1RUML

Crystal structure (f) of h2o2-soaked cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at ssrl beamline 9-1.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
218
Chain Sequence
b'DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rumL01
1MCWW 4HMEA 3RIAK 3I84A 3OAZH 4M48L 1ZEAL 15C8H 2FIKA 5ICYB 4FFVC 5I71C 4NKMB 4PJ8A 3GMLB 4F7TA 3MODH 1QLEH 1MFBL 1T4KA 5DFVD 4NKIL 1MCJA 3NIGE 3LOWA 2W9DH 1FHGA 3UTTA 4LPUA 5AAWA 4O2EA 4TNWF 4MVBD 5DGRA 1P5UA 4M1CD 3W11D 5A1AA 5F7LB 3FO9B 4OD2B 3LEVL 4E9LA 5BVPH 5J1AB 1KJVA 2PW2A 1ONQB 4MSWA 4HLZG 4JLRA 4NRZA 35C8H 3SDCD 1AGFB 5I16B 5JORA 3GFUA 3JWNC 4G6FD 2QADB 5BVJB 2MCPH 4UU9B 1IGML 4JCLA 1RZ8A 1S7SB 3MYZA 4N90D 4PJ9B 5C0GA 1S7UA 5IFHH 4KJQD 3T2NL 1AO7E 3S3JA 5CEZE 1XCTA 3TBYA 4IBLT 5HDLA 3U7AA 5SWQA 4H1LB 2PF6A 4OQTA 5CCKH 1JHKH 1A7RL 3WD5L 4LGRB 4QRQB 1FG2B 1I85A 2NY3C 2X41A 2YUVA 4G6MH 5TGBB 4C57C 1RUMH 2EDHA 4MD0B 2A1WH 4Y19D 2CDEA 4JR9L 4X9BA 1JJUA 3QI9C 3V7AG 2R0LH 3ARTA 3MLWH 5KVFL 5DD1H 5CJ5A 1YEHH 1UB5A 2IPTL 3PWPA 1HH9B 4LCCB 1YNTA 4BK5A 5E94A 1UJTA 5BZWB 4PREB 3RGHA 1BJ1H 2VDOH 1MI5D 1TJGH 2AJUL 1S8DA 2DB8A 5EU6A 3TWCL 4F58L 1RZGA 2DBLH 4C56E 4ODHL 1ZLVK 3QUZA 4U1IA 4K9EC 4LVOC 1RK0A 1BREA 1T1ZB 5ESQA 2F54D 2P5EA 2AAVA 3CLEH 4HLZH 4IIQB 1KEML 5F7EH 1U8NA 3T04D 4OZHF 1QA9A 3CDGA 3LKSA 5JLZA 2KZ1B 1HILA 5F3BA 1IEBB 5TPWH 4BFGA 5FKAB 1MHHA 5C07D 4Y8AA 2WMPA 2YBRB 1U9KA 3WNNA 3HR5A 3IDJB 4L8CA 3OKDA 2WSKA 1IBGL 1NMCC 1O5DT 4GBXD 3CFCH 4OLWH 2PO6B 1U91A 2OCFD 3QUKB 5I9QB 4NPYB 4XAWH 2E3VA 4U6YB 3V0VA 3CFEA 1FDLH 2CMRL 1NUNB 2V2WA 5ESVB 1HHGB 4XPAH 4P4KB 1OSZB 3ULUF 1N6VA 5B39A 2FBOJ 1TVHA 1YEJH 2R1XA 3KG5A 3VH8A 4CMMA 5C08E 1B88A 2HT2D 4QHUA 3TVMC 4JN1L 1X3DA 2B2XL 3EO9H 2HFFA 4LHUD 5HD8D 4NT6B 4AIOA 3REVA 1KPUA 2DI7A 4OFVA 1ZOXA 1Q94B 1UXSA 2IH3A 1JPFB 2A0LC 3WDJA 3REWA 5B8CA 4BFBD 1N4XL 3PV6B 3HG1A 4W6XB 1T1WB 3RU8L 4OFDA 4XCEB 1FSKC 2E6QA 3FQUB 4OM0H 3U6RA 1A6ZA 2FH8A 3ABZA 3RZCA 5GS0C 3GKWL 1I1YB 2CJUL 1AD0A 4YIQB 4KMTH 3LN5A 1TNNA 4EI5B 5HPOA 4QNPF 4PGEB 4XP1H 1NEUA 4K23H 2BSSB 1WT5C 5T3ZL 2HFGL 5T1DH 4R90L 1DR9A 1G6RA 5F89B 4MA1B 3CXHK 4CGTA 2JK5A 4KFZC 4F37F 3VMPA 2EYTB 1BECA 4BH7A 4G9FD 5EBMA 3C9NA 4OIIH 3BIBX 3KS0H 5EU6D 3TESA 3QIWD 3QUZD 3JVGA 3CMOL 3JV6B 2ARWA 4KTEL 4YK4B 3LPGA 3NA9L 2DKMA 3RTQC 5I6XC 2BZDA 5TDNA 4J3VA 4MA7H 3C60A 2DKSA 3FN9A 3W5MA 3HMWH 3MXWL 1CS6A 3MRQB 3GBML 3PL6B 3RWEB 4P3CH 3C5ZD 3TN0B 1FNGA 4OZ4A 1L7IL 1TQCC 2E6PA 3E3QC 1H3WM 3O2WL 1MF2H 4QF1A 1U8IB 4X4XB 3FQXB 1E6OL 3E6FA 5KVDH 3PWUA 4CVXB 1C1EL 4PJ7F 4S1QL 1UT9A 1AO7A 5J11C 5E1AB 3EO0A 3DXAA 1EZVY 3G5VB 3J8F7 5I0DA 1A6PA 1W72H 2DM4A 1HINH 3OAYH 1KJMB 1BAFL 4UT6L 3BP7B 5AZEH 1WIPA 3ET9F 3P2TA 4JG1H 1FLRH 5ISZD 2NX5A 4K2UL 2LU7A 2FR4A 2BC4B 5FYLD 2BVTA 2HKFL 5MI0C 3V2AR 1FGVH 2R1YA 4XNYH 2W65A 1JRHH 5ID0B 5DS8A 3B9KB 3TYGL 2P7TA 4FXGA 2R1WA 1CK0H 2CDGA 1NDGB 4E42B 4NKOA 1FYTB 3D39E 3LN4B 3UAJC 4ZAKB 4NNPL 2CLZA 1YUHB 1FVDB 4NDMB 5GSRB 3MOBH 2UZYB 3CVHH 2OP4L 1UWGH 4HH9A 1DSFH 1CXIA 5IMOA 1QFWH 1CD1B 2EH8H 2RCSL 3WHE1 3SKJL 4JQIH 3U30C 1QFPA 3RZCD 1KPVA 1A3QA 4ZO7A 1ZHKA 4NO5B 3FHAA 5ITFA 3O6KH 5I74B 4CAGA 2DJUA 3DBXB 4XNQA 5EH1A 4ZOAA 4PTTB 2YD7A 1WBYB 2RFXB 5F1IB 1UADC 4FZ8L 4HZLA 2OX5A 2R2HB 3QULB 4HDIA 2ENYA 4LIQL 4OGAD 2Q1EA 3ZKND 1F3DJ 4I0PB 4KAQH 5HHPA 1DN2A 5DGQA 3SCMA 4HS3A 1B6DA 4WI5A 1UZ8A 1H8OA 5BQ7A 1HQ4A 4FFWD 5E2WH 5AD0A 5KS9F 2W9EL 3BSZL 4AEFA 1G7JB 4QXWA 4JFYA 5FEBA 3L6FA 4MYWB 1M05B 1R5VA 3EFFB 4GKNB 3MCKB 2V2TA 5AUMB 3C6LC 2I60H 1QACA 1VSCA 2A74A 3VGAC 1I4FB 3MGOB 3RWDB 4FTVB 4XPFH 3FFCE 1KB5H 3ULUC 4H20H 1FCCA 1OSPL 3PQYE 1NGQL 4MWFA 3MV9A 1MAKA 3TBWA 4NZTL 4YFLF 4MAYC 2JCCE 1LWRA 4NQDA 2FRGP 5ETUB 1U8QB 2VLRA 3HUJE 3MODL 1QLEL 2X4RA 3FN3A 1NMBH 4MX7A 3M45A 3I6KB 1BJMA 2W9DL 3ZL4H 1KJ2L 4P2QE 1AO7D 1J05A 1UENA 3FHQA 5E6YA 1R3LB 1U92A 1JMXA 5EOCJ 5HPMA 2RBLA 2WWKT 4G8FA 5BVPL 1Z0NA 2DQFA 2IANE 5DJZA 3ILQC 3SKOB 1OB1A 35C8L 4Y2DC 2KL6A 3QQ3B 2EXYD 5HHME 3RP1A 2MCPL 3QXAB 4DK6A 4X4ZA 5IFHL 1N0XH 5CP3H 1CL7I 2EICA 5D93B 3TNMB 4JAMB 1SJHB 2XFXA 7CGTA 3IRPX 4BM7A 1ZLSH 1B6UA 3DV6B 4Y4HC 5ITBH 2V7NA 2VISB 5CCKL 1JHKL 2CLVA 4D0CA 3JWDC 4YBQC 1A3RL 4Q0XH 4BSWB 4D0BB 5JDJA 1JPGB 4G6ML 1RUML 2A1WL 5B38G 1PKQB 2X1XR 6CGTA 1CFNB 4JQVA 5TH2B 4C56D 4KZEL 4ZYKA 2R0LL 4EN3C 3MLWL 1AXTH 2APXA 5DD1L 1YEHL 3QA3B 2P8MB 1F4AA 4XI5D 3F12A 1FO0A 2AV1B 4G7YH 4P0DA 4QXUH 5DRWB 2ZG1A 1EEYB 4RMQA 3ZKQD 1TJGL 5IBUB 1RZJL 2BOBA 2VLJB 2DBLL 2DQIH 4Y16A 4Z77A 3G5YB 1R5IB 3CLEL 2XN9B 1D6EA 3ZT7A 3SE8H 3OZ9H 5HGAB 3RWJB 1U8MB 4JZNA 4LOUC 3SDDA 3U0PB 2O61A 3ARGA 3QG7H 3KPRE 5TPWL 1T83C 3QXUA 5ELIA 2E9IA 3IRZA 4Z7NE 1FV1B 1QQDA 3TO2A 5F6IB 4TUKL 2BY1A 2Q76B 4H5SB 2GI7A 2PYFB 3O4OC 1FP5A 3OAUH 4U1KB 1MFNA 3GEWB 5DSCB 1X5JA 4AY0A 2OR9L 4OLWL 3O6LH 2UUDH 5T1LA 5E9DA 2Y9RT 1FE8H 4XAWL 1J0HA 1FDLL 3ILPB 4XPAL 1OW0C 2J4WL 1YEJL 1PLGH 4PRPE 5GZNC 3PJSA 3D39A 2IG2H 4RISH 5IB5B 3EO9L 2APBA 1F02I 1LK3H 3ROOB 2AJ3B 1SJXA 5HHXH 4D0DB 1EIBA 1GGBH 1RULH 2ICES 5D7IE 3GJFK 3L3GA 4PB0H 3ZYZA 1T7WA 2VYRE 1PSKH 4KRPC 5D2LE 3IAGC 2A9MH 3OB8A 1YEDB 3BW9B 4PY8I 4XZUA 4OM0L 4QRRB 3ECBA 1NEZB 3TGXA 2LFGA 4JGJA 5K59E 1FLTX 1YEFH 4JPVH 5ECJE 2B5IB 4BKLA 4H8WH 1INDH 5SX4H 1U8PA 1MHCB 4F9LC 3K1KC 1BP3B 5DJXA 3HPLB 3HNVH 3HZVA 4KMTL 4NCC2 3OKLA 5CZXD 1ETZB 3SQBA 4PRDA 3NCJH 3OG6B 4F8TA 1NBYA 4LHUG 3T4AB 1I8MA 2G2RB 2OBGA 4TRPH 4ODUA 3MXVH 2ADIA 4ZS7H 3IDUA 5FUCE 2PXYB 3CSYB 4K23L 3IFPA 4JKPH 5T1DL 1JYWA 2OM5A 2VABB 4HKZA 3FFCA 3QUXA 1OWWA 5EO9A 1PZ5A 3ZDYF 4OIIL 4WGWB 3WYRA 2O5XH 3GI9H 2XZCH 4F33A 3CFDB 5DT1H 5TQ2L 3W9EB 4JO1H 4KJWD 4Y16D 4MJ5B 4JFOA 1XF5B 2DLHA 2VMFA 4MA7L 3PNWB 3QH3A 5CEYA 3WHE0 5DJAB 5GS3A 5BZDB 1GOGA 3K3QA 4P3CL 3SDDD 2GY7B 5F1KC 3ARGD 3LVEA 1QP1A 1QFHA 3NZ8B 2WBWB 3IDGB 2ESVA 1LE5A 1U95B 4EEEA 3TJEH 4K3EL 4X80H 3H9SB 4UNUA 3UYRL 4P49A 3LRSB 2IFFH 4C58B 1IGYA 1PFCA 2NY6B 5KVDL 1EJ6A 1QRNE 3NBNA 3ZE0E 1LEIA 2A9NH 1T1YB 3RRQA 2X4UA 1KG0A 5L2JA 1W72L 1HINL 4O2FA 4ZXBB 5LCVL 5J1SC 4JG1L 4X6EA 4MCZB 1FLRL 3SOBH 3D39D 4TUJB 3SEPA 4MD4A 1G0DA 4WGVB 2BNQE 3PWLB 2H26B 2O5YH 1A02N 2D7PA 4PRHB 1FGVL 1GC1H 4XNYL 3V9FA 5FFLA 1JRHL 2BVQB 5FO8B 4FRWA 2HMIC 1IFHH 2QL1A 1DVFB 2B4CH 3VFSB 1EX0A 1CK0L 5DQDH 4OQTH 4G7VH 1K5NB 1OTTD 4AL8L 4N5UA 2DIBA 3QNYB 3T0EE 3CVIH 3MOBL 3CVHL 4GW4B 1UWGL 3OGCB 5I1EH 1DSFL 1J1OH 1QFWL 4FA8A 1JZ3A 3ZSTA 2EH8L 3B5HA 2XNAB 1AR1C 3H8NA 5F3HA 4O00A 4APQD 2BSRB 5C09E 4PD4J 3OB0K 4LU5L 4U1HB 1YY9C 2X1PA 3O6KL 3KPRA 4BH8A 3S3PA 3QCTH 4OB5H 5L8KB 4F3FA 1W0WA 4L8SA 1EA9C 2CPCA 1J1XH 4ELMF 3DX6B 4Z76A 1UB6B 4G8GA 1JCKA 1M7IA 3FFCD 3QNZB 1T7VA 3KPMA 3PQYD 2DQHH 2WUBH 1MVUA 3VI4F 4HV8B 1P7QA 5FA3B 4X6CA 4X98A 2YEZA 3ARDA 2ADFL 5H94B 1SEBB 4C4KO 2I60L 2RGSA 5E5RB 3WUWA 2GK0B 1EAPB 4DGYH 4XPFL 1A8JH 4TN9A 1KB5L 1CZ8H 2Y1VA 3MROA 3O3UN 4H20L 5DK0A 5KSBB 1FZOA 2EZ0D 5DA4A 4WUUA 4XRCB 3FO1A 5E2TH 3BPLB 4N8VG 3VXUB 4LCYA 4XNMA 3DVGA 2FHCA 5IVXF 5JOEA 2IGFH 4OCWH 4I9WD 4GRMA 2J3SA 5D2LA 5IFAH 3O3EB 2IAND 1NFIB 3O11A 4OF3A 2OI9B 4XGZA 4B7IA 4WWID 1NMBL 4M5YH 1QLRA 4ZUUA 4GXVH 5HHMD 1JWSA 3S8WA 1G7QB 5FYLH 3FCTA 3ZL4L 4DGIH 1QZ1A 1X6NA 3T2OA 2R29H 1FZMA 5FV2A 1PJ9A 4ODSH 2IEPA 3SKNB 2VSDA 4AIZB 1OPGH 3W5NA 4KQ4L 3GSOB 3RWHA 1I8LA 3LEYL 1Z5LA 3QG6B 1HNGA 3BO8A 1ZWIB 4I2XA 1DUYB 1B2WL 3GRWA 4R0LC 1E6JH 2AXHA 1FGNH 3EYVB 5EBLA 2QEJA 4R4BA 3VMNA 5ITBL 4HUKB 2Q86A 3ZE1F 2DMKA 4Q0XL 4RQQB 3R06B 4RGOH 2BNRA 2ICCA 2ARJA 5HGDB 2IC2A 3WIHA 1KCLA 3HNTH 1FJ1A 2C4FT 1AXTL 1NBVH 3RWGA 1FFNB 1DDHA 3V0WH 3VWKD 2J6EA 4G7YL 4XCYB 4QXUL 1QVOB 1S9XA 2VXTH 3LD8B 1G6RH 1D7FA 2W0FA 2J7LA 1XGRA 4PJ5E 4LDEB 1XR8B 1FL5A 4RWHA 4HIHB 4NC0B 4N1CA 1J10A 3KPRD 2X4SB 2KQNA 5F72S 1OLZA 2X2YA 5T1MB 2GIYA 2J12B 1KLUA 3SE8L 4D3CH 3GSWB 3OZ9L 4H0GA 1MOEA 3MFFA 4G8GD 4L3EE 3CC5B 5L6YH 4HKBB 4ZUTA 3MLRH 4PJBF 5J56B 2Y72A 3KLAB 4B53A 4OD1H 2AGJH 4IRJC 2AXFA 4XCCL 3ARDD 4IOFC 1FC2D 2PW1B 1RV6X 4MQ7A 1OGAE 1U8KA 4HXBH 4JRYA 1UCTA 4PRPD 4KV5E 3OAUL 3VRIB 4G6JH 3OKNA 2PTVA 1HNFA 5C0AA 2LE9A 3VE0B 3W2DL 1RAMA 3O6LL 5INDA 3SPVB 4WUUD 3QFJA 1UZ6E 1BBDH 3ELAT 4X4ME 1FE8L 4LDLB 1YMHB 2F15A 4PJXB 4KKLC 5D7SH 8CGTA 1P9MA 1I9IH 4OCMC 4PGCB 3MBXH 1PLGL 3ZYJA 4OLVH 3IDIB 3DROB 2IG2L 4LVNB 5JO5B 1YJDH 4QEGA 2DICA 1LK3L 3Q0HA 4PJDE 5FGCB 2SEBB 5HHXL 3P0VL 4YDVB 3QCVH 1GGBL 1RULL 5ERWA 3D85D 5D1XA 3L5IA 3FTGA 4L8BA 4KI5F 4PB0L 2YPKA 1PEZA 2VZOA 1PSKL 2A9ML 2VXQH 3LKQA 5J6GA 3KPOA 3L3HA 1WTLA 3MRJB 1OAUL 4YGAB 3QAZB 5DDHB 1QFUL 3HE7C 3OJDA 2LV4A 1WIOA 3UTZA 1YEFL 3MFGB 4OKVA 4HIIA 1YQ2A 1TTUA 1YECH 4H8WL 4OZGE 1INDL 1Q0YH 2A6DB 1AY1H 5E5MB 3EGSA 5DZLA 1A3LH 4YDLC 3HI5L 2UWEB 4OSUH 3VXSE 1DBMH 1K9TA 2CKNA 5D2NB 4IJ3B 4YDKH 4F7PB 5D1QB 3NCJL 2H2SC 3MRRB 5EU7E 1KEGH 4TRPL 3MXVL 3U79A 4JPIB 3O81A 3AMKA 2FIRT 4FS0A 3VXRB 1CYGA 1VEPA 2D9QB 5BV7B 5IEHA 5IQ9B 4NUJB 4LLQB 2VERN 3AREC 3MRDA 3U48A 4K7FA 4QYOB 3HE6A 5JXED 2O5XL 3GI9L 4ZPVA 2D4FA 5I19H 5DT1L 3C08H 5C6WH 2VIRB 4JO1L 2D31A 1HXMB 4DEPB 4KDVA 4S1DD 5I8EA 2GT9B 4GW5B 4PR5B 1GRWA 4JJHA 5DJCB 1QLFA 4CNIA 4CMHC 1GGCL 5IBTH 2J5LC 4FQHA 3WS3A 1IZKA 1MRDH 2ZUVA 1QBBA 1ZMYA 3P30H 1VENA 1ED3A 3ZHLA 1HHIA 1BVKA 1CLYH 3X13A 3VGEA 4M3KB 4X80L 3V5HB 5CHNB 1X4ZA 3WEXB 2EEBA 2PNDA 2IFFL 5HDBF 5C0AD 5GS1A 3TH4T 5F7DA 3GMQA 4I18A 4NO2A 5EC2B 2BNQD 2A9NL 4DKEL 4JFDE 3QFJD 1K3IA 3GSNH 5C0NC 3JSSA 4MNQB 2QR0A 3IXAA 1IEAA 2FJFB 1NC4B 1P4BL 5F6HI 3SOBL 2XTJD 3GMPB 2FWOB 4PJFA 4JFXA 2AK4A 3T0ED 2O5YL 3U36B 5M95B 1UM5L 1GC1L 1EGJA 4NQEE 1H5BC 1YC8A 3DECA 3OHXB 1NFKA 1IFHL 3KPQB 2B4CL 5D1XD 2VL5B 3SKUD 3K8MA 5DJYB 4QRTB 1Y18A 3KLDA 5DQDL 4OQTL 4G7VL 2X5PA 5I0ZA 3CK0L 3VD5A 1WBZA 1EH9A 5C09D 3CVIL 5CP7A 4KK6D 2VZ3A 4R2GD 4Z7UB 2VWEE 3L3IB 4WFEE 5I1EL 1J1OL 5E00B 3L7EA 2I07B 1S5HA 3IU4H 4Q9CA 3MRIB 2Z31A 1FO0H 3WKNA 5DK2B 2VR9A 5HYJE 3O9WA 4NKDA 3LKNA 6FABH 3SKMA 3QCTL 1NFDF 2DYPA 2X09A 4U1NB 3O8XA 5DTFB 1GZQB 1N0LA 5IHZA 1JTTA 1J1XL 2VE6A 3EDKA 3QI9B 3C2SA 4KKBD 3W0WA 1QKZH 1XH3B 3ARFC 2DQHL 2FD6H 2WUBL 2IAMD 1MPAH 4X9IA 3HS0B 2CDFB 2OR7A 3HE6D 2IBGA 4ZFOL 5T1KB 4NQCB 4QTHB 1DCLA 4DGYL 2UV3A 3VWJB 1AXSB 1CZ8L 2NW2A 5FYKH 3MA7B 3ZE2E 1J18A 5KZCD 1EDQA 1S3KH 4JCMA 1E28B 4OUUA 3WJJC 5E2TL 4ACPA 2ZSVB 3P9LB 2EE3A 3MV7E 4HW6A 1L7TL 1T66C 4HPYH 2PTTB 3OXSA 4UT7H 4A6YA 2XA8H 1B4JH 1NL0H 4OCWL 5JMRA 5DVKA 4JZJC 5IFAL 4I5BB 4KI5C 1LEGB 4RFEB 4D8PB 2AKRB 3OR7A 2ZWLT 3FB5B 2HH0H 1KCSH 3GIVB 4GXVL 1JF1B 5FYLL 4DGIL 1F4YH 1HHKA 5F1SA 2ZPKL 4YBHA 3G9VA 4WTXA 4ODSL 4AEEA 3KPTA 3HPJB 3CPLA 3MLYH 5CJOL 5SWSE 3IXTB 1UCBH 5EIVA 1A4KA 2FO4B 4M02A 1OPGL 4MNHA 1OM3H 1U8OB 1ZXQA 4WNQB 3G6JB 1SVZA 4F9PA 1CDIA 1FNSH 2OK0H 4XTRD 2B8OT 2OTWA 3MOAH 5T5NG 5GRVK 2ATKB 4PGBB 3R4DA 4HUUB 2Y6SC 4RX4A 4EUPG 4DOHE 1CTNA 1TETH 1E6JL 1Z2KA 4L8DA 1W0YT 1FGNL 2AK4D 3TVMB 3TO4A 3WDIA 2L7UA 4UV4H 1E4XI 1VACA 4AENB 4JDZB 2YOCA 3TLRA 3ULSB 3CMGA 3CCHB 2MKLC 3KLHC 4EJ1C 1XGTB 4RGOL 2XQYG 2HJFA 4N0FB 4EI6A 1EEZB 1Q9WA 4NFDA 3ZKSD 4PJ5D 1RHHB 3NCEB 1KTKE 3HNTL 5HY9B 5I1AA 1NBVL 4JFHE 1OT2A 2CLRB 1FSKB 4P4RA 1ES0B 3PHOA 3V0WL 1OGTB 3DPBA 1PZUB 3VGGA 3WSQH 1FN4B 3IFNH 2Z31D 5F44A 2VXTL 1G6RL 1TCMA 5FK9B 1MEXH 4L3ED 4OJFH 4P5TB 3O9WD 3WNLA 4Z5RA 1RZJC 5JNYA 4E41A 1RK1A 2EYRA 3QEUB 1N3NB 1FNEA 3O8XD 3QIUB 2EEDA 3K7UA 4XX1E 4D3CL 3NIFF 1VFOA 1C8PA 3RUGE 3TBTB 3V4PH 3RDTC 5L6YL 1NSNL 2HT4D 2XWTA 4HCRA 3MLRL 4X7FC 3F7VA 4NO0B 4UAOB 4YHIA 2AGJL 2Z35B 5D7JA 3H9HA 5DJ0A 3VFNA 4HXBL 2P44B 4PBWD 4G6JL 3QDJB 1IGCH 3JXAA 2NNAA 3F7PC 3L9RB 3LKOB 5DZOA 3SHSA 1BBDL 4Z7VF 4NQEA 3VFOA 4ZS6C 1JGDB 1WICA 4KVNH 1BOGB 1I9IL 2BHUA 5HVHB 3MBXL 3VXQA 2MQ0A 2ICWI 4OLVL 5C9JA 3MRPA 1ORQA 1VFAB 4FQ1H 1U8LB 3KYMA 5BW7A 3QCVL 1NAMB 4JVWA 1J88A 1EAJA 3EDEA 4ZD3H 4L9LC 4LBEB 2CR3A 5ID1B 3VDBA 5J6HA 1YEEH 4PLJC 2VXQL 1IGTB 1AIFA 3GSVA 3D0VA 1JZ4A 3DIFA 1K8DB 1YECL 4KGLA 4RX4D 1Q0YL 4I48A 3G6AB 1AY1L 3TO4D 4AM0A 5MI0B 1A3LL 3KHQA 4N0CC 2IMNA 4AH2B 3S34H 5I1KH 2P5WE 4NCDA 2BJMH 2X4PA 1DBML 1X5YA 5GGQH 1JHTA 4YDKL 2HVKB 4Z0XA 2CRYA 4NHUA 3IDMB 3MRLA 4AK1A 1KEGL 1N8ZB 1LO3H 1KCVL 3H7BB 5IKCB 3SE4A 5ICYA 5KG9B 1BF8A 4LAQH 4NKMA 4B7LA 4GLRH 5GJSH 3GMLA 5HVWA 2Y25A 5AYQA 5TFSH 1JGEB 2ZUYA 1EERB 5TF1H 2NR6C 2HT3C 1VKXB 3C08L 2WBJC 1F00I 4OZHB 3FO9A 4JQXC 4OD2A 5J1AA 2E7BA 4ODBD 1ONQA 3CU1A 4CDGC 1P2CB 1AGFA 5I16A 2EC8A 4LSVH 5BVJA 4UU9A 4YDJB 5IBTL 4PJ9A 1S7SA 3GM0A 3P30L 4S1RH 2OTUB 4JFDD 5L2KB 3MRNB 1CLYL 1U3HB 2IF7A 4H1LA 4LPTA 3WV0A 1H9VA 4QRQA 2FCBA 1FG2A 3KYKH 4NBYB 4DCQB 3M17A 5TGBA 3TH3T 4MD0A 1NCNA 3C6LB 4H25B 1RUPH 2NY3D 2VN7A 1BBJB 2Y7QA 2VKXA 5JMOC 3QEQB 3I02B 3FFDB 1PW3A 4Q6YA 5F7UA 3GSNL 1CDCA 3V6FB 5GHWH 2GJ6E 2RB8A 5LGKA 4NQED 1HH9A 4LCCA 4U7SA 4NGHH 5F7WC 3RAJH 1A64A 4AG4H 4C54A 1GPOH 4BQ9A 5BZWA 4PREA 3IFLH 4Y5YB 4Q9QH 3IVKB 5AG8A 5GRJH 1I1AD 2DIJA 1FG9C 4UZGA 4WFED 1T1ZA 1V8HA 2PCPB 5E99L 3GRWH 2DWDB 5GGUB 4X6DB 4IIQA 3BMWA 4O51B 1U58A 4Y2OA 5F7HA 5HYJD 5ESAB 3TJHD 3HAEB 1IEBA 3RVUC 1ORSA 4MB5A 2ZCHH 3OMZA 2WNGA 3WIHH 4Y2DB 5FKAA 1WF5A 1DZBA 3ORJA 2VO5A 3DETD 4OFYA 2YBRA 3IDJA 4TTDC 2J6EH 1MFEH 6FABL 4Y4HB 3WLBB 1IRAY 2PO6A 3BD4A 5CWSB 1UH2A 3QUKA 4NPYA 3NFPB 4U6YA 3BGFC 1OHQA 5ESVA 2YD4A 1HHGA 4P4KA 1OSZA 3KJ4B 4DUWA 3AS1A 3V6OC 4NHCH 3HA0A 4EN3B 1EHLH 4PG2A 1QKZL 2C1PB 1CD8A 4KK9D 2FD6L 4NT6A 3TBVB 1MPAL 3DYMA 3BIKB 5DFWH 2BFVH 4J3UA 1Q94A 4S0TD 3QRFM 4FQJH 1JPFA 5EOQH 4WV1B 5KOMC 3PV6A 5J13C 3GO1H 4WO4B 1GOFA 5GGVH 1T1WA 4XC3H 5I1DB 2Y36L 2EDLA 9CGTA 3GDBA 1KLGB 4KKCC 1S3KL 1RPQA 4XCEA 3NAAH 3FQUA 2HLAB 3BZEB 2QADD 2F53E 4GOSA 4X6FB 4GRLC 4PJ9D 1YEIH 4HPYL 4UT7L 5FIEA 5C0DB 2XA8L 1B4JL 5SWSD 2NXZB 1NGYB 3MLZH 1I1YA 5DHVB 3H3BC 4N5EC 1T0MB 4YIQA 5D7LB 4PJ7B 1DQLL 3QXVA 2HH0L 1KCSL 4EI5A 2VZ1A 1F4YL 1JI2A 4ODXB 4PJHF 2P43B 2EDKA 5JOFB 1JZ2A 1Q72H 4PGEA 3MLYL 4OZIB 1GGTA 4XHJC 2BSSA 1Q1JL 1UCBL 3VRLF 4JZOB 4P2OB 4KUCD 1OM3L 4I1NB 2V9TA 3I3BA 3RVTD 3ALPA 5MEPB 1JWUB 4EZMA 4MS8C 3OR6B 5F89A 1FNSL 2OK0L 5I15H 3FRPA 3MOAL 5D5MB 5ALBH 2EYTA 1UH4A 3C5JB 1PKQE 1I75A 4QWWC 4YHLH 5IWLA 1TETL 2COQA 2E9WA 1WVZA 1ZHNB 4UV4L 3JV6A 4JM2F 2WP3O 1KULA 1BQSA 2CD0A 1BMGA 1VDGA 1IT9H 5L88H 1A7PL 4KC3B 3E2HB 3MRQA 3PL6A 3RWEA 2QQLL 2YPVH 3TN0A 2VAJA 4P23C 3SDXB 4YEFA 2VJXA 4FP8H 2NLJB 4YZFE 3RL1B 5CD5D 4WEBH 5JUEH 1D5XB 1G1CA 3OKKB 3IFNL 1KTLB 1U8IA 4X4XA 2I25N 3FQXA 3ARBC 5EUOB 5FUZH 4OJFL 4CVXA 1MRCH 2ZJSH 1KTDB 4WUKH 5E1AA 2PO6D 1QFWM 3G5VA 2GAZB 5ALCH 1D5MB 1JN6B 2X6MA 2VSCA 3U7WH 2VDKH 1KJMA 1UEYA 5FA4B 1RURL 1UJ3B 3BP7A 4UTAH 3LN9A 3BUTA 3V4PL 2QQNH 4YHYC 1OP9A 5KS9B 4GG6F 2BC4A 5DVNA 3VDAA 1NBZB 5J9PB 3DURB 1ZGLP 2YS4A 1XF2A 1GGIH 5ID0A 5BRZE 3IB4A 3U82B 2H45A 1NDGA 1G7MB 3EOAB 1IGCL 2XQYK 4E42A 4TOYH 1FYTA 3LN4A 4KTDH 4I77H 4ZAKA 5GSRA 1YUHA 1FVDA 2J8UE 4NDMA 3PGFH 4JDTH 3SGKA 5FHBL 1FNAA 3CSPA 5DFVC 2P4AB 3KNBB 1CD1A 3HRPA 3EW3B 5LGJB 1TZIA 1BQLH 4KVNL 5FECB 4MVBC 3GK8H 4M1CC 4YPGB 3W11C 4XVJH 3EYSH 5DC9B 1R0AH 5E70A 4S0SD 4FQ1L 4NO5A 5CBEB 1MFDH 2Y5TB 2OSLB 2XA3A 3SDCC 3QQ9D 4QRRE 4KZDH 3DBXA 3FAWA 1L4IA 1YDPB 3CXHJ 4PTTA 4ZNCD 1WBYA 2RFXA 4RBPH 5F1IA 4ZD3L 4KJQC 3P9MB 2MQ3A 1NLBH 5F9WC 2QHLA 4YWGH 2I27N 2R2HA 3QULA 1EGJH 4EDWH 2ILLA 4QRSB 4RAHA 4I0PA 1DQQB 2OL3L 2YMXH 1JVKA 1CDHA 5DWUH 2OZ4A 2P5WD 2IPUG 1LO2H 1G7JA 5C0CB 2E6JA 1M05A 1WTGT 2X9YA 1I3VA 3EFFA 3MCKA 4GKNA 5DC0A 1V7NH 5AUMA 1MAJA 1QFWI 1NCUA 1I4FA 3MGOA 3RWDA 1X5IA 4H8WC 2V5MA 4FTVA 1NH6A 1DBJH 5I1KL 4D9RE 2BJML 3UDWC 5GGQL 4G8IB 1J8HB 3OGOE 4W4OC 3PL6D 3BPNB 1LO3L 2A73B 2RIKA 4O5LH 3F5WB 4ETQB 3THMH 1KGCE 3TN0D 1I1RA 4XBPB 3P77B 4LAQL 5ETUA 2GFBB 5GJSL 1U8QA 1QNZH 2EC9T 1BD2B 5TFSL 3I6KA 3IJSB 2ZUUA 4HGWB 4ZSOB 3UCRA 3UPRB 1LO5B 1J0YA 5TF1L 3WIFB 4GAFB 2VAAB 1R3LA 5HVGB 1HILB 2C5DC 1N7MH 1YYML 2JKXA 2EXWD 1A1NB 5TJWK 2G60H 5E2UH 2Z9TA 5FKPB 5BOZG 1A0QH 1FZKB 4HFUH 3B2UD 3SKOA 4ZUVB 3OKMB 3QQ3A 5JZ7D 4LSVL 1VFUA 3QXAA 5T5FH 4F57H 3STLB 1MJJB 1GYAA 1QOKA 3OKDB 4GBXC 1DANT 2DLFL 4S1RL 4NC1E 3TNMA 3JTSB 1SJHA 4JAMA 3DTXB 3DV6A 5T33L 2GJ6D 2VISA 3BRGC 4Y5VB 3BQUB 3BH9B 3T0VA 4A6YH 5HYSB 4XAKE 1MCPH 3B9KD 5D6DA 1TFHA 3KYKL 4BSWA 4JY6B 3QEGH 4D0BA 5I1JH 1JPGA 3NTCH 1PKQA 1RUPL 2HT2C 3NIGF 3IAPA 3I2CH 3PDOB 2M8XA 1NGXB 1CFNA 3B2VH 1QEWB 4IMKA 4ZAKD 5TH2A 2DRUA 1MCBA 2A6IB 5HD8C 3H9YA 4U0QB 3QA3A 5GHWL 2EKJA 4UINH 2V2XB 2P8MA 1YQVL 4AG4L 4NGHL 3RAJL 5I1HH 2AV1A 4MAUH 1GPOL 3LB6D 3IFLL 5DRWA 4LSTL 3N9GH 1EEYA 3ZDZE 5GRJL 1QTYT 4Z7WE 1SEQH 4CJ1A 2VLJA 3O3DB 3SJVA 5C0FB 4LNRB 1P69B 5MENE 4BUHA 5FXCH 1RZKH 3G5YA 3GRWL 1R5IA 1KPRB 4IMLB 1GC1C 2XN9A 2DQGH 5TQ0H 5HGAA 3RWJA 2FBJH 1U8MA 2AI0L 2B4CC 4HUWB 3K4AA 2CR6A 3U0PA 4KK5D 3H2WA 2W38A 1CTOA 1I85C 3LN5B 3ZT6A 3NCYS 2ZCHL 4Q58C 3WIHL 1XMWA 2DI8A 2GHWB 2P8LB 4ODWB 1FV1A 1S9YB 5IHBA 4XC1H 4UQ2A 2D7TH 2ZUSA 2Q76A 4H5SA 4NZRH 3F6IA 3L1OH 1ZT7B 2PYFA 1TZGL 2J6EL 4X99B 1MFCH 1IARB 4U1KA 1MFEL 4A2LA 5DSCA 2AEIT 3FOLB 2OJEB 3VI3E 1BHGA 3ILPA 3QXDB 3QIWC 3IT8D 4D9QD 3QUZC 3MYJB 1UWEH 3P73B 4NHCL 3KPPB 1WCBB 4NN5C 5IB5A 1EHLL 3WDHA 3RI5K 3WHXB 4EXKA 5KSBE 3UTPE 3ROOA 2AJ3A 2FEDD 1PQZB 3T1FB 4HCRH 1C7TA 1BGXH 4D0DA 1ZT1B 4Q6IC 2BFVL 2F53D 1MH5B 4FQJL 2N7BA 3C5ZC 3QWQB 5EOQL 1DBBH 1HSAB 3GO1L 2DQTH 5GGVL 4XC3L 5F1NB 4WDIB 1IMHC 1YEDA 3BW9A 3NAAL 4QRRA 3LIZH 4ENED 1NEZA 2AQ3A 1A9EB 4BUGA 1YEIL 3UPCA 1MCNA 4GS7C 5KSAB 3GBLA 3D3VB 2P48B 1MHCA 4XP6H 3HPLA 1KCRH 4IRJB 2NXYB 1ETZA 3D6GA 2DLTA 1OY3B 3H9ZA 3T4AA 2G2RA 3DVNB 1Q72L 3DX9B 2PXYA 1CGVA 1G0XA 2E7LA 5AAMA 3VJ6B 1CE1L 3TV3H 2VABA 4W6YB 2R1YB 4HZAA 5BS0E 2X7LB 4M6NH 3QZWB 5B8CC 5I15L 4C4KT 5ALBL 3K74B 2J8OA 4HWNA 2PYEB 4YHLL 5IMKB 2Y07H 5IBLD 2VLJD 4OIBA 3CFDA 1Q0XH 1AGDB 4JFFB 3MOQA 4Z7OE 3WNPA 3W9EA 3HZKB 3VFGH 1CIUA 2Z93A 4MJ5A 2FDBP 3K1DA 4KDTC 1XF5A 2XN9D 3PNWA 5IOPB 5SX4I 1IT9L 2C3WA 2XV6B 4H1LG 5BZDA 5L88L 3RZCC 5I1LB 2V5RA 2YPVL 2XKNB 1I1CA 3NZ8A 3OKOB 3IDGA 3BH8B 3M07A 1U95A 4FP8L 4QHLB 4TQEH 1CU4L 5I66B 4PJAE 4WEBL 5JUEL 2YD9A 3H9SA 5I73C 2H8PB 4OGAC 3LRSA 3ZKNC 5FUZL 3TT3L 3KPSE 1MRCL 2ZJSL 4XNUH 4FFWC 4ELMB 3ZKMD 2X4OB 4YDLB 1T1YA 5ALCL 4PRBB 1CFSB 5E6IB 2VDKL 3U7WL 4ZXBA 5BRZD 4MD5A 3NPSB 3QIBB 3IAQA 2QQNL 4MCZA 4P9HL 3OJMB 4TUJA 3PWLA 2H26A 4PRHA 3AREB 4Y1AB 1KXVC 4L4VB 4PJXE 2OLDA 3KXFB 1GGIL 2BVQA 2DKUA 5FO8A 1DVFA 1W0VB 3CSBA 3VMOA 4M7LH 1JZ6A 1Q38A 4H1LH 4OQ1A 3VFSA 1K5NA 4HIXH 4TOYL 5IV2B 4KTDL 4XX1G 4I77L 3QNYA 1WBXB 5IVXB 4BZYA 1K6QH 2AEQH 4GW4A 3BWAB 3OGCA 4QRRD 3QISA 4X8XA 4P46B 1JP5A 2XNAA 4OLUH 3GK8L 4BQ8A 4CMHB 3BE1H 2ATPB 4XVJL 4X5LA 1DQMH 5I2IB 3EYSL 1EFXB 1R0AL 2BSRA 2GJZB 4U1HA 1MFDL 1ZAGA 2YD6A 2EXYC 4KZDL 2HG5B 3QDAA 1UQSB 4HKJB 1CQYA 3QO1B 5IROA 3DX6A 4YWGL 5IJVB 1UB6A 2PXYD 4EDWL 4AEHH 5IR1B 4KVCH 5B22A 2YMXL 1YMME 5DWUL 3QNZA 2FL5B 4D9RD 4U33A 5HHNB 2X4TB 4HV8A 1LO2L 5FA3A 3MV8E 3BXNB 5H94A 1SEBA 4S1SH 5HHVH 1KGCD 1EK3A 2GK0A 1EAPA 5TE7H 4XI5C 3UZQA 1ZLWK 5KSBA 1IEHA 4H0HB 1QSVA 4TVPE 4LIQE 4XRCA 4ZFZB 1BX2B 4MJIE 3VXUA 1SYSB 2X4QB 2AJXL 5FGSA 4O5LL 3WJLA 3A0OA 1AGEB 3FT4B 3H3KA 3O3EA 1NFIA 5C0IB 1QNZL 1TLKA 1G7QA 1EUUA 2NY6D 4OV5A 3SKNA 4PIRF 3FRPG 3HR6A 4HIEB 2NY7L 1N7ML 4AIZA 2G60L 2F8VA 3FQWB 1A0QL 4LK4A 4ZXBD 1CT8B 4HFUL 4XAKD 3H42H 3T08A 3QG6A 2APFA 5T5FL 1ZWIA 3OJ2C 3MJ8B 4F57L 2IPUK 5LVEA 7FABH 1DUYA 3EYVA 4WTZA 4PRHD 1T04B 3BZDA 2VZSA 2JCCF 2WLZA 1MCPL 4UMGA 5FM5M 2YZ1A 5T5NF 1DVFD 1DP0A 3QEGL 3HC0B 3R06A 4RQQA 4CU7A 5I1JL 3HUJF 3NTCL 4I13B 2YA1A 1P84K 2C4FU 2WLYA 5HGDA 3I2CL 3DO7B 3B2VL 5HHQA 4QGTA 2P49B 5MEND 4UINL 1FFNA 4C59B 1J0KA 1UYWH 4F15C 2ADJB 1OAZH 5I1HL 4P3DB 4MAUL 3CDCA 4XCYA 1BEYH 4U1GC 4M8VA 2VL4A 3UBXB 1QVOA 3OXRB 1MHPH 1SEQL 3CDYA 5F9AC 1XR8A 4POZD 1TPXB 1G1YA 4JZJB 3HFMH 3PGDB 2R0ZH 4HIHA 4Z7UE 2X4SA 1RZKL 5F7FA 3OJVC 5T1MA 5TQ0L 3MACH 3UZEA 3D18B 4K3JL 4QHNB 3GSWA 3GJEB 1CGTA 2NQCA 2YWZA 2O5ZH 3GSQB 4TUOB 3CC5A 1KJ2B 1X7QB 1R3JB 2DF3A 4HKBA 4WHYH 3WIIH 4J3SA 3WO3B 5HVFB 5CZXC 3LEXB 2F5AH 3KLAA 1LO0H 5EU4B 1PY9A 5HDOA 5E2JA 4M7LT 2XQBH 1ZKAA 4XC1L 1K2DB 2D7TL 2PW1A 1VEOA 4ZTPH 4NZRL 2GYSA 3L1OL 5KSUB 1UACH 2UZIH 3VRIA 2B0SH 2BERA 3KYOB 3VE0A 2XZQH 4PV8B 3SPVA 4D2NA 4NYLB 5IESH 2GSIB 4M7ZC 4PJXA 1YMHA 1HWHB 4CVZB 4OLEA 3WFHB 5J12C 1A7QH 1X5GA 2Q8BL 4PGCA 4KKLD 4NQCE 4Y89A 1O7SA 3QDGB 4KJWC 4Y16C 3IDIA 3PE9A 4JJ5B 1WK0A 5EBWB 3DROA 5JO5A 2FB4H 5MERB 3L3DB 2SEBA 4HCRL 2EDOA 4YDVA 1YNKH 3SDDC 3TCXA 3TIDB 4HGMA 1TITA 3ARGC 1DBBL 1BZ9B 4Z7NF 1OF2B 2DQTL 4XNXH 4QRPE 3O6FD 3MRJA 3LIZL 5DDHA 5KW9H 2J2ZA 4RGNB 3ZHKA 5CGMA 1BFOB 4WEUD 1CXKA 3BUYB 5E5MA 4XP6L 4J3WA 4Y4KB 3H0TB 5LQBH 4ORZC 1KCRL 2UWEA 5BS0D 5L2JB 5BXFB 5C2BH 5GGVY 3K4ZA 4LCWE 5D2NA 1IE5A 3LQAL 5D1QA 4F7PA 3MRRA 4JPIA 5EO0B 1MCLA 3VXRA 3VCLB 1B4RA 3DARA 3ROLB 5D7IF 5IQ9A 2YKLH 2C3VB 4NUJA 3TV3L 5C6PB 2OQJB 4WI4A 4LLQA 3QUYB 4M6NL 4PRAB 5D2LF 3NFNB 4MJ2A 4QYOA 5IHUH 3RGVD 1OTTC 2OZ4H 2VZVA 2Y07L 3S6CA 1FNHA 2D4DA 2EIEA 5K59F 3NIDE 1SY6H 4GUPB 3SGDH 4U3CA 1HXMA 1WFNA 3VFGL 5JHLH 3DOSA 1WWBX 2GT9A 4MZ2A 4GW5A 2WANA 4PR5A 1QUNA 4QXGH 5GPRA 5CUSL 5DJCA 4L9LB 4APQC 4G3YH 3GJFB 3HC3H 1RIHH 1NDMB 4Y5XB 1A4JB 1MCSA 1N5AB 3WL9B 4U1JB 3PHSA 1Z9SA 4NQSB 3V5HA 5CHNA 3WEXA 1NFDB 4NQXB 1BZ7B 1HH6B 2X9WA 3RZWA 3KWWA 4XNUL 4NP4H 5EC2A 1D9KB 3LS4H 3SY0B 4PGDB 5IW6B 4JM4H 4MNQA 1P7QB 4C83B 2FJFA 1OP3K 3LQZB 1NC4A 3VD4A 3GMPA 2FWOA 2EZ0C 3U36A 5EIIB 4I3RH 2GCYB 1FAKT 5KANI 1D6VH 3OHXA 3KPQA 3NN8B 4M7LL 2VL5A 4V1DB 1HQRA 5DJYA 4QRTA 3RI5F 3P11H 4CUCA 3HMXA 4WW2F 4HIXL 1QSFB 5F71A 1K6QL 2AEQL 4Z7UA 3L3IA 4NNXB 3GZKA 4LPXA 3ZE0F 5E00A 4ZUUB 2I07A 4OLUL 4P2RB 3FONB 3N0PB 3BE1L 3MRIA 4WI6A 1WJ3A 1JMZA 1DQML 1G9MH 1TQBC 4FG6C 2ZSWB 5DK2A 1YMMD 2R4RH 3KR3L 5DMKB 1S7XB 4JRXE 1FFRA 3B8YA 3QHZH 5K9OB 1F90H 5D1QD 2YPLE 4U1NA 5DTFA 1GZQA 1TIUA 2VLLB 2E8YA 3MV8D 3P40A 4AEHL 1PGRB 4K07A 4GKZB 4KVCL 1WITA 4WI3A 3QI9A 4ALAH 2Q8AH 5EBLB 2D3VA 5C0BB 2V9RA 5JW4M 1XH3A 4DK3A 4TVPD 2Z8WC 3AAZB 3UTOA 3MRHB 3HS0A 2CDFA 2JJUA 5T1KA 2AJZB 2ITCB 1YC7A 4J1UB 4S1SL 5HHVL 4PJIE 4DZ8B 4NQCA 4QTHA 4KHXH 4J3TA 2DN7A 5TE7L 5GGSB 1LP9E 4M9PA 4M93B 3VWJA 1MVFA 1AXSA 4DZBB 3MA7A 3VWKC 4PJEE 2OXGA 4GKSB 1E28A 1DLHB 5LBSH 4JVUA 2ZSVA 4OCSH 3P9LA 4XH2B 1H0DB 2J1KA 2PTTA 4TULH 4OZHE 2AEPH 3MJ7B 4I5BA 4L8SC 1LEGA 3V6BR 4RFEA 4D8PA 2AKRA 4LVHB 5CGTA 3FB5A 2R69H 3GIVA 1JF1A 5TDOB 5EA0H 3TH2T 4UILH 1RSFA 3HPJA 2VR5A 3IXTA 5L2KE 2WUCH 2CUMA 2FO4A 4G6KH 1U8OA 4WNQA 4NRXB 3G6JA 5F70A 4K8RD 3ARDC 3IYLW 1KT2B 2WW8A 1HI6B 1NC4D 3H42L 3T65A 1YYLH 2ATKA 4PGBA 4HUUA 7FABL 1MHEB 1MWAL 1Z9LA 1E4WH 3TVMA 1NBQA 3QWRA 3WXWL 1NUGA 2YHGA 3BEWB 4AENA 4JDZA 2V5SA 3GKZA 3K80A 3ULSA 3CCHA 1XGTA 4XBGB 5E7BA 1MJ7H 4N0FA 2DTMH 4Z7VB 5GRXG 1EEZA 5J13B 4KKNA 1RHHA 4FQQB 2QHRL 5HY9A 2CLRA 4GAYB 1UYWL 1ES0A 1OAZL 4X6DE 3DVIA 3TM6A 1OGTA 5ERWB 1FN4A 4MNGB 5JW4R 5FK9A 1V7MH 2W0PA 1MHPL 1AH1A 5A2LH 4P5TA 1NCBH 2R0ZL 4Z95H 3IFOB 3M1BB 4RFNC 5IM7B 5AWNH 4POYA 5HGHB 1H8NA 3QEUA 1N3NA 1F2XK 3QIUA 4EOWL 5FUCC 5B3JE 2O5ZL 1E4KA 3TBTA 1MIMH 1H3XA 4PJCE 3WIIL 4X7CC 2EECA 2AXGB 1G6VK 5DLMH 1NQBA 3ARVA 3V6ZB 2F5AL 4NO0A 1LO0L 1JK8B 5GISH 4YBLB 2Z35A 1VADB 2XQBL 3QDMB 4BZ1L 4J8RB 4E5XB 4ZTPL 2ORBH 3HI6H 1JNLL 4NQCD 1UACL 2UZIL 3QDJA 4KQ3H 3VWJD 1XAUA 1CDYA 2XZQL 4NO3B 4D9LH 3L9RA 3LKOA 4XNZB 3RTQA 2NY2B 3HRZB 5IESL 5LKNA 1LEKB 5JXEC 5C7XH 1JGDA 4HHAB 5L0QB 1BOGA 4WU7B 1FAIH 3L5WB 2FB4L 4S1DC 5DMGD 2D31B 3MLVH 5IB4B 1XIWB 1U8LA 2ZUTA 1T6WA 3D1MC 3HNSH 3QPQD 5EPMB 5IUSA 2CUIA 1CFVL 5C0JB 3F8UB 1NAMA 4L9DA 5IVOA 4LLUB 4LBEA 3ARBB 1VB9A 5ID1A 4BFEA 2D03H 5JPNA 4UQ3B 3EJZD 4KV5F 1U3ZA 4XNXL 1IGTA 5HDQH 4QHKI 1F3DH 2LQRA 1UWXH 5KW9L 1CQKA 4GH7B 1UZ6F 4GXUM 1K8DA 3IDYB 4QOKB 3V4UH 4IS6B 3GSRB 4N90E 4OZIE 1U0QA 3G6AA 4GW1B 1ULVA 3QWRD 2VOTA 1HCVA 4BQBA 5LQBL 1ZVHA 3GM8A 4AH2A 5C2BL 1P9MC 4UIMB 3GB7B 1V3LA 5HYEA 3L7FB 2HVKA 5D5ME 4PJDF 4LSSL 3CFKB 3MLTB 3IDMA 3MBEB 2XTJC 1N8ZA 4Y19E 1RJLB 1AGCB 2HVJB 2ZUQC 3BD3A 3T0EC 1ZS8B 3Q48A 4XP4H 5B38B 2YKLL 5IKCA 1EJOH 3OQ3B 5KG9A 2CO7B 1FC1A 5IK3B 4NZDA 1BWMA 5D1XC 3U7YH 2HJLB 2FJHB 1Z9MA 2H41A 1DBAL 5E8EB 5FYJU 2VTFA 1XGQA 1JGEA 1QHPA 3LQMA 1J7VR 2OZ4L 3ZYOA 1MI5E 4P5TD 2IFGA 4KK6C 2AJVH 1SY6L 4R2GC 1VKXA 3IF1B 1D5ZB 4OZHA 5JHLL 3SDXE 4OZGF 3SDCB 3WFDL 2BK8A 1IKFH 3QIUD 4QXGL 5EOCH 2JE8A 1P2CA 2IADB 3WN5B 4G3YL 4YDJA 3PXJA 5EUOE 2EO1A 3HC3L 1RIHL 3PWVB 1RI8A 2YRPA 2OTUA 3NPZB 5L2KA 1YPZE 3MRNA 1U3HA 1AR2A 3UJJL 2LU4A 2ITDB 1N6UA 5IB2B 3RA7H 4DCQA 4L4JA 1YN7B 1DEEB 1N6QH 3C6LA 4KKBC 1NC2B 4H25A 3QDJD 4GLRI 2Q7YB 1QR4A 1BBJA 1CICB 3LS4L 3QEQA 3OL2A 3I02A 2IAMC 1MCWM 3FFDA 4EDXB 3V6FA 5I8KL 4JM4L 3EOYG 4PY7B 3V5KB 1F4XH 3HE6C 3H3PH 4MJ6B 2QSQA 4OFKA 4Y5YA 3QO0B 3IVKA 3PP3H 2HLFD 2WP3T 4LP5A 2F54B 5AYUH 3DGGA 4I3RL 4P9HC 4JO4H 2NY1D 1JV5B 4X6BB 1YN6B 2PCPA 4NBXB 4WJ5B 4LL9A 5HI4D 4XCNB 4NN7C 2DWDA 1D6VL 5GGUA 4X6DA 5IGXH 3AU1B 1A1OB 4KDWA 3UTTE 3DSNA 3P11L 4O51A 3NMEA 5DXWA 5ESAA 1AGBB 3KYNB 3HAEA 4JY5H 4JRXD 1V3KA 4HJ0D 4M4RA 2B1AH 2DQEL 4Y2DA 5GS1C 5GRZA 4I18C 4JDVB 5CILH 3TZVB 1G9ML 3ZMRA 3PWNB 5GGRB 2R4RL 4PJHB 1QBLH 5TE4H 1X9QA 4Y4HA 4ZOCA 3WLBA 5HTSA 3QHZL 2F58H 4XTRC 4FQXD 5CWSA 1F90L 3NFPA 4RMWA 1KIQB 4HUVB 4LHUB 4ALAL 4DN3H 4EN3A 2C1PA 3PWPE 1KYOK 4Z7QE 3TBVA 1ODAA 5HSFA 4RWYH 3BIKA 4JM2B 1DQTA 3RKDD 3D2UD 2EDRA 5CJXA 5EU6E 2X89A 4WV1A 4DWHA 4WO4A 5I1DA 1KLGA 1BD2E 2P5EE 1ZHLB 3IS0X 2X70B 1FIEA 2Z31C 2HLAA 5HYFA 1NGPH 3BZEA 4OCSL 4KTYA 4X6FA 4ZSOE 3O9WC 2G75B 4KY1H 5C0DA 4TULL 4J12A 5L2KD 2AEPL 3RNKB 1NGYA 1U3HD 3VFUB 5DHVA 3O8XC 3V7MA 1T0MA 5D7LA 1TVBB 4ZFFB 4PUBH 4PJ7A 1BJ8A 5D1ZD 2R69L 5HJ3B 4JO2H 5DHYB 4ODXA 2HT4C 5EA0L 5JOFA 4UILL 1HN1A 4N8PA 4OZIA 5CD3B 3A67H 5JIKA 3CFJB 3QEQD 4G6KL 4JZOA 4P2OA 4MQSB 5MEPA 1RUQH 4GG6B 1JWUA 4N9GB 4G9FB 3ZLQC 3OR6A 2NY4B 3ZE2F 1BQUA 5D5MA 1YYLL 4UDTB 3CH1B 4ZOEA 3C5JA 3BP4B 1E4WL 1P7KB 3IETB 4YE4L 2IH1B 4NN5B 4LHJB 5EBGA 2OJZH 4N8CH 2MKWA 5FYLE 1ZHNA 2X1WL 2EYSA 3JV5A 1F11B 1JPST 4ONFH 3FQRB 3AFLA 4Q6IB 4BELD 1KOAA 1MJ7L 3C5ZB 4KWUA 4ZFOB 2RHEA 3HG1E 3S88H 1DEDA 5M94B 2WM0A 5AZ2H 1UA6H 2NPLX 3SDXA 2NLJA 2W0KA 3MTRA 5E8OB 3RL1A 1D5XA 4L29B 3OKKA 2MCG1 1KTLA 4XVSL 3WO4C 2YUZA 3BD5A 1V7ML 4N0UB 1REIA 2NY0D 3BKCH 5EUOA 4K7PH 2PUQT 4TVPH 4EKXA 1M6OB 5L7XH 1NCBL 4O2CB 4Z95L 4AJ0A 1KTDA 4NM8H 5AWNL 2GAZA 1D5MA 1JN6A 5EU7C 2AQ1A 1RZKC 1PG7W 5FA4A 3LSOB 1UJ3A 3QRGH 5ISZB 1WFUA 3TO4C 1XT5A 1MIML 5KS9A 4ZO6A 3TT1H 5E95B 4XT1C 4GQ9L 1RY7B 5DLML 1NBZA 1U2HA 1TNMA 1T5WB 4OCYH 5J9PA 5GSVB 3DURA 3ZTNH 1J0IA 2ED9A 4LQ1A 2MJWA 5EU3A 4ONGH 4NNYB 2ORBL 3HI6L 4Z0BL 3N06B 4WO4D 1G7MA 3EOAA 3MLXH 4KQ3L 4NM4H 4HPOL 1ZHBB 4D9LL 5ANMB 5CZKA 3BRDA 5CJQH 2VKWA 4D94A 3KNBA 2XIDA 3VRJB 5EULV 5LGJA 4JN2B 5C7XL 3C8HA 4LFHD 5FECA 3HHRB 2XOTA 4YPGA 4N8VB 1FAIL 4K8RH 2GY5A 1HE7A 2NXZD 3MLUL 3T1WA 3RUGF 4P57B 1SJEB 3MLVL 5CBEA 1U2CA 1X5AA 2Y5TA 4POUB 2OSLA 3HNSL 4YHZH 2PKDA 3VGBA 5EWIH 1YDPA 2AJSH 5GRWA 1CDGA 4LRIA 3CIQA 3P9MA 4TSBH 3EYOB 1MFAH 2E9BA 2D03L 4NQTA 4QO1A 4QRSA 4P2OD 1DQQA 3DXAE 3BN9D 5K93A 5HDQL 3HMXH 5DJ2B 4JKWA 3B8SA 4OM1L 5ACLA 3NABH 3M17B 2E27H 4TPRH 5C0CA 3V4UL 1AKJD 3RX5A 1GVIA 1D3CA 2BMKB 4NZUH 2NX5E 3RBSA 2Y7QB 4RFOH 3V95A 1GCFA 1KN2H 1MRFH 5LJYH 3EYFB 1FORH 4JY4B 4YXHH 4XP5H 5D9SB 4G8IA 1MCFA 1J8HA 2O93L 3UZVB 1RVFH 1KCUH 1I1AC 4UBDD 2MOVA 3N1GC 2A73A 3LQAC 3FB7B 3F5WA 3MNZB 2VWEC 5FHAH 4XP4L 4JFFE 4ETQA 2EC9U 1EJOL 3N85H 3MRBB 2QKIB 1NLDH 5DO2D 3SO3C 4XBPA 3P77A 2V5TA 2GFBA 3U7YL 1BD2A 1R3HB 4HKXB 5MHSE 3B5TA 3T0WA 3IJSA 5CIPB 1HCFX 2VZUA 4HGWA 4ZSOA 3UPRA 1U58B 1LO5A 4XPBH 3WIFA 3MRGB 4L4TB 3TJHC 2EDXA 2VAAA 1A1NA 1ORSB 4B41A 1P1ZB 4TTGA 1IKFL 5FKPA 5EOCL 1FPTH 1FZKA 2VDRH 4JEGB 1JPSL 1RUAH 4QCIB 4ZUVA 4M03A 5KOVC 3DETC 2DMBA 3FT2B 3OKMA 4JFEB 4OKDA 1DANU 1KC5H 3O4LB 3OX8B 4YNYB 3STLA 1MJJA 3FZUD 5C0EB 2R23B 3WCYA 2ERJC 3JTSA 3W9DB 3DTXA 2H6PB 3OF6A 1K4CB 1KNOB 3QJFB 2Q7NA 3V5DB 4Y5VA 3BQUA 3BH9A 4YAQB 5HYSA 4Q74A 2Z8SA 3RA7L 1C16A 4JY6A 3FT3B 4NWTH 4OGXL 4C56B 4RRPG 3TCLB 1N6QL 3PDOA 5JOPE 2IMMA 1NGXA 2P46B 1QEWA 1J87A 4KK9C 4M1DH 1ZLUK 2A6IA 4PJ8D 2HTLD 1F3JB 4TNVF 2V2XA 3H3PL 3NCMA 1RZFH 3IKCB 3KXFE 1NCWL 4JREB 2N56A 3UTTD 4HFWB 1B0GB 2LABA 3MV9E 5D6CB 4OTXL 3AY4C 1B0RB 3O3DA 4NSKB 2RAMA 4NQDE 5C0FA 5AYUL 4LNRA 1D5BB 2MQCA 1XF3B 2VLRE 4YHMH 3U0TB 2QADC 1KPRA 4IMLA 5IGXL 4PJ9C 3KDMA 1E4XL 1NCCH 4R97C 3V8OA 4ORGB 1S7RB 4HUWA 4PBVC 1CFBA 1EMTH 4BK4A 3MSPA 2VQUA 3T2QA 3F7QA 2B1AL 1MAMH 3STZB 4XWGH 4ODWA 2P8LA 1S9YA 5C08B 1WUNT 2BVYA 3E8UH 4JE4B 3Q3GB 5CILL 5J8OA 4YC2B 1S5IH 2HRLA 1ZT7A 3RVTC 3UTSB 5A2KH 4X99A 1JTOA 4XB7A 5CLTA 1QBLL 4LCCC 3PWPD 4O02H 4IDJH 5D70H 3VGFA 2F58L 4Y4FB 1O0VA 3FOLA 2OJEA 1MCHA 4RIRB 1JF6A 3JV4B 3ZE1E 4W81A 3QXDA 5DMYA 1CVRA 4M61B 3MYJA 3P73A 5F1OB 1MSPA 3BJ91 2DD8H 3KPPA 1WCBA 4ZUWB 4DN3L 1C08A 3WHXA 5I1GH 1BD2D 2P5ED 1PQZA 4IIQC 4LSPH 4F15B 3T1FA 4RWYL 1W8NA 3GSNB 1ZT1A 5H35B 3LV3B 1MH5A 3LRHA 4KROB 4NOFA 1T2QH 1HSAA 2OXHA 4HJJH 1ACYH 1PYWB 5F1NA 5FGRA 3X11B 2DDQH 4WDIA 5CD5C 3MJGX 1FNFA 3U4BH 5HXMA 4IDLA 5J57B 3HC4H 5SWZB 1NGPL 1XGPB 1A9EA 2DS4A 3T8XB 1A1MB 4KY1L 5KSAA 3B43A 2PO6C 3D3VA 3QFDB 4Q9BA 1UM6H 4MGXA 3HTLX 5DYOB 5I75B 2XTLA 3BQUD 4PUBL 3I9GH 4H0IA 4IRJA 5IVNA 4OLXH 1KN4H 3MO1B 2B1HH 4JO2L 3IGAB 5FYKE 2VC2L 1A9BB 3DVNA 1OWRM 5LGHL 1WIUA 3ARPA 3DX9A 1X5HA 1NAMH 3A67L 4HWZB 3VJ6A 3EJJX 3UYPA 1RUQL 5E9DE 1U6AH 4G6AD 2X7LA 2K3TA 4M7ZB 1MCEA 3S97C 1XF2B 2QV2A 3QZWA 4RGMC 1EHXA 1LD9B 2PYEA 5IMKA 1KXTB 4N9OB 3DGCR 3HG1D 2D2OA 1Q9LB 4JFFA 1AGDA 2OJZL 4KMLB 5EIQA 3HZKA 2YXMA 2JB5L 4ONFL 3S5LG 1X5LA 1TZIB 4K7PX 5IOPA 2A77H 2WINB 1GHFH 3U46B 3MLSH 5I1LA 3DYOA 2W1NA 3S88L 4Q9RH 5IMMB 1MCQA 1ZK9A 4MHHG 2XKNA 5AZ2L 3QQ9C 3OKOA 3BH8A 4QHLA 5I66A 1I3UA 3HE7A 4ONHB 2H8PA 3BKCL 4ZFGH 4WW1B 1HYRC 4K7PL 3V4VL 4TVPL 5KVEH 5L7XL 4M7JH 1C5BH 4ELMA 4MA1C 1S9VB 2X4OA 4QTIH 4R4ND 3VG0H 4PRBA 2AQ2A 1CFSA 5E6IA 1WWCA 5FDWB 3C2AH 5IWLC 4JFPB 4I4WB 3QIBA 2GITB 1NCTA 1VFMA 1CR9H 4YK4C 3TT1L 1QBAA 4HS6B 4OCYL 1I7RB 3AREA 4Y1AA 3ZTNL 4L4VA 3C60D 3Q5TA 2BNUB 3KXFA 1IQDB 3TA3B 3PL6C 3VXPB 4KRLB 4J7RA 4ONGL 1W0VA 2GK2A 4YZFF 5DJDB 3TN0C 1UGNA 3MLXL 1PAMA 4NM4L 5IV2A 3C09C 5DMJB 5CJBA 15C8L 2C1OB 1WBXA 5IVXA 4HG4J 3OAZK 5CJQL 3BWAA 2VR4A 4WRLA 4P46A 3C5SB 4WU5B 4ZODA 4OLYH 5E1HB 3ULUH 2MSPA 3CJJA 4MLSA 2BX5A 5KSAD 4LCIH 2ATPA 4K8RL 3D3VD 3DI2B 3EFDH 2P45B 2EXWC 5I2IA 3S98A 1EFXA 4PP1D 3DXAD 2GJZA 4I9WE 4S2SB 2YUWA 3FMGH 1IAKB 2ESVE 1WAAE 5JIPA 3B2UC 4R7NB 2NXYD 4F7MB 4YHZL 5EWIL 5JZ7C 2HG5A 4WEMB 1UQSA 2AJSL 3SO5A 4HKJA 4PFEA 3QO1A 4TSBL 1MFAL 4KJYB 5IJVA 5IR1A 5TF0A 3UPAA 2NX5D 3KJ6H 3I75B 3PQYB 4FMFA 3F7YB 2VXSH 4W70A 3MRCB 5C70A 2FL5A 3B9KC 3HMXL 1I7TB 1FL6B 2X4TA 2J8UF 5HHNA 3NABL 1DJSA 2E27L 4PG9B 4TPRL 2PYED 4IRZH 2WWMD 3X14B 4ZAKC 3BXNA 3SGKC 2JCCB 4NZUL 1E27B 4JFFD 4RFOL 5CAYB 3HUJB 1KN2L 4LFHG 4EUPB 5E4EC 1BIHA 2BSED 1FORL 2VUYA 3LB6C 2VXVH 4YXHL 2J8HA 3O0RH 4ZFZA 4P2QB 5MHSD 1BX2A 2CK0H 3U2SB 5A2IH 1SYSA 1RVFL 2VDOL 1CD9B 1KCUL 2X4QA 3BAEH 3RVXD 1VPOH 3QHFH 5FHAL 2YD1A 2IANB 5I74C 4BJLA 3N85L 3SJVB 1NLDL 1AGEA 5HYQB 3FT4A 3S35H 5C0IA 5HHMB 2P47B 3VFMB 2D0FA 2EIBA 5F7EL 3UX9B 4AYFA 5EC1B 1P53A 3ZTJH 4KK5C 1CFTB 4NQVB 3H6JA 1MREH 3SCMD 4HIEA 5EORH 3FQWA 5LWYH 2R56H 1T2XA 4KGJA 3U9PH 5E6ID 1FPTL 2VDRL 1CT8A 1RUAL 4J23A 3QIBD 4YXKH 1ADQA 4UQ2B 1A6WH 1KC5L 5JOPD 3MJ8A 3VXOB 2KUTA 2CXKA 4G8GE 3CFCL 4Y1AD 3WFBH 1T04A 2OL3B 4CU8A 1BQHG 3KXFD 1WQVT 4X6CE 4LQFH 2MFNA 2W60B 5JIIA 3HC0A 4NWTL 2NMSA 3MV9D 5DHVH 3INUH 3D5OF 3DO7A 1EO7A 4M1DL 1OT1A 4NQDD 3SQOH 1L6ZA 2FEDC 4ZO9A 5I17B 2VLRD 3VWKB 2IBBA 5JDSB 4WUUE 4O9HH 1RZFL 2ADJA 4P46D 8FABB 4P3DA 1JUFB 2BVUA 3OKEB 3UBXA 4V1DE 1X6LA 3MRKB 2LAAA 3OXRA 5GJTH 5DD5H 2KDGA 1EFXD 3DRQB 4JZJA 3PGDA 3HI1B 1Y6MR 1CF8H 4YHML 1JPTH 5ILTH 4NFBA 4ENEC 3VFVB 4LLAA 2FX9H 3D18A 4IOIB 4QHNA 1NCCL 5IVZB 4BZ2H 3GJEA 4OAWB 5B3NA 3GSQA 4OF0A 1ND0B 4TUOA 3DHMA 1KJ2A 1X7QA 1R3JA 1EMTL 1I9RH 1ITBB 3MRFB 3LEXA 5EU4A 4ODTH 1O7VA 4NJAH 1MAML 4XWGL 4HK0B 1VCAA 4PRPB 4B0MM 5A43C 5IP4A 1CXEA 1K2DA 4IMKC 1JNNH 1T3FB 5CKAA 1S5IL 4I2XE 4TSCH 5KSUA 3P4MB 3U83A 4XP1L 2CIIB 5DQ9B 3X12B 2FLBT 3KYOA 3Q2CA 2E5EA 1G9MC 4O02L 4IDJL 3ZDZF 5D70L 4Z7WF 4PV8A 1TTGA 4NYLA 3RWCA 2XWJB 4G9DB 1ZVYA 2GSIA 5D7IB 2BNRE 5IBLC 4CVZA 3WFHA 5DD6B 3C6SB 3QDGA 4JJ5A 2VDMH 2DD8L 5EBWA 2Z93B 5I1GL 5MERA 3D85B 3O3AB 3L3DA 1KJ3H 2EDJA 3QBTB 1OOAA 5E5UB 3TIDA 3HMWL 3SDAB 3EUUA 1BZ9A 1T2QL 4RZCB 1CIDA 4LSUH 2C9AA 1JWMB 1OF2A 4HJJL 5E24E 4NN6C 2GUOB 2DDQL 3O3BB 2FJGB 2V7HB 1WAAA 3U4BL 3BESR 3S4SB 3HC4L 5F6IC 1CXHA 1MF2L 4AEIH 5FYKD 1ZT4A 4HC1A 2IQAB 3VI3F 1BFOA 3MZTA 3N1PC 1P84J 3ZKMC 3BUYA 2ADGB 1UM6L 2HWZH 4Y4KA 5T1LD 5E9DD 3H0TA 4U2ZA 4CN6A 3I9GL 1AFVH 3RJDA 4OLXL 3G08B 5BXFA 4G80B 3T09A 4MD5B 5AZEL 3OAYK 4JRYE 4DFHA 5EDXA 5EO0A 3DWTA 2P24B 2JJSA 3VCLA 1OARH 5C0AE 2GSGB 3ROLA 3HCVB 2C3VA 4PGZA 3QFJE 1U6AL 3EKCA 2OQJA 1M7DB 3ARXA 3QUYA 2XWBB 4PRAA 3BDYH 3NFNA 2X10A 2FX8H 4HUMB 1UH3A 4NUGH 3D69B 2XTJE 1HWGB 3JWOH 4GUPA 4WW2B 1CG9B 1TMCB 2XI9A 1INQB 5FGBA 1MCDA 2A77L 4MNGE 1QRNB 1CD0A 4HMDA 4JQIL 4L9LA 3MLSL 3I3EA 2YK1H 3GJFA 4Q9RL 1NDMA 4Y5XA 1A4JA 2O26U 1K4DB 1N5AA 4HEPG 4ISVB 4U1JA 5B39G 3WL9A 4HWBA 4Z78B 5JPMB 3VH8G 4NQSA 3FL7A 2PXYC 3QB7C 1IGIH 2I9LB 5ABDE 5H2BB 4ZFGL 1NFDA 4NQXA 2BNQB 1BZ7A 4DW2H 1CLZH 1HH6A 5KVEL 2EIZB 5I8CB 4M7JL 1C5BL 4KAQL 1D9KA 4QTIL 3ISWA 3SY0A 3DRTB 4PGDA 5E2WL 3QUXD 5IW6A 3VG0L 4Z7OF 2AV7B 4HK3N 3QDME 4C83A 3PGCB 3LQZA 1T6VN 3SGDI 4LAJH 3T0EB 1CR9L 1XF4B 4LEXH 5DD3H 3ARRA 3DMMB 2QBWA 4F2MB 3BPOC 5EIIA 4K7PY 2I9TB 3B9AA 2GCYA 4ZOBA 3NN8A 4V1DA 3PF2A 4PJAF 5DEGB 5C09B 3TNNB 2R0KH 1QSFA 3MCLH 2ESVD 5DEZA 1FZJB 1FVCB 4NNXA 3BN3B 1DFBH 4TYUA 5AEAA 2NY6C 4OLYL 4P2RA 3FONA 2VLKB 4LCIL 4R96B 4NC1C 5IW1B 5C1MB 3EFDL 4OV5B 3L3OB 5KSVB 2ZSWA 2V5YA 3FMGL 4Y4KD 5DMKA 4FG6D 4ZXBC 1JFQH 4GMSH 1S7XA 4XMPH 1H3PH 3AS0A 1MNUH 5K9OA 5FCUH 4YGVB 2C3HA 2VLLA 4QOKE 2UZXB 3QP3A 1N0XL 3KJ6L 4GKZA 1RMFH 4PRIB 2VXSL 2IAMB 1ZLSL 5C0BA 1G0YR 1BVLB 3QUYD 5A2FA 1DVFC 5E7FA 3AAZA 3KPLB 3MRHA 3FRUB 1NKRA 4IRZL 4P59H 2AJZA 1UVQB 2ITCA 5EZOH 4J1UA 4ZUSB 1I1FB 3S35X 4DZ8A 3LEVH 4PJFE 5HHQB 2AK4E 5GGSA 4WFFE 4DZBA 2VXVL 4NN7B 4GKSA 3O0RL 1DLHA 2CK0L 5T3XD 4X7DC 3BAEL 4XH2A 5FM8A 1VPOL 4POZC 1H0DA 3QHFL 1HXYB 2DQIL 3WS6A 3MJ7A 3S35L 1U8JA 4U6HB 2R2BA 2H2PD 5IROC 1QR1B 1L0QA 1OAXH 5GZOD 5EO1B 2P8PB 5TDOA 2YD2A 1MIEH 3A6CH 1U36A 5GRYA 4LEOB 2IPTH 3WNOA 1MREL 3QG7L 1D9KD 2AEWA 5EORL 3TP4A 5LWYL 2R56L 4NRXA 3U9PL 1P7QD 2AW2A 1KT2A 1PBYA 4NJ9H 1HI6A 3RNQB 4YXKL 1RUKH 3BZFB 4OGZA 1MHEA 5GXBB 3P4OB 3WE6B 3W0WE 5IB3B 4NOBA 3S7GA 3A6BH 3WFBL 1CDJA 3BEWA 1RFDH 3BPLC 4G43B 3LHPH 2DLGA 2UUDK 4LQFL 2EEAA 4RNRB 4PJ5B 4V1DD 4XBGA 5CZVH 2R9HD 4Z7VA 4U3XA 3G6DH 2R39A 1QSFD 1HYSD 5CMAB 4FQQA 4RISL 2OI9C 3QR2A 1MQ8A 4GAYA 3N1QC 4O9HL 1R5WB 1I8IB 2UY7A 4P2RD 4M8QB 2W59A 4L3EB 4N0YH 3WNMA 1IJ9A 4HULB 4KRMB 4MNGA 3P9WB 4X5WB 5GJTL 5DD5L 1F8TH 3IFOA 1AHWB 3M1BA 3O6FC 4GRWB 4YR6B 4CADB 5ILTL 3UXFA 5IM7A 5HGHA 1OGAB 2FX9L 5JXAH 2ID5A 4BZ2L 4JPVL 3ESVF 4U0RC 4JN1H 4HAFA 5KANG 4AT6B 1NGZB 4IRSB 1XR9B 1I9RL 3HNVL 2AXGA 3V6ZA 4ODVH 1OP5H 5F8QC 3F58H 1JK8A 1A6AB 4NJAL 5F9JB 2CIKB 4EXPX 1VADA 3QDMA 2BNRD 4J8RA 4E5XA 1JNNL 4ZS7L 4TSCL 2DJ4A 3GMOB 4PJDB 4JKPL 3PHQA 2I24N 1KB9K 2IJ0C 2MHAB 3IJYB 4NO3A 1I7ZB 3HRZA 4L5FH 2KQMA 1LEKA 1T21B 4WWKB 3RGVC 3F7RA 4HHAA 4WU7A 1GJIA 2XZCL 3JUZA 1J9CT 5MEQA 3L5WA 3GHBH 5E8PB 1GXEA 3EHBD 1T0PB 1KENH 5IB4A 1XIWA 1G7IB 4DVRH 1KJ3L 5EPMA 5C0JA 1NCAH 1EEUA 4LLUA 4OZGB 2GJJA 5T3ZH 3ARBA 2P1YA 1BLNB 4LSUL 1XF1A 1JE6A 4LPCA 4PY8J 4UQ3A 3VXSB 4E41E 3MPCA 3TJEL 3BGMB 2Q6WB 4Y7MA 5K9JH 4AEIL 3EO1B 4JRYD 4QOKA 4IS6A 5GGTA 3GSRA 3AMLA 4MXQD 3KWWB 2HWZL 4GW1A 4LLYB 4LF3B 1AFVL 4KU1A 4UIMA 3GB7A 4MCYB 3L7FA 3CFBB 1S9KC 4ZQKB 3CFKA 3MLTA 3MBEA 1MCIA 2CKBB 4LVNC 4MMZC 1RJLA 1AGCA 2HVJA 1OARL 2CK2A 1ZS8A 2BP3A 1MCKA 2MNUA 4DGVH 5B38A 5I71B 3O2WH 1MQKH 5L8JB 4JHBA 1G9NH 5IK3A 4CW1B 4P99A 2HJLA 3BDYL 2FJHA 2C3XA 5E8EA 5F93C 2FX8L 3AXLB 3G5XB 3IDNB 4U31A 1FH5H 4X9FA 1HQRB 3RPIA 3T3ME 4F8QA 3CX5K 3JWOL 3IF1A 1D5ZA 3QAZC 1HHHB 1I3RB 3SDCA 1V5JA 2IADA 5LAXB 4N0UE 3WN5A 1ACZA 2YK1L 1CGYA 4JFDB 3PWVA 1T7YA 2AK1H 2DQUH 3MMEB 3ME0A 3KGRA 4M00A 4IJ3C 5D1QC 3NCBB 4OB5L 4OI7A 5JIHA 2ITDA 3QDMD 1RJYB 5BJTB 2VZTA 2MTPA 1IGIL 2NY3B 4PLKD 5IB2A 1YN7A 1DEEA 1NPUA 2OTPA 1A2YB 4NNPH 1WFTA 4DW2L 1CLZL 2Q7YA 1NC2A 2OP4H 4LVEA 3TC9A 1CICA 2FGWH 2F19H 3SE9H 4LSQH 1FNLA 1TDQA 2NY2D 3L3KB 4EDXA 3NIDF 4PY7A 3V5KA 3BKYH 4MJ6A 3IDXH 4W4OA 1WISA 1I1AB 3GIZH 3O6MH 3QO0A 2X1QA 5DD3L 1ADQH 5MEOB 2F54A 3EDFA 4LVOB 1XIWD 3JZ7A 1C5DB 4QRUB 1YEGH 3K2MC 4X6BA 1JV5A 5SWZA 1YN6A 4FZ8H 4WJ5A 3RBGA 3WFEH 4XCNA 5DRXB 4WI9A 3NH7H 1QPPA 3UYOD 3AU1A 1A1OA 2JELH 1VFBB 5HYJB 2R0KL 3SE3C 2IGFL 3MCLL 4KXZH 4X8JB 1AGBA 3VFPA 3KYNA 1EFQA 2W9EH 1E0OB 4J3OC 4M5YL 1DFBL 1K85A 1CGSH 4QOKD 3GSUB 4JDVA 2R29L 3TZVA 2QQQA 3PWNA 5GGRA 1OSPH 4PJHA 1NMCB 4K8RC 4PRNB 5HHOB 1JFQL 4GMSL 4XMPL 1NGWB 1H3PL 5DVLA 1MNUL 5J89A 1WLHA 4G5ZH 1RHFA 5FCUL 3TYFB 1S9WB 3MBED 1KIQA 3T65B 1IAMA 4NZTH 2QSTA 1BZQK 5CSBA 1RMFL 3EJYD 4HUVA 2NTSP 5F21B 4LHUA 4WFFD 2LAGB 4UI2A 3VFWB 3MV7B 4OT1H 2BY3A 1KJ2H 1BVZA 3CZJA 1PDKA 4JM2A 1TTFA 3QHTC 2XRAH 4P59L 5EZOL 1A6TB 1OTUD 1QSEB 2VDLH 5DRNB 1OAYH 1P5VA 1FFOB 2CGRH 3FN0H 2XYCA 1ZHLA 2VH5H 4YHPB 2X70A 32C2B 3GMRB 1S7WB 3ARSA 4K3DH 4R97B 4JANB 5SWSB 2VN4A 4L4TE 1Q8MA 2G75A 3IS1X 1SYVB 2R4SH 3RNKA 3VFUA 1A3RH 3EOBB 4PJGB 4ZFFA 1TVBA 3MV01 5DEFA 2DYPD 1OAXL 5H8DA 5HJ3A 4HT1H 4DOHB 3HZMB 5DHYA 4JFEE 4KZEH 1NC2D 3O4LE 1WWWX 1MIEL 3A6CL 3RVWD 2AVGA 2ZG3A 3VXMB 1CICD 5I1CH 5CD3A 3W0WD 3CFJA 3WKMH 4PJIF 1C7SA 4JGUA 1QO3B 4GG6A 1BF2A 4OD1L 1U8HB 1LP9F 4N9GA 4G9FA 5C9KA 4NJ9L 1RZJH 1RUKL 2IWGA 4PJEF 4UDTA 3QIWA 3CH1A 3BFOA 3BP4A 5JR1H 3VWJC 2AS5M 1P7KA 3IETA 5C6TH 2IH1A 1CCZA 3A6BL 4HC1H 4UB0H 1RFDL 5SWZD 3RTQB 5I6XB 4FXLA 1F11A 3LHPL 3FQRA 2EDNA 4U1MB 2ZOKB 4Q6IA 2XG4A 2K9UA 4GAGH 1T7XA 5D7SL 4DKDC 4N0RA 4HH8A 5DUBA 5CZVL 3C5ZA 4FNLH 2DQJH 5B4MD 3G6DL 4ZFOA 5DMGC 1YJDL 3QPQC 2A83B 1RZ7H 1TQCB 2Q20A 4TUKH 5E8OA 3RUGB 4L29A 4N0YL 3BRFA 4JG0H 3TZVD 4N0UA 2NZ9D 4L1DA 2OR9H 3DSFH 5JPNB 3EJZC 1M6OA 2ZZUT 1KIUA 5J11B 4O2CA 1F8TL 3WUWG 1KYOJ 2K1MA 4XPTH 5H37G 5JXAL 2J4WH 3KPNB 3LSOA 5ISZA 3UTSE 2H32B 5IEKB 4HGKC 4PLOB 5GQBA 2WBKA 2HAZA 2NY5H 5T3XH 1T5WA 4ODVL 4OSUL 1LE9B 3BGAA 3F58L 3GJFH 5GSVA 1OP5K 4JM2D 4PV9B 4KH2A 4RGMB 5FOBB 3BVNB 1LNUB 4HWBH 4NNYA 1KV3A 4X6DF 2F9BT 5ENWB 3NACH 1MWAB 3AM8C 1ZHBA 5ANMA 3BKMH 2JIXB 4KDTA 4L5FL 4PP2B 5E8NB 3VRJA 4JN2A 3RVVD 1XGQB 1ZVSB 4DVBB 4P5TC 3QJHA 3U30B 2E9JA 1PVHA 3LKRB 1DN0B 4N8VA 5I19L 5B3JF 3GHBL 4E41D 1KENL 4P57A 1SJEA 3QIUC 5DI8B 3FB8B 1OD9A 4PJCF 1GIGH 4DVRL 4IOSD 2QJDA 1NCAL 2A6JB 1E4KC 4JFQA 5H37H 3QUMB 1E4JA 3ESUF 3EYOA 3MUJA 1MRDL 4UAOC 2P5WB 4Y0GA 1ZGLM 3RWIB 5J4MA 1AXIB 2NY4D 5D7JD 5DJ2A 1BOYA 5K9JL 1S7VB 2YSSB 5J3HD 5TQ2H 2BMKA 3QPXH 4FQCH 3VGAB 5M7QA 2JJVA 2FO1A 2F8OA 4OGYH 3EYFA 4JY4A 5HVHC 2DLIA 4NRYB 4QGYA 5D9SA 4ELKB 2QSVA 1AP2B 1JBJA 4OCNC 2HLFC 3PIQB 1OQOA 3FB7A 1FYTE 3C09B 3MNZA 4BSVB 4DGVL 4MAYB 1PG7H 1MQKL 2NY1C 5HI4C 3MRBA 4K3EH 1Y6NR 2QKIA 3DGGB 1HHJB 1G9NL 2Q87A 3UYRH 1IC1A 1R3HA 4HKXA 4LARH 1AD9B 5CIPA 5CSGA 1FH5L 3BPCB 4WFGE 1OCWH 4ZMAT 1VA9A 3MRGA 4L4TA 4PLNC 2YC1A 1WZMA 4HJ0C 4OZIF 5LCVH 2UYLB 2CSPA 1P1ZA 1A22B 3DHJA 4WHTB 4QCIA 3FT2A 3IU4L 1WEJH 1HOCA 1UKTA 4JFEA 5IG7B 1I7UB 4HUXB 3O4LA 1FO0L 3OX8A 2DJSA 4YNYA 5D5MF 2AK1L 2DQUL 1FFPB 2R23A 2WV3A 5C0EA 2GJ6B 1R24B 3BMVA 5F96H 4FQXC 3W9DA 2H6PA 4M6MH 1K4CA 1KNOA 3RJQB 3MR9B 4QXTB 3QJFA 2W9LA 3V5DA 4YAQA 2BHZA 2YRZA 4AL8H 3FT3A 4XVTH 4C56A 3TCLA 3GHEH 1WC7B 2FGWL 2F19L 4RA3A 5E4EB 4FTVE 1EO5A 2FEEI 4LSQL 3SE9L 5FYJE 2DIAA 2FECL 4LP4A 4C55A 4BA8A 1F3JA 3C8DA 3FOMB 3RKDC 3BKYL 3IKCA 5F6HJ 3SDXF 3IDXL 3OB0H 2ZOLB 4HFWA 1B0GA 1F13A 5IJKA 3IU3B 3GIZL 3O6ML 5D6CA 4LU5H 3MNWB 4D9QE 1SJVA 4U1SB 1ADQL 1B0RA 4HAGA 4K3GA 4NSKA 5EUOF 5FYKL 1D5BA 3MUY1 1YEGL 1XF3A 1BIIB 3WFEL 5HI5D 3U0TA 1U3JA 1YPZF 3NH7L 2JELL 2BOCB 3GGWB 3TF7C 4ORGA 1DQDH 1S7RA 3FQTB 1U3HC 1NL0L 1T22B 5DRZB 4OZFB 4KKAD 5IMLB 5IHLB 3ZHDA 5D1ZC 2ADFH 3STZA 1CGSL 3RY4A 5KAQG 4OBSA 5FF6B 2YUXA 4KMQA 1BFTA 5C08A 3Q3GA 3O4OB 3UTSA 4YFDB 3CU7A 3PP4H 3QCUH 4Y4FA 5TDPB 5IQ7H 4G5ZL 4Y5YC 2YXFA 5E8DH 4RIRA 2B7DT 1EUTA 1WZ1H 3JV4A 2HKHH 2YWYA 5LXGH 1QSZA 4M61A 1H3GA 4LCUB 4KPHH 2FNBA 3LKPA 4NCC1 5F7MC 4ZUWA 2EYSB 3NGBC 2Y4SA 4X7TB 4OT1L 2F53B 2VDNH 3GSNA 3K4DA 2FHBA 2L0DA 5H35A 2XRAL 3LV3A 3RY6C 5CEZD 4AZ8A 4L4TD 2VDLL 1MUJB 5KN5B 2VLJE 1OAYL 3SJVE 4KRPB 4KQ4H 1PYWA 1B9ZA