1RUML

Crystal structure (f) of h2o2-soaked cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at ssrl beamline 9-1.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
218
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 53
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumL01
1C16A 5K9OB 1ZK9A 1KT2A 2EDJA 5ANMA 3W2DH 1F4WH 4PUBH 1VFUA 2Y5TA 2YSSB 4J4PD 1J18A 4MXVF 3ZSSA 2ZUQB 5ENWA 2EZ0D 3VFPB 3TO2B 3FAWA 3SDYH 1IM9D 2VSCA 3W0WB 3RJDA 3OKOA 5K9JL 4X7TA 2EYTB 1R24A 1KCKA 4PBXA 2F19L 4Z77A 3D25B 1I8MA 2YWYA 4PJEA 4H0HB 3LY6A 1FFPA 1KCRH 3CSYA 1UVQA 2XG4A 3L3KB 5D1ZD 2VDPL 3TPUB 3U4BH 1CXEA 1CF8H 5DD5H 2B1HH 5FA4B 4CJ0A 4X8JB 4M8QA 1IT9H 1I3RA 3F5WA 3KYKL 1WQVT 3IXAA 2E8ZA 4PJXE 2UV3A 2XQYK 5C0CE 1S5IH 1D6VL 1J8HB 4C56E 3OF6A 3C8KA 2DLIA 1MHEA 2VXSL 4LFHG 5TE7L 4RGOL 4DCQA 1KYOK 4KK8D 3WNNA 2VDQH 2OR8A 1S5IL 1ZT1B 3KDMB 1BQUA 3V6FB 1QFUL 3G5VA 3MV7A 5EZLB 2XV6B 1U58B 4JQXC 5DHVA 2J5LC 4UV4H 5E8PA 5ICYB 2QKIA 3BKJL 1IAIH 3IAGC 2VAAA 4LMQI 2G5RA 1KPVA 1DBBL 5EIIB 3HB3C 3TO4D 3RY6C 1F2XK 3L95B 2R2BB 3JTTB 5JPNB 3I6GB 4EN3C 2DDQL 1UADC 5JMOC 3G08B 1R3KA 3C6SA 4FTVD 4IDLA 1OGTA 3KR3H 3VH8B 3TCXA 3N9GL 1H3TA 4U6XA 2G5BB 3SOBH 4NN7C 1ZTXH 4N5EC 4OJFL 4AIZA 4BFGA 4JKWA 5JOPD 1RIVH 4K23L 4YC2C 3ZMRA 5ID1A 3G9VA 3V6OC 3ARED 2VJXA 1ZWIA 1B4JL 1WFUA 3VXUB 1ZLSH 1BQHA 1EO8L 1Q1JL 4LIQE 4Q9RL 1QACA 8FABA 1DCLA 1DVFA 4JFQB 3X13B 5ICZA 3O81A 1ZLSL 4KKAD 2C9AA 5DEGB 4NZDA 2Y72A 1QNZL 4EDWL 4WJ5A 2AXHA 4V1DB 5MERB 2DS4A 5I9QC 2YRLA 3MLWL 4G3YH 4KJWD 4PG2A 5E00B 1KB5H 2P47B 4MSWA 4P5TD 5IEHA 1CDIA 3QG7L 3TBTB 2QSQA 4MHHI 1NBYB 3NPSC 3BWAB 5HHQA 5SX4H 3S36L 5GISH 3WO4B 2GI7A 1FZJB 2VR4A 2IANA 3OAYK 2AJYL 3IDUA 4QWWC 5D1XB 4QF1B 5F7FA 4OF7A 4QHUA 3CFCH 3I02B 4D0BB 1KEGL 1UXSB 3FO0H 4KTEH 2OK0H 3HNVL 2ZPKL 3UDWC 5L2KD 4XBGB 1HXYA 3R0NA 2P5EE 4N0YL 5AZ2H 2ZUTA 1MCWM 5JXEA 2EDBA 5JPMA 4Y16D 5DURD 3ZZ1A 4OLEA 2FIRT 3RTQA 2CH8A 4POZD 1FJ1B 3MV9A 5DSCA 5DQDH 1RPQA 5HHNB 3EOAB 1Q9OB 3MRLB 3KPPA 5F96H 1P53A 3DBXA 4G43B 5FO9A 3MV8D 4WFFD 3CC5A 3BQUB 3HR5B 3B6SB 5HI3C 1WV7T 4EQ3A 4NC1E 1KJMB 1SHMA 2W65A 2FZ3B 3C5ZD 3EBAA 4WO4B 5B38A 1S7UA 4ODVL 3FFDB 4Y16B 1MPAH 4Z76A 3FN3A 3QI9D 1KG0B 4TOYH 4JREC 1FNEA 1U95A 3MLTA 3GSRA 1NC4A 4Y4HC 1QBML 2XG5A 4LBEA 4TQEH 5EU6E 1DQLL 4PJ8A 4GUPB 1IMHC 2DQUH 3DVNA 1EIBA 1CCZA 3WIHH 4EJ1C 2AK1H 3C5SB 4HWZA 4YWGH 2EE9A 3DX8B 4X80H 4QRRB 2FYYB 2H2SD 2VABA 4UOW1 3IAPA 4XH2B 4M6ML 5CUSH 2AK1L 1T2JA 5IESH 2JIXD 1I1AB 4IOFC 3LV3A 2BHYA 4NWTL 2FR4A 3ZHDA 1MY5A 2XKUA 3ZTJH 5GGRA 5DYOB 5I30L 1J1OL 1Z0NA 5MEQA 1A3QA 1F4XH 1PQZB 3LAFA 3B2VL 3ARQA 3SDCC 1WFNA 4F7TA 4HIXH 5ITBH 3H3BC 1RK1B 4N8VA 5L8JB 2I27N 1NANH 4XCYA 1ZLUK 3U48A 3K2MC 1JF5A 2AJ3A 2P5WE 1JHTA 2VXUH 4HIXL 4XBPB 2HYMA 5D71H 1WITA 4CBPA 5E4EC 4E41B 1BVKB 3VGAB 3IKCA 5FHBL 4NJ9H 2VXUL 4MQXD 4CMMB 4DGYL 2X1WL 4GRWF 4ZTPL 2FX9H 1IGFL 3N9GH 2LE9A 2Z31A 4U6YB 2GAZB 4F9LA 4OI8A 2RJMA 1HSBA 3NABH 2DD8H 1VEMA 4ODBD 3RKPA 2AJUH 3WNMA 1U3HD 2PTUA 2GUOB 4H0GA 4R0LB 2CRIA 5HHME 5I8CA 1Q0YH 4YHOH 1MH5A 3LS4L 4JFPA 5ENWB 5D2LE 3EUUA 3T2QA 5J13C 1MWAB 3TO2A 3G5ZA 2XWBA 3GMRB 3QDJD 3BP5B 2WBJB 3O2VH 5C2BL 5CSBA 1T4KA 3ARDC 1RQ5A 4G6ML 4NGHH 3OR7B 4PRID 1TJGL 3NCBB 3WJLC 5IMOA 5J6HA 4F7EA 1QPXA 3R06A 3GI8H 1WCBB 1GCFA 4F57L 3F5WB 3MXVH 4I1NB 1WAAA 4JN1H 5ESAA 4Z0BL 3TBSB 2G60H 4OAWA 4F33B 3VW3L 2P5WA 1A8JH 3P0YL 4GH7B 1INEH 2EXYC 3MXVL 1I3GH 2VWEE 4DCQB 1MREL 2D7TH 4X6DF 5AD0B 1EEZB 5CSZB 3AS2A 4G8EA 1ZT1A 4MJ5A 3V6FA 1SYVA 5T1LD 1QHOA 3U2SA 1IE5A 1CGVA 3WHXA 4XVTL 2ILLA 2J6EH 4GKSA 5CGMA 3H7BA 4YPGB 1JHKL 2QKIB 4J23A 2VAAB 3ZYZA 3WV0A 4CMHC 3REWA 2BK8A 3QWQB 1R0AL 1C5BH 1I7TB 1BJMA 3JTTA 1OP3K 3OAYH 1CQKA 3C6SB 2DQJH 4MNGA 4PJ8C 4PJGE 4OLWL 2G5BA 4LSPL 2XZAH 3QWRA 4YHKH 1G7PA 3EYFA 3CSGA 5D7IE 3BHBA 1T1ZB 2V5MA 3P9MA 5ID1B 1UWGL 1T03H 2ZUYA 4NP4H 3MGTA 4Z7NE 2YHGA 1RZFL 1ZWIB 4GQPH 5JA9A 2IH3B 2VSDA 2APVA 4CW1A 5EOTA 1QD0A 3PWJA 2BSSB 2ESVB 3DMMB 4HH9B 2E7CA 4KKLD 2NY7H 3CFKB 4OZIA 1A6ZA 3VCLB 3BD5A 4QRQB 2P5ED 2JK5A 4MNQE 3OKYA 1PGRB 1RIUH 1P84J 1RY7B 3RGVA 4ELKA 2NYYC 4JY5H 2VLMD 5DD3L 4XCFL 1T0NB 7FABH 5MI0C 2DQTH 3V6ZA 4PY8I 4AEFA 5B39B 2RBLA 2R1YB 2NW3A 4TUJB 2D0HA 5BOPA 5T1KD 2Q76B 3A67H 4C4KO 4Y0GA 3UCRA 1ZVHA 5D7LA 4IHOB 2EKSB 3DO3A 1DE4B 2VE6A 5TDPB 2FLRT 1WAAF 4M7LT 4F37K 5I1GH 3U4EB 1JPFA 1HIMH 3PDOB 1J1XH 1FNGA 2BX5A 4OCRH 3OKNB 1NUNB 1WJ3A 4HUMB 2E9WA 2LTQC 2YMXH 4PB9H 5TE6L 4LSVH 3O3AA 5HHOA 4CL7A 4FXGB 5D93B 2GK0B 2GIYA 3BIAX 4NQDD 3EYQD 1XF5B 1KIRA 43CAB 1J8HE 4APQD 5TGBB 2AK4E 3FQXB 4K7FA 3UTOA 3WLWD 4G3YL 2Z92B 1DVFD 4BJLA 4G43A 4KROB 3QUYD 4FFVD 1W72L 4HUUA 3EDKA 3UPRA 5JZ7D 5A3ID 3KNBA 3IB4A 3HR5A 1UKSA 4PJDE 1MJ8H 4U1IA 1NCCH 2HJKB 5CSGA 7CGTA 2AV1A 1CXLA 4U1HB 1SJHA 3T2PA 3RA7H 1MOEA 4Y16A 3HRZB 4M7ZC 5HI5D 1INQA 3KXFE 4KI5E 4DAGH 2R29H 3TA3D 1EBPA 1JNHB 3PWLA 3CXDH 1CICA 4GFTB 4XAKE 5SX4I 1CZ8L 1RUPH 1QA9A 4JQIL 4OCMC 4JM2C 4TRPH 2ENSA 1OAQL 5CP3H 3NZHL 1ZANL 2XTJC 1VADA 2A6IA 3L3DB 1JPSH 2VYRE 2VABB 2BNRE 1HHJA 1KIPA 4ZNEE 4MJ4A 3PHOB 2YK1L 4JKLA 3WIFB 4BK5A 4YR6B 2V2XA 4KJPD 4M7ZB 3WFZA 3HNTH 2Y06L 2DQHH 3TO4B 3OKDA 1NMBH 4WV1B 1A6TA 1I3GL 5TFSH 1JFQL 2O5XH 5F9OH 2MCPL 1A0QL 1N6UA 3AU1A 3SPVB 2IQ9H 2JCCE 3D39B 3DTXA 3HI6H 3PWPB 5C0AB 4P4KD 3VXNB 1UEMA 2MQ0A 3MA9H 3QEUA 1UWXH 4KVNH 3T0EE 5TQ2H 3FT3A 1OWWA 3H3KA 3BZ4B 4HIIB 4WI5A 2AQ3A 2GSGA 2W60A 4XI5D 3MA9L 1QSFA 3BEWB 3MREB 3D1MC 1KELL 1IEAB 4CNIA 3DGCR 4XWGL 4QXTA 1N2RB 3EOTL 2VXVH 5C07A 1KUMA 15C8H 2E6PA 4KU1A 3GSWA 2ZCHL 3VXQA 2B1AH 3QP3A 2GITA 2W9EH 2GAZA 5F44A 5E5UB 5KVGL 5A2JH 2BHUA 4K9EC 3GJFB 2VWEC 5SWZD 3NBNA 4KJQC 1NAMA 5GS3A 4P2QA 1LGVA 5DK0A 5HDLA 3BP4B 1B0GA 4ZTOL 4XCNB 1GGBH 3I6KA 1N64H 1B6UA 3RVWD 4LRIA 2BY2A 3CMOH 5I1LB 1C12B 3GHEH 3P0YH 1HDMA 5DA0B 1JNLH 1FLTX 1T4KB 5IW6B 5BV7L 2Q8AL 5E99L 5EBWB 4S1RL 4ZNCD 1D9KA 4FQ2L 5HVFB 1YEFH 1ZEAL 1TTFA 1XAUA 1JUFB 2BFVL 2NXYD 2NNAA 5KG9A 3UBXG 4BYHA 3AAZA 2K7PA 4TN9A 2FHFA 3VRLE 5FO8A 4OAWB 3BH9B 3SDCA 1NMCB 2DL9A 5I19L 3OXRA 1AD9B 1JTTA 3C08L 3VG9B 3GMPA 1ZHBA 2DB8A 1EEYB 3C60A 4R4FL 3PGCB 5I9QB 5E6IA 1R5WA 1KYOJ 2PO6D 4XMKL 3VGFA 3AXLA 5I15H 1CFSB 3H9HB 4NN6C 5EC2A 1SYVB 3AREB 5CZXC 1LEIB 4LCCC 3BGFC 3GDBA 5CHNB 2DIAA 3WUWB 2VDKH 3H7BB 3KG5A 1MHCB 2YD4A 2R69L 4NT6A 1Q0XH 2NXZC 3HE6A 5M94B 2NMSA 4GRLD 1MCEA 4NBYB 4R6UA 2Y7QB 4WFHD 1QFWH 5DRWA 2ZKHL 4Y4FB 3MGAA 3AM8C 4P48A 3WE6A 1MJ8L 1FL6B 1AP2B 4JR9H 3VFUB 3D18A 1NSNL 3GIVB 2P48B 4H8WH 3HC4L 1P6FA 3MGTB 3QWRD 3NAAH 5INDA 2APWA 1QBAA 1LO3H 4ZUWB 1IGTB 5I1CH 2EDXA 2ICWA 3PJSB 4N1CA 4OF0A 2VIRA 4GLRH 2JJVA 1PEWA 3HC4H 4MZ3A 2C7UA 4JFFB 1QTYT 3SGJA 4ELMA 1WTLA 1UT9A 1ZGLM 1SYSA 3MRFA 4BUHA 3ARFD 4RBPH 2EH8H 4RMRA 3OB0H 3EDEA 5F6HJ 5FCUH 4OZ4A 4GW5A 1K5NA 4ZUSA 1S9YA 5IW1A 5FYLL 4QRQA 1IL1A 5GGSA 1G9MC 3WLWC 5C0GB 1YNTA 2NY2C 5D9SA 3V5HA 4EI5D 4OFIA 1QLFB 4LSVL 4M3KB 4IM8A 4XX1G 3LB6C 4F2MB 4MXWL 3LIZH 2DIJA 5DJAA 1LEKB 1WEJH 1EFXB 4NHUA 4IHOA 2X4PB 3EGSB 3TIEB 2DQFA 1DE4A 3SQOH 1TPXB 2VE6B 5TDPA 3J8F7 2HFEB 1JZ7A 1RMFH 3D85B 3PDOA 3U7YH 3AS3A 4ORGA 4F15C 5FYLE 5EUOB 1EHXA 3OTTA 3W39B 4ESKA 3RDTB 1CFNA 1LWRA 3B9AA 1BD2D 4K8RC 4UILH 4NQED 2XTJD 4TVPD 3Q6FB 5HGBA 3B3IA 4MS8D 5DD3H 1DUZB 1U3JA 2ZCLL 2A9ML 1V7ML 3BZEA 1JNNL 4WGWB 4MD4B 3ZKXC 1KIRB 4Q58C 5TGBA 1AO7D 1IKNC 2GT9A 5D7LD 1QFWM 4RAUB 2EDKA 1QUNA 5TF1L 1CLYH 5I1AA 5AUMA 2YXFA 2IADA 1FFOB 4U7SA 4YZFE 1R3HA 1J88A 2Q1EA 4FMKA 2PXYC 5KW9L 3RX8A 4P23B 2AJVL 5KOMC 4HIJA 1A1OB 1TQCB 4Y7MA 1FPTL 4RFOL 4CVZA 3VA2C 2IEPA 3H9SA 1U8HB 2ZUUA 4NFBA 1I1FB 4U6VH 3FKUS 5M95B 1JNHA 2W07A 3FMGH 3PWLB 1U6AL 4MMZC 1FC2D 3EFDL 3LKSB 3RU8H 3UTZB 5FUZH 4U6VL 3RIAF 3IU4H 1FDLL 4NQCE 2EIZA 4KKCC 2DD8L 1CL7L 3L3DA 3F12A 4C55A 3ILPB 4H26B 4DZBA 2CDFA 4S1QL 1ED3B 4O5LL 2VLJE 4ODSH 2MPAH 1OGAE 3DLQR 4M7JH 2CIKA 2LVEA 4ONGH 5BS0E 1ETZB 1WIOA 2B2XH 3BO8B 5D2NA 4XMPL 1NC4D 5IVNA 1XZ0B 2I5YH 2Y07L 3FB5A 4PJBF 4KRNA 1YY8B 3L5HA 3VXNA 4AYFA 2NY2B 3PWNB 1QSEE 1OLLA 3QEUB 3RZCB 3O45A 1WAAE 5E70A 4LIQL 1K8IB 3BZ4A 1E6JH 1F8TH 3JV4A 4OKDA 3MREA 3G6JA 4NFDA 1UZ6E 5D96C 2XN9B 3PWVA 4AZ8A 5MEND 3QB7C 4I0KA 4Y5XA 1LNUB 4KKBD 5C0BB 4L8SA 5H37G 4XPGL 1X5KA 3EDFA 4YX2H 4MJID 5DMJB 3W2DL 3UJTH 4NO3A 5SWQB 1QKZL 1DQJA 2EE2A 5IQ9B 1KGCE 4U0RC 1JHLL 3NH7H 3SDXF 2I24N 4R7DA 4PJDF 2EXWD 5GRWA 3ARGB 5L9DL 2J7LA 4KMTH 3I6KB 3RNKA 2P8LB 1A47A 1DLHB 5DWUH 1WF5A 5I1LA 3MLPA 1C12A 4WI8A 1EDQA 5IFHH 1PLGL 4KRPD 1Q9KB 3U9UA 2ZSWB 3ZDZF 5D5MF 2OL3A 1JWMA 5DUBA 3VMOA 5J1AB 4ODHH 2NXZB 4V1DD 5LQBH 4U1SB 3UJJL 3KWWB 1HINL 2J88L 3KPNB 4PREB 5T3ZE 1EGJH 3RP1A 2HP4A 3GJEA 1W0VB 4ONHA 4PRNA 4Z0BH 4B5EA 3E8UL 3BESR 2J8UF 1JV5B 1ADQL 1T7ZA 1AD9A 1KN4H 3MJ8A 3OXRB 4P57B 5HGHA 3TV3L 1DFBL 3F7YB 4I3RH 3PG2A 5KBNC 3SDCD 2BY1A 4WEUD 2YUZA 3V0AC 4JFYB 3SEPA 4FRWA 3BKJH 3MRQA 2PYED 4HCRA 4IEFB 3WUWA 3QXWA 1VACA 5AZ2L 2DDQH 1RZJL 1LO4L 3T4YB 1NDGA 4JANB 3V4UL 4HWNA 2R0ZH 3BGAA 2VZ3A 2VXTH 5IBUG 5C0JB 2Y7QA 2DBLH 5F7UA 4FFYL 4UDTA 1ITCA 4OZIF 4ZS6C 1OAKH 3OPZH 2AXJA 3HMWL 5D70L 1FL6A 3FZUC 3VFUA 5JW4Q 3TM6A 1H15B 1N7MH 4F9PC 1KPUA 2V9RA 4XHQA 3ULUD 4HS6A 5HDOA 3WHE0 5L0QC 4YGAB 1NMCC 5C92A 4PJBE 2XZCL 1HZHL 3ESVF 3NMEA 3QIWC 4WUKH 5I1JH 3VGAC 1U91A 3VGGA 5IW1B 1G7IA 4MQ7B 4HX1B 1IL1B 1QFWL 5J7CC 4HK0B 4TTDC 2NY3B 1FNAA 4POYA 3UC0H 2XY2A 5GGSB 5C0GA 3BZDA 4S1QH 3F7VA 2IWGA 4M1DH 4X6DB 3BRDA 3WXWL 2HT2D 4WWKD 3LN4A 5BV7B 4GO6B 2WANA 3RUGA 4NQCD 3ORJA 3ES6A 4Y16C 3UO1H 1TQBB 4LF3B 2CK2A 3EGSA 4KTEL 3VMPA 2F5BL 1H3UA 2HFEA 2I07B 4P3DA 2NXYC 4L1HA 4IOFD 3KVQA 3T09A 4K71C 1N0LA 4QXUH 4ELME 3QCTL 1I9JL 1ZT7A 3HC3L 3B3IB 3T0WA 2IPKB 3VWJC 5KVEL 4BFIA 4BSJA 1R3IL 3MROA 3O3DA 1A7RL 5DRNA 4GAGL 5DHYA 4M1GH 1DANT 4RNRB 2GT9B 2BDNL 3WKML 5BMFH 3TH4T 4LQFH 1LP9F 1FQ9C 1JWSB 5IGXL 5FHAH 3EFFB 3GMNB 2IADB 2R4SL 2ICWJ 2P5WD 3ZTJG 2CDGA 3O4LA 1R3HB 5BXFA 4JLRB 4ZO6A 4HC1H 1TVHB 4XPAL 3MODL 5E4IA 3JTSA 3VFTA 3ZT7A 4HIEB 3RAJH 4P49A 5JW4N 1MUJB 1YN6A 4HC1L 2FJFA 7FABL 2WUCH 3HTLX 3L3IB 1MCDA 4LSUL 3VGDA 2MFNA 3L3HB 2CKBL 3LKSA 4POZC 3C6LC 4ACPA 2QSCH 4LVHC 5EU3A 4OLVH 2Y1VA 3TEUA 4LVEA 1MLBB 4Y4KA 1BFTA 3ARUA 2FEEL 3RDTD 4N0UA 5DD1H 1NAKL 3S37L 3ILPA 6FABH 3FQNA 4X8XA 2K7QA 1HINH 1OARL 1DL7H 3DO7B 1EGJL 3SHSA 1D5BB 4YAQA 4UUJA 1OT1A 3V0VB 3LDBC 5F70A 4PJFA 1W8NA 5IJVB 2PR4H 2XXMB 5CMAA 4M62L 3RL1A 1YMHB 4ZOEA 1BMGA 4QRSA 4WY7H 2EC9T 3SO3C 1MNUH 4NUJA 5FUZL 3DOSA 3PWNA 1FL5B 4U6HA 4OTXH 4X98B 5J6GA 1IGIL 1VA9A 1D9KC 1IEBB 2R0KL 3N1MC 1UENA 5KSAB 2JTDA 3JWDC 4H1LB 1NJ9B 1WBZB 1XH3A 2V17L 4Y19D 2VLLB 3O6FD 5AAMA 1I85A 1T21A 4MS8C 5ACZA 3DV6B 1FGVL 2P7TA 2CLVB 4OCYL 1F00I 2IBZY 2APTA 3BGFB 4X99B 1J05A 3U46A 3CXDL 3RL2A 3LN5A 3LEYH 2PCPB 5SWZE 5SV3A 3GRWH 4NN5C 3REVA 4QYOA 3FQRA 4XNYL 4OF8A 3GNML 5TF0A 3SE9H 4LIQH 4D9QD 4LU5L 3IJYA 2EDLA 4P4RB 3VG0H 2X1XR 4HBQA 4WFED 1CD1B 5CKGA 1X9QA 4FABL 4MX7B 1FP5A 4M8VA 4O51A 3HHRB 3ARFA 3DRTB 3NVQA 5CEZL 1FZOB 3UTSE 5D8JL 4A6YB 2P24B 4XTRD 2XTJE 3MUY1 2E7BA 3NIDE 4RRPG 1IGYB 1DDHB 4PJ8D 3FB6B 3MBEC 4RGNC 2IJ0C 4FG6C 4Q0XH 5T5FL 3HC0B 3VFVB 4RA3A 1ZEAH 3VXRA 4M9PA 2HWZL 4EOWH 5C0EB 1DR9A 1JK8B 3FB8B 2VZVA 3DETD 1GH7A 1JGVL 4KHTL 3QQ3B 4AH2B 4OLXL 5DVKA 5D96B 4YX2L 2X70A 3QUKB 5E8NB 1LVEA 1JZ8A 4RWHA 1U3HA 4WTXA 5KZCD 2W1NA 1NFIB 3RWDB 2A83B 2CO6B 4IRZL 1BZ9A 1G7QA 4APQB 4PJ5B 2UUDH 3B9KA 1NCWL 3MRQB 1W0WA 5DJ6B 1PZUB 5GZNC 1FO0L 1CGSL 4MQXC 1FORH 4LCIH 1N4XL 3RWFA 3RX7A 4UQ3B 4CVXB 2YC1A 4KUCD 3HG1B 3MYZA 1FCGA 4TSCL 2JKXA 1B6DA 1MEXL 3J7HA 4CDGC 5GS0C 5ITFA 4NQUA 3STZB 4ODXB 1DUYB 4YHNB 2DQIL 4Z0XA 5FYKH 5C0RL 2Z93B 3QR2A 3G5XB 4XTRC 3SDAA 1EJOL 1KPUB 2CXKA 1NPUA 4I0PA 5C0AD 3T3ME 1X6NA 2DLTA 2A9MH 2M1KA 4M7LH 4JAMA 5K9QG 3MR9B 4I5BB 1JIBA 3L7FB 1YEKH 5I66B 3S9DB 1DTUA 1YEJH 2PTTB 1EK3A 4JGMA 3GK8H 4N0YH 5I8KL 2YPLA 3C6LD 1G7HA 5IVXF 5C0NC 1AHWB 1CDHA 2MKWA 1ZHNB 4UAOC 4OBSA 4LGPB 3MRPA 3P4LA 4JG1L 2DAVA 4K2UL 4X5XB 2OTWA 4P23C 3MUGA 4G9FB 3FCTB 4XB8A 2CLZB 3CVHH 2AAVA 3NZHH 3U4AA 1JWUB 2YPVL 2OXGA 1T5WB 1GC1C 4HFWA 4JVWA 5J0BA 4HUVB 1XF3A 2GSIB 2OR7A 4YBQD 2PR4L 3CXHJ 1Q9LA 1I3VA 3MFGB 2VLKD 4JB9H 4OCXH 2DI7A 4WU7B 1BP3B 1CTNA 5GRJL 2DWEB 1JP5A 1AGCB 1NFDA 3ZE2F 4O2CB 5CEZD 3N1GC 5D7IA 3IFPA 4ZYKA 3NA4A 4XPFL 3DXAD 3PNWB 1U2CA 3O11A 2MCPH 4F37F 2FGWH 4IRJC 4TVPL 4RGNE 3T8XA 4J12A 4DQOH 4NZUL 1AXIB 2XZZA 4BFIB 3LQMA 3SKJH 2VDOL 1BOYA 2BSTA 2VLKE 4G8GB 1FVCB 1G7JB 2ZG3A 1EVUA 1TITA 3CJJA 5DHYB 1L7IH 3L5XH 4RNRA 3PABA 1X5FA 2WUCL 5ESVA 3ZE0E 3NFSH 3SKNB 5J8OA 1T7XA 2I9TB 1MFAH 3E0GA 3U79A 5DS8B 5F1IA 4OI7A 5DRXB 1AGDA 1CU4L 1QFHA 3I50H 5DUMH 5JDJA 4X7FC 5HVWA 5IBTL 3JTSB 3VFTB 3QQ9C 4JFEA 5FYJL 3K81A 4Y5VC 4WUUE 4UTAL 1YN6B 2FJFB 3FO2A 4ZXBA 3CFEA 1RJZA 4K94L 3FMGL 5JW5A 1MCQA 3DYMA 3WHE1 3HC3H 4GRLA 2AJZB 4PJ7F 2DLGA 3U7AA 4NJ9L 3O4LD 5IFJA 1HCVA 3ARDA 1T1XA 1N59A 2PN5A 2NZIA 4UT6L 1TZGH 2QTEA 4FA8A 5IM7A 3DO7A 4L4VE 3FFCA 1CDJA 1D5BA 4KY1H 4YAQB 2BC4B 3MV8A 1Q94A 4R9HA 2YBRA 4KQ3L 2P8MB 1V3KA 5H2BA 3SKMA 4LARL 4Y4HB 1T2XA 4JPIA 2FB4H 1WWAX 1YA5A 4UILL 3MXWL 4YFEA 4M43L 5C6TH 5KAQF 5D7JB 2FHBA 3AREC 3UBXA 4X0KA 4EDXB 5J06A 2VC2L 4PGEA 2F8VA 1NGPL 5IBUB 3X17A 5C08E 4OZGF 2XNAB 1FGNL 4OUUA 5ANMB 5SX5H 4D94A 4LPVA 1WLHA 2Y5TB 5J6GB 1XGTB 5KSAA 4H1LA 5DK2B 5F72S 1HEZA 5E2WH 1T5XB 3G5YA 4NGHL 5BVPL 3O6FB 5ICXA 4YHPA 2JB5L 3OKOB 3PV7A 4Y5YC 3KPLA 3TCLA 5KVGH 3GKWH 3Q1SH 4JJ5A 4RFOH 1DANU 4JKPH 3LSOA 5I1KL 4TUOA 4EBQH 5DGQA 1NKRA 3RVTC 4IMLA 2R0LL 3TBYB 1N26A 1UVQB 2NY4B 3L3KA 4LQ1A 4NBXB 1XGYH 3U6RB 2QR0A 4R0LC 4OIAA 3AY4A 1RHFA 4JDZA 3O3EA 2FL5A 2KUTA 3QDGB 4Q9QL 4QOKA 4AQ1B 2YPLD 3C6LA 2DBLL 4QRRD 1CD1A 4F58L 3WL9A 3ZE1F 4Y1AB 3VFSA 3B9VA 3M8OH 1FZOA 1I1YB 2XIDA 3HUJE 5JQ6H 2EYRA 1JYVA 2X9YA 2FO4A 4QHNB 3HRPA 1KACB 3MV7B 4OKVB 2NY3D 3MRDB 4JGJA 1NGXA 3UPAA 5HI5C 3RBSA 4LDLB 1YPZF 1U0QA 4MD5B 4AENB 3RJQB 1JK8A 3FB8A 5F7MC 4PJIA 1YUHB 4OT1L 1B4RA 2P5EB 1IGCH 3CK0H 3QPXL 4AH2A 3I6GA 4S1SH 3VD5A 3E8UH 4H25B 2VUYA 4R4FH 4FZEL 1TVBA 2MHAA 1BQLH 4U6XB 1INDH 5FM5O 3TVMB 1U3HB 2BERA 1D5IL 1ZA6A 2BRRH 2FBJH 3ZYJA 4LLYA 5EIQA 5JW3H 3VWJA 2JCCB 5BOZG 5EN2B 4GG6B 2JLLA 1N6QH 1CDYA 3CPLA 4OB5H 3A6BL 5H35A 5ICZB 1AQKL 1ZGLA 3RWJB 2AEWA 4NN6B 3RHWK 3KYMB 3GKZA 4MZ2A 1IARB 4RZCB 1JHLH 3KPQB 3TZVB 4U0QB 3LD8C 1BBDL 5MERA 4XPBL 2OJEA 4KRPC 4R4BB 3HZYA 2AJXH 1WICA 3PWPE 4PY7A 3N06B 3H42L 3O9WA 2KQMA 4CJ1A 5K9KB 1EHLH 1RULL 5IEHB 4AJ0A 1VGKA 1B88A 2BRQA 4HMEA 3TBTA 1XFPA 3W11D 2FECI 1S9XA 4OZGB 3BUTA 4Q9RH 2N4IA 4QF1A 3RIFK 3BX7C 3ILQD 3MMEA 4GSDH 4U1LA 3HB3D 2HTLD 3HAEG 1AXTL 2AKRA 2FH6A 2D7QA 5A2KH 4WDIA 5JPMB 2VNCA 3WNKA 4RAVB 4JFDA 2HRPH 1NFKA 4OFDA 6CGTA 4LSTH 1EUTA 4UOJA 1F6LL 4P2QE 2YPKA 1R5VB 3VXPA 12E8H 5DSCB 3RQ3A 2ARJQ 3BN3B 3TT1L 4JO4L 2IGFH 1I8KB 3DBXB 4J3UA 1CGTA 3EZJB 1RIUL 5HHMD 1Q9LB 2MPAL 4MQTB 5FO9B 5IBLC 4G7YL 2ZUSA 1X3DA 1G9MH 2E7MA 3LKQA 1I1AD 4LLWB 4HWBA 2UZIH 3NACL 1MRDL 2F53B 5D7IB 4ZYKB 3WFBH 4ZD3H 5IMLA 2VXTL 5I18L 5L8LB 1I9JH 3JZ7A 4Q6IB 3EJZC 2E9IA 3NIFE 2UWEF 5HD8D 1NGWA 2BSTB 3CH8A 3MRIB 4NRZB 1S7XB 1W8OA 3ZKMC 5ALBL 4OZFB 4Z7WB 1NCUA 5ESVB 1MFDL 2RR3A 3QRFM 4C58B 3P40A 3NPZB 5CP7B 4YO0A 4J4PC 1YNLL 5HHMB 1U8OB 2X4TA 5DJZA 4OV6F 5DS8A 4NQSB 4ONOA 1RZ8B 4WI6A 1A3RH 5F1IB 1OT2A 1HQRB 4X4XA 1MFEL 4FFZL 2AQ1A 3C09C 3WIHL 1A9EB 4YBHA 1L4IA 4R90H 4ZXBB 1RJZB 1AD0B 3LQZA 4Y8AA 2ITCB 4UQ2B 5B4MD 4F9LC 5MEQB 2CPCA 5CJ8A 4P99A 1MCWW 1X4XA 3HZKB 2CDEA 2A9NL 2XN9E 1VSCA 4GRLB 1FV1A 2X4UB 2EIBA 2GJ6D 4PB0H 3V8CA 4ZOCA 2AJ3B 4LGRB 3MRBA 1J0JA 2KBGA 2C3VB 3LD8B 1A6VH 4LASH 5CILH 5C8JA 1CFQB 1KCSH 3MV01 4TPRH 4XC1H 2FBOJ 2MWCA 1C1EL 1KT2B 2JJSA 1Z2KA 2IPUK 2F9BT 2UYLB 3IKCB 4DKFL 1Q94B 3K8LA 1D6EA 5DQ9B 5D2LB 3UTSA 5KJRH 3VFPA 4BSWA 4JPIB 4QY8B 1RJLA 3BD4A 3W0WA 5D1QA 4U6YA 5MP6H 4KK5D 5HHPB 2BJMH 1XIWC 2ERJC 2B5IC 2Q86A 4Z77B 2NXZD 5IQ7H 1HYSD 1KC5L 1FE8L 3TIDB 4NSKA 2CMRL 4EI6B 3SE4A 3O6LH 2W0FB 1IC4H 5FA4A 1IGIH 1RZ7L 2DLFL 4M8QB 4NFCA 1NLBL 2QHRL 3BKCL 1MH5B 3AGVA 1ORQB 1NBZA 2PO6B 3IJHB 4G80A 1WT5A 2YA2A 1N5YL 4FXLA 2DICA 3WS6A 2AXFA 4XPAH 2OX5A 1IGML 3PXJA 5C0BE 3C8KB 4MA8L 3K2UL 5IHZB 1GGYA 4JRYE 4AK1A 2FX9L 2X9WA 3NIGF 1PAMA 3S4SA 5F7EL 2J8OA 4Q74A 2R4RH 1UJTA 4MA8H 3VFMB 1OTTD 5F9JA 1P4LA 5DHVB 1XCQA 3CX5J 5IT2L 5GGQH 4MA3A 4ZSOA 3E6FB 3C2SA 5ESAB 1BVZA 4MMXC 2X4OA 3KLSA 4PJHE 3L95A 4PRHD 2L7UA 3TYGH 1FC1A 1A1NA 3NN8B 3WL9B 2O5YL 1X5YA 3KLHC 4F9PA 1LE5A 4OD1H 4LNVA 3GSNL 4B0MM 3S8WA 4AIZB 1RZGB 3U2SB 2YZ1A 1E6OL 5MEPB 3GO1H 1OL0A 2O5ZL 5KN5B 1TCMA 3B5TA 4WCYH 2WK2A 5CCKL 3UPCA 1I7TA 2P5EA 1V8HA 4FZ8H 3KLAB 5I8KH 4JFQA 3X13A 2E27L 3MJ9L 4NZRL 4QHKI 2YRZA 3C9NB 3BP7A 4FFWD 1IAKA 4JG1H 4BA8A 1N8ZB 3EYFB 4KKNA 1JF1A 3LKNB 3VWJB 4JPWH 1A7QL 5TQ0L 5FYLH 2VDRL 3V5KB 2GTWA 1WTGT 1EFQA 3F62A 4P4KB 3MACH 1NBYA 3GFUA 4GRMB 4L5FH 3KYMA 4NRXA 2IQAB 2WLZA 2Z8WC 2WSKA 4RZCA 4WHTA 5JXAH 5ISZD 5IF0B 3JBG7 3MLVL 3RGVB 2D9CA 1G9NC 1WC7B 3HE6D 4MAUL 1T0NA 1ZA3B 2X89D 5E2VL 4QLRA 3MO1A 3FFCE 4XNXH 5FIEA 1MVFA 1T7YA 2DTSA 1MF2H 2N7AA 3ZDYF 2XZQH 1PD6A 2NR6D 4WEBH 5E6ID 4IRJA 2O61A 1AFVH 1MFCH 3L1OH 3PV6B 4PS4H 3SGEH 3X3FL 3ULVL 5F7YC 5I2IA 1AJ7L 4KDVA 1ERNA 1T6WA 5J9PB 3QAZB 4PFEA 2F8OA 1QBLL 1W2KT 3CSPA 4KI5C 4NQEB 2NY5L 4MVBD 1DEDA 4WDIB 2VDLL 2ZG2A 4FQ1H 2G75B 3RTQC 2FZ3A 3OGOE 1BBDH 4GXUN 3SDAD 3U1SL 2BOBA 2Y25A 1AGBA 2YPKB 5KW9H 3L5JA 1KJ2H 1IC7L 3EO1A 4I4WA 4NN5B 2WW8A 3IU3B 3ULSA 3TZVC 1U8LB 5DJ8B 1NC4B 4W81A 1G7MA 4Y4KC 1IM9B 5DMKA 3QO0B 4QOKD 2A6DB 2FEDD 3WNLA 3O2DA 3S98A 4K7PX 1EVTC 3VRIA 1MCLA 1KEML 4GAYA 1UFUA 1JYWA 4XP9L 1KV3A 2AV1B 1CR9H 4DN3L 5ADPH 1SJHB 4HJGA 4MAYA 4C57C 1OAYL 1CLOL 1P69B 1I1AA 1TLKA 4YQXH 3GBMH 1C5DB 1ND0B 1QHPA 3WNPA 3IJSA 2R0WL 3QISA 3X3GH 1G1CA 2OQJA 2HJLB 1Y6NR 4JO2L 3SE8H 4QO1A 4RMSA 4OZFA 5GGRB 5CP7A 4YO0B 3HAEB 3H2WA 3QXAB 3BGMB 5C08A 1JMXA 1VADB 2A6IB 5J3HD 1N3NB 3ZSTA 2JB6A 5IVZB 3PIQB 3STLA 4PR5B 3W9DB 4DZ8A 4GG6E 4Y5XC 3THML 3QNXB 5EA0L 4X4XB 2OI9C 1JHTB 4TSBL 4YR6A 4K07A 4BELD 2V2XB 3LS4H 2XRAH 1MRDH 3WFBL 1WSST 5E9DA 3N50A 2GTZB 3MYJB 4OGYH 1ADQA 5HDQL 3VJ6A 3QWOB 3DSFH 1RJYB 5FV2A 4JRWA 1CLYL 3FN0H 3JWDH 4MVBC 2FHCA 2ITCA 4UQ2A 1N5AB 4U2ZA 4D9RD 4ZFGH 3OBAA 3TPKA 3SN6N 3S88L 1NCTA 3GHBH 1T0MB 4NNXA 1KTLA 3FHAA 1OCWH 2FX7H 4FFVC 3FT3B 4LDOB 4XMLH 5HYJE 5F6IC 32C2A 4QHMA 5TFSL 3KJ6H 4PP2B 2LFGA 4ENEC 5D7JD 1L7TL 5BVJB 3CGTA 3MJ7A 1HQ4B 3QNYA 3VRJA 5I8CB 1F90H 1F6AB 3BWUC 2PETA 1T89A 3EYOB 3NH7L 5DQ9A 1PZ5B 4AMKL 4IJ3C 3OKMA 2OJZH 1YYLL 4NNYB 3VWKB 1I9RH 1LO0H 3Q6GL 4L4TD 5I17A 2XT1B 5JHLH 5LAXA 1F90L 2H9GA 1ZLWH 3K2UH 4HLZH 4JQXA 5HHXH 4C4KT 3VG9C 4Z5RB 3EJYC 2WWKT 1MWAL 4NSKB 5CEXA 2UUDK 3MLXL 3CXHK 4P9ML 1A6WL 2DYPB 3QXDA 4JFDD 3MV8E 4WFFE 1BFOA 4HT1H 1NBZB 4YBLC 2PO6A 4G80B 2YKLH 1NLDL 5L6YL 4EXKA 3SE3C 1XGQA 3N85H 3MJ9A 4LVNB 2D7OA 1RIHH 2XQBH 3O6MH 4O2EB 3VD3A 4EBQL 2NYYD 3QXVA 1EEZA 1NCAL 3C2AH 1NCDH 1RZFH 2HLFC 5H8DA 1BFSA 2VDML 3C60C 3VFMA 1Z0MA 4K9EH 5F9JB 3WHXB 3CMOL 2AK4D 3ZL4H 3BFOA 3CX5K 3QFJB 2UZYB 1II4E 4I2XE 4JVPA 3QA3A 4WI9A 4ZSOB 2DJSA 2BNRA 3E6FA 4LCCA 4KKLC 3BAEL 1QFPA 4D3CL 2RHEA 3GMQA 2X4OB 1UYWH 5F88B 1K9TA 5I1DB 3IDGB 5IHUL 3WIHA 5T1DL 3OZ9H 2WBJD 3X3FH 2HT3C 4YDVB 1ITBB 2MSPA 3KGRA 1OTUD 3PGCA 1BFVH 5E6IB 3WO3B 1KBGL 1SEBB 1CFSA 3H9HA 3S7GA 3SGKC 1OP9A 3GSVB 2YS4A 1LEIA 2X4RB 4I3SH 4XP5L 2IFFH 4GW4B 3OXSB 4R8WL 4BZYA 4GMSL 2EDDA 4PV9A 1T1YA 2Q8BH 5EOTB 1FG2B 4P9HL 4OM1H 2BSSA 2ESVA 5EC1A 1PG7L 5B4MC 2VC2H 5ESQA 4X4YB 1UJ3B 4LEXH 5AG9A 4KUCF 3ARBD 1IAKB 5KSBA 4KAQL 4JM2B 4J3OC 5ALCL 4U49A 25C8L 1RU9H 3RZWA 2JK5B 5LQBL 1JF1B 3OJMB 3P30H 5C86A 1MVUA 4LSRL 5CD5C 4KTDL 4OLYH 3WUWG 5B39A 3V5KA 4ZUWA 4CVWA 3MLRL 2DKUA 2ICWB 3PJSA 2ORBH 3X14B 3GUTB 2VIRB 1Z5LB 4L29B 4N90D 2Z35A 1OY3B 3O2WL 5DDHB 3TF7C 1A6AB 3TA3A 2C4FU 1HYSC 4H8WL 4ZUSB 4H5SB 3HUJB 3QO1A 5GGTA 3H0TA 4W6WB 1QRKA 3FFCD 3QZWB 2E7LA 1FNGB 1WC7A 4DVRH 2DQCH 1EPFA 2F5BH 3I85A 4RRPA 4WWKB 2XA8H 4OM0H 2XPGB 2RCSH 2ZG1A 5I74C 2OZ4H 3E1F1 3TFKD 1FIEA 1J1PH 3O3AB 5HHOB 4F2MA 3X11A 1MIEH 4PRAB 3V0WH 1IKFH 1TPXC 5D1ZA 2H2PD 4R7NB 2X4PA 4IRJB 1JZ3A 2DQFB 4KHXH 5J11B 3RRQA 1DN0A 4Z7OE 4ZO8A 4YC2B 5F3HA 5J9PA 1QRND 3EJYD 4HUUB 5CEZE 1CG9A 3FOLB 1NFDE 4LHUB 3WKMH 4NQEA 4Y5VA 1P7KB 1RV6X 1CFNB 4LVOC 5I1IL 4XCEB 5FO7A 1JGUL 4NJAL 3Q6FA 1E4KA 1T2QH 2XWTA 1VB9A 2YD3A 4LPXA 4WO4D 5C0DB 1FVEB 5L2JA 4HPYL 1DQDL 3STBA 2QBWA 4I4WB 4UIKH 4EKXA 5E08H 1IM9A 2AEQL 5DMKB 3CFDB 3KPOA 3PUCA 1IAMA 5AUMB 4RMWA 4HMDA 2X9XA 3VRIB 4OZHE 5DK3A 4FP8H 4J3WA 3OHXB 2MOVA 3M17B 5LJYH 4HJGB 3PGDA 1A1OA 4OUOA 4X4MA 4EQ2A 1JE6A 3EJZD 4YHML 4PY8J 2X89A 1MI5B 3PHOA 1OM3H 1KLUB 1LO5B 3DV4B 3IJSB 2R1XB 1DJSA 1XIWB 2ERJB 3MOBL 4UTBL 2HJLA 2A73B 3UTZA 2HFGH 3TO4A 4ZFFB 3IFLL 3WIIH 3BGMA 1X5IA 5IB2B 3K7UA 2D7PA 2PYFA 3E6HB 1GIGL 2JB6B 5IVZA 3PIQA 3STLB 2G2RA 5D5ME 1E27A 4I13B 5D7SH 5E4EB 1Z9OA 5GJTH 3B83A 3QNXA 2FX7L 4HWUA 4P5TC 5DD6B 5DQJA 2HAZA 3DMMC 4W4OA 4N9OB 1KTRL 2GJ6A 1RI8A 4I48A 1UYWL 3HS0B 2CIKB 2R15A 3PQYB 3VJ6B 5HSFA 1IEAA 2D2OA 4I18A 4R90L 2ZUWA 3WUZA 1ETZA 3BO8A 2YA1A 3FOMA 3RVUC 5CEYA 4XXCA 5IG7A 5F9DC 1XZ0A 3GSWB 4DGIL 4GKZA 4LVOB 4JM2F 4OIIL 3ROLA 5DMIL 3UXFA 3CVHA 3A6CH 4NNXB 1ZLVH 1A7PL 2OR9H 4OI9A 4Z7UE 3WS3A 1LK2B 4RFEB 5T1LB 4BH8A 4OLZH 1U42A 4L9LC 3U4BL 5H37H 3THMH 4OZHA 4P2YA 4OM1L 5DK0B 4GOSA 1S9WA 1JGEB 4K3GA 3RKDD 43C9A 4N0CC 4BQ8A 1F6AA 2AJUL 1QFWI 4RFNC 3ALPA 5E1AB 3UEZA 3RTQD 5I17B 2F54A 1E4JA 3R0MA 2ZWLT 4WI4A 1OP3H 4CVUA 1F58H 1D9KB 1ZANH 4PJAE 3DUHA 4U1KA 1TNMA 4K3JH 5L2KA 4AL8L 2BSRB 2GQHA 2YD6A 4GMTL 5DA4A 1JUFA 3QXDB 4GQ9L 5D6CB 2HFFB 3T65B 5KG9B 4G6KL 1P4BH 4UT9H 3OV6A 1J5OH 4KJYB 3SDCB 5J12B 4XBEH 2AI0H 4JFOA 4G6KH 3GMLA 1EEYA 1Q9KA 2FIKA 1HSAB 1R5WB 2YZ8A 4NDMA 4LCWE 3S3SA 4G8IB 1IQWH 5HYSB 1A3LH 2LV4A 4ZQKA 4HGWB 5CHNA 1HILA 3VXRE 5CJ5A 4ZO9A 1H5BA 5DJ2B 3SO3B 5CGYD 1W0VA 4ONHB 4DN4L 1B2WL 4XAWL 5DZNA 3HPJA 4OLWH 4AEHL 4HDIB 3JV5A 1MWAH 2R2CA 4KI5D 1L9NA 4YDVA 2ZJSL 2V7NA 5GJSL 1SJEA 3N85L 1P7QB 3WE6B 2W9EL 4X7CC 3HZVA 4L8SC 1URLA 3GSVA 3L3JA 5E6IC 2DOCA 2DTML 2C3WA 5FKAB 3S36X 1C5CL 1DQML 4L3EE 5AZEL 3OXSA 4MXWH 4FXKA 4EN3D 3ZE2E 4PV9B 5GHWH 1RAMA 2V6HA 1XF2B 3ZL4L 1FSKB 2COQA 5SWSD 2ZNWA 5LWYL 4MDJA 5EORH 4JFFA 3DSNA 3FB7A 3G6DH 1A6PA 2YA0A 2FNBA 4OQTA 4KMQA 1S9YB 1UM6L 1H3PL 5KSBB 1AKJD 3OAUL 4RA0C 1AHWC 5EORL 1KN2L 4TUKH 3RGHA 4NWUL 1X5ZA 1J0YA 4MB3A 1HHIA 1MVUB 2A1WL 3HN3A 3MRNB 5HPMB 1LO2L 3DXAE 1KN2H 4TUKL 4JFEE 1MJUH 4I3SL 1KB5A 1P2CA 4XP5H 5J12C 4L29A 5E94B 1KIQB 2DQEL 3NCEB 4BKLA 3TFKC 1WBXA 5C9JA 4ZG1A 1EFXA 1YJDL 3V95A 1HHKA 2MKLC 1Y18A 3CVHL 4KKBC 3QZWA 4MQ7A 5D1XC 4HX1A 4YXHH 1JVKA 3D85A 3H42H 3HE7C 3CZFB 3KYOA 4M6AA 5EO0A 5EU4A 4WWKA 4GG6F 3W39A 3PHQA 4E5XA 2XPGA 5I1GL 3ULVD 4LP5A 4JREB 1GZPB 5I8OL 4KRLB 2FDBP 3LN4B 1GRWA 2FWOB 2X4QA 4PGBB 1CI5A 4U7MA 5I71C 1ZMYA 5D1ZB 3GEWB 3KPSA 4K7PH 4HPOH 4LF3A 4UIKL 5KSVA 4G6AC 1D5ZB 3MJ6A 3MFFB 4RAUA 4DFIA 5F1SA 3ZKMD 5FA3A 5F3HB 1YMMD 2H8PA 1KGCD 5I1AB 3FOLA 1FFOA 3OG4B 5EWIL 1A9BA 1QSFE 3O2WH 5F7DB 4MA7L 1QR1A 1ZT7B 2KH2B 2NY6B 3CFIC 3I6LD 4YDKH 1XMWA 2NY4D 3DX6A 4IDJH 5L2JB 1QYGL 4E42B 3H9SB 1U8HA 1SMAA 5C0ND 3WXWH 1BWMA 1KLFA 1J1PL 4L3EB 3IETB 4BH7B 4JFZH 1G9NL 1IKFL 1YDPB 1M71B 1W72B 1JWSA 2YXMA 4NO0D 3IFLH 1J0HA 4RDQG 3UTTA 1JRHH 4MJ2A 5DQDL 1OSPL 2CDGB 2EICA 4X7EC 2VOTA 3TGXA 4D8PA 2VRAA 2J1KA 3QIUA 4XWOD 3DROA 4URTB 3M17A 1FFRA 1A5FL 3SE3A 3MSPA 1JTOA 1MCPL 2ZSVA 1KLUA 2X2YA 1XIWA 4QOKE 5JHDA 2A73A 4RGMC 4MJ6B 1LK3L 2Y6SD 2ZOLA 4ZFFA 1OD9A 3MCLH 1EO7A 1YEGL 1J8KA 1QBMH 2GK2A 4TQEL 1I1RA 5I0DA 4LQFL 3KPSE 4RAHA 4Y5YA 1KFAH 4DUVA 3SJVB 3TC9A 4N0UB 5KS9B 5CS7A 3RZCD 3QDMB 3SGDH 4AG4H 4NZUH 5EA0H 3IAQA 4QRUA 5I71B 5DQJB 5B3JF 1NMAH 4UUJB 1Z6JT 5DT1H 5E1HB 4PJFB 1RUAL 4M7KL 1YPZB 1BQHG 2MTPA 1FN4A 4JRYD 4OSUL 5CEYB 3B43A 1RIHL 5JMRA 3MRCB 3PWVB 1R6VA 2XN9A 2YD1A 3BPLB 3L7EB 3MQIA 1SQ2N 4PB0L 4GKZB 3CD4A 3ROLB 4NHCH 5T3ZH 4BZ2L 1ZHKA 1ZV5A 3CSBA 1KCUL 1HH6A 5GIRA 5I30H 3LPWA 2CQVA 3MRJB 3IFOA 2CK0H 3W5NA 1R3LB 5SWQA 5SWZB 1DQJB 4HBCH 4M9OA 2W0PA 4YDIL 3MZTA 3V52H 5E8DH 3ARGA 3INUH 3R8QA 3RNKB 2V5RA 2P8LA 4YDIH 5E1AA 3GBLA 2P46B 4ELMF 2WZPD 5BQ7A 1KJ3L 4UNUA 2R1WB 5FXCH 3S6CA 4HG4K 5K59E 2HN7A 3WLBA 1QVOA 1TZGL 3WDJA 3QAZC 3QHFH 3VD9A 3IDXL 2OL3B 2Q7NA 5DUBB 2I60L 3T0EC 1IGJA 1FYTB 4M5YH 1S78D 3KPNA 4XVUD 4NO2B 1CWVA 4XNQA 3FRUB 3MLSH 4WI2A 1J86A 2VDRH 3U9PL 4OLZL 1UKTA 4PRNB 3MNWA 3IXTB 1S7SB 1AO7A 1ZS8A 4JRYA 1Q38A 5HGHB 3GMLB 4Z7WE 2J8UB 5GJSH 3V6BR 4ALAH 4X5WA 4NDMB 1M7IA 2I25N 3CFBB 2B20A 3ARXA 3L3OB 4G8IA 4PJEF 3MLYL 3OB0K 4OCLC 5HYSA 1H3WM 1KLGA 4MAUH 4ODTL 1SY6L 4LHUG 4C56B 1F3DH 2IANE 5CBAB 1TXKA 4XZUB 3SDDB 2X70B 4LPUA 3KAAA 4XCCL 5EG6C 4FQJL 1UQSB 2LU4A 4XVSL 4C56D 4HUWA 3RX5A 1BZQK 1I85C 1TQBC 1U3YA 4U1NA 5EO1A 3BEVA 4DKAA 5EZJB 2A83A 4HMCA 5D5MA 3BPOB 4PJBB 2H6PA 2DMCA 3HZVB 5DTFA 5HPOA 3MV7E 3ALXA 1PY9A 2VKWA 1BZ7B 2L0DA 3NTCH 4JO1L 3RY6A 3U36A 2BNUA 5B8CA 3KXFD 5FKAA 1BLNB 4PJFF 3EZ8A 4ZDHA 1X5HA 2HWZH 4MJIE 4FXKB 3RWFB 4EOWL 1Q9WA 35C8L 5LCVL 5C09D 1FBIH 4QXGH 1S7TB 2C5DC 2FSEA 2ID5A 3VXTA 1E4WL 1G1YA 3EO0B 4QCIA 5C09B 4DUWA 1XR8A 1FO0H 3RNQB 4PTTB 4FHBD 1XGUB 1N4XH 3HA0A 1RUKL 3G5XA 1GPOL 3UYPA 1PX4A 1NLDH 4HK0A 3H9SE 4HW6A 1G6RH 2EYSB 3MRNA 4LSPH 2E5EA 2XQYG 1D9KD 1MCPH 5J57B 5FCSH 3RUGB 2YPLB 3KPRA 3ES6B 2F54E 4D9RE 2VXQH 1QRNE 1UWGH 1IM3B 3JV6A 1Y18B 1ROWA 3CFCL 4PJAA 1OPGL 1HI6A 4OCSH 3A0OA 3HNVH 3FCTA 5IW3A 4MDIB 1CXHA 1T04A 4G5ZL 2CLZA 4WW2B 1JGLL 4EXPX 3V4PH 4GAFB 2VMFA 3O4OB 5GZOD 3AFLA 4M7KH 4PGDB 3MROB 3O3DB 5F97E 5D6DC 5DRNB 3V2AR 5KSVB 1MJUL 3TBWB 1GVIA 4ZD3L 2A1WH 2AJSH 1CBVL 3MFFA 1G9NH 4X7DC 1F3JB 2NPLX 3OB8A 5ALBH 2DWEA 1M6OA 2QQLL 4Z7QF 1CIDA 3EFFA 1S7VB 2W9DH 1CFVH 5CZVH 1CK0H 3OJ2C 5BXFB 1MRFH 4DKEH 2GJ6E 2WINB 4JLRA 2A77L 1DP0A 3QCUH 2W9LA 5HHVL 4D0CA 5IOPB 3T8XB 1RD6A 3S34H 4GXVH 3IGAA 3ULUL 1MUJA 3QCUL 3ARRA 4Y8DC 1IBGL 1UM4H 5EU6A 3PABB 3IETA 4JGUA 1RSFA 2APFA 4M4PA 2HKHH 2DQHL 1G0DA 2FJHB 5HGAB 4V2BA 1JZ4A 3KS0J 3FONB 1PKQA 5DJXA 5GXBB 3MUHL 4L8BA 4XP1L 5DRXA 1MLBA 4XXCC 2NZ9D 1DBKL 3QULA 3UTTD 4E41E 4JFEB 1XGRB 2ARJA 5C0FB 1VKXA 1IKNA 4P46A 3BIBX 1DBMH 5GS1C 4G6FB 1FLRH 3UTSD 2FGWL 3CFEB 5DR5H 4JDTH 4NCC2 4JG0L 4UDUB 4MA1C 3QUXD 3EYSL 2GCYB 2R29L 5B8CC 4FQQA 3VA6A 1T20A 5C6WH 4IDJL 1BREA 1OP5K 2R9HC 3QUMB 3GRWL 4OFVA 4TYUA 3FJTA 2XRAL 4GMTH 4F7CB 2I5YL 2Y07H 4X98A 5EOQH 1UJ3C 2W38A 3RGVC 5IQ7L 3QCTH 1CVRA 4PRPB 5K93A 1HYRC 2ADGB 2E6QA 4G9DA 1UZ8A 4KK9D 4MCZB 1NJ9A 2OM5A 3PDDA 4G8FA 4XCCH 2HH0H 5GS2H 2C3XA 4ZTOH 4HQQH 2AGJL 3IDNB 1CDBA 3QQ4A 5T1KB 5ACZB 3MRCA 3LPGA 2J6EA 3DV6A 3SJVE 1ZHKB 1LK3H 2AGJH 4PYGA 3NOIA 3KR3L 4LLAA 3OJVC 2A0LD 1YEDA 3PWPD 4P46C 5KVFL 1R3LA 4J3SA 4J6RL 1B2WH 4W70A 2VR5A 4XAWH 5D2NC 1KJVB 1S7WB 1YYLH 3O6FA 5ICXB 5C0CA 3UP1A 3U9PH 5JHLL 5CGTA 3KPLB 3TCLB 4Q97A 5IKCA 3LMJH 1DQQB 3LSOB 2H2PC 1UH2A 5I19H 3HR6A 1NUGA 4IMLB 5E2TL 4B41A 4LCWD 1GZQA 1I9IH 2Z9TA 2WBWB 1LP9E 2B0SH 3UDWA 1QO3B 1JGDB 4I0CC 3TNMB 3VXRB 4IRSB 5DD1L 1FORL 3KYKH 4LCIL 4HV8B 5EBMB 2IPUG 4PD4J 2E8YA 4ODTH 2LU3A 1LE9A 1IVLA 4XNMA 1TIUA 4B7LA 3HLAB 3LRSB 3HCVB 1TDQA 1ZS8B 2AI0L 4P59L 2FO4B 2YEZB 3LKOB 2C3GA 3KYNA 1OGAB 1OF2A 3CFBA 1PYWA 1OAZH 1U8KB 2F58L 5A40E 4BM7A 1FVDB 4X5LA 3VXSB 1KLGB 1QQDA 1EGJA 1OAZL 1HOCA 2EKJA 3DGGA 3GSNA 5DD0H 4FQXA 4HWBH 2VL5B 1OSZB 3NCMA 2AJSL 5BRZD 3O8XB 1E4WH 1ZA6B 4XXDB 1I1AC 3QCVL 1NC2B 3B9KD 3C08H 2C1OA 2X40A 3MLZL 4GG6A 3WMSA 4U6TA 3DI2B 2Q8BL 2BNUB 5B8CB 2EXWC 4I0PB 3FAXA 1U8MB 4ZDHB 1AKJB 3T3MF 5F1OB 5IR1A 2O5YH 4OD3H 1MHPL 2PTTA 3CLEL 1T2QL 1YZZA 3MC0A 4TNWK 4EVNB 1NEZA 2FSEB 3G6DL 5JIPA 4HHAB 4HKXA 5SWSB 5C09A 1S7QB 4KMLB 1FYTE 4FZEH 2IPTL 2OJEB 3S3PA 1XGUA 3HZYB 4N0FA 3FQUA 4PD4K 5DRZB 4M6NH 5K9KA 4I9WE 3DHMA 5DC0A 3K4ZA 2EDHA 5FOJA 5I16B 1OAUH 1T5WA 4HFWB 1JZ5A 1GHFL 1XF3B 1YJDH 1MAJA 4KK6C 3D39E 4M5ZH 2AKRB 3ME0A 3VI3F 4DVRL 4CAGA 1JYXA 4LSQL 5IVXA 5LBSL 4H0IA 1YNKL 3TN0B 2VQ1B 2VH5H 2W9DL 4KROC 4O2CA 1L6XA 4DKEL 4AM0B 4RGMB 1ORSA 1FZKB 3O6FC 1G84A 1DLFL 1UEYA 2EH8L 5JHDE 4U1MA 4HF5L 1FVCA 1G7JA 4PGZA 5JXAL 4Y19B 2BVPA 3LB6D 3V7AG 1TCRA 3B8YA 5MENA 2OZ4A 4L8DB 5CLTA 5EOCH 1ZLVK 4YXKH 3O41B 3BDYH 4XP4L 5D7JC 1BD2E 4CU7A 2R9HD 3S4SG 1CE1L 5BZDB 1IRAY 2YUWA 2ZOKB 4D0CB 4Q6IA 4OCSL 3VXUE 4YHZH 3WBDA 1NEUA 2DI8A 3IFNL 5TPWL 1JGLH 3NA9H 3RVXD 4K3HA 4JPKL 2PXYD 1NL0H 4Z7WA 4QNPF 3PP4H 1KNOA 4Z95L 4YH6A 5JW5B 1K2DA 3ARVA 4R2GC 5K33A 2KZWA 4ZUUB 4YDLC 5D2LF 5GS0L 1X5XA 4PJDA 4NKDA 4DTGL 2L7JA 4V1DE 4ZFGL 4AT6A 1TFHA 2CK0L 3AM8A 2AXGA 4OGAC 3LN9A 3ZKNC 5C0FA 1VKXB 4HAGA 5EOQL 3CCHA 1JPGA 5HY9A 3IDJB 5HHVH 1HWGB 5H2BB 2EDYA 4GRLC 3KPRD 4OZFG 4KZDH 1FSKC 4PPTA 1QEWB 3HZKA 2A6KB 4F57H 4YFLF 5HHOD 1UM4L 5I8OH 1YEGH 5D7JA 1WWBX 1F11B 5CZXD 1I3UA 2C3VA 4DVBB 3QUZB 4IS6B 3ULUC 4LCYA 4ODVH 5EDXA 4LLMA 4YIQB 1U8NB 2LAGB 2DMBA 3IU4L 4DKDC 5D2LA 1XCTA 2B1HL 1T5XA 2J6EL 3G5YB 5E8EA 2Q6WA 4GG8A 1HKFA 3UROR 3DIFA 4OSUH 1F5WA 2ICEB 4KV5F 5HHPA 4BQCA 4K3DH 3MLXH 1AH1A 5E6YA 4B50A 4IRSC 5FECA 4U31A 4KWUA 1NGZB 1MQKH 3MRHB 4NIKB 4WHYH 3U6RA 2VLJA 3SY0A 2WQRA 5DEFA 1WBYB 2D3VA 1D5MA 4J7RA 1ORQA 4JDZB 4FN0A 2AXFB 3BUYB 1Z3GH 1C5CH 1DQMH 5AZEH 1XR9A 5C7XH 4Y4HD 3O3BA 4K94H 1FNHA 5IHZA 4JVUA 5IKCB 1DZBA 4CADB 2YN5A 1QSEA 1JPTH 2UZXB 4KH2A 4Q0XL 4PJGB 2DL2A 2X1PA 5DJDA 1B90A 4D3CH 1A64A 5FGCE 4M1CC 1I7ZA 4ETYA 1P4LB 1GGCL 5JDSB 3MCLL 1AE6L 5TH2B 3GBNH 4OQ1A 1YUHA 4KUZL 4ZAKB 1LE9B 3MV9E 2DKSA 4LKXA 4CMHB 4LPCA 1XF4B 3IKKA 2PO6C 4MNGE 3HCVA 1LE5B 2R2HA 4HKJA 1BX2A 1TVBB 2MHAB 5DHXB 2Z4QA 5EBLB 4N5ED 5DJCA 3TVMA 1QSFD 2KKQA 5ELIA 2BMKB 4LLYB 1Y0LA 3OJDA 4R2GD 1QLRA 3DUUA 5CIPA 1PYWB 4FMFA 4XC3H 1U8KA 1AGFA 4X4ME 1A2YA 1GOHA 1NH6A 5BRZE 3VXSA 4NHCL 5T3ZL 1MI5E 1J9CT 3DGGB 3HE7A 4X6CB 3TWCL 3MGOA 4F15B 4FQXB 4UZGA 4C83B 4NM8L 1WFOA 4NQDA 5C0CD 1N8ZA 4FS0A 4JCMA 5D7IF 4P5TB 3LKNA 4OBRA 4FZ8L 1NC2A 3WFCH 2OL3L 4UT7L 3VI4F 1RK0A 3BKYH 4W68A 1VFMA 1BPVA 5JUEL 5JOPE 3GO1L 4HCRH 5MI0B 2IH1A 4WCYL 2E3VA 3T2NL 1S9XB 1AC6A 1AKJA 5BS0B 2F58H 4GRMA 5E99H 3NZ8A 3R1GL 1A4JA 1HXMB 4KVCL 3IDXH 4Z95H 2GW5A 2IQAA 4NZTL 1C8PA 4ZAKD 1QZ1A 3CLFH 1S78C 4EUPH 5SWSA 4RGNB 4D9LH 1HWHB 1MRFL 4JFXB 4N0FB 4DW2H 4L4JA 4WW2F 3TH2T 2HMIC 4RAVA 4D0DA 3QIBB 4MJIA 1S5HA 1A21A 5JNYA 3JSSA 3VXPB 2O61B 5EU5B 1KXVC 1R5IB 4OD3L 5CAYB 1J1XL 2NY0C 1CE6B 2CLRB 1LP9B 5EOCL 3DVGA 2ORBL 4LPWA 2HG5B 4XP4H 4KPHL 4OLUH 4TVSa 4NQDE 4AM0A 1TVDA 3GMMB 3I75A 5I1JL 4XGZA 5T33L 5DJYB 3L9RB 4KRMB 1U8JB 5DJ8A 1OQOA 3H3PL 3T3PE 4KROD 4KK5C 2D0GA 3CUPA 1NGWB 3F6LA 4NPYA 4FP8L 4Y19A 4JKMA 4YDJA 4YXLL 4OV5B 4FQXD 2BVPB 3RVVC 4X9HA 3ZKND 1S9VA 3GMOA 2ADIA 3LKPA 3M1BB 1GHFH 3BYYA 4K23H 3WN5B 2RCSL 4FQHA 4MAYB 4XVJH 1RZ8A 3CIQA 4BQ6A 4UTAH 1NGYB 2A0LC 4LSQH 1YNKH 4YUEL 5LKNA 3LDBB 5EFIA 2Y6SC 2OQJB 2K1MA 3OGCA 5BW7C 2EIDA 3ULUH 2ED9A 2EZ0C 3HFMH 1JI1A 2L4OA 1KULA 5C1MB 3S35L 4EN3A 5ANME 3QXAA 2QHLA 1VGEH 1HIML 4G8GD 3QXUA 4NKDB 2ATPA 4AT6B 2J2ZA 1KEMH 1MQ8A 2NX5E 3A6CL 3BPOC 1H0DA 1RZJC 3QDME 3MUJA 1EJ6A 3V6OA 3P4OB 2OR9L 1S3KL 5LGHH 4OGZA 2Q8AH 1CLOH 3MYJA 5IWLA 4J3TA 4NN7B 2UYLA 5F71A 3P0VH 5DVMA 1GGUA 4LLQA 3GB7B 1D6EB 3QFJE 5IVOA 3QUXC 3VXOB 1BF8A 4ONGL 3DHJA 5FF6A 1UZ6F 1RJLB 4HIHB 3C87A 4JPVL 3P0VL 4DJMA 2ZCLH 3CH1A 3GM0A 1G0YR 1LD9B 1I9EA 4LEOA 3TIDA 32C2B 2H26B 4U1JB 3FQWB 5F1NB 3PP4L 3GSUB 4WI3A 4LCYB 4XP6L 4GBXD 4LLMB 1C16B 1V5JA 4PRBA 1KXTB 2BY3A 5K9OA 2HTKC 4ALAL 3MJ7B 3QNYB 4YIQA 3E3QC 1U8NA 5CZKA 3VRJB 4TSBH 4L4TA 5C3LD 3WIIL 3IJHA 2F74A 2Z91A 4JKPL 4P46D 4KKCD 4HQQL 4EEEA 1U9KA 1NBQA 2H9GB 4UNTA 4JHZA 3ABZA 3LQAH 4KZDL 1GGTA 5LXGL 3S4SB 5GRUH 3P73A 3VWJD 4X6FB 2VLJB 3OQ3B 1FFQA 4NNPL 5E2UL 4HCRL 1OCWL 1XCQB 4WY7L 1D5MB 3PHSA 3UTPD 1KIUA 2HJFA 1XGPA 5JR1H 2NW2A 1J8HA 1I7RB 5IJKC 2H1PH 5DI8B 4O2EA 4AEIL 1SBSL 5IHLB 3T1WA 5GSRA 3U82B 4R97B 1X5JA 4L8CB 3G5VB 2RIKA 4PRPE 1JJUA 3W81A 4AEIH 2NY4C 5JDSA 4GKOA 5DZLA 2IBBA 4LCCB 1OW0C 5TH2A 3K4AA 2VDPH 1FCCA 3HKFA 4PRIE 1T03L 2DTMH 1MRCL 5GRVK 4X7TB 5GRVL 5L88L 1R24B 3G08A 1OGTB 1I8MB 4M1CD 1BX2B 5EBLA 5D4QA 2X42A 2EDQA 4OZIE 4G6AD 4N1HB 3CU1A 1T1WA 1KSRA 1I3RB 3DUUB 4LRIC 1K3IA 1AGFB 5DFTA 1T1YB 1BQHB 3EAKA 2GTWB 1CXFA 3EHBD 4JY5L 4YGVB 5EC1B 2F54D 3P3YA 2NY2D 4P4KA 1F45A 4WFHE 2ED7A 1AE6H 4ZS6D 4UINH 1WCQA 2JELL 3CFJB 3PP3H 3HUJF 4C83A 2DQEH 4JZNA 2QQQA 2R2EB 4WHTB 3FT4A 3AMLA 4F8TA 1IZKA 5ICYA 3O9WD 5L9DH 4LK4A 4CUCA 2D03L 1I7UA 1ES0B 4N0RA 4P5MA 2Z35B 4XNZB 4NC2B 2IALB 4HFUL 4GSDL 4P0DA 2OBGA 2D9QB 3HFML 2IANB 1VESA 4H5SA 3HUJA 3QO1B 4WGVB 3PV6A 3S35H 1CGSH 4LMQE 1CIUA 5I2IB 3K80A 1H8SA 4WTWA 4XHJD 1NFDF 4I77H 4GXUM 2PF6A 5F7LB 4BFBD 4JEGB 3DUSA 4UV7H 2G75A 5FGBC 4HH8A 4PRAA 2E6JA 4NZJA 1AGBB 5DEGA 3MV9B 1Q0XL 2W91A 2CJUL 5JUEH 3IU3A 4U0RB 5HHNA 3VI4E 2OL3H 1G7MB 4UT7H 1ONQA 1R5IA 3QO0A 4M5ZL 4WJ5B 4V1DA 1T0PB 2A6DA 5GPRA 1CG9B 5I18H 3PQYE 1DBAL 1BGXH 4HEPG 3EO9H 4QTIL 4Y2DB 1ZT4A 3BKML 1S7UB 2XWTB 4ORZC 3O9WC 3FTGB 3W9EB 1SM3H 1WISA 3I75B 2YPLE 1FZJA 2UZIL 3MLUH 4ZOAA 4GUPA 3KPOB 4NJAH 4GJTB 1AY1H 1WK0A 3JVGA 4XBGA 1UB6B 4Q9CA 3HAEA 4HWZB 4TNVK 3WN5A 4CU8A 1KENH 3ELAT 4YXKL 1N3NA 3UTTE 4E41D 2F53D 5FYKD 4JQVC 3RPIB 3OHXA 1GJIA 3ZKQD 4KDTC 3N1PC 3B9DA 4NNPH 3RTQB 1FJ1A 4WUKL 1ZVSB 3NFPA 4K7PL 3DVFA 5F93C 1Y6MR 3EOAA 4KJQD 3RWGA 4OCWH 3C5ZC 2XKSA 3QWOA 3BQUA 1WWCA 2XKNA 4EN3B 1PQZA 4HJ0C 1KJMA 2AEQH 4F7TB 4K55A 1NMAL 1U92B 3FT2A 5C07E 3LEXB 3RY5A 2EEDA 4Z76B 2R39A 3A6OA 2HT4C 4HXBH 3JUYA 4W6YB 3JXAA 2GJ6B 4L9DA 4LFHD 3BRGC 4I48B 2OS7A 4FFWC 5BVJA 3CVIL 5HI4C 1FIGH 3ZKXB 1KTKE 1MFAL 3DWTA 3GB7A 5CP3A 5IG7B 3EYOA 3KHQA 3OKMB 1L9MA 4X9BA 5FF6B 3LS5L 4HKZB 4QRRA 4YK4C 4M4RA 5T3XL 3CH1B 1A5FH 1Q72L 5E8DL 4N90E 4BH8B 4LEOB 1JNLL 3LV3B 4PB9L 1DFBH 5CEXB 1PEZA 4OZHB 2GUOA 1J10A 4X6EA 1A7NH 4GLRI 1BFOB 2F74B 3G5ZB 3GMRA 2F54B 1TZIB 4HUXB 3UBXI 2H1PL 2NY1D 3WFHB 3GZKA 5K9QI 4KQ3H 4TULL 4M5YL 4UT6H 1FH5L 3P11H 3NA9L 2HTKD 3MXWH 2V7HA 4XBPA 1U93B 1T80A 3O4OC 5J6HB 4E41A 5KSBE 3QFJA 3R06B 3WJJC 3T0ED 2NY5C 5T5NG 2BNRB 5DFVC 4IMKC 1K85A 4DTGH 5I8EA 5C07D 3TBSA 4F33A 4XMKH 3IDGA 1TJGH 4JFOB 1I7RA 3JWDL 1G6RA 1QNZH 5L88H 1RU9L 1OHQA 1E6OH 1LDPH 4P2OB 4Y4FC 5ETUB 4G8EB 3WFCL 4KI5F 5L7XH 3AS1A 4L3CB 5IB5B 4M93C 4L8CA 2BRRL 5AEAA 4ZFOB 5JW4M 4HGWA 3ZTNL 4GKSB 1V3LA 2IPTH 4GW4A 4XVSH 1H5BB 4JHWL 5DJ2A 4JZJA 3L6FA 1MWAA 1P84K 3D87B 1FG2A 2AJYH 2V2TA 3BP5A 3QH3A 5ESQB 2EDOA 4QEGA 1IAOB 2N7BA 3PWUA 1BM3H 3B2UD 3OR7A 1WZLA 3B4NA 5K9JH 4JM2A 4JZOB 4UIMB 3L3JB 5KSUA 3BHBB 4F7EB 3PL6B 1UCBH 3MV7D 1CS6A 1T1WB 4NYLB 1HN1A 1SM3L 4FQCH 4BQ9A 1XF2A 1MELA 2BVQB 8CGTA 5DVOA 1IC5H 1RUKH 4MDJB 3PQYD 2ZP0T 2ITDA 5F96L 2EE3A 4LSSH 3NIDF 1SJVA 2ZCHH 3BT2L 3P0GB 2IAMD 3CFJA 5KVEH 3KPRE 1RZIB 2VXSH 1UWEH 2R2EA 2ZUVA 5GHWL 1PKQE 1IFHL 1WIPA 2AK4A 2VDKL 2BDNH 1YEEL 5HPMA 5FYJE 2BOCA 2R1YA 2Q76A 1KB5B 1P2CB 1MFCL 2VAJA 4OCWL 1N6QL 5C0BD 4MNGB 2WP3T 12E8L 5D7LB 5GRZA 3TBVA 3GSXA 4JCLA 4I2XA 3PDGA 2VUOA 4YWGL 1JPFB 2XZQL 4JPKH 5FK9B 4CN6A 5A1AA 1BHGA 3KYOB 3OKNA 5EO0B 1FNSL 4LHUA 4Y5VB 3EYUH 5JXED 1PFCA 4CW1B 1GZPA 5F6HI 1EERB 3DUSB 2HMID 1EBAA 5FYKU 2JELH 2JE8A 4LCWA 2X4QB 5IBLD 4JN2A 5TF1H 2D03H 3IF1A 4G6JH 2W0LA 1A6ZB 2ZZUT 3VCLA 4PJGF 4K7FB 2H3NB 3EKCA 5GRXG 3QEQB 4K8RL 4LRNL 3ZYOA 3U1SH 3MRMA 1KB9K 3OSKA 3HI1A 1MFDH 3UPRB 1BD2A 1T66C 5F7DA 1QR1B 4XRCB 4MAYD 1DLFH 1ZT4B 5D7KE 3PGDB 1KCLA 4IMKA 4N8VG 3FTGA 1FG9C 3W9EA 4P2CG 2HLAA 2EKSA 3DV4A 2WIMA 3C60D 4Q6IC 3RIAK 4BH7A 4XP1H 4JY6B 2CRMA 3VH8G 1M71A 1W72A 1LEGA 1NAMH 3WSQL 1LHZA 4JO2H 1ACYL 4M03A 3WDHA 2PYFB 3E6HA 3SE8L 4M6MH 4WIQA 2GK0A 3ZO0A 3V9FA 1O7VA 1BEYL 2E9JA 3QRGL 3LEVH 3RWGB 3HS0A 2Z92A 3PQYA 5BO1L 3GHBL 1JN6B 3RVUD 3BKMH 2XKNB 5GSVB 2FD6L 4S1DD 5HJ3A 3U0WH 1YQVL 2HJKA 3VG0L 4NRYA 1EZVY 5LXGH 3LPFA 3DTXB 3PWPA 5KS9A 4AL8H 2I9LB 4PBVC 4RFEA 5T1LA 2YN3A 2V9QA 1GAFL 4J2XA 1JGEA 1FN4B 4L3ED 3U30C 4HD9A 5BMFL 1FAIH 2GITB 1PDKA 1HH6B 5GIRB 4EI5A 1NCNA 3IFOB 3GJFA 4YXLH 4PRIA 4J3VA 4M00A 1WZMA 3D0LA 3PL6D 3ZDXE 5IESL 2MMXA 4RX4D 3QUXB 3BP4A 1B0GB 1F6FB 1E0OB 3OKDB 3TVMC 4XI5C 1A6TB 4DUXA 3SDDC 3RUGE 1UCTA 3I3BA 1B9ZA 1L0QA 1C1EH 1KELH 3AU1B 3D39A 4HBCL 3GRWA 4DKFH 3U0TB 4PG9B 1HNGA 2VXVL 5DC9B 3WLBB 1IFHH 1X44A 9CGTA 5F21B 4NKOA 1HSAA 4F8QA 3TESA 5KSAC 1WFTA 5D7SL 5GJTL 5E5RB 3BEWA 1ZXQA 5T5NF 4CNIB 4TTDD 2YOCA 4QXTB 1VEPA 3CX2A 5C7XL 4HS3A 4JN1L 4KJPC 4XB7A 5JR1L 5I8EB 5TJWK 3VXQB 1Q72H 4KTYA 1H3PH 4JRYB 1YEFL 5HI3D 3OR6B 4MXQC 4KJWC 4CDHA 5MENE 3BAEH 3O6LL 4NKQB 4JFED 3EDDA 1SJEB 3Q0HA 5FOBB 4CU6A 1S7RB 3CLFL 1MNUL 3TH3T 4QRTB 1YC8A 2VB5A 1OB1B 3H6JA 3AREA 4KUZH 3PF2A 2GY7B 5D70H 5CBAA 3L6FB 3MOQA 5D1QC 3SDDA 5IV2B 1K3ZA 4K94C 3HE6B 1BECA 1HDMB 3QH3B 3BE1L 3E2HB 1GOGA 4YXHL 3QDJA 4ZUTB 3FB7B 4U1NB 1IAOA 3BD3A 2VDQL 3IRPX 4PJBA 2XA3A 2CR6A 4UIMA 2PYEA 3KS0H 4X7SL 4ISVB 4DK6A 1HHIB 1FYTD 2BVTA 3NPSB 4F80A 3SKOB 3KJ4B 1IGTA 3D2UD 3TWCH 4F3FB 1UWXK 4OD1L 1CGUA 1HH9B 5FKPB 5E94A 3GMPB 5IB1B 1RUQL 4M6NL 5DUPL 3ZDZE 5E9DD 1WBXB 5C9JB 3C60B 3MBXL 4NUGL 4QCIB 1XR8B 1HHKB 4KFZC 3H3PH 5CEZH 2LVCA 4M1DL 5LCVH 2OZ4L 2QEJA 3ZT6A 1OTTC 2AK4B 1BM3L 4KK8C 2VZSA 4MD0B 1EO8H 1EHLL 4NT6B 3VFRA 1CFBA 2C4XA 4N9GA 5F7NC 4X6CE 4KVCH 4JPWL 3GJFK 1LEKA 2DI9A 4Z6AT 5BO1H 4KK6D 3OG6B 1KJ2L 2AP2A 4Y4FA 3VXMD 3PL6C 1IM3A 3JV6B 4KDWA 3SBWA 3RZCC 4PLJC 3MLZH 4I2XB 3B5GA 2YWZA 3D18B 1AI1L 1BAFL 4W6XB 5FA3B 1AR2A 1TETL 5FK9A 5CD3B 1UM5L 4ORGB 1TJHL 2X5PA 1J0KA 3D9AL 1T04B 1X5GA 4M3JA 1GPOH 2JCCF 4OFPA 5IGXH 3UJJH 3FO9B 5HGBB 1K8DB 1CGWA 2C7UB 2XZAL 4JN2B 3BZEB 1UWEL 5GISL 3DX6B 5EZIL 4OZ4B 1K5NB 2PUQT 2H3NA 3QEQA 5FGSA 3E3QE 1L6ZA 3QIBC 4GS7B 3UAJC 3VRLF 1G9EA 3WKNA 4PRHA 1VFBA 1S7VA 1S8DA 3V79C 3C8HA 1G9ML 2DM4A 1CD8A 4LSUH 2LAAA 4S2SA 1CFTB 3U7WL 5A16A 4DQOL 2WM0A 3B9KC 5DURB 3WNOA 2VDOH 1RZJH 3IGAB 1KTDB 2ZSVB 2HFGL 4NHUB 3S5LG 1CGXA 5D1ZC 5DMYA 3LEVL 2EEBA 3QEHB 1U3ZA 4G6JL 5HGAA 1D3CA 2ZOLB 1IC7H 1PKQB 5DJXB 1GSMA 4GXVL 5I6XC 5HVGB 1KENL 3G6JE 3VGHA 3SJVA 3WJJA 3QDMA 1U8QA 1A4KA 2A6JB 5D71L 4U1GB 3LZFH 4XMLL 1ED3A 2FECL 2GEEA 2PW1A 4GAGH 3KPTA 2JJTC 4MLSA 1F4WL 4PUBL 1KB5L 4UDUA 2X6MA 5IEKA 5D2NB 1JN6A 4PGCA 1JFQH 2O5XL 3VFNA 4WO4C 5GSVA 4Q9QH 2Q3ZA 1YY8A 4WW1B 4NRYB 4XPTH 4R4NC 2I9LA 3KHOA 4JO4H 4ZSOE 2GJZB 3KPMA 2DN7A 3O45B 3VGBA 4BZ1H 4PLKC 5DMIH 1A6VL 4GW1B 5CILL 4G9DB 1UZ8B 3UMTA 4RWYL 2HKFL 4P2OD 1CT8A 3JV4B 4G8FB 1QR4A 5KAQG 3IDNA 2SEBB 3TP4A 4DFHA 3UTQB 4OLVL 2EO9A 1MRCH 4Y5XB 1LNUA 5BQ7B 4R2GB 3EYSH 1CLZH 3H9YA 1NGPH 1D7FA 2JJSC 4EI5B 4FG6D 3ZTNH 1FGNH 2FD6H 2CSPA 4BQBA 4NO3B 2NY0D 4WFGD 4PRIB 1JPSL 2VDMH 1OAQH 4N1EA 1IGJB 1U36A 2G60L 3ISWA 2K9UA 3NFNA 3QNZB 4LL9A 5L0QB 3FRUA 4ZOBA 1RUQH 2HLFD 2D31B 2KQNA 4JZJC 3IXTA 1S7SA 1FO0B 4QRRE 3W0WE 2DKMA 1GC1L 3EJJX 1GZQB 4PG9A 1OP5H 1OAXL 4TULH 4KK9C 4Z7UF 3RZCA 4YEEA 4NKOB 1M7IB 3JUZA 1YJDC 2DF3A 4IRSA 5HD8C 3L3OA 1OAXH 4QHKJ 5EBMA 4U1SA 35C8H 3VE0A 4KVNL 3G6JB 1DEEB 1IILE 5D1QD 2H32A 5F7WC 4C56A 4HS3B 3IDMA 5J1SC 4XNMB 4XZUA 5HHXL 1A6WH 3HLAA 3LRSA 1BIHA 5TQ2L 1PG7H 4OCNC 1IAII 1G7LA 3O0RL 3OR6A 3O2VL 4HUWB 4MB5A 3VI3E 3LKOA 4LEXL 4Z7UA 3KYNB 1EXUB 4HGKC 5EZJA 4QRPD 1OF2B 2D0FA 3QQNA 5LG1A 2H6PB 5DTFB 2V2WA 4PJ5E 1KCUH 4S11A 4JE4B 1J7VR 2H45A 1FVDA 3SE9L 1UGNA 1BLNA 4LU5H 4NM8H 1QQDB 2WBJC 3T4YA 4ERSL 1TMCB 3ZT5A 4PGJA 5EU6D 2VL5A 5IMMB 1I8LA 4JFHD 3O8XA 2ZSWA 3T3PF 2VKXA 2HTLC 4OF3A 2X1QA 3IS0X 1JWMB 1K4DB 3GHEL 4ZUVB 3RNQA 5T1MB 1RZ7H 2DLFH 4PJ9C 4UOW0 4D2NA 4QRPB 5TDNB 3KXFA 3QG6B 4HWBL 4PREA 4HC1A 1A7QH 2OP4L 5GGVL 4OB5L 3VFWA 4HS6B 1F13A 1BQSA 3RKDC 4QT5B 2VO5A 1JV5A 1FNLA 4D8PB 1HH9A 3MLSL 5FKPA 1P9MC 1NEZB 5IB1A 5F7EH 4HZAA 4R8WH 1RIVL 4HKXB 1EEUA 4FNLL 1E4XH 1NKOA 4M6OL 2YPVH 3K0WA 4PJEE 4PJAB 2DBJA 4NP4L 3OAZH 4R96A 5E2VH 1ZE3C 25C8H 2XXCB 4HK3N 4MD0A 4O2FA 4X6DA 1YC7A 4XNXL 4N9GB 4CKVX 5C0JA 2ADJA 4LSRH 1U6AH 5I15L 4MNHB 3DECA 4LPTA 4PGDA 4TOYL 3DMMD 4UDTB 4NC0B 4WEBL 3D0VB 3TBWA 2X1OA 5FYKL 3PXHA 2Q3AA 3LRHA 4WRLA 5DUPH 2I07A 4P3DB 5CD3A 4P5KB 1H15A 3VXSD 5T5FH 3QDGD 1YEHL 4LSTL 3PP3K 4IRSD 4JR9L 4P2RE 4JRXB 4IBLT 5T3XD 3MRRB 3FO9A 1L7IL 3B5HA 2CJUH 2DQCL 4U1MB 4JG0H 1YEHH 5LBSH 1LO3L 4RMVA 2ZNXA 1OM3L 2VH5L 3S97C 1U91B 1UCBL 5EU6B 2Z8VC 1CL7I 3V4VH 4XMPH 5FYJH 3MOBH 4UTBH 4WUUA 4Y89A 4WWKC 5CJOH 2FJHA 4N0CD 1O5DT 5FAAA 5JTWA 1S8DB 5IK3A 5KJRL 2W59A 5BZDA 1VGEL 1CQYA 1TVHA 5DLMH 3QULB 1M4KA 4M1GL 1UM5H 3ZE1E 5A16B 2DLEA 4QGYA 5I76B 1XGRA 2ARJB 5E95B 3D9AH 5J11C 4P46B 3TO4C 1XIWD 3C09B 1FE8H 3EYVB 4WI7A 4NKIH 4S10A 2BVEA 1G0XA 1K2DB 5I73B 1I4FA 4L4VA 2ZUXA 1W72H 1BOGB 4LDEB 2B7DT 1CDCA 4LGSB 4MB4A 1EJOH 1T20B 2P8PA 4MWFB 4C54A 4NM4H 3BSZH 4HPYH 4M02A <