1RUMH

Crystal structure (f) of h2o2-soaked cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at ssrl beamline 9-1.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumH01
1MRFH 4PGZA 4RX4D 1GGBL 2CRYA 3N50A 3I50L 4XNQA 1IGYA 1Y6MR 3TYGL 3VWJC 5FGCB 1TZHA 4I0PB 1KG0A 2ILLA 1RY7B 1OGAA 1YMHA 2J8UF 2BX5A 1QLFB 1VA9A 2QBWA 5IGXH 1CYGA 3ARQA 4G9FB 5TF1L 3RVXD 3NTCH 4LPUA 4OUOA 4OFIA 4HUVB 1OWRM 2J12B 3WUZA 3JWNC 2DKSA 5E4IA 4HIJA 3K4ZA 3LQAL 5GS3A 3VGAC 1FG9C 3BN9D 5FYLL 4I3SH 4IIQB 2P4AB 4JAMA 3U2SA 3O4LD 1RULL 3K7UA 3D25B 3T0VA 1UA6L 3O4OC 5LWYL 2AXFA 1OQXA 1E4XI 1NBQA 2J8UE 3LN4A 4FQ1L 4O2EB 3ARBA 4U1NB 4PRDA 3MJ6A 5H94A 3X12A 4OLVH 1J0HA 4OIIH 2EH8L 5TDNA 3EGSB 1KPVA 5F88B 4P4RA 3C09C 3BP4A 5CIPA 5CIPB 1EAPA 2M2DA 1TNMA 1NANH 1VFOA 1IT9H 4P5TC 5HHMD 5LG1A 1BECA 2C1OB 1EJOL 3MSPA 1UADC 2CIKB 1ZVHA 4O9HL 2LABA 2OL3B 3OF6D 1FRGH 2BVQB 3HMWL 1MWAH 1LEGA 4IS6A 4YAQA 4G9DA 4D3CH 2XPGB 1FAIL 3MRLB 4J4PD 4F3FA 4U05A 2HWZH 3S37H 3UTOA 4MAYB 2AGJH 1LO5B 1QG3A 5KS9F 3BI9X 4G6KL 5F9WC 4UILL 1M71B 5TE4L 4C56A 3DO7B 1CQYA 4FXKA 4Q2ZA 4YHLH 2BNRD 3HPLA 1IGTA 4I5BB 5C6TL 1VFBB 1NGXB 2H26B 5CBAA 4YBQD 3GBLA 4RBPH 5JDSA 5B39A 3QG6A 2V7NA 3QG6B 3U48A 1I7RA 1JGLL 5J13C 1I3RB 4OAWB 4NUJB 4U6YA 3U1SL 5C0RL 1MCQA 1GGBH 1A4JA 1JI1A 1LK3H 4NO0B 2EDTA 3RWJA 3VH8B 5K9OA 1YEEH 4XP5L 1TDQA 1AQDA 3WHE0 4CN6A 1I4FA 1VGEH 3P4OA 1CF8H 4EUPG 4LVHB 4AEHL 4U33A 5D7JD 3UZQA 4G8IB 3BP6B 6FABH 4H5SA 1OP5K 1PG7H 3OGOE 3EYQC 5EUOB 3RDTD 4X80L 3UEZA 4CBPA 4FTVB 3ARGC 1LO2L 4FTVA 1KEMH 2COQA 5GGUB 3LV3A 2BCKB 4TSAL 1A14H 4KXZH 3FRUA 3K74B 1JHLL 3QUZD 4X9GA 4JZOA 1B0GA 3WN5B 5GS1A 1YY9D 5K9JH 4Y4KB 1FVDB 3JXAA 2Y5TB 4Y4HD 1MNUH 5ICXA 5D1ZB 5CJBA 2V7HA 2GTZA 4L4VA 1AQKL 4P2QB 3O6KH 2DLEA 4P46A 1B4JH 2GY5A 1IBGL 5GS2D 2YZ8A 5C0AE 3MLYH 4GSDL 2DLHA 5AYUL 2X4TA 3UTQB 3KDMA 3VGHA 5IJVB 2IH1A 5DVOA 1FZJA 4XVUC 1DEEB 1IAOA 1DEEA 1IAOB 1OTTC 3D39D 4R3SB 1KJ2A 1PG7X 1S5HA 4ZUUB 4HFUH 2XQBL 5GJTL 4HH9B 1ODAA 5BXFA 5EZOL 1T2XA 4YK4C 2C5DC 4HS6A 4FFYL 4PJEB 2FCBA 4QXGL 4WTXA 5SWZE 4M9OA 1UVQA 2VLJE 2B4CL 1MJ7H 4K23L 1DN0B 1GGYA 3VH8G 3VGDA 1W8NA 4WHYG 3GSQB 4NJAH 2QKIB 4QHKJ 1QPXA 3H9SA 3G08B 4W4NA 4OB5L 5KVDL 3MR9B 4LSDA 1NC4D 1U8MB 4HKJA 4R6UA 5LKNA 1F58H 3EO9L 1JFQH 1CFTB 4WUUA 3DO3A 5JPMB 1UZ6F 1U42A 4MHHG 1OGTB 2HN7A 4J12A 2VO5A 2F5AL 3T0AA 3DI2B 1A7QL 2VLKA 2XZCL 1TQCB 4WI9A 1F00I 5D2NC 1QLRB 1L7TH 3SKJL 4XP1L 4U1HA 3RVTD 5GGVY 4XHQA 2X4QA 5IB4B 4OIIL 4WU5B 4EVNA 2GTWA 5EO9A 4O2CB 5I6XC 2YS4A 4OCLC 4F7PB 1LO0L 2VLRA 4P23B 1F13A 2VZTA 1KENL 1K8IB 4X6CF 5I73C 2FJGA 4UNUA 3RPKA 1RZ7L 3VFVA 4TUKH 5F93C 1AD9B 1BZQK 3T8XA 4XB7A 3RBGA 3H42L 1TZGH 3VFOB 4OTXL 1R0AH 4H0GA 3X3FL 3BIKA 5B21A 5DEGB 3PWJB 3DV6A 2GAZB 3ZE1E 3DMMA 1QSFA 2OP4H 4O5LH 2VLMD 3MC0A 1KYOJ 3WNOA 2K7PA 5LAXB 2YD1A 3U1SH 4CN4A 2CDFA 3ARZA 1P2CB 4YH6A 4LDOB 4M7LH 1R3JA 4KK8D 1G7JB 3RHWK 3NCCB 3EGSA 3EOAA 3CH8A 3NA4A 3RAJH 4DGYL 3OKOA 2JLLA 3TJEL 2ADFL 3LKNB 3R8QA 1E6OH 1FFOB 1IGIH 5HHOA 1FFNA 4HKXA 3HNVH 4B53A 3IVKB 1P4LB 2VDPL 4XMKH 1RK1B 4HBQA 1LNUB 3T4YA 5C09A 1MCRA 1CWVA 3VRJA 1E28B 5CSZA 1KIPB 4U1NA 1ZHNB 1J0IA 3WXWL 3QDJA 3MRQB 1PY9A 1AY1L 2HVKB 5ADPH 3KJ6L 4QTHA 3K81A 5TJWK 2WIMA 3QJHB 3WFZA 3V6OC 2CR3A 4WV1A 1KCRL 5CJQL 1M7IA 4NC1C 4RNRB 2VTFA 3WE6A 4ZQKA 5AUMB 4U1MB 4O51B 4GG6A 4R2GD 1DSFH 5CJXA 1I3RA 4OAWA 3NFPB 1A5FH 1DBBL 2AERT 3SE8H 5D70H 3F7PC 3RL1A 5E5RB 1TJGH 2HA1A 4RIRB 3SDDD 1KT2A 4IHOB 4P59L 1MIMH 1HXMA 4P2OD 4KXZI 4CVUA 3VJ6A 5TF0A 5CLTA 3RI5F 3KNBA 3KYAA 4JEGB 4TULH 3A6CH 3V0AC 1OLZA 3LQZA 4K23H 3QDMB 1AXSB 2VLRE 4HFWB 5B39B 2XN9D 4YAQB 3PGDB 4LHUB 3OZ9H 3EDFA 3GSWB 2WBWB 3AAZA 5IROA 4WO4D 5A3IC 1I3GL 4PLOB 2ZUQB 4QEGA 5F9DC 2Y06L 3SKNA 4ZD3L 4ENED 1T22A 5KN5B 1S9KC 1IFHH 3O6FB 2JKXA 4F7EA 1TMCB 4ZDHB 4JFEA 1YNLL 2PO6A 4ORZC 3UYOD 2YD7A 2AKRB 3QCTH 4JGMA 2XY2A 3JTTB 5AYUH 3WJJA 5C2BL 2IWGA 1N0XL 1BFVL 4NNXA 4GAJH 5I30H 1OAQH 2FSEA 1CFSA 2CGRL 4OLYL 2E7BA 3MUJA 1FZJB 1EUUA 3V5DA 1HINL 4GKNB 1I8MB 1MNUL 2YD2A 3NN8A 5HPMB 2VLKE 3TH3T 1PSKL 3CLEL 2DOCA 4LL9A 4DVRL 1BQHB 2CLZA 3RWEA 1YNTA 1OTSD 1K2DA 4M6AA 3TNMA 2ED7A 4F57H 1NMCB 4B50A 1IGFL 2J6EA 5C09E 2VQ1A 5D1XA 1JF6A 1IM9D 3SKJH 2CJUL 1U8JB 4ZO9A 1LE5B 1CDHA 1U3HA 3OR7A 3WSQL 4H88L 1X4ZA 4WO4B 5E94B 5JHDE 3TFKC 4ZOEA 4KHTH 3ARVA 2QADC 1WZKA 3V5HB 2VWEE 1YEIH 2ID5A 1RJZA 1PAMA 5D7LD 2R15A 3WN5A 4EQ2A 4LCWA 1KCSH 1Z5LB 4QTIH 3W82A 5IFJA 4FXGB 2V2TA 3TGXA 2V7HB 5CJXC 1OGTA 2HN7B 5IHUL 1MFCH 4Y4FB 5MENB 1HOCA 4XCEA 4XCEB 1MLCB 4UAOC 3RL2B 2Z31A 4LLQB 5T1DL 1G6RH 1XGQA 5HI5C 4L8DB 3OKMA 2XRAH 4JB9H 3RZCB 2Y36H 4LLVA 1GC1C 4JO3H 1TVHA 3BDBA 2OQJB 3QXTA 3ZL4H 4G42A 3B2VL 1KTDB 1QVOB 2OMBA 5HYEA 1FVEB 2R1WA 2Q7NA 5FA4B 4NHCL 4AEHH 1R3KB 1H3PL 4HCRA 5KOMC 3FQUB 3VFWB 3BP7A 3PABB 5SV4A 3B9EA 1JPTH 3K1DA 1XF1A 3O3AB 4PR5A 4QY8A 3HI5H 3KPSB 5EBMB 1AKJB 4GKSB 3BZ4A 5SWSB 4OQ1A 4P4KA 1N8ZB 1SYSB 1JHLH 3VWKC 1TQBC 2EE6A 3M1BA 2EC8A 1A9EB 4AM0B 1IEAA 1CGVA 3O2DH 1CXFA 1LO2H 3RKPA 2P47B 2O5ZL 3ZO0A 1FL3B 4JO4L 5E2VL 4L4VE 5TE6H 3BIKB 5I18H 5KVEL 3DECA 2Z4QB 4D9LH 5C0IA 3AC0A 5CINL 1QOKA 4JQVC 3RNQA 1BVKA 2D03L 2H2SC 3G5YB 3F7VA 4N68A 4P2YA 5B38B 1I8LC 3ZKXC 4CJ0A 3HC0B 1RUML 2WANA 3DTXA 1IL1B 2F74B 4HUUB 1T0MB 4LARH 4RMVA 3DGGB 5JOEA 4MJ4A 3HCVA 2YBRB 2DM2A 2FO4B 4OCSL 4Z7NE 3JV0A 4XPHH 4BYHA 4I1NB 3CFCH 3VG0L 4L5FH 4JE4B 3SDDA 2LE9A 3I9GH 3D18A 3BKCL 4HKZB 1PLGL 2E27H 4ZO6A 4U1MA 1EEZA 2D03H 3FO9B 3I75B 3QG7L 4K3GA 4ZMAT 1DCLA 3EHBC 4PRIE 1Q0XL 1AXTH 5HGDB 4K3EL 4HWEL 4NQDE 4PJFF 4X4XA 5F9WB 2XTJD 4XWOC 5HVFB 1A1OA 3BP5A 3ULVE 5B39G 1GCFA 4WI7A 1CLYL 1CXEA 2EYRA 1JNHB 4R4BA 4J3XA 3L7FB 3SJVE 5IVNA 2E27L 1KBGL 3K80A 1WFOA 4NRYB 1F4AA 3WHXB 5L7XH 4TN9A 5J56B 3E6HA 5FO9B 2GW5A 4LLMA 1J1PL 5EWIH 1YPZB 1TJHH 1RU9H 4CVZA 5T3XH 4DKAA 3MRRB 4JKPH 1J8KA 4MA8H 5H37H 1FNFA 2JK5B 3QUYC 5JZ7D 5C2UB 4TQEH 4X0KA 1ZVSA 1BWMA 5BCAA 5CZVH 3CK0L 3JTTA 4KUCF 5FK9A 4Z77A 3TBSB 1MCOH 3PDOB 4PG9B 4RA0C 2CLRA 5HI3D 1LEIB 3CFKA 3HE6A 4NUGH 1ZLWK 1SEQL 4IIQC 4XI5C 8FABA 4M61B 5C0GB 3MLWH 1DP0A 3NFNB 5E95B 2CH8A 1FNGB 3PWPD 2AXHA 4LLYB 2YPKB 2YPKA 4KQ4L 1FSKB 1J8HB 4QXGH 2R0LH 1C8PA 3EDDA 4K3DL 4QOKD 4GLRI 4PTTA 5EOQL 2F53A 2H3NB 1ZK9A 4PRPA 5IW6A 5AD0A 1U8PA 3VG9C 5EU6A 5HHPA 4HJGA 3LH2H 4C56D 4XNMB 3ZE0F 4JY4B 2GJ6E 2IMNA 2VR5A 1J18A 4NKDB 3DVGA 3EO9H 2VDLH 3MLXL 1IJ9A 1EFXB 4G8GE 2YC1B 4EQ3A 2VNCA 3NIGF 4UI2A 4GKNA 2WSKA 2E7CA 3CPLA 1MCIA 1G6RB 5DURD 3SDXB 5DQDL 1ZE3C 4FMKA 5C0JA 1C7TA 5E1HB 5KS9E 3VXTB 3G5VB 1Q9LB 5C08B 3WNMA 1FC1A 5GGRY 2XRAL 2YK1L 4XNQB 2BRRL 5LGJB 4Y5YC 4PJ7E 3OKDA 1IC7H 3QZWB 4Y19D 5TQ2L 4ELKA 1R5WA 5I1LA 5IFHH 3HZKB 5JTWA 4KMTL 3OXSA 2YA2A 4O2FB 3MACH 5KAQF 2P48B 5EC2B 4PLKD 5I30L 4I3RL 1N64H 3T3MF 3ES6B 3UBXB 1ZTXL 4NO2B 3ZKQD 4DGVL 5E5UB 2KUTA 1C12B 1G7HB 3OB0K 1N0XH 3QNZB 1WC7B 2QSCH 2XG5A 4L9LB 2AV7A 2C1PB 1MCFA 5DHYB 4HZAA 4JCLA 5L6YH 5IUSA 2P1YA 2Z31B 4DK6A 4KV5E 4KMTH 4HJ0C 2CMRH 2W0KA 3G5XB 2HRLA 2NW2A 3RVUC 3BKYH 1A14L 4OF5A 4UV4H 5GRZA 4W4OC 5HSFA 4ZUVA 3IDJA 3VXQB 3U83A 3UC0H 1CIUA 2UY7A 1TQCC 4HQQL 4JFEE 4QLRA 1HHGA 4LSVH 1D5IH 1BFOA 2R4SH 3KPLB 2IPUG 1RFDL 4AMKH 5DJ2A 4XAKE 5E00B 1R3HB 3LH2L 4OGZA 5E00A 1OP3H 1ZLSL 5HYJD 4HUVA 5GRYA 3BPNB 3QULA 1IT9L 4KDVA 4FQXA 2BFVL 3O6MH 4MCYB 5SWSA 1SBSH 4LCCA 2AJXH 1J1PH 5EWIL 4GRWF 3KR3L 1FH5L 1U3JA 4YFLI 5GGTA 3X13A 1FVEA 3SO3C 5DVLA 5E2JA 1LP9E 2ZG1A 4QHNA 4NUJA 4KK6C 3DX6B 3RWFA 3CVHB 4OKVB 4BZ2L 2OR9L 3QFJD 4OD2B 4P48A 1G7IA 2DYPB 3JWOC 4ZSOE 4K7FB 3T3PE 1I1YB 4P57A 3MV9B 3NTCL 4PRIB 4X8XA 1Q0YH 1ZWIA 3GSUB 2ADFH 3BJLA 3NCJL 5EC1B 2NZ9C 3P11H 4J4PC 5BO1L 3IAGC 1QBLH 4FFWD 5HYJE 4OZGE 3M17B 4U7MA 2IQAA 3FB5A 4YHMH 2XWJA 2ERJB 4X6CB 4OCXH 2ADIB 4JGUA 3KJ6H 2B0SH 1OP5H 1INQB 3C08H 2A1WL 4KVCL 4L8BA 4EDWL 3VGEA 4UT7L 3QO0A 4ZFGL 3C9NB 3OX8B 1UJ3C 1S7QA 1O7SA 1OAKL 3GMNB 3VRLF 2YBRA 3O8XD 5CJOL 2B1HL 4RAVA 5TE6L 3BQUC 5GSVA 3IXAA 4OZIA 4QRPA 3CH1A 5C3TA 5TE7L 1ED3A 3QIBC 2CPCA 5IEKA 4P3WA 5F7EL 4NRZB 1CXKA 2I26N 4HV8A 4JM2B 4OQTA 4PGCB 4R3SA 2PYFA 2O61B 5CBEA 1OWWA 4LRNH 1A2YB 3QUKA 1WIOA 5DJ6A 3FZUD 3MRGA 1W72H 3MRKA 4G6JL 4CDGC 3U30B 4BH7A 4LCCC 3HE7C 3QUZC 4GFTB 5I17B 4MNGE 5DZOA 1U91A 1UFUA 2IADA 4UINL 1AR1D 1D5ZA 2QQLH 4GAFB 1AC6A 1U8MA 3RA7L 1IEHA 3AXLB 4UIMB 4P2RE 1NC4B 5DRWA 5CZXD 2IPTL 4WJ5A 3F8UB 1BQLH 3R4DA 2EEBA 1FNAA 4U3CA 3T2NL 4PTTB 1V8HA 1I85A 1ZT7A 3A67H 4NKMB 2J6EH 3ZKND 1C1EL 1YJDH 5IW1A 3LEXB 5IB5A 3GBMH 1NKOA 4ONHA 4OLZH 3BSZH 4HWUA 4N0FB 3V6OA 3LPFA 1MCPH 5LGHL 1SBBA 2IANA 4AMKL 4NWUL 2EYTB 3PHQB 1I3UA 3CFDA 3T0EE 2Y72A 3AS2A 4Z7UA 3UJJL 2BNRB 4XAWL 3BRFA 2BNQA 4BSVB 4Z76A 4L8SA 2XN9E 1WITA 2ZSWB 5DEGA 4NYLB 4NCDA 2RB8A 4OF6A 2VKXA 3UPAA 1U0QA 1UGNA 4ODTL 1C1EH 4WI5A 3M07A 3HC4L 2R0LL 1U8KB 3RWCA 2RAMA 4KQ4H 4ODWB 3BJ91 4L4TD 3GMQA 4YUEL 4G7YH 3GK8L 4CW1B 3MCLL 1FGVH 5EPMA 2E6JA 1HINH 5JNYA 2X1WL 2GFBA 3ESVF 1IRAY 5ANMB 4YZFF 1ZOXA 2HRPH 3ZT6A 5IB3A 5BW7C 3ARGD 5FKAA 5BV7B 5F7NC 5FHAL 4HXAH 4U1HB 3DX9A 1J0YA 4AL8H 3I6LE 2FX8L 1L7IH 3U7WH 2F54E 5J11B 1NAML 1FLRL 2BVOB 3FRPA 1YY9C 1VERA 4YPJA 3QISA 4Z0BL 4DWHA 4D9RE 1EZVX 2EO1A 1AGCB 3WIHA 2JE8A 5FYLE 3VFUA 4YHPA 4K7PX 3T8XB 1E27B 3RIAF 5ACZB 2NLJA 2AJSL 3QI9A 3U2SB 1R5IB 3FQRB 3D25A 4OZFA 3DMMB 3OTTA 4JN1L 5JW3H 5IMOB 4TYUA 3WE6B 5I16A 5F6IB 5ITFA 1HCVA 2OMNA 4BSJA 3R8BB 3SBWA 2JJTA 4P46D 1AP2A 4OCNC 4MX7B 2BVTA 4XHJD 3DWTA 2QJDA 4OCWH 4PBXA 4OGYH 4LLWA 3ARGB 4H1LG 1AXTL 4Z7QF 2Z8SA 4MSWA 1XF4B 3OXRB 4JG1H 3ELAT 4X7FC 4L1DA 4LCCB 1IFHL 1L0QA 5F7HA 2QTEA 3LPGA 4G9FE 4P5MB 5GS1C 2APFA 5DUMH 4EN3C 1T04B 5D96B 1K3IA 5GS0L 3HAEG 5MEOA 5DJ8B 1HH9A 2A0LD 1U58B 5ESQA 1IQWH 3UPCA 1H8OA 1SEBA 2OSLA 2GIYA 4HIEA 3QIUB 4HPYL 2HT3D 1KTRL 2H2PC 4JFOA 4U1LA 5EU5A 5HDLA 2X09A 2YPLE 3DV4A 5J6HA 4HWBA 4HZLB 4UDUA 4YR6B 2R9HC 5I15L 1JHTA 1KXQE 2J8UB 5CEZL 4Y5XB 1G84A 2DD8L 5IBTH 1UQSA 3V4PH 4J23A 4JFPB 4LU5H 4ELMA 3LZFL 2W9DH 1LO4H 4GS7B 1DANU 1TXKA 1KUMA 4QHLA 3EOTH 4YK4B 4HBCH 5I0ZA 4LIQE 2VDRL 3JV6B 2EDJA 5AZ2H 1Z9LA 4IDLA 3HZVB 3U4EA 4E9LA 1AQDB 3A6BH 3P4OB 4MAYC 4BJLA 4BH8A 4MJ5A 5D2LF 3OKNB 1KTLB 4I48B 4BA8A 1U8JA 4KRPC 3TA3B 2NY6D 3MFFA 2HT3C 1FYTE 4KJYA 2FDBP 1QBAA 1JL8A 2YEZB 3VMOA 1KJMA 1ZLVK 3KPPA 1UWGL 5DMYA 5I66B 2JJSC 4DN3H 1FLTX 3RKDC 2DQHL 4EN3D 2JELL 1WAAF 1QR1B 4LDEB 5E9DE 1DQMH 1RQ5A 2VQTA 3CIQA 5DD6B 3FTGA 4LHUG 5D8JL 4WNQA 2XY1A 3H9HA 4M7KL 3WMSA 4DKDC 5A1AA 1GZQA 5E6IC 1B6DA 1IEBB 5BO1H 5KSBB 4FQ2H 4NT6A 3VXUB 3H7BA 3HFML 2DI9A 4H26A 4LARL 2ENYA 5JW4R 5HVGB 1U8IB 4QRSB 1VSCA 1Q38A 4PP1D 4PV8B 4H8WC 5T3ZD 5EU3A 5T1KA 2VAJA 2CUMA 3U7WL 5KW9L 4CGTA 5LVEA 1QHOA 2F5BL 2DQGH 1ROWA 1Y0LA 3D0VA 3GRWH 4FHBD 4FG6D 4ONGH 5IESH 2K7QA 5KSVA 2IMMA 3PHQA 3JWOL 1KB5B 4PD4J 4M1CD 1K4CB 4PYGA 1NGPH 1T5XA 4IMKC 3VRIB 2XKNB 3QEUB 1XIWC 5DR5L 4NQDA 4U1SB 4HGWA 4NNPL 1JI2A 5E5MB 1YY8B 3MR9A 4F58L 4PGEA 4PJDE 3ROLB 4PJEE 3L3OA 4W6XB 3AFLA 4F7MB 3V7AG 1QKZL 3TO2B 4YHOL 2GT9B 1AGBA 4M02A 3LKRB 3BKML 1KELH 1WBZB 2BK8A 1FORH 4G6AD 3CFDB 3OG6B 4C58B 2LU3A 2AEPL 3BRDA 2R0ZH 3MMEA 1HILA 2GSGA 1RZIA 2Z31C 5EORH 1MH5B 1XGQB 2FX8H 3O9WB 1PFCA 3U9UB 4NGHH 1V3LA 1NUGA 1NMAH 4XH2A 2HTLC 1YEDA 1RUPL 4WHTA 3KYNA 2D0HA 3TIDA 5F3BA 3C09B 1QA9A 4MD4B 1TPXC 4ODUA 1FL6B 4QOKE 4PV9A 2EDRA 4FOMA 4RGOH 3O6FD 4XHJC 5CJ8A 3DVNA 3DBXB 3DBXA 2Y6SD 4OCRL 5BRZA 1K8DB 3OKLA 1JGVL 1HYSD 4BUGA 1QSFD 3W11C 1M05B 5JIIA 4PG2C 3GMPA 3V7MA 1JE6A 3ARFD 5HDQH 3RDTC 3QCUL 5I8EB 5C86A 3CDFA 1EZVY 3BVNB 1DQDH 2QR0A 2JCCB 1XH3A 5T1LB 5D71H 3QCVH 5JQ6H 3TYFA 4X5WB 2X4PA 3E8UH 4MJID 3NA9L 1UEYA 3QHFL 1LK3L 4ZUSB 1QFUL 2ATKA 3ECBA 3GHEH 4ZD3H 3OJMB 1FFNB 2X1OA 2MKLC 3MV8A 4YBLC 4F9LC 3PNWB 4PJIB 4MLIA 2EDYA 5T1MA 1WBXB 3LKOB 3L5XH 3TWCH 4MXVF 2Z4QA 3MRMA 1IGCH 4NJ9L 4YDJB 1KG0B 3WD5H 2O93L 4JO1H 4NIKB 2BMKB 1YEJH 2Q8BH 3CC5A 1Q94A 4G6KH 4X5XB 4BQ8A 1JIBA 3VFSA 1CR9H 2B1AL 4QHUB 4BSWA 4XBGA 4HWBH 3DX8B 4C55A 1U92A 3FZUC 3HCVB 4NQVB 4XCFH 4Y4FD 5DGQA 4GKZA 4D2NA 5ABDE 1RMFH 1FRGL 4PBWD 3D85A 3LS4H 3EKCA 3GMOA 3RZCD 2FD6H 3ARBB 3PWPA 4GXUN 4NNYB 1B3JA 4YLQT 1SVZA 4PB0H 4YGVA 1NCAH 4JREB 3D5OF 5IVOA 2OTPA 3FOLA 3QQ4B 1OSPH 1XF4A 3OXRA 5C07D 2VSCA 1QFPA 3IF1B 1P6FA 3OSKA 3VXRE 2NW3B 3CDGB 1CGSL 3EYSH 5DO2C 3ARSA 3RUGB 5F7DA 4OM1H 1V7MH 4ELMB 2IAND 3ABZA 1E28A 5CSZB 4XC1L 1GIGH 5D1ZC 3ARRA 4NQCA 1KENH 3VXSD 1ETZA 4PRDB 2AK4D 3WIFB 5LQBH 4PJCB 2XV6B 3V7AE 1X3DA 5IGXL 3RVUD 1YQ2A 4A6YA 5KTEL 2VKWA 5IM7A 1OTUC 4ZXBC 3R1GH 1XEDA 3VW3L 2AJXL 4L4JA 3BDYH 4UT6L 3RJDA 2DQIL 5KVGH 2DLGA 1F3JA 3G04B 3EYOB 4JLRB 3MFFB 3CMOH 4FFZH 5LBSL 2E6QA 1MRFL 3HI6H 3WS6A 4AH2B 3L3IB 4MS8D 1A4JB 2AW2A 5DWUL 2HTLD 3R06B 4UQ2B 4QCIA 4IBLT 3V4PL 5BMFH 5BOZG 5DQ9A 3MZGB 3VWJA 4PJAA 1K2DB 1W0VB 4UTBL 5KOVC 5K9KB 1NFDF 4TUJB 2B1AH 5ACMA 1U6AL 1JP5A 25C8L 4L3CB 1YN6B 2X89D 4PJCE 3RIAK 2NY5H 1S78D 2AV1A 5DFVC 1MFAH 1QRNB 3HMXH 3CFJA 4JFFE 4QXUL 3GO1L 4JZJC 4KZDL 3L3KB 1ZLUK 1REIA 4A6YH 5C7XL 4P9ML 4RGND 2XTJB 1FDLL 1X5HA 4S10A 4LGRB 4E41E 3QHTC 1GOFA 3QRFM 5DFWH 3NIFE 5J12C 2HJKB 2N7AA 4RMUA 4TUOA 1BX2A 4RAUA 3MYZA 1QBBA 3VI3E 2DF3A 4DW2H 5CCKH 3TIEB 5J57B 1YEGL 1CFSB 3MACL 3WFBL 2AK1L 3LEYL 3TC9A 3AGVA 3VFNB 1AO7A 4N0YL 2QL1A 3RY6A 5INCB 5JIPA 3HS0B 4UB0L 1DVFD 4DUXA 3AM8A 1A3RL 4MWFA 3QIBB 1BIIB 4AYFA 5IV2A 1H3WM 3RIFF 5E8DL 4TNVF 4OZIE 4N0RA 4WUUB 1T7YA 4OIBA 3LQMA 4GXVH 3K46A 2YOCA 2PTVA 3B83A 3O41A 3ZE2E 1VENA 2MCPH 3EJJX 4MAYD 2R2BA 4HGWB 5CSBA 3CSYA 4DW2L 5CCKL 3C5JB 4I4WA 4ETQB 3O6LL 1JMZA 3KPSA 1MHCB 5K9QI 4L4TA 2JCCA 1BFSA 2APBA 4OB5H 1HNFA 1YZZA 4H0IA 3RX5A 1E6JH 4JFYB 5FM8A 4BQBA 4YDLB 1XF2A 1UXWB 4RDQG 1WFNA 5FB8B 5ISZA 5CD3A 3W11D 4D94A 3GI9H 3KYKH 4GG6E 1J05A 3FQTB 3MCLH 1MHHA 1HHJA 3OB8A 1RIUL 2P8PB 2D9QB 2JJSA 1ZHLB 2G2RB 1RJYA 3B2UD 4PG2A 2OJEA 4M7KH 3MRBA 2QEJA 1CG9B 1BD2B 2RR3A 3V4UH 3QUYA 2VXVH 3AREB 4H8WH 4AZ8A 5FYJE 3GEWB 1YEGH 3BEWA 5EBGA 4HKJB 1Q94B 2JB5L 3J7HA 4DZBB 2WBKA 1BPVA 2V6HA 2DM4A 4S11A 3T2OA 1WUNT 1IL1A 4NGHL 5I1HH 3HE6C 4F37F 2EXWD 4BFGA 4ERSH 2VXSL 5I1DB 1W0WB 1KPUB 2HT4D 4KHTL 3JBG7 2R69L 1KEGL 3NPZB 2Q76A 3WNPA 4AEIH 1HHIA 2PYEE 5EOQH 3DX7B 4ZNEA 1T6VN 1KB9K 2CUHA 5IB4A 1N5AB 1ITCA 1JZ8A 2GTWB 5EO9B 3V95A 1L4IA 1INEH 5FO8B 5L7XL 1O0VA 1JVKA 2O61A 1NEZA 1I9RL 5DGRA 1FNSL 3AS1A 5E1AA 4OZHF 5B3JF 4ZPTA 4KJQD 4XCYB 1HH6A 3S4SG 5E9DD 4Z7QE 1T20B 4AT6A 3MLPA 3OHXA 4I3SL 5FYJD 1CVRA 4NRYA 3WHXA 3DETC 3SE8L 2VDPH 1FFRA 4XMKL 2AJ3B 5E2UL 4RZCA 3D3VA 5HGBB 4B5EA 2NYYD 2Y1VA 1DSFL 3VFSB 1EJ6A 1EFQA 4M8VA 5T3ZE 4X7SL 3MRQA 3KPQA 2LV4A 3BQUD 2EIZA 4OLWH 2NY4B 1QZ1A 3OKOB 4JDTL 2VOTA 1CGYA 4DEPB 1P7KB 3RU8H 2FR4B 4K9EC 3SE9L 3O8XA 4M62H 1MCBA 1MPAL 4PJXA 3O3DA 3MRPB 4M1DH 4QRUA 2OL3A 5D5ME 1WCQA 4D0BB 3BPCB 1A64A 3X14B 4FFWC 4LHUA 5KVEH 5FYLH 1Z9OA 4PJHA 4M7JL 4CKVX 5EA0L 3ME0A 1PZ5A 4LASL 3L3GA 2EH7H 4PRPD 1J86A 2W0PA 5H35A 2C3VB 3BKJL 4FQPA 3NGBC 4QF1B 1LEKB 1YPZE 4R7DB 1RHHB 4KVNL 4NN5C 4DTGH 5HVWA 5EZLA 1X4YA 4D0DB 2YSSB 2G75A 1HDMB 4JM4H 2RHEA 3K2UL 4G5ZH 4PY8I 4P2QD 2UWEA 4XP4L 2M1KA 5FYKU 3EDJA 3LAFA 1YDPB 3OKYA 1RUMH 3ULVD 1OB1A 1D6EB 2F5AH 2VAAB 3U7AA 1NPUA 4UQ2A 3FCTB 3MNVB 4WEBL 3SJVD 1JFQL 5C0BB 3ZKNC 1F58L 1XFPA 1BAFL 2MSPA 4QHMA 3REWA 3D39B 1ORSA 2VLLB 3PDDA 1S7UA 3QDGD 3TVMB 1JPGB 1G7PB 4WCYH 4FQXC 1JMXA 4MS8C 2R1XB 1UWXK 3HE6B 4POUB 5FCUH 4HPYH 3H3KA 2Z35B 5J3HD 3GHBH 5HGGS 2HKFH 2VXUL 2ADJB 1A6AB 4NRXA 3IETA 1J88A 4UQ3A 2YD9A 5DJZB 5C0AB 2OL3L 3MRIB 3RWEB 2CLVB 2DMCA 2NY1B 4HUXB 1QTYT 1TLKA 4R8WH 1LHZA 2FATH 4IJ3C 2PTTA 4G43A 4L8SC 5HHPB 1GJIA 1YMME 4LEXH 3HNTL 3IU3A 2ZUYA 4Y1AE 1ITBB 4NM4H 5DJ0A 3OKMB 1PY4A 4OCWL 1TZGL 4KROD 4X6BB 1HI6B 3OJ2C 4ODWA 4XMPL 4HQQH 1SYVA 3L3JA 3PQYB 4EI6B 4FABL 3BYTA 2Y7QA 2V2TB 4FXGA 3MFGB 3Q2CA 3DURA 5A2JH 2C26A 3RPIB 3U0TB 1K9TA 1NKRA 4LRIA 4C4KO 4M8QA 2IBBA 3DX9B 3L5XL 3TWCL 3ZMRA 4F2MA 1HIML 4P5MA 2IBZY 1DL7L 1R3KA 4TSAH 4E42B 35C8L 3OG4B 3MUZ1 2EDHA 4G8GD 3QUMB 3U9PH 1DUZA 4YHIA 5E6IA 4YHIB 3O2VH 5E6IB 2BP3A 1UM5L 4XAWH 5ECJE 1T6WA 4XMPH 4YZFE 5FDWB 5HHVL 4NFBA 3ARXA 5IMLA 4M03A 1LK2B 2UWEF 3H9SD 4E0RA 3ZYIA 2UZIH 1KULA 1IBGH 5IF0A 5HHQA 1PKQE 2ICES 3MA7A 4I3RH 1CIDA 4JY6B 3MLUL 4WDIA 3TESA 4IOFD 1KELL 3FQTA 2EDQA 5DEFB 2ED9A 2Y6SC 4KKCD 5A40E 5FHBL 2UUDK 4GMSH 3GK8H 2PO6C 2XZZA 5DHVH 2J6EL 2PKDA 2YK1H 1C5CH 3B6SB 3CDYA 1MIEL 3HZVA 5EZOH 3U4EB 3SQOH 2WWKO 4L3EB 2IQ9L 3NZ8A 5HJ3A 1SEQH 2P45B 3TO4B 5ID1B 3DSFL 1KIRA 3QDHA 4PJGF 4QRRE 2XTJE 3DIFA 4LHJB 5I74C 4S1QL 4JDZB 1OPGH 4P59H 2R23A 1T03L 1CT8B 4AEFA 2WQRA 4BM7A 4TTDC 4KKLD 4F8TA 5C0FB 4Y2OA 4KY1H 5D2LA 4O9HH 1CL7H 5ALCL 4LEXL 4G80B 1T7WA 4QYOA 1CK0L 3LN9A 2R2EB 4BFIB 3G5YA 2DMBA 5EZJB 1I1RA 5ICXB 1A7RL 1AO7E 5JPNB 4Q58C 5CJQH 4HUUA 2F74A 2D4FA 5J1SC 4Y1AA 1BQSA 3G6JF 1AE6H 5KSAD 4YXHL 3QUXA 1MJJB 3HRZA 3HTLX 5F21B 5I1GL 3BXNB 5C0CB 4YBLB 2VABA 3L7FA 3SDDB 1S5IH 5ANME 5IEKB 1EIBA 1NEUA 3AU1B 1IGML 2W9DL 2ARJB 3ORJA 4J8RB 5HVHB 3VA6A 43CAA 2IAMD 3MTRA 2XZAH 4YE4L 3CAFA 1A9BB 4X4XB 3UTSD 3U79A 5GHWL 4RFEB 1I7TB 1MHEA 2LQRA 3D6GA 1PW3A 4Q6IA 4Z0XB 4JANA 2HVKA 5TF1H 3LKPA 4PJBF 4XNXH 4TNVK 2XYCA 2G60L 2Q86B 2Q3ZA 3WXVH 4K71B 3MRGB 1ND0B 5IMMA 3I3DA 4G5ZL 4C54A 4TSCL 4H1LA 4K55A 1E4XL 3GSRB 2VSDA 1H3GA 4CMHC 3MRPA 4QKXB 1MAML 5IMKA 4RZCB 3VXRB 3X14A 4RFOL 5J3HC 4R0LB 3ISWA 2CO6B 3GRWA 3SE3C 4Z7VB 5LQBL 1WLHA 2EZ0D 2JELH 2XG4A 4LLYA 1A6UL 3BPOB 2OZ4A 3MNVA 1HILB 3MMEB 4JFDA 4P46C 1NMCC 3KPSD 3FT3A 1AGEB 3MOQA 4AJ0A 4CDHA 4QXWA 4OZGF 4Z77B 2HMIC 1GRWA 5IWLC 2EYSB 1U8PB 3S3SA 3HLAA 3LKSA 4M1GH 5D7IB 4Q74A 4O4YH 4TVPH 1NCWH 1YEFH 1IAMA 2VZ1A 1J8HA 3IAQA 3MRRA 4ODVH 2EDFA 1KLGA 2YN3A 5E8OB 1A7QH 2FJGB 3P77A 5I1CL 3SDXA 1Q0YL 1ZLSH 3ARPA 4IMKA 3WJJC 2YRZA 3IDNA 5HHNA 1NC2A 5L2JA 2HT2C 2R4RH 3LN5A 4NHCH 5EOTB 3RWDA 4DVBA 4JY4A 3I02B 3I02A 4TPRH 5SWSE 1CI5A 3QQ3B 4HXAL 5KJRL 4P5TA 3UBXG 1X5YA 4AIZB 3QIWB 3AXLA 2SEBA 4KKCC 1X5KA 12E8H 2Q7YB 1F3DH 1UM4L 1I8MA 3OJDB 1YEJL 3OJDA 5IQ9A 5IQ9B 3P40A 3SQOL 3U0PB 3V2AR 5DUPL 3EJZD 1DL7H 4PUBL 4RRPG 1T83C 4QHMB 3RX7A 3MV8B 3KXFD 5BZDB 2VWEC 2X70B 2BVPB 1AD0A 2W60A 5I8CA 4CU6A 3QDJE 4XCNB 5DD5L 4HX1B 5ID0A 4MXWL 1FL6A 2FX7L 5HYSG 4OV5B 1EO8H 5J7CC 1EVTC 3IGAA 1NBVL 3VXNA 2OJZL 2EYTA 2BDNL 4J3VA 4WWKA 4WFHE 3A0OA 3V0VB 1LQSR 3UBXA 3ES6A 4PJ9D 1GYAA 4FRWA 1AGFA 3BH8B 1KLUA 3MROB 3UC0L 5BRZD 2QSQA 4OZGA 3MA7B 2NZ9D 2VZUA 2ZSWA 3CJJA 5SWSD 4P9HC 3VD4A 1CCZA 2X4OB 4X6DB 4KDTC 4RGNE 1A6WL 3EJZC 3MRJB 3VFRA 3HG1E 4EI5A 4LCWD 4WFEE 5F72S 1WZLA 4Q9QL 2VZOA 1X5XA 1HN1A 3PWNB 5AZEL 3KHQA 3WUWB 5EPMB 3B5HA 3QRGH 1BOYA 4NUGL 3UX9B 5J1TC 5IWLA 4Z0BH 3CUPB 3LKNA 5D1XD 3VD3A 3FB6A 3C5ZB 5ANMA 3SY0B 5L6YL 3RVWC 3GSOB 3MRNB 2EECA 1KCSL 4EZMA 3U0TA 1CFQB 1FFPB 3PNWA 2C1PA 1NLBL 1ORQB 1ZHBB 1ORQA 1ZHBA 2YR3A 1YEIL 2ZOLA 1OTUD 1GGIL 1JTPA 2AJVL 3MV7B 3D2UA 3O6KL 3BP7B 2GK2A 5C0FA 3GGWA 4RRPA 1C5BL 3RTQD 1U58A 5MEQB 2FRGP 1GVIA 2ZG2A 3UO1H 2W0LA 4OD2A 4LNRA 3EZ8A 4P4KB 4WGWB 1JYXA 1G0XA 3HB3C 4PJDA 3SCMD 4C56B 3ULUD 3DO7A 1BVZA 5JPNA 3MJGX 4MNGA 3OKKB 3RRQA 5HYSB 4EIGB 1GGCH 1T1ZB 3D85B 4OZIF 4M43L 3X3GL 2GI7A 3GKZA 4U6XA 1EV2E 5E2TL 4O2EA 4H1LH 2QQNL 2X1PA 5BV7H 3SQBA 2BC4B 3MJ7B 4MX7A 5CWSB 4L29A 4Y19A 3OQ3B 1PYWB 4JQVA 1CD1A 4RIRA 1I9JH 1TETL 2GSIA 7FABH 3L3HB 3QO1B 4M9PA 3PWUA 3CXDL 5EZJA 1A4KA 4XC3H 4IDJL 1KIRB 3RWGA 4OI9A 1FDLH 1P1ZA 5FUZH 1U3YA 3SDAD 4PLNC 4WEMB 2NR6D 4RA3A 4JM4L 4JRYB 3QDMA 4RAVB 2AJUH 3ALXA 2X9WA 5HTSA 3VA2C 4TVPL 1J7VR 2XPGA 1ZGLB 4KVNH 4DTGL 1T1XA 1H8NA 1FE8H 3D18B 1E4WH 1JRHH 3FN0L 1KN2H 3MLZL 4R90L 2R2EA 1U36A 4BFIA 3MO1A 4NKIH 1G7IB 5C0DB 1YNKL 3F5WB 1FO0B 5JW5B 4Y8AA 1T1WA 4ZXBA 5E2VH 1MJUH 4LSSH 3K4AA 4YPGA 2W38A 4UT7H 1VCAA 3ALPA 4F7CB 3S5LG 1JNHA 3WFCL 4NFDA 1E4WL 2H8PA 2JJWA 3B9KB 3EYFB 3ARUA 4OQTH 4X4YA 2XWJB 1HQRB 4KJPD 3ZYZA 2KL6A 2BSTB 2PXYD 5JHDB 3SPVB 2AI0L 5FYKE 3RDTA 3QDAA 2EKJA 1G7MA 5JW4M 4Q6IB 4Z0XA 1KEGH 3C9NA 4QXTB 1E4KA 1GAFL 3QEHB 1U3HC 4WWKD 2AJZA 4NSKB 4Z78A 4HULB 1N7MH 2HH0H 4QRRA 5HGAB 5T5FH 1T0PB 5DD1L 4Z7UE 2O5ZH 5ISZE 4PJHF 1I9EA 4M43H 3O81A 5ESAA 3NPSC 2P5WA 2SEBB 1MAMH 4JFYA 2ZNXA 4XI5D 3GI8H 2DQFA 4Y4KD 2DQCH 1MFEH 4TUOB 3KPRA 1DN2A 1Q9OA 2HT2D 4KPHL 3HUJE 5FHBH 5IK3B 2ICEB 1AIFA 1A6PA 5IW6B 5TQ0H 4PY8J 5AYQA 4WY7L 1NDGB 4WI8A 1JPFA 1FAKT 3MXVL 1GGIH 4LQ1A 3EIFA 4LOUD 4RISH 1P4IH 4PV9B 3S5LA 3VRLE 3U7YH 5KSVB 4WWKB 5D6CB 3IDGA 5D7JC 2Q7YA 4WI6A 4Z5RA 4KJPC 4Z95H 5TFSH 4PJXE 2GKIA 4BQ9A 4HK3N 3QAZB 2EC9T 2G5BA 4PREB 1FNSH 2P43B 4PREA 4YBHA 2ZUUA 4LMQI 3ZKXB 1T89A 2BVPA 1AFVL 3DX7A 3BUYA 1F45A 4RGOL 1KXTB 3RWCB 2VIRA 4FP8H 4K7PH 3ZTNH 3RTQC 2L7UA 4M48L 3LEYH 3KYOA 5FB8A 1BOGA 5F1NA 2H32B 4JKLA 3QXWA 4M4RA 2HVJB 3O3BB 3HB3D 3SCMC 3ULUC 4JRXB 3S37X 4NZRL 3V5KA 4S1SH 1GL4B 4F8QA 3UTTE 1A6VH 5HYJB 1RK0B 3C5SA 5D72H 4S1QH 1LNUA 1FIGH 2HRPL 3Q3GB 3E2HC 1CICD 1I7ZA 2BNQD 4MD4A 3OPZH 4DAGL 3WNNA 2NR6C 3MV7A 5CUSH 2YPVH 1ZANH 3F7VB 2APWA 3GO1H 4KAQL 1BZ9B 4FFYH 4X7TA 3SGEH 4LAJH 3KLHD 1HHHA 2EIZB 5FECB 4C57C 2C3HA 2ZOKB 3BZDA 5CEYB 2DQUH 5I2IB 3A6CL 3L5JA 5IP4A 1FBIH 1S7XB 1V7NL 1G9NL 4OZFB 3RBSA 1NANI 2GJJA 2DYPD 5DJAB 2BOBB 1CLOH 4JFZL 1FNEB 5FYJU 4YHYC 2B20A 1N5AA 1A6VL 4XVJL 3G5ZA 3D1MC 2BDNH 2R4RL 3D9AH 4U1JB 3STLA 4P23C 1TTUA 4R0LC 2FH6A 2WINB 4ODBD 4X6EB 3T77B 3B9DA 1JGEA 1JGEB 3W0WA 1CD9B 3K8MA 1UH2A 2NTFA 3QWRD 4XXCC 5INDA 4NQSB 4OF0A 2GJ6A 3O3EB 1CDUA 4WFGD 1FGNL 3H0TB 4MNGB 4QXUH 2ESVB 5KTEH 1NGXA 1F4HA 3C8DA 5C9JA 4P3CH 1MHPL 4PJDF 3MCKB 5IBLD 4Z8FH 2IJ0C 4DFHA 2HG5B 2GQHA 4MNQD 4MAYA 4OLXL 1I1AD 2X4RB 5CJOH 1I4FB 1IGJB 4APQC 2MMXA 1P7HL 1CFBA 4OLUH 1HKLL 1UG9A 3GSXB 1S7VB 5EU4B 4P57B 5IVZA 2MFNA 1OW0C 4HMDA 5T3XD 4O51A 4WWKC 5C70A 4GG6B 4U0RC 3T04D 3ZDZE 3QNXA 3EYOA 2CUIA 1QEWB 5C7XH 2P24A 1AGDB 1IAKB 2Y23A 4PJ7F 1R5WB 3JUYA 2FJHB 2P49B 3KPNA 2XFXA 4K3JL 3VE0B 3N1FC 3IETB 2VR9A 1HQRA 2XACC 1PVHA 3HR5B 4YHLL 3FFCE 3HG1A 3NACH 4YFDB 3OMZA 3WXWH 4QRTA 4I48A 4KKNA 5EOCJ 1C08B 3DHJA 5I71B 1KLFA 4HLZH 3VDAA 5JOPD 3Q6FA 5GPRA 2Q3AA 3TLRA 5C8JA 1CGSH 3EYSL 2OTUA 3KXFE 3PWLB 1CLCA 4HWBL 5D2NE 5I1JH 1UH4A 5C08E 1EGJH 3MRCB 1HEZB 3SDCA 3BW9B 4JFHE 3BO8A 5FKPA 2YXFA 3MV9E 1ZLUH 1ES0A 1CE6B 1JBJA 4Y4KA 2G9HA 3HHRB 4MNQA 5IM7B 1INEL 2DWDB 3ARBC 5BXFB 4WNQB 2GCYA 3TBVB 3TT3L 5F9AC 1VEPA 3G6AA 4PRAA 4PJEA 5D2LE 4F7CA 3QEHA 1I8LA 2ICEA 2WQ8A 3GMMB 3L3IA 1NGWB 2J88H 2X4TB 1N2RB 4O2FA 1KJMB 1WEJH 2GJZA 1XR9B 2HFEA 1UC6A 3TH4T 4WW2C 4BQ6A 3LQAH 1WZ1L 2DI8A 1KXVC 2OR9H 4LKCA 5D96C 5MHSE 1DFBH 3R0MA 1Q0XH 3BAEL 4X98B 5D1ZA 4JCMA 2I07A 5DD6A 1URLA 4JN1H 5JW3L 2FJFB 1GHFH 3JTSB 2B39A 5GGRA 3DSNA 1JRHI 2P5WD 1IGCL 4NJ9H 2F19L 3WD5L 3RAJL 1MI5A 4LLUA 3QIUD 1S7SB 3GJEA 3O11A 3ZE1F 3RZWA 2Z91B 5CD5D 4K94H 5EBMA 1NDGA 4LNVA 4YHKH 4NQED 4DKEL 5E70A 4G7VL 5ALCH 4FQHA 4W4OA 1AGBB 5E2UH 2VXSH 2YN5A 2XWBA 1V05A 3KLHC 1T80A 5FYKL 3WLBA 3IKCB 1MHHB 1ZTXH 3KS0J 3EO1A 2NXZB 1CICA 4BSVA 2ZCHL 4KWUA 2DDQH 4P2OC 1WIUA 2IH1B 1NCCH 4MHHI 1B0WA 1CGUA 2IQ9H 5HHOE 1ZA6B 4XPBH 5E5MA 3EFDL 4E41D 1I7UA 3MV8E 2P44B 3HUJF 5AEAA 3DMMD 2WBJC 3UJIL 3HC4H 3MOAL 2YKLL 3QHZH 2NY6B 2LVEA 4MDJB 4PGBA 1JWSB 2FL5A 4PS4L 3CGTA 5JNYB 5BV7C 4JKKA 1T5WB 2DDQL 4X5LA 3H9ZA 5CGTA 3TV3H 3WLWD 4UAOB 1YUHA 5FM5M 3D9AL 3HMXA 1XGPA 3CLFL 4TVPE 3O3UN 1U8QB 4ODUB 4J3OC 2A9NH 2EE3A 4P4KC 3GDBA 4KC3B 4Y16D 3H3PH 4JFDD 4EIZC 4RFEA 1SM3H 1FBIL 1CZ8H 1I1YA 2ATKB 1CS6A 4KK9D 1XCQA 4Y16A 4G7YL 3RY6C 2EYRB 4B7IA 5DLMH 5EC1A 5J89A 3PGFH 4KKLC 3JZ7A 1Q1JL 2GUOA 3QEQA 2KKQA 2Q6WB 2PN5A 5JMRA 2F8VA 3FO1A 4YDLC 3C8KA 3D3VD 2F53D 4EUPA 25C8H 4XCCH 1F5WA 4PTUB 4WFHD 3BE1H 4LLMB 2QHRH 3PV7A 4P23A 4R0LA 4XRCA 2ICWA 1XR8B 4WU7B 3P9MA 4XBPA 2VXTL 3VXSE 3RL1B 1RAMA 2PCPB 1NBVH 4WJ5B 1TJIH 3WKNA 4NQCE 1FHGA 1CE1L 4NPYB 3S96B 3M8OL 3BKMH 2Q76B 3NFSH 3IVKA 1S7VA 3CMGA 2WMPA 4MZ2A 1MCEA 4PJXB 4A6YL 4ODSH 2BXZA 4YHNA 5DHXB 2CJUH 1OM3L 3C5ZC 3T0EA 4JQXC 3T0EB 3B4NA 4Y2DB 1A9BA 4DVRH 3GI8L 3MRLA 4HT1H 3DUSB 3AS3A 1MWAB 2CK2A 5GIRB 3VXMA 3K8KA 1PZ5B 3L9RB 1T89C 1IARB 4M7ZB 4LCIH 3C8HA 2FIRT 5DJ6B 3PL6C 3LZFH 4U0QB 4XMLH 3RVTC 2DQDH 4PJ9C 3WNLA 3H0TA 3IDNB 3BD5A 3U36B 1YYMH 1BAFH 3T4YB 5L88H 1IE5A 2G75B 5I8KH 1J1XL 3EAKA 2HFGH 4NHUA 2V17H 3LCYA 4NQCB 4FQQB 4DZ8A 2EZ0C 3I9GL 1D6VL 3VXUD 2AEQH 4JFFD 1J1OL 3DUUB 1GOHA 4MD5A 3KPQB 3TT3H 5H2BB 3C6SA 4LPVA 4GW4A 1ZT1B 2J7LA 5J11C 5GZOC 2DWDA 4X7SH 3REWB 1HHKB 4HWNA 3T0ED 2QADD 1JPSL 4HXBL 1PJ9A 5T1LD 1MAJA 2LAAA 1HKLH 1RMFL 5JDJA 2DRUA 1A1MB 3C60B 3DRTB 1RVFH 5T1KD 3NFNA 1RZGA 5EC2A 2XTJC 4EOWH 3WBDA 3GNMH 5HYQB 2EDEA 3LB6D 4BZ2H 5H35B 4JRWA 1RUKL 1W0VA 4HXBH 2IALB 4R7DA 3AVEA 4OZGB 4PJ9B 3C2AH 1MCSA 1D5XA 5DRZA 3AMKA 4P3DA 3LQAC 4RAUB 2VLJD 4M5YH 2A6JB 2RBLA 4ZUTA 3CDCA 2FWOA 2XA8H 4MAUH 4YJZL 4EXKA 3CXDH 3QHFH 1J87A 4CVXB 2BJMH 1JF5A 4ERSL 2OTWB 4GW1B 4MWFB 4EOWL 3NCFB 1Y0LB 3D0VB 4ONFL 4JPKL 4IOIA 5FKAB 2VQ1B 5D1XB 1S8DB 3P0VL 3QH3B 2R1XA 4I13B 2EE9A 1T0NB 4D8PA 1VGKB 4YQXH 2IPKB 4LPTA 4AENB 4KI5D 4A2LA 1XR9A 3ILPA 4NO3B 1A7PH 5D7SL 4CMMB 5DI8B 1XGUB 4RMTA 4ODTH 3RTQB 2H9GB 1JNLL 3VFUB 3QIBA 5IV2B 2I60H 2YPVL 1QRNE 1H15A 1CDYA 1DLFH 2R0WL 1JWSA 2CXGA 2FL5B 4S0TD 2DTMH 3SCMB 4PGDB 5FA3A 3VXSB 1TJIL 3PQYE 1BVLB 3V52H 3OR6A 3FT2A 4NQTA 3MLSL 3ZTJH 1DQDL 2Z31D 3QPXL 3TZVD 1T7ZA 4Q6IC 2V9QA 2WBJD 4KRPB 2X4QB 2JB5H 2IEPA 5IHBA 3FQXA 5E8PB 2WBJA 1FC2D 4XNYH 3W9DB 1KJ2B 1XAUA 3KHOA 4F33B 5E08L 1P4BL 4PS4H 2EDOA 5IBUG 3RHWF 4JY5H 3HE7A 3T2PA 5J4MA 3M1BB 5C3LD 5GGSB 3BKYL 3UJIH 1FP5A 4B7LA 2VB5A 3FQWB 2R1WB 2DM7A 2J5LC 4XZUA 4GMSL 3U6RA 4U1KA 1FZKA 2IPTH 1MFBL 1U3HD 4EEEA 1S9YA 1S9YB 3VXME 1BD2A 1BJ1J 5IKCA 4Y5VB 1FIGL 1X5ZA 1WVZA 2AJVH 4LSTH 5F1IB 3IDXL 5GSRA 1SMAA 1AXIB 1RZKH 3RP1A 2J8UA 3BZEB 2ZWLT 2R0ZL 4FZ8H 3CU1A 2DBLL 1GZPA 5TQ0L 2P8PA 3KXFB 4J7RA 3JWDL 4F9LA 2EDXA 4L3EE 3KLDA 4GXVL 4LKXA 1QLRA 1CGXA 5JA9A 1F97A 1WV7T 4ZTOL 1PSKH 3CLEH 1S3KH 4U1IB 3RNQB 2R1YB 4PJBE 3NIDE 5TDPA 4JFXB 4OLYH 1NSNH 3LKQB 3VFMB 3ARTA 5H8DA 1IEAB 5D2NB 3S37L 3MRFB 3RA7H 1S7TA 1BP3B 5E6YA 5T5FL 2ZUSA 4JRYA 5T5NG 5IHLB 3CLFH 4HC1A 1I9IL 2VE6B 2AEPH 1OY3B 5E56A 2VL5B 3LRGA 4YHZH 4U3HA 1T83A 2ZKHH 1LEIA 4YFEA 2AI0H 3U4BH 1DLFL 2MTPA 4HGMA 4ZO7A 4ZAKA 2BVEA 2ZUVA 1KJ2H 3N9GH 4MDIB 2VDRH 4TSBH 4Y1AB 1BHGA 3IFOA 1UYWL 3CCHB 4X0KB 5LJYH 1IC5H 4NPYA 1AY1H 1A7NH 3BQUA 4ZS7H 5FCUL 1OLLA 3HZMA 3O8XB 5CD5C 2V5TA 1I8KA 4GAGL 4XP6H 3QB7C 3CFKB 4OT1H 1UCBL 5CILH 1JYNA 3B9VA 4MZ3A 2E5EA 5HGDA 5FO9A 3GRWL 1KIPA 3C6LB 3W5NA 1MWAL 1JF1A 4QWWD 3ILQD 5I76B 1I7TA 2AP2A 4Y5YB 2AS5M 4TTDD 4M62L 3FAXA 2YD4A 2X89A 1NUNB 4RGNB 4WV1B 5IHZB 2FYYB 1P7QD 4NQDB 3B5TA 1S7WA 2V9TA 1ZSDA 5CZXC 4XXCA 4GQ9L 4U6HB 3G04A 4JLRA 3UTSE 4Q9BA 5HY9B 4Y1AD 1OSZA 1CGTA 1RUQH 2MHAB 5D93C 2EH7L 4WFFD 4NQEA 5HHOD 1MJUL 2QQQA 4ZOCA 2ZUQC 2XZAL 4YE4H 2IC2A 1OHQA 3EYVB 1V7ML 2IAMC 1BQHA 2CLZB 4JRXA 4JO4H 1U93A 1I1FA 1DVFB 3HMWH 4UDTA 1AIFB 4IRSC 2HYMA 2J88L 2R8SL 2VISA 4LEOB 2V5MA 3QIBD 5L8KB 3C6LD 2Q8BL 2MCG1 1G7PA 5BZWB 3X11A 1HXYA 4HEPG 2V5YA 4G9FD 5TH2A 4NFCA 1GC1H 5MI0C 2AJYH 4AENA 1KCUL 2FX9L 3L3KA 3KR3H 4NRXB 4KKBD 4HJJH 5DI8A 4ZS6C 3T0WA 2NY7H 1JWMB 3NFSL 1P7QB 4GW5B 4NQDD 3SGDI 2ZOKA 5CEYA 4JQXA 1FYTD 4U3XA 1VEMA 2H41A 1JGDA 3MOBL 5IEHB 1S8DA 2VUYA 3T0XA 2D7PA 3IU3B 5IT2H 5GISL 5HHXL 2JTDA 4Z7VE 2X4OA 1OAZL 2X1QA 5L9DH 1T0NA 2CDFB 4D8PB 3SO3B 1MCWW 5B8CA 2NY4D 4NNYA 4LLVB 4GRLC 1L9NA 1Y18A 2X4SB 3LS5H 4ZUWB 2PXYB 3DYPA 4I9WD 1FE8L 3OKEB 3H8NA 2AJSH 5FDWA 4QGYA 1T2JA 3TBYB 2CLVA 4JJ5B 4X9BA 1MVUB 5MENA 1L7TL 1IZJA 2R2HA 1CZ8L 2DB8A 5T33L 1PGRB 3GHEL 4NWTL 1B0RA 4LGPB 4PJBA 4YDJA 1QD0A 4HUKB 4Y7MA 1NDMB 4WTZA 3QSKB 3IU4H 1I9JL 1TETH 1BQHG 1JYWA 5F7YC 4YDVB 5B4MD 3MA9L 5KSUB 1D5IL 1FG2B 3OAZH 1T1YB 2D3VA 3MLRL 2X4RA 1CDGA 2W07A 2AQ3A 1UM5H 3QJHA 4I3GA 3PWPE 4F15C 3HPLB 4AQOA 4Y8DC 1WIPA 1J11A 3FO2A 2J4WL 4PP1C 1OT2A 1QFWM 2Y36L 1IGFH 1ZHLA 1WWAX 2G2RA 3KPRE 2NW2B 3T2NH 1BFOB 1Q9WA 3KPLA 4HS3A 3DNKA 4NQEE 4PR5B 1FL5B 4N8PA 3SOBL 3SDYH 1KEML 3QXAA 5DRXB 4FXLA 4QYOB 4U1GB 1HQ4B 5D6DC 1C5BH 3GIVB 3CU7A 3FB6B 4JJHA 4M6MH 2A9NL 3E6FB 2IG2L 1ZS8B 5DMIL 1WT5C 1KTDA 1QVOA 4JKWA 2PF6A 4AL8L 3MLYL 4GSDH 4BK5A 1T0MA 5I1IH 3F6LA 3TF7C 4UU9B 2YPLB 3DYMA 1W0WA 4KJYB 1AQKH 1BQUA 3GSNA 3FHAA 1NL0L 1F6AA 4YHKL 2OM5A 5DJ2B 2OTUB 3QJFA 3VD9A 4NWTH 4YHOH 3WSQH 5C0IB 3B6SA 5DFTA 2DM3A 2OL3H 1A7OL 4MYWB 43CAB 2FLBT 2D0FA 4F57L 1NBYA 1DE4B 3MUGB 5I1EL 3BZEA 5KSAA 4ZAKB 1T1WB 4NCC1 5EU4A 1UM4H 2KZ1B 1MJJA 4PJ5E 3CVHL 5E1AB 3LKPB 2AK1H 4P2CG 1A1NB 2R29L 4DN3L 5HDBE 1YN7A 4PLJC 5IJVA 3W2DH 2C3XA 4H1LB 4PGCA 3RWJB 4NWUH 3VH8A 3AROA 1KACB 3QIUC 2VN4A 2VN7A 3BUTA 4MA8L 1SY6H 2M8XA 4N0CD 3ZDZF 5H37G 4G8FB 2DTML 4MXWH 1FSKC 5JHLH 3SGEI 1TVBB 5T3XL 4F9PA 5E8EB 2I9TA 2CSPA 1K4CA 1YJDL 1RZ8B 4XNUL 4ODXB 2VDQL 2AV1B 1ND0A 1OD7A 5GSVB 1SJXA 1S9XA 1YQVL 1QLEH 1QNZH 3H9SB 4J8RA 1ZSDB 4X6CA 1UWEH 3TCXA 2NCMA 4QRUB 5C92A 4C56E 1DFBL 1NUDA 2CDGA 4LASH 5EFIB 1UWGH 1WCBA 2W9EH 2LU4A 1VFAA 1JTTA 4NQEB 3OX8A 3MOBH 1BJMA 1J0JA 4OIAA 4I0PC 1DDHA 1LO3L 2D7TL 1F4YH 4EDWH 2FB4H 5ESVA 2GYSA 3FFDB 4JKPL 1AGEA 3FT3B 1YJDC 1XMWA 4YXKL 1YEDB 2XQYG 1BM3L 5M95B 2CLRB 5DVNA 4CNIA 3NOIA 3ZYJA 5L2KB 2DQJH 2QHLA 1Z0NA 3C6LA 3UYPA 1S5HB 4XX1E 2X40A 2VLRB 1WAAA 3G6JE 3QIWA 4JPVL 2X41A 3QA3B 3CPLB 4IRSD 2LFGA 3B9KC 4JHZA 2HMID 2OXHA 5BS0B 4RDQF 1VACB 2FZ3B 5EA0H 1U93B 2FYYA 3QFDB 1I1FB 2MNUA 4NKMA 1UCBH 5IBTL 1I1CA 4X4ZA 4OUUA 2DQDL 4QGTA 4NNXB 2AQ2A 3S8WA 3WEXA 4NKIL 1CR9L 4R90H 5ESAB 2A1WH 4KVCH 4J3TA 4V1DA 3VWKB 5J06A 2LAGB 1OSZB 1KTKE 2A0LC 1QLEL 5C1MB 4DOHE 4X5WA 4GQ9H 3HAEH 3GKWH 3CFEA 3S88L 4CUCA 4LSUH 4YXHH 1W8OA 4ZPVA 3V9FA 4XWGH 5L0QC 1XCQB 4KQ3H 5DUML 2Y25A 3O9WA 1HH6B 3P30L 3U9UA 3MJ8A 4R97B 4Y19E 2ZKHL 5I75C 5CIPH 3ESUF 3GMRA 3MJ9A 4HJGB 5EZIL 2HT4C 4TRPL 1U95A 4XCNA 3VRJB 1ONQA 4OGYL 4P5TB 2A6KB 1QLFA 2A6KA 1D9KD 5F44A 4GRLA 5C0BE 3VDBA 4OT1L 4QHUA 4Q0XH 4BSWB 5KVDH 4XBPB 5J1AA 1KCVL 3GBNL 4LPCA 2P8LA 1SHMA 3QRGL 4M1CC 4PJXF 1WC7A 3BGMA 2FR4A 1NAMA 1IC7L 4YHYB 4CL7A 5B3NA 4ZQKB 2Y9RT 5AUMA 1LMKA 4N5ED 5B4MC 1IC4H 5D1QA 1G6RL 4X6DA 3UO1L 3UBXI 4HX1A 5D5MF 1JNNH 4DAGH 1N0LA 3DETD 3EOYG 4IDJH 5FOJA 1G7LB 1QFUH 3TN0D 5DC0A 5GIRA 1FG2A 4OFVA 5AAMA 1FFOA 2HVJA 4JZJA 1S78C 4X8JB 1AGFB 1BFVH 4NM4L 5SV3A 5ACZA 4PJIA 2VLME 1UQSB 3ZL4L 3SKMB 5ALBL 5GRVK 1UZ6E 1YNLH 4LHUD 4NM8H 2RGSA 4DCQB 4OZHA 3LQZB 1G0YR 1X5LA 1R3LB 1IAIM 1KYOK 1DQLL 1MFBH 5HGBA 3VCLB 3AAZB 1IC4L 2YKLH 3QHZL 1MLBB 4JFQB 4F7TA 5CEXB 1FL5A 4XVSL 3GB7A 1FYTA 2JCCF 3P4MA 1NBZA 3PWVA 3MLTB 5KANG 5F88A 1EHLL 5T1DH 3I84A 4HIJB 1BBJA 5DMGC 2W59A 3H3PL 5DDHB 5HYSA 1LWRA 5D1QD 3GBNH 5TDOA 3CX5K 1MCOL 1TZIB 4FZ8L 1FPTL 2EDBA 3L3DA 3D69B 4FQJL 5KJRH 1EERB 2QSCL 1A1NA 5CZVL 3CVIL 2F5BH 1WWCA 5HHVH 1V3KA 1MREL 1ULVA 5J8OA 2FGZA 2UZXB 1KB5H 1QFWH 2CK0L 2OSLB 5DK2A 3IDMA 4RQQA 3GJFB 5C0CE 3L9RA 1CU4L 3HAEB 1IM9B 1EBAA 3QO1A 3L3HA 2FH8A 3SDYL 1UB5B 5B38A 2BY1A 3QWOA 1EXUA 2YD3A 2FNBA 4XGZA 4H5SB 5I71C 3QR2A 4PLJD 4HIHA 4FNLH 5HXMA 4HFWA 2FEDC 3ULUF 4OFYD 5MENE 2CKBH 1G9MH 3KAAA 4PRNB 5I73B 3PWLA 1V3MA 5IFAH 3KDMB 5IG7B 1SEBB 5DJYA 5CWSA 2BHZA 3QIUA 4JFOB 4G8EB 1B2WH 3KLAB 5C6WH 5C0EA 5K33A 1FAIH 5FM4A 4XXDA 2DYPA 2OTWA 3DUHA 3QUML 4OCYL 4L8BB 3CSPA 2B4CC 3MA9H 3VXTA 1WBYB 5JW5A 1AH1A 1RUQL 2GTZB 3P0YL 3VFTA 2HJKA 1EMTH 3C08L 2IBGA 4PFEA 4RFNB 3TVMA 3S34L 3W5MA 5LCVH 1WQVT 1T5XB 3AB0B 5C0RH 7CGTA 1QUNA 2NY5C 4LMQE 3U30C 4U0RB 1CTOA 4FQ2L 1YMMD 1UB6B 1BEYH 1HNGA 4NO3A 3V0WL 4CMMA 1K6QH 4OKDA 3E1F1 5SX4H 3SE3A 1K4DA 2V17L 1ERNA 4LKCB 1U6AH 1ZA3B 5TE7H 4GBXD 2PW2B 1RZ8A 3QIWD 3FB7B 4LP4A 3VG9B 5I18L 1I85C 1E0OB 1Z9SA 4JQIH 4IRZL 3OB0H 3ULUL 4LLUB 5M94B 4K3EH 4QRRB 1S9WB 3STZB 1AKJD 1GAFH 3WO4C 3FRUB 4ZFZB 4APQB 4C83B 4C83A 2VLJA 3PDOA 4PG9A 1EBPA 4GUPA 4CVXA 4EVNB 5ERWB 4MMXC 4N0UA 4F7MA 2DQJL 3R1GL 3ZZ1A 2B8OT 3SPVA 3NIFF 4OLVL 2E7HA 1NGYB 5JOPE 5DMJB 3VGFA 4HCRL 5BS0A 5ADPL 3NCYS 4FFVC 2XKNA 1JZ4A 1KCKA 4XH2B 5AD0B 1T21A 3OF6A 1F4YL 1QR4A 3LEXA 5IB5B 4NN6C 2KDGA 2XWTB 3PWJA 5JORB 4IEFB 5D2LB 1PKQB 4HUNB 1PKQA 1YYML 5L88L 4KZEL 1NUFA 4LSVL 2W9EL 3KYMB 3RTQA 4XP9H 3BEWB 5CEZH 1AHWC 4L1HA 4Q6YA 4X98A 4JRYD 3FN0H 4CMHB 3T0EC 3UXFA 5FA4A 5AAWA 1RURH 3ULSB 3QUXB 3ECBB 4P3CL 1I9RH 4I77L 5BW7A 32C2A 1YEKL 3UZEA 3BMVA 4W68A 1DR9A 5D7KD 5E03A 3E2HB 3CVHA 4OKVA 1JV5B 4F9PC 5I8EA 5DT1L 3VU2A 2E8YA 3SN6N 2BSRA 4M5ZL 3ROOB 3S98A 4TOYL 5SX5K 1FNHA 2R56L 3I85A 1A0QH 2C7UB 4UBDC 1XIWD 3H42H 4HF5H 5C6PB 1K5NB 2BSSB 5EBLB 1CLOL 4JFZH 5A16A 3THMH 1IGMH 1CLZH 4YWGH 1UKQA 4LIQL 3NCMA 3Q3GA 5ADOH 4WU5A 4WFGE 5GRUL 1BD2D 2ADIA 3BVNA 5F7MC 3VCLA 3AS0A 3GUTB 2OX5A 1AHWB 1FYHB 3NABH 1D9KC 3PP3K 5I1KL 3DXAE 2W1NA 3T4AA 2PUQT 5JO5B 5TDNB 1Q72L 2AK4A 5CEZE 4DGIL 4LIQH 3HRZB 3KXFA 2R69H 4Y4FC 3TCLB 2IBZX 4N1CA 4ZUVB 3IDYC 3WDIA 5EB9A 3W81A 1FNEA 2ESVA 2IF7A 2ZOLB 2OK0H 1OP9A 1TZHB 2DI7A 2QR0B 2V5SA 3MRDA 3MRDB 1RUAL 3CC5B 3S9DB 1NSNL 1F90H 2FLRT 4MB5A 3EOAB 4JO3L 4X7TB 2HP4A 1N6QL 2YRPA 2DKUA 4Q9QH 3P77B 1X5FA 3QEGH 4X8JA 1PQZA 2IFGA 5IW3A 3QWOB 3HMXL 2GUOB 3FN3A 3QEQB 4FXKB 4Q2ZB 2NYYC 3X13B 5TPWH 1IILE 2YXMA 4R4FH 3FFCA 4S1RL 2NY0C 4S1DD 1MFCL 3B9AA 2ITDB 3O4LB 5JIKA 5AG9A 5C9JB 4LLDA 1NGPL 2AJ3A 3QQ3A 4YWGL 1XGTB 5D72L 3DGCR 4JFDE 4RWYL 1ETZB 2BC4A 3MJ7A 4KTEH 3HNSL 2OK0L 4WU7A 4IRJA 3UJJH 4ZFFB 4ONFH 1HSBA 3S6CA 1RZFL 5DWUH 1KPVB 5EORL 5C08D 2CRMA 4HWZA 1P9MA 5D7IE 4BZYA 1A6TA 3BQUB 1UB5A 4NN6B 5F7LB 1DVFA 1V5JA 2NY7L 1Q72H 3AUVA 3MV9A 1X5AA 4PRIA 1U3HB 1J8HE 2BY3A 2APTA 1KCUH 4KPHH 1KCRH 3MBEB 1QEWA 4K3HA 1NCWL 5DS8B 5DS8A 3IJYB 1SJVA 1EHAA 4LSUL 2VZSA 1KBGH 2EICA 4G3YH 3D2UD 4I0KA 1B88A 2DJSA 1CLYH 3TPKA 3GJFK 3O4LE 3THML 4MB3A 1ZKAA 4G6ML 3U7YL 4PRPB 5GRXG 5HHXH 3HKFA 1IGTB 2HTKD 4I5BA 3RUGA 4KRLB 4JO2L 1A6UH 3OAYK 4P2RA 4NYLA 2NY0B 2YA1A 5DJXA 3CFJB 4RMWA 4RFOH 4DKEH 2ATPA 3GM8A 3BGAA 3ZYOA 1J5OL 3BRGC 4ZSOB 1HSAB 5DQJB 4MD5B 1MI5E 5H2BA 5DO2D 1BLNB 1X5JA 3ARDD 3UTPE 4OD3L 3GKWL 1JNJA 4YXKH 5HD8C 1E4KC 3GMLA 3MBED 2IANE 1T7VA 2VITA 2GJ6D 2FJFA 3JTSA 1X5IA 2GY7B 4XVTL 1XIWA 1BGXH 4LSSL 2XA3A 3TVMD 3VFWA 4KK8C 3UTQA 3LDBB 4OM1L 3U46B 2NZIA 4ZFGH 3QPQD 3OGCB 3GIZL 4X6FA 5IFJB 4HH9A 2PETA 2Y5TA 4G3YL 1WJ3A 1IQWL 2RIKA 3BP6A 1UXWA 2ORBL 3VXPB 2RFXB 3MCG1 2PW2A 4Y4HB 1ZHKB 5JOFB 5D1ZD 3MGTA 1RZIB 5C07E 1TNNA 4DEPC 3SKUD 2BCKA 1C5DA 2AEQL 4MXVE 4APQA 1KPRA 4QRPD 1SYVB 3O0RH 1U8OA 3L3JB 3VFNA 3LS4L 3EOBB 2KH2B 2E7LA 2XOTA 2W9LA 3F58L 1BREA 5E4EC 4I2XE 5GS0D 4PRID 4GJTB 3S5LB 3KPSE 4FQJH 3B2UC 3FQWA 5EO1A 5E2TH 2PW1B 4PLKC 2NNAA 1QACA 2WNGA 2UV3A 1UXSA 1NDMA 5DZNA 3TH2T 3MRHA 5DTFB 5I9QC 5DUBB 1VADA 3MXWH 1OARH 4M7ZC 5DC9B 5I1EH 1KJ2L 3N9GL 5DRNA 1YY8A 2JB6A 3BUYB 1VKXB 3EO0B 1WTGT 1INQA 3RUGE 2QSTA 4Z7OE 1U8LA 1A1OB 1UVQB 3SCMA 4ZUSA 1GZPB 2WIIA 2V2XA 4H0HB 4OZIB 1PBYA 4XPAL 3KPMB 2OBGA 3O3AA 1RK1A 1FPTH 2HLFD 4MJIE 3QXAB 1JGUH 2PTUA 3N1MC 2IH3A 5SX5H 5F70A 4U1IA 4BZ1H 2ESVD 4XPTL 1KSRA 4JO1L 1XF2B 5ID1A 1R3JB 1J12A 5GZOD 1XR8A 1YC8A 2D7OA 5D9SA 3MODL 2VDMH 1LD9A 3QUKB 3TO4D 4KAQH 1RD6A 2PCPA 3CXHK 3TA3A 3TT1L 3T0DA 1UZ8A 3QDJD 3K1KC 3KYKL 1U41A 1IVLA 3O4OB 2R39A 4NQXB 5E9DA 4HAGA 2LU7A 1EAJA 2Z92A 1P53A 1NMAL 4ONGL 4GAJL 1FFQA 3CZFA 1MEXH 1RIVL 2VDNL 3HUJA 3L5WA 5HI5D 8FABB 4ZFFA 1MQKH 1IAII 3MXVH 1VFAB 3G6DL 1EO8L 3FQNA 3H9HB 3TFKD 3LDBC 3N85H 4HWZB 3EYQD 3QDGA 2EDWA 4R4FL 4S1RH 4BQCA 2IGFL 4YGAB 1WF5A 3W0WD 2GAZA 2C1OA 2BHUA 1JWUB 5FF6A 2BNRE 5ENWB 4I18B 1HDMA 2RCSH 5GGQL 1NMBH 5I0DA 4LLDB 2VQUA 3PWPB 2BMKA 3IDIA 2R9HD 4Q7DA 2Y07L 5DJ8A 4ORGB 4E5XB 3WFBH 2YC1A 5A2IH 3JWOH 3QDJB 4PD4K 1DUYB 3V6FA 3SKNB 3LRSA 3FOLB 1CGWA 3QQ4A 4EI5C 2QQKL 2KPNA 4P2RD 4WEBH 4E41B 3MBXL 4XNZB 5EOTA 3V6ZA 3KJ4B 3PP4H 5ICYA 3PP3H 1NFDA 4M48H 3S36H 4FQQA 4WWID 1JGLH 2D31A 3RQ3A 1AI1H 2AQ1A 3B3IA 4R2GB 5F96H 2Q8AH 3VFGL 5EIQA 2ZG3A 4DN4H 3RVVC 1MCCA 4QCIB 5IOPA 4UQ3B 4DQOL 2DWEA 3FCTA 3LMJH 5CP3A 2P8MB 4OZHE 5ESVB 2A74B 3WFCH 5IB3B 2AKRA 1HHKA 5FK9B 2WUCH 3LRHA 4GRMA 1NFIB 5F8QC 1AXSA 4GBXC 1MCLA 1LEGB 1P4IL 3IT8D 5BVPL 2DQGL 1RZJC 2YEZA 2WP3O 1INDH 4DZ8B 4NZJA 5T5NF 2ERJC 5I76A 1KLGB 3BO8B 3QA3A 3PUCA 2XA8L 4MAUL 1MCHA 3RIFK 4OZFH 5D7IF 2APXA 1Z5LA 1YNTB 1RU9L 4K3JH 3BDYL 1CD8A 3LEVH 4N5UA 3I3BA 3HFMH 4L9LA 3DURB 1U9KA 2CR6A 5KVFH 2DQCL 4DVBB 4OM0L 3F7YB 4HBCL 4P46B 5FUZL 1QRNA 4JREC 3S34H 4JR9L 3H9YA 5HY9A 1BF2A 3S4SA 4HK3J 5J9PB 5GRJH 1OVZA 4OJFL 1J1XH 1U8OB 4ZFOA 1D6EA 1RZGB 4X6EA 5BVPH 1YPZF 1GIGL 1TVHB 3ILPB 3QULB 1FV1A 3TN0B 4NO0D 3C5ZA 4JZJB 5A2LH 1WK0A 3O9WC 4QOKA 3DXAD 4GG6F 3F12A 1JZ3A 4Y2DD 3RL2A 1XF3A 2P7TA 4NOBA 5HD8D 3LMJL 4NBYB 3MNWB 2E9WA 1HHGB 4PJBB 1R3LA 1BZ7B 2OS7A 5EU7E 1MI5B 1L0YA 5CKAA 3VW3H 4PB0L 4OCSH 3VDCA 5I8OH 2XQYK 3WFHB 3U46A 5INCA 3BFOA 4FTVD 1RJZB 1BZ9A 3PJSA 4HIEB 3GB7B 4U1LB 3M45A 1UWXH 5K59F 3FQXB 4AY0A 2C4FT 2P8LB 2YD8A 5EUOE 4F37K 1CFTA 4PJDB 4M7LT 1G7QA 3QUZB 3MBXH 5IF0B 4WHCA 5IJKC 3LKRA 5F3HB 2UYLA 4ETYA 1CN4A 3F62A 3OR7B 3ZHDA 4GLRH 4XC1H 1HWGB 4MQTB 2JIXD 4XCFL 2ZZUT 3NIDF 1F11A 5DMIH 3RWIA 5ISZD 4G6MH 3PHSA 4OFDA 4RWYH 2R23B 1L6XA 4CN1A 2VC2L 3NAAH 2P5ED 2R2BB 4KJWC 4KHXH 5L2KD 1QP1A 1FGVL 4ALAH 4LCWB 1GGUA 2IH3B 4DFIA 1VFUA 4EI6A 5DK2B 5GRWA 4U1GC 4P4RB 2QADB 5F1IA 1YEHL 4XPFH 3SDAA 5IMLB 1DLHA 5DLML 2AEIT 3ULVL 3PE9A 5FM5O 3BN3B 3C5ZD 5A43C 1S7QB 4U4BA 3X17A 2ZPKH 5E99L 3FQUA 2WIIB 3QP3A 3Q6FB 5MERA 1EMTL 3GSQA 3QNYA 2VABB 3EUUA 1JYVA 3KPPB 3CSYB 4F7TB 5CEXA 1R3HA 3IDUA 1RZFH 2VXTH 4JRYE 2JB6B 1NBZB 4GKSA 3IU4L 3CZFB 4PYHA 4E0RB 5HJ3B 3PXJA 4U6VH 1G9NH 5ISZB 3LSOA 1EH9A 5IB1B 4P4KD 2VLKD 3CSBA 3GBML 5K9JL 2P5EB 3V6BR 5GZNC 1EHLH 3P73B 4K9EL 4X4ME 3FN9A 4EXPX 2CQVA 2FHCA 4TNWK 3INUL 3QXVA 5CS7A 3TBWB 4HIIA 4YBQC 3LS5L 5DRXA 2HFEB 1CDBA 1WWWX 2I9LB 1SYSA 2R0KL 2VYRE 1BVKB 4KFZC 3HUJB 1MREH 4G9FA 1CFVH 2V9RA 4JFHD 1QFWI 3DROB 2EDLA 5E8EA 3BZFA 1S7TB 1C08A 2WP3T 4PJ8B 1MF2H 2R56H 3NGBB 3I6LD 1IQDB 2IG2H 1R24A 1FL3A 3MRKB 2NPLX 4E41A 3S35H 4AIOA 4UIKL 1KJVA 3VGAB 3DLQR 4HJJL 5IJKA 1HEZA 3SDCB 4ONHB 3PG2A 5CFHA 4APQD 4K3DH 4XBEH 2LTQB 1VB9A 5D8JH 4MVBC 1VHPA 4E5XA 5FUCC 5JW4N 2CDEA 4X99B 2X7LB 3HZYA 3CCHA 4FABH 2Q86A 4Y4HC 4PGJA 4L4VD 2ZCLL 3WFDL 1OAZH 4WGVB 1JHKH 3VJ6B 1U8IA 4GRMB 3BISA 5F89B 4J6RH 3TNNB 1WT5A 3HLAB 1JTOA 2JF1A 2B5IC 4D0BA 1XF5A 2H2SD 3B9KD 1OCWL 1VEOA 5JHDA 1JK8B 1J0KA 4AIZA 3BSZL 4NC1E 1TVBA 4PJHB 5F6IC 4D9RD 1I8IB 2K1MA 4OFYA 5ICZA 1M7XA 1CXIA 2ICCA 4KGLA 2DWEB 4XWGL 4IRSA 1VPOL 3N06B 1BM3H 2Z8RA 3ARWA 4UV7L 2QKIA 4U1SA 4XNXL 3SDXE 5DJCA 3F7YA 1EGJL 1JCKA 2R8SH 4ZG1A 4L4TB 5B38G 1I7RB 1LO4L 4PGEB 3C87A 1DQJB 1U8KA 2DLFH 1EFXA 2VH5L 4M7JH 5I1LB 3P9LB 3P9LA 1FVCB 3IJHB 4EDXB 4J3SA 2VAAA 1WFUA 3CSGA 2C9AA 1Q9KA 3DI3B 3F58H 2Y4SA 3KPRB 3KG5A 4R97C 1J8HD 3G5VA 2IALA 2Q20A 4QOKB 3NBNA 4CRPA 1BEYL 4WHTB 4P2OB 5CP3H 2X4NB 2YSSA 4XNUH 2AAVA 1WGOA 2HFFB 3FFCD 3O6ML 5KS9A 3V5HA 1KGCE 3QDMD 2FD6L 1MRCL 3VXNB 1NGZA 2XN9B 1IM3A 1YA5A 3L95A 4YHZL 4YNYB 4YNYA 5GS1B 1GPOH 2ESVE 1I9IH 3X3FH 3GNML 4DUWA 1MJ8H 2H3NA 3UDWC 5A3ID 2JCCE 2AV7B 5DURB 4ODHL 2UYLB 3P4NB 4PRHB 5E7FA 2BVUA 1BX2B 4XMLL 5A2KH 1IGYB 3GMOB 3CVHH 3UYRL 4Y5XC 3KWWA 4LDLB 3X11B 3H3BC 2DIJA 3ZKMC 1VGKA 4HIXH 1LILA 3NACL 5J9PA 3KPRD 5MEOB 3RGHA 2Z9TA 1KCLA 2E3VA 5C07B 5DJZA 1T2QH 3PL6D 5C0AA 5BQ7B 4O00A 2WWMC 2H9GA 1AI1L 4HLJA 1X4XA 3TNMB 4GBXB 1U8HA 1Z9MA 2ADGA 3C6LC 3RPIA 1NJ9B 3LPWA 4JRXD 1DZBA 3PDGA 3EOTL 1YYLH 4JG1L 3GMRB 3QAZC 4QRRD 4GRLD 4OZHB 3T2QA 3L5IA 1MF2L 4QO1A 4X9FA 4EKXA 3PIQA 2AXGB 3PIQB 4KV5F 4RFNC 5ACLA 5HGHA 2YWYA 2NY1C 2HG5A 1D9KA 4FQLH 4P0DA 4H25A 2ICWI 1XGRB 4TVSa 3JWDC 3BP4B 5D7LA 5D7LB 3S96A 3QI9B 1YQVH 3FRPG 1QSZA 2NY3B 3WUWG 4YXLL 3ARDC 5BJTA 1A9EA 4TSBL 4AM0A 1KJ3L 2H26A 5CBAB 5GS0H 2R2HB 3O45B 4NQUA 4U6XB 1RJYB 4Y2DA 1IAKA 3QUMA 4N1HB 2IAMA 4R96B 4GMTH 4PJGB 4R96A 5DD3L 1RJLA 1QFOA 4MNHB 1RZJH 1HH9B 4L9LC 1NL0H 4NO0A 3M17A 5I66A 5K9OB 1QRKA 4OD1H 1KT2B 3L3GB 4BH8B 5GZND 1CTNA 1D5BB 3MGOB 4O58L 3K4DA 3QUXD 3DROA 4M6OH 1FFPA 4PJ9A 4AG4H 2R29H 3NIGE 1OAXH 4M6ML 3DGGA 2OYPA 4LFHD 1R3IH 1IQDA 4FQCH 4GMTL 2AABH 3VFOA 1WAAE 1C16A 1HK6A 1H3XA 1S3KL 3I3EA 1Q9WB 4HS3B 1MIEH 3EYUL 4WUKL 3NABL 5GGTL 3FB5B 4NCC2 2BOCA 1YEHH 4XPFL 4IRJC 4JZOB 5DUPH 2H45A 1JHTB 4JN2B 5D5MA 4MNQB 4OZFG 4KDTA 3QO0B 1UKTA 4X80H 3LKQA 4FQLL 2ZCHH 3PGCA 5B8CC 5D4QA 3GMLB 3ARDB 5FUCE 4V1DE 4RGMB 3AB0C 5EUOA 3WIHH 3BXNA 1PG7W 5IMMB 4J2XA 2D0GA 5C2BH 3TBWA 1T20A 1B4JL 4LSTL 2BJML 4G6JH 1YEEL 1A6AA 2MCPL 3RWHB 1TCRB 1TCRA 3WFEH 4JVWA 3ULUE 5I1CH 1F42A 4G8FA 4JG0H 3MRIA 4XP4H 3P30H 4D0CA 1BFTA 2GT9A 2XNAA 3FTGB