1H15B 5HPMA 2XWTA 2VXVH 5CP7B 4DGYH 3BP4B 3O6FA 5GGSB 4WUUD 3LKQA 5EORH 3VMOA 3BN9C 2FL5B 4X4ME 3WHXA 1UH3A 4U6TA 1JGEB 1DVFC 3OR7A 4KI5C 2AS5M 4FXKA 3FQXB 3GKWL 1RIHL 5DVNA 2QV2A 1XF2A 5H2BB 1FVCB 2CKBH 1MAMH 4LCWD 4XTRC 4HCRH 2AJSL 4L9LB 1KGCE 4XT1C 2BMKB 5K9QI 3VXUE 1U95A 3D2UD 3MRCA 3VRIA 2VZUA 1T1YA 1F02I 1L4IA 2IAMC 5KSAD 4U1LA 3RAJL 4KVCL 3QQ9D 1XGQB 4N9OB 2MCPH 3ISWA 1CT8A 1FQ9C 3ARFC 3RFZC 3BIKA 2NX5D 4XC3H 1AD9B 4XTRD 3MLYL 1X6LA 1I8LA 3C09B 3GI9L 1AXTL 3JV0A 5E1AA 4DW2L 2NY3C 4HKBB 4XZUB 4FNLH 4HGMA 2F5BL 4X7CC 4V1DB 1IEHA 2EDRA 4KRPC 4LARH 1QP1A 4S2SA 4XNUL 3QDGB 3JTTB 5FDWB 3F6IA 3DRTB 4LKXA 4K94H 2NY0C 5IFJB 3UJJL 4RGOH 5I8EB 1R5WB 2OTPA 4U1JB 1BLNB 3RVUD 4O02L 3PWLB 2W60B 1OAQH 1GZQB 3BH8B 1HQ4A 2QL1A 3BZ4A 4NQEA 1OGAB 3WL9B 4YDKH 4D9RD 1JNHA 1QFWI 4D0CB 4PV8A 2AV1B 3HC3H 2D4DA 3DYPA 5FOJA 3LKSB 1MCWM 3M07A 4WFEE 1HINL 5C07A 3SOBL 1B2WL 4RFNB 5D1XB 3VWJD 4NRZB 2W92A 1FLRH 2OR7A 3QFJE 3EOBB 3IJYA 2BVOB 5GS1C 4ZFZA 3SCMA 4BYHA 5D6DC 3V6OE 1SJXA 4NRXA 4MJ5A 2W59A 3DIFA 3LQZB 3U6RB 2OX5A 5TE6H 1OD7A 3BISA 5IFHH 4DKEH 3PL6A 3QEHB 1TPXC 2B0SH 5EOQH 4PJCF 4PP1C 4HZAA 4GKSA 2L7JA 3LHPH 1YN6B 3KPSB 1JWSB 1UCTA 4RFOH 4KMTL 3SDDA 2R4SH 1KG0A 1TQBB 2E27H 1BF2A 4DJMA 1H3UA 1NJ9A 2VSDA 3IS1X 5JA8B 1D5ZA 4HT1L 5DRZA 5C0JA 3VH8G 3MCLH 4U1NA 1WZMA 3BKCL 4F33A 1FN4B 2FECL 1WC7A 4N0YH 2DJUA 2XRAL 4WO4C 1RUMH 3LSOA 1AY1L 3VD4A 1Q9WA 3VRLF 1OTTD 5GHWH 5EO1A 4P9ML 5AAWA 5IMKB 3VXPA 4NKIL 1M4KA 1PGRB 1AP2A 5E6YA 1VDGA 1JF1A 2QSQA 1ZANL 3UO1L 3GSVB 5D1ZD 5FOBB 2JCCF 4NQEE 4JRYB 3QFDA 1MF2L 4LIQE 3S35X 3F62A 4W4OA 5GGUB 2YN5A 2X4OB 2EE2A 3LKPB 3H42H 5F7HA 1MWAB 1T80A 3PQYA 4NQVB 4N0CC 1A3QA 3S4SB 4BM7A 1K8IA 2GSGA 1NFDA 4MAUL 4Z7UE 4CMHB 4HBCL 5D2LE 8FABB 1UWGL 4D8PA 5TE4H 3R1GL 1G6RA 4JAMA 4UBDD 1QYGL 3IXAB 4K94L 3CDCA 4ZAKC 3DXAE 1T2JA 4G9DA 2CXGA 3T8XA 2H8PB 1EJ6A 2YRZA 1F8TL 4OZHF 3ARBC 3SO5A 1EDQA 5FF6A 5JIIA 5IGXL 4HIIB 1CS6A 4HLJA 3D3VE 4LGSB 32C2A 3GIZH 3TN0B 2OTUA 4OZGF 5EUOF 2OL3H 5E00A 4LAJH 4PG9A 2W9DL 5KSBA 1ZA3A 1AY1H 2VZTA 1VA9A 4PJ7F 4P2RE 3SOBH 1N4XH 3QIBC 1HEZA 5J1SC 2DM2A 3ZO0A 1KTDB 5I18L 1VCAA 1TZGL 5DHYA 1YA5A 1MF2H 4RGNE 1NCBH 1RVFL 5CWSA 4WW2A 1IGIH 5DJYB 3ZT7A 4KDTC 1WZ1L 3RUGB 3AGVA 3UTPE 3M17A 3E8UL 4OFIA 3L6FA 1RHHB 3RVXD 1JCKA 2P8LA 3MO1A 3R1GH 2DM4A 3MRBA 1G7HA 2NZIA 1YJDH 3TM6A 3NPSB 4I48A 1JI1A 5HDBF 5HHXH 3GSQB 5F6IC 3RWFA 3ZYZA 1BZ9B 4XRCA 1ZWIA 2MHAA 5D7LA 3S5LG 2VR9A 1XF5B 4N8VG 1FDLH 3BKCH 3CH1A 3CFCL 2E7CA 1UM6L 4YAQA 3FFCA 3O6FC 5HVHC 5J11C 1N0XL 4FABL 4JFFA 4YC2C 1UKQA 3AAZA 2XPGA 3IT8D 4X9GA 4YO0B 5ESAA 5GZOC 1IEAA 2XZZA 1SEQL 1YNKL 3CFKA 1RZJH 1DL7H 2BNRD 4Z8FH 4JFDD 2FSEA 3DX6B 3C5JB 1HIMH 1JV5A 3HS0A 4OZHA 4HBCH 4PGDA 1LE5A 2J6EH 1T7VA 3QSKB 5L2KE 1YEJL 1GAFL 1M71A 3ILPB 5D6CB 2EDYA 5FHBH 4U6VH 5C0AE 1KIPA 3DHMA 4F7CB 2CK0H 7FABH 3VFNA 3LRSA 4MD4A 1ZLWH 2NY7L 5BO1H 1UM4H 3MBEC 3CAFA 1BF8A 3LPGA 5CGTA 4H0IA 4S1QH 5IF0A 1V7NH 4NGHH 3CXHK 4O2FB 5EFIB 2FNBA 4LCCC 2J5LC 4XVTL 4MMZC 2ITCA 5ADPH 3MOBL 2P5WA 4TUJA 4HIEB 1EO8L 1I9IH 1S9XB 2I26N 1IZKA 4MNQB 1DN0B 2P24A 3G08B 3O41B 3NH7H 1ACYL 5IOPB 4PJDF 5EZIH 1HHHB 3TO4C 3X3GH 1NLBL 2NNAB 1E6JH 1JVKA 1NEZB 3SGKC 3WHE1 4ZNEA 1EJOL 4GG8A 4Q9QL 5ETUA 5JPMA 2WP3O 5EOCJ 1T04A 4QRTB 4BFGA 1PD6A 3D69A 3QEQA 4RZCA 4PJGE 2BNQD 4MX7A 4EVNB 4KJYB 4NKOA 2R15A 3MNWB 2Y36H 4Z7NE 1BX2A 4N8CH 2BSSA 4NQCD 4NN5B 3IDGA 3MYJA 1K5NA 4D9RE 5DMIH 3AREB 5F7YC 1DQQB 5DUMH 4XMKH 1QPPA 2WNGA 1CICA 4HWUA 4GG6F 4PREB 4Y16D 2VN4A 2EXWD 1QVOB 5KZCD 4QF1A 1I3GL 3ECBB 4KROD 1FFOA 3SY0B 2HFTA 5EBLA 5C07B 1KBGH 2I60L 5C0AB 5EO0A 3WL9A 5C8JB 2NY5C 4KKAD 3AB0B 4K3EH 5I1AB 3GNML 3QQNA 2CDEA 4LOUC 2D7MA 5AZEH 3V0WH 4IBLT 2QKIA 5J13C 2PTTA 4G6KH 2EYTA 1A7QL 1K6QH 1FFNB 4NQDB 1HHGA 1YEKH 1U8NA 3N1FC 4OKVB 1H3VA 4YHNB 1EJOH 4C4KT 4PR5B 5SWSA 1S5HA 5C0EA 4MGXA 2Z92A 2P5WE 4MB3A 3MV7D 1SYVA 1H3WM 4XC1H 4UIMA 4D0BB 3NABL 5J3HC 3LN4B 4GKSB 2DBJA 4OAWB 4F3FA 1VKXA 4H20L 2F53D 3VFTA 2ZUSA 4LARL 2VDMH 5DD5L 2OJEB 4FTVD 1LE9A 4LF3A 1EH9A 5JR1L 4AT6A 5D5MA 3NVQA 4OFVA 5FECA 3ARRA 3F5WA 2DJ4A 1UACL 2C5DC 3P9WB 4HH9B 4MJID 3KS0J 4RBPH 2ZWLT 3O8XD 1VPOL 2P8PA 3JV5A 4Z7VB 3ZKXB 1YMMA 4JFFB 2NY6C 4RDQF 4JQVC 2DDQH 1CK0H 3KXFD 1IVLA 1PKOA 2VAJA 4OLVH 5GGRA 4RMTA 1FL3A 4P2RD 1IM3B 2EDXA 4P2OB 3QIUA 1CR9H 1SYSA 5I0DA 3DETD 3OJ2C 3CGTA 1MIEH 2QTEA 3SDAC 3QO0B 5BCAA 2R1YB 4IRJC 1YEHH 1IL1B 1Q38A 2W9EH 2EIZB 1RIUH 3BVNA 4LK4A 5ENWA 1KXTB 1XIWB 3U7AA 3SN6N 1P9MA 4KH2A 1K8IB 2GSGB 3A6BH 4U1IB 2I25N 1FE8L 1VEPA 4JFEB 5GJSL 3VFUA 1ZEAL 1JNNH 5B39G 5DF0A 2MWCA 5GRYA 1QFPA 4M1DH 4NO2B 1CFNB 5FM5O 1DBAH 1CXKA 1GZPA 4M7ZB 5DFTA 4S10A 1UJ3B 3SDCC 1MFDL 4OCSH 4KDWA 1EA9C 5E8NA 5D70L 1G0YR 3TCXA 2O5ZH 4PJBF 1CBVL 1L9MA 1W72A 3QR2A 4HLZG 4ZXBA 4U2ZA 5F1OB 5E7FA 1WEJL 4LLYB 2HKFL 2J6EA 2ZCLL 4DKFH 1Y6MR 4NQCA 2F53B 2EDLA 2Z8RA 5DD0H 4JO3L 2AV1A 4QRRD 3WFDH 5K9OA 3QDGD 1UKTA 2BNQA 4M7KL 2CLVA 1B0WA 3VD3A 1A3LH 5INCB 2GIYA 3FMGL 3RKDD 5I6XB 2K7QA 5D7LD 2MCPL 4OCNC 2PYEA 1NFDE 1AO7A 2KQMA 3PGDB 5TE6L 3MR9B 4L8SB 1DFBH 5IP4A 4I48B 1ZV5A 5D71L 1QFOA 2BSSB 3S5LA 1F58L 1HNGA 3BHBB 3OKEB 1A6ZA 2MPAH 4OM0H 3S96B 5HJ3B 3BEVB 4M1CC 1ZVYA 3MNVB 3MV9A 4JFPA 1ZLUH 3E3QE 3ZE1F 1SM3L 2DRUA 2A6JA 4KK8D 3RVUC 2EKSA 4GW1A 1NMCC 4S2SB 4I2XB 3G6AA 1QVOA 4NN6C 3VGBA 5EWIH 1G7IA 3MLXL 3BPLC 1KLGB 3WLBA 1U36A 4M3KB 5IWLA 4YPGB 4NBYB 4RISL 2RAMA 3SE3C 4YX2L 4Y4HB 3QFJD 3AM8C 3LQAC 3IJHA 2N56A 1Y18B 4P5TC 5EUKA 5GS0H 5GGVH 3QEUA 5GS0L 2HWZH 4XCFH 1NGYB 4HWBL 1K2DA 3K1DA 3K4AA 5GXBB 1LEGB 4LSPH 1UEMA 1CL7L 1RD6A 3EUUA 5DDHB 1DE4A 3A6OA 5EA0H 5I18H 5C7XL 1ED3B 1KCVH 2DQGH 1KN4L 4NZTH 2RBLA 3CFDA 2E6PA 3ARDC 4QHMA 5C7XH 5FA4A 2H9GB 3BWUC 1Z6JT 4ZQKA 4Z7OF 1DBJH 4U0QB 2E5EA 3WUWG 4PRNB 1F6FB 2DS4A 1S9WB 4JFFD 5C0FA 3GIVB 5F7DA 4OCWH 5SWSD 1NSNH 2JK5B 4XP5H 4K71B 1TDQA 1WFNA 2XQYK 5DI8A 2ZKHL 2WWKT 1T03L 25C8H 1CGUA 1WEJH 1HI6A 2DQIH 2C4FU 4LU5L 3BMWA 4WW1B 2DQIL 3VG9C 4F9PA 5IMOB 2FH8A 3BIAX 2X4TB 5HYSG 3SGJC 1E28B 3OAZK 1YC8A 2DQEH 3MACL 2WIIB 3TBSB 3QISA 3MACH 3HTLX 4G8EA 2HVJB 1ZAGA 4MX7B 1KSRA 5ENWB 4YK4C 3PNWB 4HPYH 1RZ8A 4X9IA 1CDGA 1MHCA 4OCXL 4ODWA 4GG6B 5C6TH 1LHZA 5F1SA 4H26A 1D5MA 4UUJA 2EXWC 2HFGH 5MEQA 3D0VB 3AMKA 3CD4A 4N1EA 1YEGL 2VR5A 4PJAE 4E41A 4YE4H 4PGBA 4XBEH 5TGBA 1FFPB 1C5BH 3ECBA 4N9GB 4QGTA 1II4E 4KHTH 1WCQA 3H3KA 1X44A 5CINL 5CLTA 1TFHA 5IIEA 4U1KB 3GMRA 2J12B 4N90D 1UXWA 4YQXL 4X9BA 4YFLF 2A0LC 4TVPL 1AXIB 4HKZB 4AIXA 2YMXL 4GT7A 3WLWD 5FAAA 3MA7B 4JHWH 4LMQI 2OL3L 1ADQH 4YUEH 4HXBH 1KB9J 5FUCE 4YAQB 4MA7H 1KFAH 4HUVA 3MCG1 4OGYL 4TVPD 4JZOB 3BW9A 3NOIA 5T3ZD 3X11B 3QXTA 1NLBH 4D0CA 4OV6F 1ES0B 1DQDH 1KTDA 5IR1A 1KCSL 4PR5A 3DV4B 1HH9B 1Y0LB 4G6ML 5CEZE 4AQOA 3ARGC 2AQ3A 1CU4H 5HYJB 5HYJD 3ULUE 5J12C 4UDTB 3BKYH 3WFHA 1UWGH 2J88L 1JRHH 2YR3A 2YBRA 5HDQL 4TSBL 3LD8C 4WFGD 4K7FB 4UNTA 4QTIL 2HFFB 3CDGA 3MRHA 2V2WB 2QLVB 1R5VA 2VLKE 3MRPB 5EZLA 4X7FC 4IRSB 4NQSA 4Y19E 5EU6D 1FNGB 5MP6L 1H3XA 4XAKD 4N0RA 5C3LD 2PCPB 4QRRA 1A1NA 2BOCA 2NXYD 4P2OD 5LAXA 1I9IL 5LXGL 1O7VA 2YPLE 4R8WL 1BJ1H 3VGEA 1OY3B 1YQVH 1SJEB 3N06B 3GJFB 1NEZA 1EBAA 3KJ6L 3DMMC 1WIPA 5CJQH 4WGVB 1CGSL 5IBTH 4JFEA 3A67L 1IC1A 1N2RA 1HHHA 4MLSA 5EO1B 4P48A 1UH4A 1FIGH 2EIZA 3BVNB 4P3CL 4WUUA 5IW6B 4IDJH 1FIGL 4DOHB 1J12A 2P44B 1GGIH 4JRYA 3ZKMC 2UVFA 2DQUL 3BKYL 3VWJA 4OM1L 3REVB 5CEZH 1A02N 3X13B 1N26A 5TPWH 2PNDA 1IZJA 1CLYH 5DLML 1ZS8B 3OAUH 5IEHA 3MXVH 3EHBD 3KLSA 5I71B 1JPFA 3JV4A 4OT1H 4XMPH 1WFUA 5CSBA 1HI6B 1Q72L 5A16A 5ANMB 5D7KD 4I3GA 3DX7B 4KUCD 3ARTA 2VC2H 1T2QH 3VXQB 3Q6FA 2HA1A 4HH8A 2CUIA 5CJXA 3MRNA 1JNHB 3WDIA 2H45A 3PGDA 3VDBA 1F4WH 3U0TA 2I24N 1CFQB 4V2CB 2XN9B 1M6OA 2RHEA 3RAJH 1CLZL 3S6CA 4OZGB 5CUSL 2DQCH 4FQLH 3MOAL 4LLMB 4NYLA 3WBDA 4NKMA 1AGBB 2ZZUT 4EUPA 5D8JH 2K1MA 1R5IB 1IAIL 2NW3A 3ME0A 4L4VD 4HUXB 3INUL 2ERJC 3FN0H 4G9FE 2CKBB 4BKLA 3JWNC 4PV9B 2YD7A 1NCAH 4DGVL 3CK0L 5DJZA 5FHAL 3UAJC 3MGTB 4DOHE 2VLKB 5BS0D 1TCMA 5TE7L 1UM4L 2FYYB 3IJHB 3LH2H 2PXYA 4IS6A 2R2EA 2VLRE 1L7IL 3QNYB 3CH1B 1GXEA 43CAA 1N0LA 3F12A 2NY2D 5MERB 3GJEB 1RK1A 1I3VA 1ZHLB 1MCKA 5FV2A 3H7LA 3P4MB 1OHQA 4OUUB 5CGMA 1OQXA 2VDKH 3RIAK 4H88H 5DJCB 2A6DB 4DEPC 1LO0L 2DIAA 4TRPL 3QO0A 5MENB 1PSKL 4M7LH 5EC1A 4P23C 3RTQC 4XX1E 3TZVB 1XIWD 3OGCA 3LEYH 3AC0A 4PRPB 4E41E 1LDPL 4OD3H 3KDMB 3INUH 4PRAB 2W0LA 1S7VB 3P0VH 4XAKE 4XB8A 5F1NB 4Q0XL 1QSVA 5A2JH 4GKZA 3NIFF 4LSTH 5BRZA 5CP3A 3KLHD 3BGMB 3MV8B 3WO4C 3QUMB 4JPWL 3TVMA 3MV7E 4X9HA 4HKXA 2IG2L 5DRNB 4M7JL 1OAZL 2XACC 1GC1C 4X80H 1U41A 3OPZH 4XCEB 3S35H 1K3IA 5EU4B 3T8XB 3KNBA 3WKMH 4QYOB 5DJ2A 3FRUA 1C5CH 5IF0B 4M43H 2EEAA 2AABL 4JG1L 4J3OC 3BDBA 5HI4D 3MA9H 5I1EL 5IMOA 5DJ6B 3PWPD 2NY1B 5DC4B 5HYQB 2N7AA 5D2LF 4X7SH 5BW7A 2X4TA 1S9YA 3NFPA 2IFFH 1Z9LA 3HI6H 1OTSD 3FT3B 3V6ZB 3GKZA 2APXA 4RDQG 3RPKA 5C0DB 5AUMB 1U8PB 5FM8A 4KVCH 3ZKSD 1NBVH 1O7SA 5D8JL 1TCRA 3RZCA 3VFRB 1U9KA 2I5YL 3BEVA 4JZJB 4G8GE 4Y5XB 4LHQB 5SX4I 5CIPA 4ONGL 2N1KA 1KIQB 4PJ5E 2EKSB 3LHPL 1I8IB 4Y5VB 3OJDB 4N90E 1IQWH 3U2SA 1AFVH 3WCYA 2P47B 1I1AA 1BQLH 4CADA 2R9HD 3LOWA 5D93B 4R6UA 2E9IA 2P8MA 4QGYA 5B38A 2FIRT 3STBA 4ZXBC 1I4FA 1FYTA 3DTXA 1QEWA 4XBGA 5JUEL 1I8LC 3W9DA 3TCLA 3V4UH 5C0IA 1QNZH 2WUBL 2OSLB 5D7IE 3E0GA 1KIUA 3H9SA 1L6XA 3CLEL 4XPBH 4LLMA 4LLVA 2YC1A 5T3XL 1GPOH 3U0PA 4JHZA 5A2LH 4OZIF 3UPCA 3TFKD 4GS7C 1NBVL 4LVOC 3UYRL 2E6JA 1IGTB 4K8RD 4LDLB 2VMFA 3WXVL 5M94B 5KOMC 3KPRD 4QXTA 4OLUL 3OKMB 2MQCA 1RUAL 2QSTA 3DX8B 1E4XL 4LASH 2KBGA 2ORBL 4LFHD 4ZPTA 5HI5C 5JW4M 1A6ZB 4U33A 5SWSB 5C0EB 2PW1A 1E6OH 1S8DB 2YBRB 3O4LD 5EU3B 2R2EB 3SGDH 1OF2B 1IT9H 3VH8A 1NSNL 1U8QA 4LLAA 1IC5L 2PTVA 3PQYE 3QULB 2ZSVB 1NCCL 1P69B 4KUZL 2G60H 1J0JA 4EDXB 1TVHB 1ZGLB 3ULSB 2CXKA 3MRKB 1R3JA 2HRPL 1KXQE 1PG7H 1MI5B 2XOTA 4UDUA 3ARFD 5DTFB 1P5UA 1T1ZB 4HX1B 4KGJA 4P59L 3SE8H 1MUJA 1DBBH 4NUJA 4FZEL 4HXAH 2FEEI 1YEIH 2P8PB 4FFWD 3DUSA 1CD0A 4I0PA 5KAQF 3O2WH 5HDBE 4APQD 1K2DB 4JR9H 1JWMA 4CVWA 1DBKH 2CR6A 5B3NA 3IETA 4DQOL 1G7LB 3QUZC 5DS8B 3QQ3B 4ELMB 1DE4B 3AS0A 3O8XA 4P2RB 4U1GC 1EIBA 2HJLA 4S1DC 1HH6B 3UZVB 1J0ZA 2PYEE 3LN5B 5TGBB 2FX8H 1JZ6A 5EIIB 5ICXB 2VZ1A 4FFWC 2HT4C 5JHLH 1B6DA 2XXCB 2Y9RT 4BA8A 4JY5H 3CNKA 3I02B 4Z78B 3IKCA 5FHBL 1M05A 1FO0B 4YR6B 1QG3A 1P4BL 1PVHA 3Q6FB 1GZQA 1R3HB 4XX1G 3GGWA 2D0HA 3H3PH 4Y4KA 1VFMA 2EXYD 4XHJD 5BS0A 3OF6D 4IOSD 3GUTA 3PABA 1J7VR 2YK1H 3IU4L 1QLRB 2R1XB 2YD8A 3HMWH 5JOPE 3G04B 3EYQD 1J8HD 1QO3A 4EEEA 4K23H 3L3IA 3VXRE 1AGCB 2GY5A 3ALXA 3VXTA 5C8JA 4PPTA 2Z91A 4PP1D 2PO6C 3WE6A 3B5GA 3ULVD 5IM7B 4X6DB 1J8HE 3VU2A 5ACMA 3QDGE 4FQIL 3OX8B 3HI5H 4HUVB 1F6AB 4XZUA 4FQIH 3QEHA 1DQLL 4OIIH 1E4WL 5C6PB 2DKSA 4FQ1L 5SV4A 4HWNA 5L0QC 1IGCH 3T0VA 5L88H 2WSKA 2XTJB 5GJTL 3BRFA 1GH7A 1FZJB 1YJDL 4NQXA 2HLAA 4DZBA 4S1RL 1PG7X 2AQ2A 1H3PL 1W8OA 2R4RH 4OI8A 3VFPB 2X9WA 2X9YA 1LK3L 3BYTA 3KYAA 4XXCC 3WJLC 4UZGA 1MH5B 3LS4L 4MSWA 3ALPA 5HHOD 2CUHA 3VGAC 2PETA 2UUDH 3EKCA 5CZVL 5FGRA 2AXFB 3GIZL 3GJEA 1GGCH 2HFFA 3CDGB 4PJEA 1OW0A 2XI9A 1SBSH 2I60H 3QI9B 4XPAL 4Z0XA 1G7IB 1OARH 4XPTH 4CN1A 4M02A 5I75C 1OARL 4XPTL 4J7RA 5FO7A 4Z76B 3DGCR 4M93B 3LZFH 2FIKB 5KSUA 2AJ3A 3MRIA 4PRPA 2R1WA 3JWOH 3HE6B 1JPSH 4ONFL 4LCIL 4G8FB 4OV5B 4GUPB 1OAYH 5AEAA 4EN3D 4JZOA 1M1SA 3I3EA 1SEBA 4JFED 5IVXF 4NQED 4LHUG 4ELKB 3QQ9C 5HBBA 1QLFB 4FZ8H 4XPFL 3T0WA 2YD3A 3OBAA 1ORQB 3AFLA 3U0WL 4JN1H 5D5MF 1GAFH 1XGPB 2NXYB 3QUMH 5E9DE 3U46A 3MV8D 5TPWL 2A77L 4UU9A 3T1WA 4GAJL 5E8PB 4Y7MA 4QYOA 5DJ2B 4ZUVA 4OT1L 4F7MB 2VN7A 4CN6A 5CMAB 4RMWA 1RK0B 2VDQH 1FORL 3P73B 4O4YH 5EULV 4YHLH 1JWUA 5JR1H 4QTIH 2GJ6B 1GZPB 4IOFD 3FB7B 3ARYA 4H1LA 4HF5L 1D6EB 1XT5A 4R4FL 4NUJB 3QPQD 3EO0A 5F7KC 1BGXH 3D5OF 2FWOA 1MFCH 3MRPA 3O4LB 4NZUL 5EZLB 3DUSB 5A16B 2UWEA 4ODHL 3K4ZA 3GMQB 5ILTL 2JLLA 1EEQA 1WBZB 1GC1L 1MVUA 3SQOH 4MVBD 2DQFB 4O2EA 5C71A 5FCSH 1EUTA 3FFCD 4LVHB 5DT1H 1O5DT 3N1GC 3S4SA 3U0TB 1JMZA 4H5SB 1MWAH 5ESVB 1QSFA 3D9AH 2YUZA 3RPIB 3WFCH 1JBJA 3IKCB 2J8UE 3MFGB 1CDBA 4PRPE 4WU7B 5CJOH 3X12A 4JB9H 4WHYG 5JW4N 1JRHL 4OF8A 1WT5C 3SDYH 4ACPA 3MJGX 3DRTA 3ZTJG 3BKJH 4PFEA 4U7KA 3D87B 1HKLH 5ESQA 3ZKNC 3UP1A 3MNVA 1JF5A 2CDGA 7FABL 2JKXA 3UZEA 1V05A 4C54A 5EB9A 2XWBB 5DMJB 3O4OC 1UM5L 1OGAA 2FJFB 3MA7A 1ZA3B 3WS3A 1EO7A 2APVA 3GZKA 4KROB 5T3XD 3UYOD 3DRQB 1J11A 2OSLA 4WUKH 5T5FH 1HILA 1G9EA 2LTQB 3ULUD 4NNXB 4CL7A 3KWWA 2J8UA 4ZAKA 3NH7L 4U0RB 3JV6A 4HS6A 2X1OA 2X4SB 1NBYB 3DUHA 3MCKB 4LPXA 1OLLA 4YBQD 1YEHL 4OGXL 3NPZB 5TQ2L 4AEHL 5DD6A 3IDMA 1OF2A 2GEEA 1VEMA 3B9KA 4AG4H 1U8QB 4MQ7B 3TIDB 3DVNB 2ED7A 4M7LT 3HE6C 1J05A 2VE6B 4RRPA 3ARGD 1MCPL 1H8SA 4LCWE 3H7BA 3PHOA 4KJPD 4WHDA 5JIPA 5KW9H 5EU3A 1UWEL 4Z0BL 3MRLB 4IOFC 1SVCP 5I8CA 5JXAH 2R0KH 1BQLL 1YNLH 5EG6C 1P7QA 3QI9A 3QIWD 4HDIB 4KY1L 5LGJB 3HE7B 1CG9B 4X8JA 5TQ0H 2O5ZL 4HWZA 1T2QL 3PWJB 5E24E 3NBNA 2D03H 4RX4D 3HCVB 3HE6D 4H8WL 4DAGL 5KSBE 4HJJL 3OXRB 5KSUB 1JYWA 4UTAL 5LVEA 3GSVA 3NA9H 3VG0L 5F7LB 1A1NB 4XNQA 4WUKL 1S7TB 4C59B 3UDWA 2IAND 4WHTA 5H35A 1S7UB 3IFLH 1J0IA 4PRID 1Q0XH 4G7VH 4JFQA 3EJJX 4YNYA 5FXCH 2O93L 2HJFA 3ARVA 1LMKA 2FECI 3UBXG 4N0CD 3SKJH 3DROB 4KC3B 4X98B 4PJIB 4R96B 2AK1L 4CNIB 2X2YA 1OT2A 2X4PB 2OZ4H 3R8QA 1ZLSL 4GW4B 1BX2B 1FAKT 2OJZH 3WKNA 3RA7H 3SEPA 5JW4R 4D8PB 3U2SB 3JWDC 5C09D 3VI4F 4KQ4L 1ZEAH 4H26B 1S78C 4WTXA 4UAOC 1YUHA 1ZS8A 1OOAA 3FN3A 1BM3H 2FJHB 2DTMH 3WIHL 1L9NA 4TNWK 5K93A 1UB5A 2Q7YB 1L0XA 2I27N 1QLEH 4PJEE 4HT1H 2JIXB 1VPOH 4QO1A 3CFJA 2P48B 2VZSA 2Z93B 2C4XA 4I18B 1MFAL 1A7NL 1PG7L 2J1KA 3MLVH 2WQ8A 4LVNC 4LU5H 3DECA 2UY6A 1KPUA 2WAHA 4GQPH 4JGUA 4NKDA 4YZFE 4KVNL 5B8CA 4M48L 1ZSDA 4QRRE 4JM2D 4Z7WA 2UY7A 1C16A 3WNMA 2IBGA 2RJMA 4HJGB 3IFLL 5IMLB 3NFPB 1PSKH 4M7LL 4ZFFB 3LEXA 4JY6A 1QSFD 3UTZB 4HAGA 3DX9A 5AYUL 4LEXL 3UTTA 3U0PB 1AD0B 4MCYA 1EEYB 1S7QB 1XMWA 1MHPH 2FHCA 3IU3B 3BZDA 4BFIA 5AD0A 4KV5E 3GMPA 2EDHA 2ZPKH 1OTTC 2DYPB 4X6BA 3WSQL 1J5OH 3ZKND 4ONGH 3SDDB 4CRPA 4KRNA 5CHNA 1TZIB 3B9VA 3G5XA 2DQDH 4PV9A 3E2HB 1GGYA 2CIKB 2QQKL 5CD5D 5EWIL 2D7TH 4LCUB 4UV4H 3WNKA 5JXAL 2AJVL 2DMBA 2IBZX 3OJDA 3U9PL 3KPSA 5BS0E 4XRCB 3FCTB 1RY7B 1IM9A 4L3EA 5GGTH 1F42A 1FNEA 1FYTD 3GSNA 4H8WH 4NHUB 4O51B 2Y4SA 2XZQL 1XGYH 4EN3C 1FZOA 2V2WA 3QZWA 4NRYA 1SJHA 5KSAA 2H6PB 3UJIH 4YFEA 3QDJD 4RFEB 4PYGA 4UDUB 5DTFA 1E4JA 1UZ8A 2J8OA 3QWQB 5DYOA 5JLZA 1NCDH 4RMVA 4NIKB 4JO3H 3RGVC 3VXMB 1B4JH 1B4JL 3S7GA 3VW3H 3ES6B 1LE5B 1DZBA 4Y4HC 2HVKB 3EJZD 3RQ3A 1EXUA 1QSFE 1NEUA 3HPLB 1HH6A 5H94B 4MQ7A 1JF1B 3TIDA 3L7EB 3VFGL 5EBGA 2X1WL 3HRZA 1W72H 4I5BB 1WZ1H 3ARWA 4Z7UF 5JO5A 3KR3L 5MEND 1IGCL 2KKQA 1N3NB 3QG6B 2VYRE 3U48A 3E2HC 4TUKH 3HLAB 4FTVE 1I1FA 1CG9A 4X8JB 1N64H 4ZOAA 5BZWB 3OZ9L 1DDHA 1RAMA 1A2YA 4EBQH 5GS1A 4QWWC 1WLHA 4PJFE 3GMOB 2DLEA 1U42A 2RCSH 1T7WA 4ZXBB 2G60L 4QT5B 5I1CH 3KPRB 1O0VA 4Y16C 1T03H 3RKDC 5BOPA 2B4CH 4JHBA 4Q2ZB 5HHMB 5DJXA 1DSFH 3MFFB 4TVPE 1JNLH 2XQBL 2PO6D 5I76A 4B53A 2FO1A 1T1YB 4HWBH 4LQ1A 4YDJA 3FRUB 2OM5A 2Q8BH 2BP3A 3NCEB 4Y5XC 4P46B 3HNTH 3PWUB 4KMLB 1SVZA 4KK8C 1OAYL 5IG7A 1MELA 3I6GB 2AQ1A 2XZCH 3A67H 3KPPB 3VWJC 2X5PA 1QFUH 3VI3E 2XTJD 3EGSA 4NWTH 5ID0A 3QUXC 3VDAA 2V9RA 4NOFA 2DLFL 3BYYA 1AC6A 2VISB 1I7ZA 4PRBB 3DARA 4NFCA 5FK9A 1QRND 2P8LB 1MFNA 3AUVA 2CDEB 5TFSH 5BVJA 5CIPB 1RJYA 1WJ3A 2C9AA 2E6QA 1RZKH 3OKDB 1U3HD 3MGTA 1H3GA 1R3HA 5IGXH 1C12A 3NFSL 4LKXB 5EO0B 5JW3L 4M8VA 3T65B 5JW3H 4P59H 2V7HB 4HSQA 3SE8L 4GRMA 1U8KA 4WRLA 1QOKA 2Q86B 1OGTA 2NY6D 4HXBL 4FZEH 4HXAL 4MWFB 5E8OB 5JMRA 1N4XL 4PJFA 1INEL 1LILA 3M8OL 1YZZA 3QXAA 5T3ZE 3MCKA 5IBLC 4ZPVA 2M1KA 1ITCA 3UPRA 1FC2D 5HYFA 3HE7C 4OGAC 4MJ5B 4M5ZH 1KGCD 2AJYL 4IDJL 3TZVA 4P23B 2X4RB 4OAWA 5I1GH 1YEGH 3TA3B 1CFTA 4Z7NF 5A2IH 3EDFA 2NR6C 1S5IH 1R0AH 2YSSA 4PJGF 2MSPA 3F7QA 5DWUL 3DIFB 3DVIA 3LQZA 5FYKL 1X5GA 3OKOA 2Y23A 4UINH 1LK3H 4R9HA 1GGBH 5HPMB 1N6QH 1BIHA 4GKOA 4YQXH 1A7OL 1TVHA 5CILH 1EO5A 4HIHB 1NLDH 3BESR 1OD9A 43C9A 3O9WD 4B5EA 4JO4H 3DNKA 3RX8A 3TO2A 3VFMA 5DGQA 3CCHB 1IAIM 1XF2B 3S37H 2JJTC 1IC7H 4MQXC 3JTSA 2OXHA 1S9VA 5HDOA 1YNTA 2B8OT 2YEZB 4GO6B 1VFUA 1VFOA 4KK5C 3U9UB 1RVFH 4U1IA 1UCBL 3KPNA 1UJTA 4O5LL 1YNKH 5DS8A 3GM8A 5JOEA 2BJML 5GISL 1UADC 1IGIL 1PW3A 3O4OB 1MCEA 5D2NA 5T3ZH 1LP9A 4GJTB 3O11A 2JELL 2XN9E 1UB5B 2UZXB 1A3RL 1FNFA 3VD5A 2VDPL 3L3OA 1MFBL 4HIJB 3AREC 2YN3A 2YD4A 5DVMA 3BAEH 3QEQB 3LPFA 5IIEB 3QFJB 1A9BB 4NNYA 1PKQE 4OCMC 3SGJA 5GQBA 5SWSE 3W39A 4XP6L 3TBTB 4TSCH 2G9HA 2VKXA 1CYGA 1W0WB 2CRYA 3P73A 3RL1B 2HAZA 1ZOXA 5TDPB 3MC0A 3W11D 1KBGL 1KELH 1IGYA 1OLZA 3GUTB 2DBLL 4LVHC 1C16B 3EDDA 1RUPL 1TZHB 5SWZA 2OMNA 4ZFFA 4MS8D 1H0DA 2A83A 1AGEA 5I71C 1LO4H 4DK3A 3O81A 1EGJH 1INEH 2YA0A 3MMEB 3OR6B 2IALB 1P84J 3V4PH 3KPPA 5HGGS 5IR1B 3MJ9L 2J5LB 1Q0XL 3T77B 2CRMA 2BVPA 2EDOA 3CSBA 4WWID 2PXYD 4S1SH 5FGBA 3IFNL 4LP5A 5GRWA 3P9LB 2X9XA 3VGFA 4I2XA 3TV3H 1FSKC 4YHNA 4BQ6A 1A1OA 2J6EL 3H7BB 2ADFL 1F3JA 3RPIA 1R0AL 3F58L 4LVEA 4J3WA 3IDMB 1FGNH 1LK2B 5JOFB 1LNUA 5T1MB 3HKFA 4PJXF 3RVTD 4LCUA 4QHUB 4EI5B 3T0EA 3JXAA 3EYFB 3RGVA 3Q2CA 3VE0A 2VQ1A 3BGAA 2VXTL 1UWXH 1KJVA 4L3CA 1KELL 4L8BB 4EJ1C 4RMRA 2WLYA 3MV01 3IKKA 5JDSA 3T09A 4YWGH 2ICWA 4YHPA 4JO2L 5C0ND 3QEUB 3CIQA 3PGFH 5DVOA 2NQCA 1REIA 5GS2H 1U93A 2BXZA 2VH5L 4NHCL 3UTTE 5DRXB 4IMKA 4NT6B 1B9ZA 5HYEA 1P4LA 1N3NA 1CLZH 3CFKB 1UH2A 2MMXA 4Y4FA 4HMCA 5DJDA 2VL4A 1P7QD 3D0LA 5IW6A 2H2SC 3MJ7B 5B3JE 3U4EB 4YDLC 5D1ZA 5FOBA 4OFPA 5DFWH 4YO0A 5ESAB 3HG1D 4YHOL 3SKOB 3P40A 3QXDA 2MPAL 4OM0L 2GK0B 4DKAA 4HMDA 1KPVA 1DUZA 1CGVA 3O3EA 3VXSE 3GIVA 1RULH 2EDNA 2HFEA 4F2MB 5DXWA 3MFFA 3LH2L 3QJHB 3MQIA 1NCWH 2Z9TA 4AMKL 4O2CB 1OP3K 4C56D 4PJ9C 5C9KA 4EUPH 3CU7A 4F58L 3TIEA 2VZVA 4Y4KB 3V6OA 2UWEB 5AZEL 1WFOA 2ED8A 3U7YH 1BD2A 1Y6NR 3QIBB 1S7SB 4X6FA 1A7QH 3I6LE 4H1LB 1YPZE 3O41A 1S7RA 15C8H 5ITFB 3BN3B 4BSJA 4H25A 2R69L 2V5SA 3DX9B 4WFED 2X4QA 4A6YL 2DQJH 5DK2B 3HZYA 4M3JA 1T1WA 2PW2B 2ZG1A 4F7EA 1R5IA 2BERA 1KEMH 4JFQB 1GGUA 2YPLB 4ZUUB 3SKJL 2Y6SC 4KI1A 1CE6B 4XC3L 3OKKB 3ARBB 4AQ1B 3PHSA 3GBLA 4P46C 1FFRA 2EH8L 1S78D 3CMOH 3DI2B 3CMOL 1Z5LB 3SDAA 1WAAA 4K55A 4LMQE 1HHKA 3RUGA 4HK3J 4N5UA 4IOIA 2ZUVA 4UV4L 1HCVA 3OG6B 3G5ZB 2BXYA 4HUWB 1P1ZB 3DX7A 4JLRA 4UT9L 3V52H 4PIRF 4A6YB 1H0DB 3F7RA 4LSVL 1ZHLA 3GKWH 5L2KB 3L3JB 4JPKH 4L3EB 1FG2B 2ZJSH 1K8DA 2IQAA 1D5XA 4OLVL 5DSCB 3PHQA 2NYYC 3HMWL 2H26B 5I17B 3O3UN 5FB8A 3TEUA 1DLFH 4R4ND 1U8IB 4Y4FC 2YD2A 2HVKA 4Z7WF 2HTLD 5JZ7D 4R0LA 1NBYA 5T1KB 3VXMA 1NCBL 4ZQKB 5FYJE 1X6NA 2JTDA 1I1CA 3ARDB 4J3XA 5DK3A 3WFZA 4Y5YA 1INQA 4LHUD 1GHFH 4PB0L 3DYMA 5L88L 2J7LA 3QRGH 1T1XB 4AEIL 1MCIA 2Z35A 3BMVA 5CHNB 1QR1B 4JREC 3W2DL 4D0BA 1BOGA 3TESA 1A1MB 1U3HA 4F3FB 4AMKH 1VKXB 4KDVA 4XPGL 3CMGA 2IMNA 4ZFGH 2F8OA 4ZD3L 4LVOB 2XTJE 5GS1B 4GS7B 1TJHL 4TQEH 5DRWB 5EO9A 2B5IC 4NN6B 2VITA 4A2MA 1IKFH 4P4KA 1U2HA 4G8IA 1I9EA 1IFHH 4TUOA 5GSRB 3PNWA 5T5NG 4J23A 1HZHL 1NBZB 2W91A 1RIVL 3N9GL 5BV7H 5C07E 5JNYA 3EAKA 2Z4QB 2O61B 4FQJL 5ISZE 1RFDH 2B1HL 3GSWA 3H3BC 2OL3A 3U36B 1Z2KA 3MREB 4PB0H 5I74C 1KYOK 2PO6A 5I74B 1F00I 2CMRH 4LCYA 5J9PA 1HHIB 1S5IL 1NUFA 4KRPB 3VRJB 3P11L 1LEIA 5HYIA 2X89A 1NGWA 4TSBH 2EZ0C 1UA6L 3PXHA 2NY3B 4ZOCA 1R3LB 1AGEB 4NWUH 3TBTA 1CFBA 4K7PL 5C0AD 1IGMH 3K80A 4PGJA 4Y1AD 4OD1H 2AJZA 4OCRH 1IGML 2V7HA 2LU4A 3GMRB 3T0ED 1E27B 4MJIA 4PRDB 5I19H 4LEOB 2BVPB 3KPOB 4MXQD 3IFOA 5C0DA 4FXGB 2BNRE 3T65A 3QO1B 2B5IB 3VJ6B 3MMEA 1MJ7H 4OF5A 4ODXA 3DBXA 4JFEE 4E41D 4L9LC 3LQMA 5I15L 1KN4H 3ARFA 4NZTL 5EZIL 4P5KA 5T1LB 4DCQA 4Y4KD 4JZJA 3R0MA 2AEPL 2VZOA 4FQJH 3RTQA 4IRJB 5M95B 2EYSA 1QR4A 4CU7A 2AEQH 2IC2A 4P2QB 1KJ2B 1P84K 1WIOA 5E4EC 4WTZA 2DMCA 3FOLA 4XVSH 5CJOL 5ANME 3CFEA 1MSPA 4OIBA 1N7ML 4IEFB 4N8VB 1BBJA 3BFOA 2JJUA 3SBWA 3WN5C 2FDBP 4AY0A 2C26A 3S37X 4Q9RH 1KT2B 2G2RA 1BJ1J 1MLBB 2VLRD 4QRSA 2GITB 3MXWH 5CZVH 2DKUA 5HHQB 1QBLL 43C9B 4OD1L 2GJ6D 3F12B 5HD8C 3TZVC 3NFSH 3UTSE 4CW1B 3CSPA 1MCOH 1GGCL 3IVKB 1R5VB 1H8OA 4LLVB 4PTTB 1IM9B 4AL8L 1NDMB 4GRMB 5EIQA 1YNTB 1I1YA 3PGCB 4PGEA 4K3DL 5HI4C 1FJ1B 3V6FA 4OGYH 1EHLL 5GGRB 4I3RL 5C08A 5HY9B 3UTTD 5J6GA 5ECJE 3STLA 1KCUH 4JJ5A 5E6IB 4MA1C 2AK4D 4CAGA 1FIEA 1KEGH 3QCUH 2UWEF 4YNYB 1R24A 4P3CH 5GGSA 3HRZB 4I5BA 4PJ5A 4RWYH 8FABA 4QRPA 2DD8H 1SMOA 1BECA 1G9MH 2DD8L 1MFBH 4LHJB 3N0PB 4CVZA 4NBZB 3T3PE 2BCKB 5D2NB 4MVBC 3D3VD 1RUQL 4LQFH 1LO2L 4RSVA 1RZFL 4NO3A 2VL5A 3GMLA 4KTEL 4DTGL 3FOMB 3X13A 1QSEB 4KROC 4RBPK 2VSCA 4LSRH 3W11C 4XBPA 4CMMB 4MMXC 2QQNL 5AZ2L 2IQ9H 2EECA 3L3GA 3N1PC 3ZTNL 3HAEH 1EHAA 2IMMA 2Q7YA 3QQ4B 3EFFB 5TQ0L 2E7MA 4ODUB 4ONHA 4XP9H 4YLQT 4G8IB 1T21B 4UILL 2GFBB 4HC1A 4I9WE 4ZOEA 5E6ZA 1VFAA 3PWNA 4KKCC 2JK5A 4JO2H 4KI5E 1JWMB 4JFHE 3SKUD 3G9AB 5D1QD 5F89A 4LPVA 4X7EC 3OKKA 4NUGH 4Y4KC 4H25B 3KG5A 1HSAB 2DI9A 3P4NA 3IAPA 1F6AA 2JE8A 3PIQA 4PJ9B 3PP4H 2NY2C 3HZYB 3O0RH 3O3AB 4QRPD 5FGCB 4XB7A 2A6KB 4Y19D 5EU6E 3T0XA 3C60C 1MWAL 5FO8A 4Q9QH 4ODTL 4GAGH 2CKBA 3DLQR 5JOFA 5DR5L 4YBLC 4F7PB 5I8OH 4HS8H 4OBRA 3T0EB 4P23D 3NACH 5ACZA 2Z0BA 4L5FL 5IHBA 2CDFA 1P6FA 4M5YH 2BHUA 4HAFA 4R97B 3QB7C 1A7OH 1PEZA 1QLRA 2EDKA 3PV6A 5D2NE 2C3WA 5L7XL 4QHNA 2DQTL 4U05A 5BZDA 4AH2A 1C12B 3MLTB 1JHLH 4IRZL 1JZ3A 1ZKAA 1MY7A 3P4MA 5J1AA 3UZQA 3O2VL 4CU6A 2XZAL 5DJCA 2A83B 2O26U 4X4MA 5TDNA 1NCTA 3HI6L 2NXYC 2XXMB 2XWJA 2ATPA 3N85H 4G8GB 1U93B 1ZT1A 4NOBA 2FGWH 4MB5A 4A6YH 4NC0B 4TULL 2OI9C 5DVLA 1HXYB 1CICD 1BVLA 3NTCH 1AQKL 5HPOA 4CVXB 1RZ7H 4EI5C 1RJLB 3MSPA 1F58H 2FHFA 5KVEL 3FN0L 3LD8B 2F5BH 4Q74A 3GM0A 1G7MA 1OAXL 3NIFE 1BJ8A 1J1OL 1JWSA 4P9HH 5EUOA 4RWHA 5BXFB 4GLRH 5J12B 5HVHB 4NQCE 1A1MA 4UDTA 5HHVH 2XFXA 4HZLA 1PKQA 1UT9A 4FQ2H 5D7IB 5E4IA 4F2MA 1ZE3C 3L1OL 1HSBB 1NFDF 3MRKA 4KKCD 1XAUA 4OZFG 3D1MC 3QNXB 1RUPH 3ORJA 5I1KH 1IJ9A 3H9SE 1S7SA 1PAMA 1XGTB 1XCQB 1BBDH 5DD1H 4HCRL 3G6JB 4YBLB 4OQTL 3FFCE 4MZ3A 4MCZB 4M6MH 1F97A 3MLWL 4POUB 2AGJL 3G5VB 3H9ZA 1FLRL 1KB5L 4TNVK 1WBXA 1F3DH 1NDGB 3IFNH 1NGZA 3T1FA 5KOVC 1NC2A 2MQ3A 4DKEL 1I8IA 4XC1L 5L8KB 2E7LA 4ZOBA 1ZMYA 1NUNB 3LCYA 3TNMB 5JQ6L 1E4XH 3TNNA 2DQDL 3W5NA 2NY3D 4HKBA 1WBYB 1AFVL 1M05B 3NIGF 2ARJA 5EORL 4QF1B 3UJJH 3EO0B 3MRJA 4HIJA 5C0AA 3EOTH 4OZFH 3VXUB 4UQ2B 4EIGB 5E2WH 3PDOA 2YS4A 4JFOB 2GSIA 2VDOH 1MJ8L 4TTDD 3RU8H 3HPJB 1T0MA 4PRDA 1CBVH 4MNHB 4HPOL 3HR5B 5CJ5A 1TITA 1CFVH 2E8ZA 1MVFA 2DWEB 4ORGA 3MRNB 4GMTL 3Q1SL 4KHXH 1Z9MA 5GZOD 3TCLB 5ICYA 4P3DB 4RNRA 3IXTB 4OZ4A 2P45B 4X6FB 3KXFB 3NIDE 3NAAL 2F74A 4RAUB 3WLWC 4U1MB 3RRQA 1NGPL 4QXTB 3MROA 4NPYB 1OWWA 4QTHA 5FIEA 3LKRA 4P2QA 3NFNB 4X4XB 1MCQA 3GRWA 5FA3B 1J1XL 4XNXH 5DK0B 2ORBH 3HG1B 4HUKB 3PL6B 5KN5A 2CRZA 4QXGH 1EFXD 3QUZD 3MRQA 3I85A 4WO4B 2ZSVA 2NTFA 1X9QA 3OXSB 3W0WB 3RUGF 3SCMC 5FYLD 5MHSE 1T3FA 4JLRB 4PLJC 5ID1A 2HH0H 4R7DB 1BOGB 2W0PA 3FO9A 4L8BA 4ZDHA 4ORZC 3ULVH 1AC0A 3WN5B 3VI3F 3C08H 1D5ZB 4YDKL 1Z0MA 5MEOB 2ZJSL 4OTXL 4FQCH 3FT4A 4F37K 3O45A 4PTTA 1XF4B 4PJAF 1AIFA 4RGND 3DXAA 5C0CE 5SWZE 2O5YH 2HWZL 3SJVD 1T89A 5GRUH 5IB5B 3LMJH 2CK2A 3DX6A 4P5TB 3WFDL 2JCCE 1KB5H 3K7UA 5KVFH 4QRUA 4NT6A 5IROC 4WI7A 3VXMD 1IEBB 1NKOA 5AYUH 1GIGH 4ZSOB 2BNUA 2YEZA 5JOPD 1UC6A 3KJ4B 4JPIB 1R24B 1ZK9A 3CSGA 4L3ED 1QLFA 3CVHA 1T4KB 4AENB 3VFSB 1EV2E 1UZ6E 2W65B 4MJ6A 3FQNA 1F4HA 3IF1A 2P7TB 4BZYA 2IAMD 3ULUL 4QXGL 1KLUB 2R23A 1P4BH 3S98A 4PRHA 3FO0H 5C9JB 5E2UH 1OTUC 4HUUB 2V5RA 2EO9A 3QI9D 3QIWA 4U1JA 2X41A 3RVVD 4MD0B 1LO3H 5KG9B 5F89B 3HFML 2A9NH 3QHTC 4M9PA 1LVEA 2VQUA 3FN9A 3MODL 4HKXB 1OP5K 2NY0B 4L9LA 3ZDZF 1MCNA 1EFXA 3CXDH 2W9DH 3LZFL 2IADA 4Z7UA 1OAKH 2FX7H 5ESVA 1E4KA 5K59F 2Y06H 5EZOL 2XNAB 5CWSB 5I1JL 4FQQB 1J0HA 5GRVL 5CEXB 5JXEA 5AUMA 3WO3B 3GSRA 3QIBD 3HNVH 2AJXL 3D85A 1XGRB 3TFKC 3RIFK 3ROOA 2BHYA 2R2CA 1RJZB 2VXQH 2X4QB 4NNPH 4ZO9A 2FJHA 3A6CH 1M7DB 3LKNB 3NCCB 1A9EA 4NP4H 1CDCA 4UT7L 4S1RH 2ARJB 5TE4L 2A74A 5J0BA 1JI2A 1JN6A 3B4NA 1IT9L 3T4YA 5DLMH 4LSUH 2Y1VA 3OTTA 3O4LE 3DMMA 4KJPC 1XGUA 3TGXA 3TWCL 4FQHA 1N8ZB 3EW3B 2ZCKL 1JNJA 3BKMH 3OV6A 1W0YT 4AZ8A 1HWHB 1SHMA 4NQEB 3RKPA 5IJVA 1FFNA 4NQDA 3R06A 1MCOL 5TF1L 5L2KA 1ZWIB 3C6SA 3RGVB 4MNGB 1YN7A 2GITA 3SQBA 4XVJH 4Q97A 2W38A 2F53E 3D18B 4HJGA 1OSPH 4GRWH 4PB9H 3WO4B 5JPNA 3FT2B 2BVQB 4POYA 3KS0H 5I30H 7CGTA 1JGUH 2VXSH 1DUYB 1D9KA 5T1KA 1QA9B 4BSWA 2X42A 1BQHA 5DT1L 3B5TA 3MRGB 3W0WD 2YC1B 4WO4D 4Y4FB 5IROA 3RTQB 5CZXD 5KN5B 4QNPF 4EDWL 3REWA 4PJDB 4XMLH 2EEBA 1JPTH 3UTQB 4WWKD 3SKMB 3V8OA 4DEPB 3K46A 2JF1A 1G9NH 2DLFH 35C8L 2NY0D 1FAIH 3HS0B 5FDYA 2EH7L 1F5WA 2EE6A 3FO2B 3EDJA 2WINA 2XV6B 3GMMA 2OMBA 1JGLH 5HHXL 5IHZA 2ICCA 2AERT 1TVBA 1UXSB 1GSMA 4XP6H 1YEFL 2X1QA 3QEQE 1NMAH 4KKNA 2APFA 1MCSA 2BVTA 4Z7VA 1F90H 4J3UA 5EBWB 4HUMB 4FXKB 1S9XA 2H1PH 4YEFA 1OM3H 3TLRA 4PJIF 1KXVC 3LS5H 1NKRA 4LPCA 3WDJA 3QULA 3NZ8B 1U6AL 4XNQB 4ZAKD 2AXHA 4LVNB 3JSSA 2C3GA 4NUGL 4TUOB 1R3JB 1KB9K 1NDMA 5H35B 4ZSOA 1JGUL 1J86A 5A40E 2H3NB 4HIEA 3EIFA 2GI7A 3KPLB 5HHPB 3PQYB 1U8JB 5DJYA 1CFSA 1U58B 3X12B 3SE4A 3ULUC 4BFEA 2VLLA 5GJTH 4UAOB 3NABH 1BEYH 1RHHA 1QSFB 2Z31A 1NANH 4E5XA 2VB5A 3K1KC 5CBEA 2WBKA 2Y25A 2AJUL 3CVIL 5BV7C 1CGTA 4MNQD 1Z3GH 3B83A 2QEJA 5GGTA 3C5ZD 4PBXA 5I16B 4KGLA 1LP9F 3F8UB 4G6FB 4HUWA 1ORSB 1JHTA 4X6EA 4Z7WB 3D39D 3QXUA 2JJWA 3BRDA 4HJJH 2ZOLB 3TO4B 4JO4L 2OK0H 2BNQB 2ID5A 4LEOA 4NNXA 3O8XC 3TC9A 5EOCL 3BJLA 4GBXA 1Z9SA 5FYKE 5LXGH 2MKLC 4LPUA 5DD1L 5I30L 1DANU 4JRYE 3GDBA 4JEGB 4NO0D 1ZT4A 3I6GA 3FKUS 4EKXA 1C7SA 4ZPVB 4JCMA 4YDLB 1QO3B 4JY6B 3ROOB 1NGXB 3QP3A 2BFVH 2CJUH 4I0PC 4ZS6D 1KEGL 2GJJA 2ATPB 4FQXC 3RWDA 2BDNL 5HHOE 1U92A 3IJYB 4PJAB 4KI5D 5DEFB 4B7IA 3QEGH 1BOYA 3SDXF 5LGKA 2HP4A 2FGZA 3Q3GA 4U6VL 5I8CB 3K3QA 1NC4D 1SYVB 2VWEC 4R7DA 2NY4B 3NACL 4G43B 5E2TH 4P2YA 2XKNA 1OPGH 3UTPD 4N5ED 5KSAB 4J12A 2VLJA 2IBZY 1HDMA 2EEDA 4HFUL 5KSAC 4O51A 4QHLA 4YHKL 1PG7W 1JHKH 5D7IA 1UQSA 1NC4A 1MAML 1S7TA 3BOVA 4FHBD 5L9DH 2V2TB 4GXUN 3VA6A 3VXSA 2LTQC 1NMBH 5EUKB 2RFXA 2XQYG 3V8CA 5DD3L 3TJHC 1A22B 1JFQL 5HGBB 4PJEB 4C55A 5E8EB 4JPVL 3G6JA 4AENA 3BO8B 3ES6A 4JPVH 4FQXB 3B2VL 3L5WA 1WWWX 3FQNB 2BFVL 4R97C 3BXNA 1CLCA 1P2CB 3LEYL 3ZHLA 1HXYA 2QHLA 4HC1H 1JGDA 4XHQA 3T0EC 2BHZA 4CVZB 1YEDB 4U6XB 4KV5F 2FD6L 3S8WA 4B41A 3LPWA 5CP3H 4QT5A 1CGXA 5DD5H 4ZUVB 2YD9A 1T0NB 4NJAL 4C4KO 4FG6C 1YNLL 4ZUTB 4NQDE 4POZD 2NLJB 2L4OA 3QPXL 1T0MB 3C5ZA 3UROR 3VXQA 2NX5B 1AQDB 2BVUA 5ADOH 3V7AG 2HH0L 3WKML 3MCLL 4QRQA 2CKBL 4XCCH 4XCNB 4OLWL 5GGVL 3U4BH 4MD5B 3ZDYE 4Y0GA 4LAQH 1WTGT 3CX2A 4LAQL 3IDXH 4L3EE 2HVJA 5I8KH 1U3JA 1YYMH 3GMQA 1X3DA 4JG0L 2EDEA 5INDA 1CE1H 3ARDD 3H2WA 4F9LA 4QY8A 1P53A 1EX0A 2XG5A 3I3BA 4P4RB 3FQRA 4K2UH 4U3HA 1I7RB 4QHUA 1B0RB 4HKZA 5ACZB 1ULVA 4F37F 4M1DL 3R06B 3AREA 5SWQA 1I85C 4OFYA 4N0UA 4QKXB 4X6CF 3OSKA 4Y19A 1OGTB 1TZHA 5SWZB 1VGKB 2W0FB 1CXHA 4D0DB 5MEOA 5DC9B 2F8XC 3VXRA 5BJTA 3NA9L 4N0FB 4OUUA 1T3FB 4PLNC 3IRPX 2FEDC 3KYOB 3WIFA 2CO6B 4FMFA 4ZSOE 1PQZA 2FJFA 1NEZG 5HHNB 2D2OA 4M61B 2AGJH 4JKKA 4Q58C 4QHMB 5B4MC 3T3ME 3UO1H 4JR9L 2FIKA 2FJGB 2ZG3A 3L3KB 4YH6A 1GIGL 1QKZH 2P46B 3GSNH 1IAMA 1MRCL 3KDMA 2H32B 5C0GB 5TDNB 5IHUL 1HHGB 3GI9H 4HV8A 1LK2A 4R4BB 4NPYA 4FFZH 1ZT1B 1MCLA 5GZNC 3RDTB 1RU9H 3TA3A 4HFWA 4X8XA 3NZHH 4X4XA 5E4EB 4HG4J 1BPVA 3JUZA 3FB6A 1UENA 2Z92B 1QRNB 2HN7B 1G0XA 4PJ5D 4EI6B 2AJVH 4P57B 5J6HB 3IF1B 2BCKA 4MD0A 2R4SL 5C0BA 3EBAA 4X4ZA 4WTZG 1PKQB 5B39B 5F7DB 1KJMA 5GRZA 5CMAA 2I07B 1QBMH 1WFTA 3AU1A 3PHOB 3EYQC 1ZLVK 5DJ6A 4PTUA 4NO0A 3MRCB 4KMQA 1HNFA 1FV1A 1EPFA 1GVIA 3U4BL 1B3JA 1FG9C 4YPJA 4LPYA 4ELMF 5LGHL 1QBAA 1XZ0A 2FWOB 3BPCB 2R29H 2O5YL 2Y7QA 1S9KC 1DLFL 1YMMB 3HZMB 4M1CD 4PY8I 4WIQA 4WI6A 5H37G 3BZEA 3D39A 4JFZL 3JVGA 5HVFB 1NAMB 4G42B 4C56A 2HJFB 1SBBA 2DLIA 4KDTA 1KCVL 5JW5A 4DVRH 4OZHE 1ZGLP 1D5MB 1VHPA 5L6YH 3DURA 5CJXC 2HFEB 1WBXB 3JVGC 5I16A 1MLCA 3QRGL 3FJTA 3QUML 4RZCB 2RB8A 4YE4L 5IEHB 1G1CA 2EH7H 1B90A 1R3IL 1XH3A 1NL0H 3AXLB 4UIKH 5C70A 2GTWB 2OP4L 3FFDA 4L4TB 2PR4H 4I8DA 3RHWF 3MRJB 2RR3A 2L7UA 3BKML 4LCWB 1J10A 2JIXA 3HUJA 5GPRA 5E5MA 1URLA 6CGTA 4G9FB 1CTOA 5I66B 5I19L 5KG9A 5ALCL 3OKDA 1V7NL 4NGHL 1UJ3C 4WCYL 2KDGA 4G8GD 3SE4C 4XI5D 3MRRA 3GRWL 3BQUA 3C6SB 2O5XL 4GRWF 2FBOJ 4JKPL 4MA7L 1RUKL 1A4JB 4RNRB 3HPJA 1CL7H 2BSTB 1XR9B 3HAEB 5JPNB 3EZJB 2WUCH 2EC9U 4ZUUA 1KC5H 3G5YB 4JDTH 4OD2B 1MRDL 1XIWC 1DQML 2P5EA 2X10A 3CFBB 3THML 2FCBA 2JCCA 3TYGH 2AEQL 4KWUA 3EDKA 1MCRA 3AS2A 4Z9KB 4OZ4B 5JHDA 4BFIB 4JREB 3L9RB 1HIML 1DVFB 1G9MC 3DO7B 1FYHB 3DVGB 3U0WH 1T1XA 3VWKC 5HDLA 1BVLB 5F1IB 3RY6A 3EYOA 4R7NA 35C8H 2F19H 5CKGA 2WINB 3C8DA 4RMQA 4C56E 3VH8B 1JIBA 3REWB 4Q6YA 5GGSY 3U1SH 2CO7B 1N7MH 4X7DC 1TIUA 2Y5EA 4PJXE 1FL5A 1Q9LB 1U91B 1G7PB 1N59A 4OGZA 2IGFL 1MAKA 1Z3GL 3VXSB 2VLJB 1BFOA 3WUWA 1LE9B 1NMAL 1W0VA 3HZKB 1UFUA 2HTLC 1ND0B 3TBYB 4X5LA 2VNCA 3IDIA 3G6AB 1BIIB 2CIIB 3F6LA 1EVUA 5DHXB 3GBMH 5IJKA 3FT4B 4BH7B 2H6PA 1K4DB 1IAII 1OTSC 3VXPB 1OSPL 2R29L 3SDDC 1EFQA 3GJFA 4EUPG 3FO9B 3GJFK 2J8UF 3QG7L 5IVZA 2BVQA 1FZKB 1EHLH 3QDJB 2BVYA 3B9KD 3K2MC 4XAWH 3KHQA 2WWMD 2H2SD 3ULVC 2B2XH 1DQDL 3MOAH 2Y72A 3QDGA 3HI1B 2H41A 3QCUL 4Z7QE 3I75B 2AJYH 1QQDB 3VFWA 4X6DE 1I8MB 1FNSH 3DROA 2NW2A 1ERNA 1FNSL 5DRNA 1A9BA 1G9NL 1RZFH 1C5BL 4Q6IA 1SY6A 5I8OL 3Q5TA 2YUXA 1FFPA 2GHWB 4LOUD 1JUFB 5TFSL 3FO2A 3O2DL 3F7YB 3MRDA 5FYJH 3E3QC 1JL8A 4CJ1A 4YHLL 4I4WA 3MLPA 5JHDD 5CJ8A 3RDTD 1UJ3A 5C0FB 4L9DA 1CLOH 2VDNL 4APQB 4DN4H 3C9NB 4PJXB 3SO3C 3GNMH 2DL2A 1F2XK 5IFAH 1A2YB 5DK2A 1VERA 3EOBA 4X6DA 2APTA 2ZOLA 4J3VA 1E28A 1DQJB 5A43C 4J4PC 4RAVB 3VFRA 5J3HD 1JPSL 2CLRA 1RZJC 1ZLVH 4NKDB 1DTUA 2WBWB 1FVDB 4PJ8D 4WY7L 5FUOL 3TYGL 5DMGD 2AW2A 2UVEA 1KCUL 1X5KA 2VLME 3MGAA 4U6YA 5IMLA 2JB6B 4LBEB 4P46D 5GISH 5INDB 4WEBL 1CE6A 2PKDA 5FUCC 3EFDL 4U3CA 3DV4A 1UWXK 3B5HA 1X5JA 3F7VA 3FO1A 1IQDB 3GB7A 3MRBB 5I8EA 3RNKB 4Y1AE 3F65A 1KIQA 2IAMA 3PWLA 4HEME 1FGNL 5KSBF 4MA3A 2VLLB 3GSQA 3TT1H