1RURL

Crystal structure (i) of native diels-alder antibody 13g5 fab at ph 8.0 with a data set collected at ssrl beamline 9-1.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
DIVLTQAAFSNPVTLGASASISCRSSKSLLNSNGIIHMYWYLQKPGQSPQLLIYQMSKLASGAPDRFSGSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDTKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin 13G5, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rurL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rurL01
5F96H 3RVTC 2DS4A 1MFBL 2XXMB 1S9YA 2APXA 2YUVA 4FTVA 1LK3L 4OLWH 1IQWL 4GW1A 2QSVA 4PLKD 4Z78A 4FXGB 4GKOA 3L3OA 4GKZA 1QEWB 4OLUH 3D2UD 2OJEA 3DGGB 3HZVB 3QQNA 2Y06L 3LQMA 1U8QB 3IDJA 5JXEC 3FQNB 3WL9B 5E7FA 1ZGLB 5ETUB 5JMRA 1VPOL 2VZSA 1EO7A 2OK0L 3VFOA 4HK3N 5E8NB 3KWWA 5C2BL 4RA3A 3ARBA 4MS8D 3UJJH 1MH5A 3JUZA 5KVEL 2C1PB 4HKBA 1AR2A 2CKBB 5KSBE 4P59L 4HZAA 4JFXB 3FZUC 5D7KD 5CMAB 4RFNB 3QI9A 3HZYB 5FDYA 2BOBB 4FQ1H 3W2DL 1CD9B 3RPIA 1TTUA 3S8WA 5CILL 4LLVB 3O6FC 1MUJA 2KBGA 4LCCC 4DGYH 2BSRB 3WHXB 5EU6B 5B8CB 1ITBB 1S7TA 1XGTA 1NGWA 3UTSE 1SBSH 2FHFA 2P8PA 3IDIB 3EYOA 1HNGA 3BZEB 2B2XH 4LEOA 3RVWC 4YBQD 3HE6C 2IPUK 2B4CH 1P4LA 2YMXH 4KAQH 1RI8A 1I1AB 4QHUB 1OAKL 3U4BL 1N3NA 4Z7UF 2EEDA 4LCWB 3C8KB 3SE4C 1N5AB 2XPGA 5I1KL 1A5FH 5HPMB 5KSUA 1TJGH 3BZFB 4LP4A 4M7LT 3M1BB 3K2UL 4PJ8A 2DI9A 4PJEA 2XN9E 3E6FA 4H5SB 4OQTA 1WBZB 4LLDB 3SDCC 3SGJA 1F11B 4PLOB 3SDDD 1Y6MR 2DICA 1T03L 2ESVE 4NQCD 1QRNE 5GRJH 3OAUH 5IMOA 4WGWB 5IB4B 3T0DA 1WBXA 2OP4H 2GITA 5HI4D 3F7VA 3TFKC 4DEPC 3CDFA 3H0TB 3K4ZA 1C16B 2VDML 4GW5A 2FSEA 5AZEL 4PRAA 3RL2A 4F37F 1ZANL 5D1QB 4E42A 3ZE2F 5IFJB 2Z4QB 3DXAD 4HWNA 1DN0A 2OL3L 2EKSB 3O8XC 1YMMA 4P3DB 4QRTA 4Z95H 1KJ2B 3JBG7 2YC1B 4HIEA 4G6FD 5EUKB 3B9VA 5F9WB 1KT2B 3LQAH 3GSQB 3DRQB 3H9HA 4QRQA 3TVMA 2I07B 2QQNH 1AIFB 4UDTB 3DECA 1U6AH 3P9MA 4K3GA 3T0ED 25C8L 1IGCL 4KKCC 2ITCB 2FEDD 4M93C 3BW9B 2VL5A 4ZAKD 1HKFA 3NCEB 3FO9A 3FB8A 4NP4L 4LNRB 2IAND 3VWJC 4YHNB 1JV5B 3LKOB 3WBDA 2PETA 4AH2A 1CFTA 5K59E 1TJHH 1NCWH 3KPPA 1GAFL 3OJDB 1OL0A 3B5TA 1NLDH 4FNLL 3MLRH 5I1EH 5M94B 3IFOA 4AQOA 4PJAE 1U93B 2FGWL 2NXYC 4OZGA 2P5EB 3ZKQD 1OAZH 4KHXL 1NGPL 3VH8B 3EOBB 5SWZE 3RTQB 1I8IB 3WJJA 3HNSH 3JUYA 1Q9KA 2QQKL 4LSRH 4V1DB 5J11B 4AIZB 1VERA 2D7MA 3VXSB 3NIGE 1KYOJ 4MA3B 5CP3H 2JKXA 5GS2H 5JW3L 4J3TA 3P9LB 4RRPG 3U30C 3WS3B 3UYOD 3MLTA 4HQQH 4G80B 3BPLC 3RVUD 5CJ8A 1K5NA 1N0LA 4JFFA 5C08E 2VQ1A 4S1SL 5F7KC 3PV6A 2EDKA 2J8UF 4LSSL 3V9FA 4HIHA 1H8OA 5DJ8B 2HN7A 3RWCA 1ZOXA 5E03A 2VIRB 2OYPA 4ZUTB 1DBJL 3REVB 5H94A 4Y7MA 4FQXD 5C6PB 4OFYD 4NZRL 3FOLB 5FF6A 2ID5A 1KYOK 3PHOB 2QKIA 3WEXA 5I66A 4IHOB 4U1KB 5FHAL 5ADPL 4GSDL 4Y5YB 3BH9A 2K9UA 2EH8H 5DI8A 4L3CB 1MNUH 1KOAA 1UKTA 5ACZB 1WISA 4S1RL 1QA9B 1HYRC 5EU5A 3TZVB 3RNQA 1E4XL 3BDXA 3QB7C 2X05A 3O6FA 2XT1B 4PIRF 3E1F1 5B38B 1JPSL 1NMCC 3BZ4B 5IT2H 3GBMH 5IEKB 3FMGL 5IB1B 3LRSB 4KQ4L 1AGFB 3HE7A 4OLVH 3S96A 3EHBC 4L4TA 3LMJL 4KRPB 5HHOE 1H5BC 4KVCL 5J8OA 4KFZC 2MPAL 4PJIF 3KS0H 4FFZL 2CDGB 1RIVH 2EE9A 5A2FA 3REWA 1DQDL 3QEQA 1YECH 5CD3A 1ZLVK 4HF5H 4PLJC 5IM7A 4AZ8A 5IB2B 1Q94A 4U1HB 1TCRA 4M7KL 1KNOA 2V2XA 3B3IB 1KGCE 4OUOA 3CSPA 5LBSL 4EI6B 1BD2E 2YS4A 1C12A 4NCC1 3RU8H 2CXKA 3SJVB 4AM0B 4JRXD 3ZT6A 1I9RH 5I15H 1PAMA 1QUNA 1X5KA 3I75B 4W6WB 2PO6D 2XWTA 1SQ2N 4R2GB 2B5IB 4MD0A 2VR5A 3H7LA 1F3DJ 5D1XB 3CC5A 4PJCB 3BEVB 3OZ9H 3CMGA 4YDJB 1RIUH 2D0FA 1KFAH 3GBLA 4HX1A 5C0AA 3PWJB 5GZND 5T3ZE 3O6KL 4M6NH 3DHMA 4F7TB 1JPFA 5ANMB 3VCLB 2NZIA 2V7NA 3OKOA 5IQ9A 3OKKB 3VI4E 1RUQH 5TDPA 1T04A 4HPYL 1V7NH 4TSBH 2FJHA 3MOBH 4ONHB 4U0RB 1N6VA 1U58B 2F15A 2PYEE 1CD8A 4CVZA 1S7XB 3CVIL 5DFTA 3C09C 5DJ6A 1HXMB 5GSRB 1U8IA 2DTSA 3T04D 3HMWH 5F7EL 1K6QL 5GS2D 4LCUA 3QUXA 3PWLB 3BXNA 1SY6H 4FXLA 3PDGA 1KUMA 4Y5XB 4WFGE 1B0WA 5FCUH 4YX2L 3KYMA 1UM5L 2LU4A 4PPTA 2R2HB 2XQBH 3MLVL 1RSFA 5CEZL 2MCPL 1RK0A 1T6WA 2FO1A 1CDHA 5JW5A 3OF6D 3RKDD 2DM7A 4NRZA 4NFCA 2IQAB 1XIWC 3NCBB 1WIPA 1UCBH 2D31B 2EICA 9CGTA 3A6OA 1IGML 3RAJL 1HIML 1PW3A 3HN3A 3QCTH 3HC4L 1VSCA 1ZT7A 2E6JA 1U8KA 3HC0B 3UC0H 4GRMA 1O5DT 5J9PA 5F96L 1JBJA 4M1CC 4BSWA 2V2WB 4OV6F 2VXTH 4OLWL 5BS0E 1JGEB 2PTTB 2VYRE 3IXAB 4Y19E 3SKOA 3UBXA 3ZT7A 4N90E 1J11A 2X1PA 2ZUUA 3C87A 5LGJB 4OLUL 5E8OB 4P9MH 5JLZA 3GMPB 4RDQF 4RAUB 1GOHA 1MWAA 2OM5A 1YQVL 3RRQA 5D7JB 3RX5A 4NYLA 3V52H 3WO3B 3UJJL 3OR6A 1HSBA 3R1GH 4Z76A 1UT9A 1N2RB 5D4QA 5C0GA 3I85A 1AQKH 3CXHJ 4XNUH 1AKJA 1ND0A 4BQBA 4Z0XA 5M95B 1T1XA 5ESVA 3U9UA 4FQ1L 4Y4KA 4MD5A 5HBBA 4JQXC 2GUOB 3KPQB 1CZ8H 2X4RA 1A7OH 4DGYL 3DARA 4YNYA 3G08B 4LHUA 5LGHH 3NA9H 1BFTA 2F9BT 3LPWA 3V6FA 5IFAL 2IFGA 3D25A 4ZYKB 3T1FB 1SBSL 2C3GA 3UTTA 3DOSA 4CVXA 2B2XL 4MJ2A 2B4CL 3CXHK 3MUHL 2YMXL 1AE6H 4KAQL 5ISZB 3G5YB 4NN5C 4FQ2H 4P46C 3M07A 4Q6IA 4RWYL 2VMFA 4M4RA 3O6MH 1A5FL 2H32B 1YNKH 3JWDH 5DMYA 2BVQB 4DKDC 1OW0C 1CLOL 3PGFH 4P2QB 1PX3A 2P8MA 5EULV 3NA4A 4XGZA 4EDWH 4NHUA 1YPZA 1TENA 3AC0A 3MRFA 3OAUL 1LD9B 4JRYD 5GGVH 5GRJL 5JA8B 4AG4L 5ICZB 2NNAB 4ERSH 1DCLA 4N68A 2OP4L 4QOKB 5I2IA 3EJJX 2G60H 2EE3A 4HUVB 4MNQD 2CRIA 3V95A 3OAYK 5E1AA 4Z95L 1TLKA 4NJ9H 3AU1B 3VRJB 3LQAL 6CGTA 3ZKNC 2WBKA 2BVPA 3VFVA 3QUYA 1I7RA 2C4FU 2QQNL 4OZFG 1S7WB 4HGMA 1U6AL 5J13C 1R3HB 4LCWE 5EB9A 2NLJB 4L8SB 5L2KD 5INDB 1FNLA 5JIIA 3TBWA 5D2NE 5C0CA 4Y5VA 1FORH 2F54D 2FX8H 1ZT1A 1B0RA 2M2DA 4WENB 2CIIA 1BBJB 5KANG 3HAEG 1CFNA 4R0LB 3FJTA 1CD1A 4L29A 4Z77A 3C8HA 1TJHL 4JFZH 5CZKA 5GXBB 1EEZA 1NCWL 1F90H 1N0XH 3ULVH 3PWNB 5GRUH 1NLDL 5EO1A 5I1EL 5JXAH 1EFQA 5FK9A 1QSFB 4PRID 3MNWB 1MHHA 4M6AA 4Y4HD 3HMXH 3T65A 2D7NA 4BYHA 3HNSL 3UPAA 3BPCA 4JZOA 5C0FB 2LE9A 2IADB 2OL3B 4HLZH 3U46A 3FRUA 4R96A 4NRYB 2BNQD 5ACLA 4JQIH 2YD3A 1DLHB 4HQQL 1NC2D 1NQBA 1MQKH 2ZNWA 1QR1B 2C4FT 3FQUB 2XZCH 3RL1A 1WFUA 1XF3A 2FJFB 3BGMB 5FOBA 3QIUB 5GS0C 3G5XA 4LEXL 3VXTA 4N8VG 3KPSB 4JCMA 1EEQA 4LLQA 2E9BA 3IXTA 1NFIA 4WEBH 5D1ZD 4ELMA 4UNVA 3EO0B 1S5HB 3NMEA 1ZS8A 1CG9B 1Q9OA 4HDIB 4PRNB 4PRBB 2FX9H 3D85A 2EH8L 4LCYB 4NO5B 1T1ZB 2AK4A 2YN3A 3PV7A 3RIFF 2OS7A 4UT6H 1MNUL 4KDTA 2OI9B 3CH1A 2P5EE 1S8DA 3HTLX 4M5YH 3FO2B 4ZUUA 4ZS7H 4PTUA 4V1DE 5BJTB 1MJUH 1KIUA 5IT2L 3GBML 4HJ0C 5GRZA 1DZBA 4OLVL 3WMSA 3DMMD 4PGJA 3H9SE 3QQ4B 3TNMB 1CFSA 1U36A 3S3SA 5IFHH 2E6QA 5D7LD 3DV4A 1RIVL 5DFVC 2YRLA 2Z92A 4XPHH 3KHOA 2O5ZH 2VN7A 1HHKB 1KJVA 5C3LD 4UINL 1YECL 4QXWA 2IC2A 2E7CA 4HF5L 4IIQB 4P2OC 5I19H 4AQ1B 5MEOB 2V9RA 4Y4FC 3T3MF 5IEHB 1HOCA 1PDKA 1A21A 4QT5B 3RU8L 2GJZB 1A6TA 1IEAB 3MGOA 3I50H 1I9RL 4FMFA 5I15L 1OWRM 2BVEA 1B9ZA 5DD3H 5DHYB 5BVPH 1NBYA 2FX7H 3P30H 2UUDK 2F74B 3C5ZC 4PJ5B 3OZ9L 3FOMB 5F89A 3MGAA 3ULVD 3VWKC 1A1NB 1RIUL 2DQCH 1KFAL 1NGXA 1ZA6A 4AK1A 5LVEA 4M6NL 4JFQA 3JVGA 4S0SD 4U05A 4N1EA 5FYJE 3PNWB 1WITA 5H2BA 1QLFB 1RUQL 1OD7A 4TSBL 3R4DA 1X5AA 3MOBL 3QXUA 4LLMB 3JTTB 1A6WH 3KS0J 4MNHB 5T1LA 1J12A 3FRPG 4Y1AB 2HMIC 4AY0A 1NLBH 3HMWL 5EFIB 2CGRH 4WFHE 5FYJD 5J0BA 3G6JE 1SY6L 1I1FB 1NAKH 4ETQB 3KAAA 1U2HA 2Y23A 1A22B 1JWSB 5I74C 4Y2DA 3KYOA 5DD0H 1YQ2A 2N56A 2XQBL 5TGBB 1ZT4A 5KW9H 2HWZH 4S2SA 3SJVE 1YN6A 4N5ED 2WIIB 2NR6D 2AJZA 3QDGB 2DQUH 5IIEA 4M3KB 3MRNA 1NSNH 1DQMH 5HYQA 2DQEL 2BSSA 3S5LG 1M1SA 1UCBL 5K9KA 4R9HA 5JORA 1C7SA 1K8DB 3FN0H 3QCTL 5BQ7B 5JHDB 4XCEB 3UC0L 3GB7A 1FGVH 1FV1A 5IW6B 3VGEA 2C3VB 4DVBB 1GC1L 2VXTL 5EUOA 3TEUA 5ENWA 3ARTA 4CNIA 3WHE1 4P9ML 2JJVA 3ARQA 4KZDH 4ETYA 5BW7C 4WUKH 1NJ9A 1UH3A 2YPLD 1GGIH 3VD9A 5I18H 4XBGB 4JFEB 1KIQA 3LH2H 4X0KA 5F3HA 4W4OC 4OZIF 4G9DA 2B0SL 4BFIA 1WCBA 2CLZA 3AS1A 3VXUA 2NW2A 1HI6B 1WIOA 5GGTH 1FNGB 2XKUA 1PKQB 3QIBD 3R1GL 4KJPD 1OGAA 4H88H 3VRIB 2AABH 2FDBP 3P2TA 1AQKL 4I3SL 4XNUL 3U0WH 2PF6A 2A6KB 1UEMA 1WJ3A 4J4PA 5LXGH 3U7AA 4Q58C 2VE6A 1DBMH 3WNOA 1CZ8L 1A7OL 3LKRA 3DX7B 3GMOB 1UM4H 5LGHL 3QZWA 5DVMA 5J1AA 3NA9L 2C3WA 2UWEB 2VLRD 3O4LB 3T0EB 1JNNH 3HUJA 2Q1EA 3T2OA 4QRPB 3RWIA 2YOCA 5BZDB 1AE6L 4FQ2L 2N7AA 1H15A 3QHFL 3TCXA 3L3JA 2GT9A 3L3GB 4ELKA 4NZTH 4KRNA 1R3JA 3PQYA 1EXUB 1YNKL 3G5ZA 3JWDL 4D8PA 5IVXB 3PGFL 3MRQA 5KSBF 3B9KA 1MELA 5DURD 3BHBB 1IARB 3EYUH 4EDWL 1KTLB 5GS3A 1H0DA 5DQJA 5GGVL 1YMHA 4NDMA 2A6JB 4G6AD 1ETZA 1ZEAH 2G60L 4P2YA 4L9LA 2A83B 4MJID 3U7YH 4I2XB 1D9KA 2WIMA 4PJFF 3S35H 1CI5A 4FMKA 4RGMC 5DMJB 3VWKA 5EIQA 4Q6YA 4AIOA 1FZMB 1A9EA 3RDTA 5JZ7D 4F7EB 1UCTA 2YA0A 1CGTA 4Y16A 3HC3H 3G04B 1K8IA 5KVDH 3X12B 5CJXC 5IQ7H 4GOSA 5ISZE 5SX5H 4HK0B 3TO2B 4F7PB 4NCDA 3RI5F 5B39G 1FORL 2FX8L 3P11L 1CICA 1UJ3B 1ED3B 2D3VA 1BMGA 2JCCA 3RGVB 2BY1A 4JJHA 2JLLA 4XX1E 1FYTA 4JFZL 1S9YB 2UY6A 1F90L 3DX8B 1CFQB 1N0XL 4HCRH 4ZQKA 3ULVL 1KN2H 4QOKE 1R5VA 3MV9E 4Z78B 5FUCC 3LB6C 2LU7A 5JXAL 4WW2A 3L3OB 1YEDA 3OB0H 2BCKA 2OJEB 4KK5D 1MFDH 4I5BB 4PJXF 4NQED 3V5KB 3HMXL 4Y8DC 3QIWA 3L95B 2A74B 2X2YA 4OT1H 4X7DC 2XY1A 3FFDA 4P5MB 3KWWB 3V8OA 3QFDA 1OP3K 4K7PX 4JQIL 3IFNH 1F6AA 2Y72A 3ZYIA 1MVUB 1EMTH 3GMLB 4Q2ZB 5E6IC 1CS6A 1MQKL 4OFPA 3EDEA 2X4QA 2XZCL 4PJHA 3TN0A 5K59F 4QTHB 3CFEA 2BNRD 2X41A 1OTSC 2M26A 3TJHD 2DKUA 4YPJA 3GJFA 4JRXB 3VXNA 3MRHB 4WEBL 5C0EA 3QSKB 3R0MA 4HD9A 4XWOD 1S7TB 3QWRA 3LRHA 5ESAA 3TO4A 1JZ3A 3QRFM 4MAYB 4XVSH 4YO0B 2FX9L 4LEOB 4LHQB 3SGDI 1OT1A 1N59B 4UT6L 1DSFH 1LO2H 3ZSSA 1QSFE 3VXRA 1WT5A 4FFYH 4M5YL 1BHGA 1F6LL 4U6XB 4WHYH 5EBMB 4LSDA 5GRXG 5KSUB 4ZS7L 3H2WA 3NOIA 3JSSA 4NQSA 3S6CA 4ZO8A 4PJ8B 1D3CA 1G7JA 3OL2A 1R3LB 3RPKA 2GW5A 3OKEA 1F00I 1O0VA 1BJMA 2Y7QA 4TVPH 3FT4B 2NW3A 3QDJD 2NY6D 4RGNB 3VGAB 3KPRA 1A2YB 2FH8A 3MJ8B 2J6EA 3MMEB 4IM8A 5IFHL 3JV6A 2FSEB 4UQ3A 4XPHL 3FQRA 4QXTA 5JPNB 1KJ3H 2O5ZL 2X4TB 4PRHB 1U2CA 1UH4A 5I8EA 5MI0C 5I19L 2ICES 3P9WB 1CXHA 2MCG1 5J56B 4PGCA 2PW1B 1J1XH 5TE7H 4R90H 3DX6A 4HIEB 2JJTC 5E6YA 5F3BA 1S3KH 4G7VH 3MFGB 3I50L 1HILA 1FNSH 5SX4H 4P2CG 4M8QA 4GRLC 5H37G 5DD3L 2AV1B 2R4RH 1EPFA 3QG6A 5BVPL 1I1YA 4MWFA 3LEXB 3N50A 4NC1C 2VUOA 5JIHA 3P30L 2DWDB 3NZHL 4AEFA 3L3KB 3EJYC 2NY7H 1BP3B 2DQCL 3RY6C 4JZJA 4JFDD 2I9TA 1I9IH 4TPRH 1G7IB 4AH2B 3NFPA 1PY9A 3BGAA 1RZIA 1A6WL 3WN5C 5A1AA 5JUEH 3PDOA 2GSGA 1NBZA 5F8RC 2CGRL 3WFDH 4OSUL 1KENL 3LHPH 4UU9B 2OZ4A 4CW1B 1HN1A 1E4XI 5D9SB 3C60A 5DD0L 1J5OH 1TPXB 3MRLA 1MLCA 3UZEA 1JGUH 1EAPB 1FFNA 3UTQA 1GZQB 5KW9L 4XP4H 2HWZL 3QQ3A 2JIXB 3MBXH 4YFLF 3VDCA 2V9TA 3MLTB 5FGCB 2O5XH 5F88A 5I1LA 2DQUL 5HI3C 3FB7A 5D70L 5DD6A 1Z9SA 1NSNL 3NFSH 4RFEB 4F15C 1FNEA 3W5MA 1LEIB 3VI4F 1UZ8A 3LEVH 5MEPA 1KPRA 4HIHB 3VH8G 3NAAH 5HYJD 1EJOH 2GEEA 2CDEB 1OLZA 2ADGB 4N0UA 1IM9B 3MO1A 2MNUA 1FGVL 4XVJH 4X6BA 1MRFH 3IETA 3TA3C 3IRPX 3ROLA 2BX5A 1IMHC 3BP4B 1QSED 2QKIB 2NTFB 2FYYB 4C55A 4ZFZB 3BH9B 3SCMC 3TBTB 3KGRA 1XF2A 1T2XA 3BQUB 4KKAD 4CVWA 2AXGA 2X9XA 4NO0D 4KZDL 4GG8A 4LKCA 1VCAA 2NY2D 5F7HA 1GGIL 4E41B 5I18L 1VEPA 5DJZA 3LH2L 1A02N 3MBEC 4U0QB 3MRGA 3DYOA 4JN1H 5D7IB 2P44B 3EO1A 4WTXA 3RZCC 2ZCKH 5GGTL 1GGBL 3HRZB 4MNQB 4HEME 4H88L 3MUGA 4KUZH 2AABL 1IEHA 5GS1A 4XHJC 2DAVA 3QDGE 3QFJE 1LE9B 3S96B 3AM8A 4WO4A 5E8EA 4NT6B 2VQUA 3ARDA 5LXGL 3BP5B 4GS7B 3DUUA 2VABA 1DBML 1U3HA 1F42A 4YEFA 1HDMA 4EI5A 5JHDE 1UM4L 1OF2B 1TCRB 5DYOB 5B38G 4NGHH 3WKNA 1JNNL 1OPGH 3L5WB 4KI5C 1C12B 4U1SA 4CMHB 5GZOD 2YA1A 1QZ1A 5EORH 5CP7A 3WE6A 2DIAA 4ZS6C 5EU3B 2Z31C 4EJ1C 1AH1A 4RAHA 4HS3B 4NZTL 5E00B 2RBLA 3X11B 5IK3A 4JFEE 3MV7D 2Q76B 2R2EA 3P77B 3GSVB 3BMWA 1LO4H 4DTGL 3AXLB 3EAKA 2ZUYA 1GGYA 3EYUL 4DQOH 4G8FB 1FIEA 4P4KC 2Y5EA 1PKQE 4P23D 5CD5C 3ZKXB 1T04B 1T7YA 4YHKH 3PIQA 3QO0A 1ZEAL 4DWHA 3UPCA 1CGSH 4Z18A 3VE0B 3U7YL 5DJ6B 2K7PA 1NDMB 3KNBA 1ZLWK 1OAUL 1P7KA 4X8JB 2R0WH 1A6PA 2NY0D 3Q1SH 4WWKB 5DLMH 4LCUB 3S35L 5L2JB 3BXNB 3F65A 1HWGB 1A7RH 2UWEE 2A6DB 4WI9A 3O4LE 3BI9X 4Y88A 1T89A 2CUHA 3HC3L 1LEGA 1CTNA 2PXYC 2BFVH 1DUZB 5KVDL 5JW5B 5IQ7L 2ENYA 4LSQH 4NRZB 4WUUD 2YHGA 2VITB 2WWMC 3VFWB 4L4VA 2WBJC 5FUZH 2N1KA 1LO0H 3PHQA 3TNNB 2C4XA 3C6LD 4I18C 3GJEA 1QBLH 4Y8AA 1ROWA 5CKGA 2YWZA 3EO9H 2R39A 3N1QC 4OZ4B 2LTQC 4HCRL 2D7QA 1KN2L 3UBXB 2IAMA 1DJSA 4GRWE 1R5WB 5IHZA 5HY9A 4I2XE 1MFDL 3KJ4C 1JZ6A 3IU4H 2AK1H 3EZJB 5DT1H 3HI5L 4G6KH 2F58L 1WZ1L 2DRUA 4OT1L 5CSZB 5FKPA 5IB3A 4Z7OE 3EDJA 3TA3A 4CMMB 5E2UL 1HHIB 1HYSC 3T2NH 4APQD 3IFNL 5C0GB 1MI5A 1EMTL 3LKSA 1AKJB 4NNXB 2D7TL 1J1OH 3OMZA 4Z7QE 3D39D 3RWDA 1CF8H 5ESVB 3V5DB 2W38A 4Y4KB 5I17B 4NO3A 4JQVC 3O9WA 2X4RB 3MRJB 4MA1C 3O3BB 1J0KA 4YNYB 2EDQA 1H9VA 1YY8A 2UVEA 4LLUA 2X70A 1A1OB 5J57B 4FTVE 5J1TC 4Q9QL 2HT4D 3WXVH 5SX5K 2Q7YA 4ENED 4XVSL 1FGNH 5F7NC 1MCRA 1JZ2A 1P2CB 1LO2L 3S34H 1ZHBA 1J05B 1QPXA 3RY5A 3W9DA 3CIQA 3BD5A 5J06A 4GAJH 3CNKA 2IPUG 1AI1H 2X4SA 3CPLB 4R4BB 4FTVD 4P9HC 1NFDA 1P9MC 1R24A 1BPVA 5T5NG 4XGZB 3QDMA 1GGUA 4LLWB 2BRQA 3VA6A 4TVPL 4LIQH 1Z9MA 3VD3A 3ULSB 1MAMH 2FO4B 5EBWB 5C09D 2GJ6A 2FRGP 3G6AA 1X9QA 3JV4B 3PP3H 4OLZH 4NN6B 5IGXL 3MQIA 3THMH 1KJ3L 3BUTA 4H8WC 3C5JA 4NUGH 3DTXB 2Z91A 4F33B 2QQQA 5E1AB 8FABA 4X83A 4RQQA 5FFLA 1MLBB 2IG2H 1J1XL 3CUPA 4Q7DA 3VJ6B 4CU7A 2D0GA 4U1LA 5TE7L 2KZWA 4R90L 3RGHA 1TZIB 2H26A 3QI9D 4XX1G 1S3KL 2CO7B 4G7VL 1EAJA 1I7RB 4UT7H 1FNSL 4ORGB 2GIYA 2MSPA 3RFZC 2LAGB 1INDL 2NY3B 3NIFE 5HI4C 1KACB 4BM7A 4LLYA 1KXQE 4YFDB 2H45A 4Y5VB 2NY7L 4U31A 5F7DA 3E2HC 4PJEE 2CIIB 4XNQA 3AS3A 4MDIA 1U92A 1CD1B 3BIKA 4TPRL 2AJ3A 2ICWB 4L29B 4Z77B 4HEPG 4YE4L 1GSMA 3ES6A 4RGNE 4X4ZA 2PXYA 15C8H 1A3RL 4PRPA 4P5TA 5SWQA 5JUEL 1CQKA 4QCIB 4D2NA 1IZKA 3WFDL 2XTJD 3ULVF 2ZUQC 3WFBL 1XCQB 1B4RA 3LHPL 3T65B 4XVUD 4ZAKC 1YMME 2ILLA 5KS9A 5DR5H 1BJ8A 1N8ZA 1LDSA 3L3HA 1J5OL 4YDVB 3SGEI 4YDKH 1AQDB 1JGUL 2VXQH 2JE8A 3U46B 4XP4L 1YDPB 3FRUB 1IM3B 1F2XK 3MBXL 3I84A 5HDBF 5JNYA 5MHSE 1NCCH 2O5XL 1FO0H 1YC7A 3IKCB 2BHUA 3Q48A 4MJ4A 2IH1B 1YMMD 1F02I 4HG4J 2A6IA 3LV3A 3GK8H 3RL1B 1LK2A 4HWZB 2DYPB 3T0BA 2VLRB 3LEVL 5I1HH 2H8PA 4HKXA 3G5XB 3PL6B 3NAAL 3K2MC 4EN3D 1EJOL 4FFVC 4A2LA 4H26A 2A77H 5MHSD 1CIUA 4ZXBC 5GJSH 1AGDB 4QHLA 3B5GA 4PJGA 4PYHA 3MNVB 3D69B 4XVJL 3RWEA 1MRFL 2P24B 4IRSC 3G6JF 2W9LA 4NQVB 1PZ5A 3FB5A 3GZKA 1QO3B 4PV8A 2D7OA 4P48A 4S1QH 3N85H 1PBYA 1ERNA 4EEEA 1Z0MA 3CH1B 4OZGE 3RVUC 3VXQA 1IGTB 2IBGA 4U1JA 2HFEB 3OKMA 1QFOA 4JN1L 1ZA3A 3BWUC 4PTUB 3T08A 3DSFH 3L3IB 5CEYA 4JPVH 2ZCKL 3RQ3A 5FGBA 4JPIA 4MJIB 4OZFA 1VA9A 4KUZL 4S10A 5CHNA 3QWOA 4GBXD 1C5CH 5DK2A 4MAUL 1OSPH 5EO0B 1UXSA 4H20H 4KV5E 5FV2A 2EYSA 2W60A 1S9VA 2Z92B 1EEYA 3RVTD 3ZHLA 4FG6D 4OIIH 2AS5M 3HAEA 4RGOH 1JI2A 1KJVB 4IRJB 3QO1B 5IR1A 4FQQA 3BEWA 2FR4B 4XCFH 2YA2A 3RHWF 4NGHL 2XY2A 4JFFD 1ADQA 5GGSA 1OPGL 3B2UD 3OXSB 3F7PC 1AGEB 1OLLA 5E4IA 1L4IA 5JXED 4M7JH 3MLYH 5EORL 4QY8A 1IILE 4G3YH 4XNZB 3WIHA 2DQFB 2X4NA 3TWCH 3W9EB 1U8PB 2R9HC 4K7FB 5FYKU 3GFUA 4WDIA 4OJFH 5D7IE 4L5FH 1NGXB 1LO4L 4X6DF 4IOIA 4JFPA 1XGRA 4PP2B 4JKLA 4DQOL 2IQ9H 3FZUD 5H2BB 1X5YA 4UDUA 4X99B 1PD6A 4YHKL 3LD8C 3RIAF 4WJ5A 1T83A 3D3VA 2BY3A 1DBBH 1CGSL 3O6FD 4HMCA 2HJLB 1U8LB 5DJXA 4JDTH 4KROC 3TIEA 1QQDA 5I76A 4N8VA 3ZT5A 5HHPA 2R0WL 3ARGB 3CZFB 2ZCHH 3Q1SL 5DLML 4PJ7F 1FL3A 5CBEA 1U0QA 2MQ3A 1X3DA 1QSVA 2XN9A 5C8JB 1IC7H 3HCVB 3HE7D 3DO3A 1A7RL 2ESVA 3RVWD 3X14B 4L4TD 1QRNA 3SO3B 2ATKA 3C5SA 3NFNA 3W81A 1G7QA 1OY3B 3QJFB 1L6XA 1JNHA 2BFVL 4WRLA 4YUEH 2BNRB 1QLRA 4S2SB 3QEQD 4LSQL 3P4OA 4D9RE 4JN2A 4M61A 5DHXB 2DN7A 3UJTH 5AAMA 3OKYA 5FUZL 4IJ3B 3LN5B 4KK6D 3SDCD 1LO0L 1T1YA 5C9JA 1QBLL 1INQA 1Q9LB 2VLKB 2LFGA 3IJYA 5C0AE 1JNJA 1SEBA 1FV1B 2CRYA 1X5IA 2VH5H 1RHHA 3EZ8A 3TFKD 2OSLB 3EO9L 2UZIH 1DVFB 5ENWB 4PLNC 2LABA 2IMMA 4OB5H 2VZ3A 3GIVA 3VMOA 3NGBC 8CGTA 4U4BA 3IU4L 5CKAA 2AK1L 2O5YH 1A7BA 1F97A 2YKLL 4KJWC 4G6KL 5DT1L 3SDXF 4D9LH 3QDJB 2NY6B 1KIQB 2Z93A 5F3HB 5C0JB 2XG5A 4K3DH 4OGAC 5DJDA 4KMQA 3V4PH 1YC8A 5E5RB 5TJWK 3KYKH 4J7RA 3T2NL 3MR9A 2W0PA 3QUXD 3SPVA 4RX4A 3SDAA 5DQ9A 4PJAA 4JFOB 2C9AA 4HT1L 3GUTA 1J1OL 4WU5A 4Z7VA 5SWZA 2NY1D 1CF8L 2IMNA 3NACH 5E08H 4MQXC 3LKQA 3RVXC 1OOAA 5GISH 5F1NA 3CFDB 5I8KH 5FO9A 2ICCA 3KPLA 4XNXH 4JZNB 4M02A 4OV5A 2Z9TA 2DTMH 1IKNC 2DJUA 5HGBA 2NZ9C 1IT9H 1TVBA 3HUJB 3WXVL 4F7MB 2YEZB 3BISA 5J6HA 3OX8A 5J6GA 5DMGD 1WV7T 5GRVL 4R97C 3S34L 1K4CB 3H3PH 3ARFA 4GLRH 4JFDB 5HHMD 3RWHB 1X5XA 1VDGA 2GT9B 4YPGA 1AI1L 4YBLC 1R3JB 5E56A 1E6JH 4D8PB 3PUCA 4R7DA 1O7SA 1I7TA 3WHE0 5EG6C 4PG2C 5BV7B 1OARH 3ILQC 4LIQL 5CSGA 4OGYH 4JLRB 4NDMB 1MAML 4TTGA 4F9PA 1H3XA 4DZ8B 1GZPA 2AJXL 1JYVA 3AY4C 2GFBB 4OLZL 3GSOA 3THML 4NUGL 4LK4A 1EVTC 4AJ0A 4P57A 3OWEA 5I8CB 2IG2L 5E4EB 1A9EB 3FFCA 4Y16B 5MEQA 2FJGB 5E8DH 2YK1L 2F53B 4P2RD 5C0BA 5HHOA 1J8HA 4LGPB 1VEOA 4UT7L 4BQ8A 5HYJB 3B8YA 4NPYB 1A14H 4XT1C 4MZ2A 2V5TA 4GG6F 4LHUD 2A0LC 1WK0A 3AREB 2G75B 1XR9A 4OF5A 3UJIL 1JUFA 2BP3A 3UTTD 2UV3A 1QSEB 2Y36H 1KLGB 1YEIH 2QADD 4HFWB 1EZVY 5KN5A 3ZDZE 2CD0A 3BGFC 4RAVB 2ARJA 3QXWA 1YPZE 4K2UH 2NY2B 5GRVK 1OGTA 15C8L 3BP6A 1UM6H 2HA1A 3UPRB 5IHLB 4WVRA 1R5VB 1FSKC 5JQHC 5D8JH 4FABH 4Y89A 4PLJD 2BCKB 1J9CT 1C5DA 1A7QH 3FT3B 4YGVB 2AEWA 3T2QA 3NCYP 3OPZH 2ZJSH 2I9LA 3QIWB 4LVOB 3RNKB 1DANU 5DR5L 1AY1H 1JK8B 2X9YA 1C7TA 5DA0B 4YDKL 1X6LA 2VXQL 2VLMD 4G42A 2ICWI 2PYEA 2VKWA 1QR4A 3QFDB 4OGZA 2ORBH 1VACA 1NCCL 2NXZB 4TYUA 1FO0L 2A1WH 1W0VA 1B3JA 2MTPA 3PP3K 1JN6A 1S7SA 1XF4B 4NHCH 4W81A 5DGRA 3QAZC 2X4QB 3DSNA 5D2NC 3GK8L 5I1HL 4UT9H 3I6GA 2VQTA 2YPVH 4TSCH 3VI3E 2A77L 2H3NA 4Y4HC 5GJSL 5IF0A 3TH3T 4JM2A 2YXFA 3ORJA 3ABZA 4KTDH 5IB5A 4N0FB 3TH2T 1FZKB 1DN2A 4J8RB 4K3JH 3D0LB 4HGKC 3K8MA 3MGTB 3GRWA 5DC0A 3TM6A 5IWLC 1HCFX 3OXRB 3QUKB 5C0CD 4S1QL 3N85L 4X9HA 3IJHB 5DVNA 2B39A 2XACC 3D0VA 1CTOA 3V7MA 3VXRB 3O4OC 3WLBB 1IVLA 4IMLB 5MP6H 1IEBB 4U1IB 4KKBC 3NIDE 4P23B 4IEFB 4ORZC 2G9HA 4M03A 3DSFL 2IWGA 4LBEA 1DANT 3FQTA 2EDHA 1D5XB 3EYFA 1U8JA 1XIWD 5D1ZC 4HPOH 4N0YH 1UJTA 3WNKA 3SKNA 4FP8H 1C5CL 1OSPL 5AAWA 3O2DA 2GSIB 2FL5A 2MQCA 4H20L 1NCAH 1HHHA 4D9QD 4LFHD 2APVA 5CSBA 2JJSA 4U7KA 1EUTA 5K9OB 4M1CD 3MV8B 4RGOL 1A64A 1FL6A 4GUPB 3P4MB 1NCTA 2V7HB 5IOPB 2EC9U 4XCFL 4B50A 4LRIC 3M17B 5CINH 5CCKH 4DKEH 2BZDA 1TETH 5TDNB 2YSSA 4I9WE 5IV2A 2DM2A 4GKSB 3MLYL 2X44D 4M8QB 2QR0B 1JFQH 3QG6B 4G3YL 2GTWB 4D94A 1D5MB 2NY5L 5KOMC 3TWCL 1QFWH 1FNAA 2MWCA 1LHZA 4JFYA 4X6EB 4I9WD 1HEZA 1FFRA 4KY1H 4L5FL 3D85D 3F12B 1UA6H 2AK4D 1J7VR 2E7HA 3EUUA 1T80A 1UH2A 2IQ9L 3UTZB 3NFPB 1SJEB 2DMBA 4EVNB 5HYIA 1QEWA 2XKSA 1CE1H 3DGGA 3HZVA 2QSCH 1U8MB 1DBBL 1U8QA 4XB7A 4JDTL 4J2XA 3FQNA 3WL9A 3TH4T 4LGRB 32C2A 5E99H 5ETUA 2VLLB 1MEXL 4WCYH 5GS0H 3S36H 1IC7L 4K3HA 1XR8B 4IMKA 5E8NA 5K93A 5IJKC 2EDTA 4KXZH 2PKDA 4Y5YC 4P46D 1OB1B 1CL7H 5GGSY 2EC9T 4HWBA 4HMDA 3FAWA 2PYFB 2C1PA 3OGCB 4YUEL 3U79A 2CKBA 1A9BA 5CMAA 3RP1A 5C0RH 3HZYA 4UOJA 3FTGB 5I1LB 2BOBA 4K23L 5EU7E 1M7IB 4LLVA 3UJTL 1MJ8L 4L1HA 2I5YH 1NBVL 1FLTX 3H3KA 2BSRA 1KPRB 3WHXA 4EXPX 5EU6A 5B8CA 4U3HA 4X7SH 4LDOB 4WU7B 3VGFA 2V5MA 5D7SH 2VH5L 3IDIA 4F2MB 5ICYA 3IETB 3BZEA 1I8KB 2UZIL 4KRPC 4QHUA 1I1AA 5HTSA 3INUH 4FQHB 5FM4A 4O2EA 3C8KA 4OB5L 1N5AA 4MXVF 5HPMA 4UQ2A 2WP3O 3BZFA 5IMMB 4XXCA 2XKNB 3M1BA 3I3EA 2O5YL 3WFEH 1GRWA 4H5SA 1WBZA 4LLDA 3ZKND 1F11A 4K3DL 5T1LD 2ADFH 5FOJA 3V4PL 5C09B 5IB4A 5JW4N 3MLUH 3KYKL 1ZLSH 2DMKA 3H0TA 1C16A 5GS1B 1TNMA 5D1QA 3ARDB 1DEDA 4Y2DD 2APWA 1CXFA 2Z4QA 3NACL 5E08L 5IFJA 5C6WH 1AP2A 2EKSA 4P3DA 2IBZY 1U3HB 4NBZB 1KJ2A 5GISL 1NANH 5L8JB 5I8KL 1HDMB 1R0AH 4XNXL 3MRIB 2VLKE 2YC1A 3PE9A 5EUKA 3ARUA 3WS6C 4GRWF 4RA0C 1KT2A 2V2TB 2DTML 1G6RA 3GSQA 3DRQA 3VGHA 1IT9L 5E2TH 1AIFA 3LKNB 4HUXB 4I1NB 3GMQA 2WUCH 3BW9A 5ITBH 3H3PL 5CP7B 4Y5XC 4ODTH 4BUHA 4LNRA 5KSAA 1CFVH 3VMNA 1BVKB 2HVJB 4YHNA 5ECJE 1FNHA 1JV5A 3LKOA 5IK3B 1E6JL 1HHGB 2R2EB 1SHMA 5IBUB 1F8TH 5I6XB 5KAQF 1T0PB 2Y07L 1RZGB 3KYNB 1OM3L 1MRCH 2DQTH 5E95B 3OJDA 2VAAB 3QXAA 1OGAE 4OGYL 4K8RH 1LP9F 5GS0D 3O3AA 3DIFA 5IMKB 1U93A 2E7LA 4RMRA 3PIQB 1L9MA 4LSUL 1FPTL 3V6OA 3QO0B 2YZ8A 1WTLA 3ULUE 2VDOH 3EOBA 3VXUD 3RTQA 1I8IA 4A2MA 2WQ8A 3KNBB 3MRMB 4KVNH 3UTOA 2BVOB 2RCSH 1OGAD 4AIZA 1AR1C 3VXSA 4UI2A 4MA3A 3UDWA 3P9LA 5AYQA 4XCNA 4PD4J 2O93L 1KLUA 3ULUD 2X09A 2PTVA 3DROB 1MCWM 3HUJE 5HVHB 5E8DL 1FVCA 1LEGB 4NQDD 1OP5H 3LQZB 4EN3B 2R1XB 1A14L 1YEFH 1DBAH 4S1DC 4OD1L 4NUJB 5DJ8A 4HZLB 4TOYH 1KJMB 3MXWH 2VIRA 1YEGH 3QUZB 3PQYE 4D0CB 4DKFL 3CJJA 2Y36L 1E28B 1IFHH 3UROR 4HJ0D 1YEIL 3FOLA 2V9QA 3GJEB 4KU1A 3PHOA 3PWPD 1Z5LA 5IJKA 3KXFD 5DRWA 3BPOC 2JF1A 1DEEA 4Y5YA 1GPOH 4K2UL 4C56B 4L3CA 5DFVD 3PQYD 5ACZA 1EGJA 1BFSA 3Q5YA 3H9ZA 1QA9A 5D8JL 4FABL 2IAMB 3TZVA 7CGTA 2R15A 4Y4FD 5IHZB 5ID0B 1WLHA 4O9HH 1A7QL 4XPTH 3L1OH 4N8PA 5D2LF 5F9JB 5B38A 1U41A 3OPZL 4CL7A 5MENB 3BZ4A 3IDGB 5IEKA 4GBXB 1NEUA 1AY1L 2CRZA 2QSTA 5IB1A 3LRSA 5CJ5A 1AGFA 4M43L 1JYNA 4DZBB 5DJAB 2HT3C 5T1KA 2F53E 4XH2B 1D9KD 3BIBX 2ORBL 4J1UA 4PJEF 2A1WL 3C5ZD 3Q3GA 2CDGA 3UBXG 3G9AB 1BQSA 3VWKD 4POZC 1BZ9B 4FZEH 4X6CB 3RBSA 3RDTD 2W0FB 4BUGA 5IB2A 3BRDA 4UT9L 4U1HA 4J3OC 1P7QD 2YPVL 3B3IA 4TSCL 3WDHA 2JCCE 3O9WB 2RB8A 3LN4B 4O51B 4EI6A 4KTDL 4NQXA 2RR3A 3V5HB 4X7FC 4K3JL 2X70B 4AM0A 2HMID 2EEAA 1GHFH 1Z9LA 4UOW1 3I75A 2CK0H 5B22A 1CICD 1EFXA 5HVGB 5D1XA 4PJCA 3BEVA 4U1MA 5LCVH 5IBLC 5MP6L 3HA0A 3SE3A 1FYTD 1BIHA 5DUBB 1M7XA 4K8RD 5FM8A 3NH7H 4F7TA 2XA8H 4N9GB 5ANMA 3VCLA 4NBXB 3TJHC 3OKKA 4X5LA 1FG9C 4ZUSB 2OCFD 3MRKB 4LCCB 1U58A 1S7XA 4N0YL 5EPMA 4FP8L 4L8SC 1HXMA 5GSRA 2YD5A 4JJ5B 1RULH 4QRRB 4MXQD 3JTSB 1FO0B 1NCAL 3PWLA 1MFAH 1Y6KR 4PJHE 2J5LC 2AAVA 1X4YA 3HE6B 3MYJB 2CDFB 4MB4A 1W0YT 3Q6FB 4DN3H 3H7BB 4NNPH 4PJDB 4QNPE 2R2HA 4OIAA 1RJZB 4YJZL 4OZGF 3HHRB 4YLQT 2FECL 3CUPB 5CINL 4U1LB 5CCKL 4DKEL 3TN0D 1IQDB 2H26B 1G7PB 4NCC2 2IQAA 4HLZG 3MJGX 4RMQA 1DL7H 4HIXH 1KEML 1P5UA 5TPWH 3KPNB 1JFQL 3VXRE 1YY9C 3UCRA 2KH2B 4DEPB 4LLYB 3HC0A 2BY0A 2DWEB 3TO4D 2EECA 5F7DB 4KY1L 2E9JA 2V2WA 1UA6L 1C08A 4XNQB 4MDIB 2PTTA 3IXAA 4B7LA 3O8XB 5IUSA 2EEBA 3ES6B 2VZUA 3KPRE 1NKOA 1CE1L 4AT6B 5E8OA 4J3UA 2WWKO 4M48H 3K4DA 3QIUC 2QSCL 3S4SA 5SWQB 2HKHH 3GMPA 3Q2CA 5GIRB 3X3GL 4RAUA 2EH7L 5E99L 4MVBD 5E9DB 1DP0A 1KB5H 3MV8E 4WCYL 1S9KC 5GS0L 3S36L 3G5VB 1T20B 3ZDYF 2Y9RT 5D7JA 1G84A 4M93B 4U2ZA 2I25N 5KS9B 1N2RA 1CL7L 1MREH 3VWJB 4X9FA 3RWFB 4TNWK 3VXOB 3MCLH 1F4HA 1P4BL 5C0RL 2A38A 5F7YC 5FUOH 1V3MA 3K1KC 4XAKD 1LO5B 3KPQA 2I5YL 5C2UB 3G08A 4DK3A 4FXKB 2NXYB 2FD6L 1X44A 3CFJB 4X7SL 4ALAH 1YA5A 1G9EA 3QCUH 5D7SL 3AUVA 2VDKH 4LPTA 4JGUA 2ATPA 4I0PC 2J12B 3VFSB 1W2KT 1NMBH 3G5YA 2GAZB 3RX7A 3F58H 3ZZ1A 2DBJA 1I8LA 4XI5C 4QO1A 5J3HD 3VXQB 5DEGB 5CIPA 3BPLB 2BVQA 4O58H 4P2QA 2YD6A 3WFEL 4YH6A 4PJBF 2X1QA 4RISH 1MSPA 4U49A 3F6LA 2OQJB 3GHBH 2HJFB 2ADFL 4R4ND 2GK0B 1LD9A 2CJUH 2EDRA 3U48A 1KPVB 3MLUL 5ICZA 2NNAA 2R0LH 5L7XH 3MFFB 4QOKA 3KR3H 4GW4B 3QWOB 5AG8A 2VZVA 2D7PA 1UQSA 1RZ7H 3C60D 1BEYH 4HAGA 4F58H 2W1NA 4HSQA 4KKAC 3SY0A 3SBWA 4P2RB 1R0AL 4Z6AT 1JWUB 5FXCH 2PR4L 3AU1A 4Y2OA 3VRJA 4YFEA 3BEWB 4TUJB 4WTWA 3BAEH 2HFTA 1Q1JL 5E2TL 4UV7H 3IDNB 1S7WA 1NMCB 1R3HA 2NLJA 5INDA 5MERB 2WUCL 5ITBL 4BSJA 4OLXH 4ODTL 4MCYB 3AS2A 3PJSB 3TYGH 1H5BB 2X4NB 4HKZA 1TZGH 1BBJA 4YHOH 2R1WB 4R0LA 1IC4L 2R8SH 4PUBH 1F8TL 4JGJA 1F4AA 5E6ID 4JFPB 5F1KC 1MRCL 2DQTL 3PWNA 1E4JA 3HR5B 3P4NB 4O2FB 1MCIA 1OTSD 4C54A 2WSKA 1KXTB 1QSFA 3MNWA 4D0DB 2OTWB 3M8OL 4X6FB 2VDOL 3MRRB 3TIEB 5GZOC 1QQDB 1FL5B 4KVNL 4X9BA 2P47B 2RCSL 4PJ9C 3GM0A 2DQGH 5C0FA 3Q5OA 2IADA 2OL3A 4HUMB 4UZGA 1TQBC 4FQPA 4F37K 5LWYH 4WO4D 1DLHA 2CXGA 3U7WH 1PG7X 4JE4B 2ZSWB 5D72H 1QLRB 3FQUA 1N26A 3N1GC 2NPLX 2FJFA 3BGMA 1MY5A 3OKNB 4EI5D 2MFNA 1YEFL 3P4OB 1DBAL 2UYLB 1LILA 4TOYL 3UTPE 3DUHA 3KPSA 3MXWL 1YEGL 3ZDXF 3C09B 1IFHL 2EIZB 2NY0C 4PTTB 5E8PB 3LS5H 1RIHH 2YUWA 3EO0A 3B6SB 1S5HA 4U3XA 1CG9A 2R29H 4HDIA 4PRNA 4PRBA 1RHHB 1GPOL 2CKNA 1BQHB 1T1ZA 4LCYA 4NO5A 2AGJH 3KLAB 3UTPD 4POYA 1KSRA 2K3TA 3PG2A 3TCLA 3ECBA 3P3YA 5E6ZA 4A6YH 3NPSC 1JIBA 3FO2A 1HQ4B 2L7JA 4LDLB 1IL1B 5LJYH 4O9HL 5D5MB 4XPTL 1JPGB 5JOFB 3L1OL 3IAQA 3W11C 5BJTA 4AL8H 1XIWB 1EHLH 1Y0LB 5JA9A 1I1RA 1RV6X 5DJDB 1G0DA 2NCMA 5F1OB 3H9YA 4HIJA 4GRLD 2ZCLH 5C07D 4G9FD 1MCLA 5C3TA 3LEYH 3QQ4A 4JANA 3SDAB 1FBIH 2BOCB 3ZDZF 3DVFA 3EJYD 1M6OB 1HHKA 1YPZF 4FZEL 4IIQA 1A4JB 5MEOA 1FFQA 2EO1A 5IEHA 4LHJB 1S9WA 4YQXH 4QT5A 2WUBH 5KZCD 2GJZA 4OZHB 1IEAA 3T0XA 1TVBB 5SWSA 4L4VD 3F8UB 5DHYA 1GHFL 2CK0L 1VKXB 3CX5J 2J8OA 4MA7H 1JI1A 2Y1VA 4PJ5A 5F7LB 5AD0B 3FOMA 3QHZH 5LCVL 2CLRB 2OLDA 5JQ6H 3BOVA 1HWHB 4ZOCA 3H42H 5MENE 1FH5H 3NH7L 3CXDL 4JHZA 1CK0H 4XPAL 2WMPA 4X4XB 3HI1B 2R69H 5HI3D 4LLMA 2YRZA 1JNLH 4MNHA 1S78D 1JPTL 4DUWA 1AC0A 5A3IC 3VI3F 1MI5E 4Y1AA 2CMRL 5FYLE 4K71C 2X4PB 4ENEC 3BDBA 4QYOB 3KLHC 1I1FA 1WAAE 4JHAH 4WHTA 2Q6WA 4ETQA 1HINH 2J2ZA 4NN5B 3TA3D 4LQ1A 1KN4H 4DN3L 4NNYB 3CDGB 4NNPL 2F5BH 5D5MF 1MI5D 5TGBA 2P48B 2CRMA 5FYLD 3QNZB 4JKWA 5I9QB 4EUPH 2WIIA 4N8CH 4XP1H 3QDGA 4MD4A 4KGLA 3SDYH 2RGSA 1A4KB 1DL7L 4HIXL 1UB5B 5GGRB 4IOFD 3EOAA 3NZ8B 1TQCB 2XI9A 1K8DA 4XCCH 1RJCA 4I4WB 5FB8B 3RZCD 3VXMB 5BQ7A 1XR9B 5JHDA 4IS6B 1JUFB 1F45A 5IW6A 4YIQB 2C3VA 4DVBA 3ARBC 3BKCH 3HG1D 3S97C 2Z8WC 1EJ6A 3BH8B 4P5KB 4MXWH 1UWGL 4XCYB 5INCB 1VHPA 4PJFA 5GQBA 3QI9C 4M48L 2YUXA 2WV3A 3F7RA 2FIKB 2HKHL 2GJ6E 4QRRE 4ELMF 3SDDA 5CZXC 5DJCA 4NQCA 2ZOLB 4XBGA 4JFEA 2VSCA 1URLA 1C5DB 1KIPA 1KB5L 2C26A 3QDMD 5EU4B 3LS4H 2JB5H 1W8OA 4PJDE 1AO7B 1MCSA 4WHYG 4Z7NF 3S88L 2FATL 2I9LB 1JWMB 4KI5D 1FNGA 1T0NB 1PKQA 1H3WM 1EDQA 2W0KA 4CN1A 3VRIA 4UTBH 1TFHA 1MREL 2DDQH 3O6LH 4XBPB 4G42B 2A6KA 2PTUA 3DXAA 2Z31D 3W0WB 3MCLL 3VW3H 1TIUA 1KF9B 1S7SB 2APFA 4S11A 1DQQB 1SJHB 4PJ8C 1BGXH 5C7XH 1CVSC 4P4KD 3SGJC 2UWEA 2XTJC 3HAEH 1PSKL 3R0NA 4R4FH 3ZE1E 4ALAL 5CD5D 3O4LA 2X6MA 3T0EA 4P9HH 3QCUL 1VGEH 2VDKL 5E7BA 4QRPA 1CD0A 1W72H 5DXWA 1L6ZA 1ADQH 5BZDA 4KJYA 4PJXA 2P43B 3MLSH 1NMBL 4WI6A 2E9WA 2Q8BH 3F7YB 4PRPE 5HGDB 3F58L 4KQ3H 5IBTH 5BO1H 1LE5B 5FV1L 1EXUA 1LWRA 5IVXA 1D5BA 2VISB 4O58L 1RUPH 4NKQB 4XZUB 3WJLA 1T5WA 5I71C 4RISL 3BHBA 1G9NC 1II4E 2PXYD 2WQRA 3GHBL 4PRPD 4Q0XH 5KS9E 4X98B 3I3BA 1KTLA 2P7TB 2CJUL 4P3CH 3TVMC 2R0LL 5L7XL 2A6JA 2HVKB 2WWMD 3EYFB 4QHMB 1XEDA 3KR3L 1U8JB 3H8NA 2NX5B 5FIEA 1CU4H 3GMNA 4I2XA 1IBGH 1RZ7L 4F58L 2FZ3A 3FQWA 2IF7A 3VRLE 1FZMA 2J88H 4NQDB 4XNYL 4YHLH 2D9QB 5KJRL 1HQRB 3CMOH 4PJGE 4TVSa 5I75B 4U6HB 1HCVA 3BAEL 2FLBT 4Z7UB 4UV7L 4Z8FH 1BAFL 3FO1B 1E0OB 3QWQB 5EOTB 4HK0A 1BF8A 3IF1A 4FQXA 1X6NA 3OBAA 3TO2A 4F7PA 3WJJC 5IVZA 3WNNA 1UJ3A 1ED3A 3KXFB 2GJJA 4OCMC 3TYGL 3NVQA 1TZGL 4YHOL 3VFUA 3RGVA 1TPXC 5HYFA 1D5ZB 2DIJA 4JFYB 1Z2KA 2R8SL 1HEZB 4FG6C 1T22A 4BFBD 3DX8A 1CFQA 4HUKB 4P2OB 1CDIA 1GIGH 4JO4L 5ESQA 4MNGB 4NJAH 1DQJB 1VFUA 1YUHB 1FVDB 3B2UC 4YC2C 4I5BA 3O41A 3V5KA 2G2RA 2X1WL 1SVZA 32C2B 5EUOF 2HKFH 3L95A 2A74A 4JB9H 2DQGL 3QH3B 2Y4SA 1V05A 3TPUB 4P5MA 4PV9B 1DBKH 1ORQB 5JOPE 4QEGA 4RCAA 5LWYL 3WV0A 1UZ6F 1B2WH 1MVUA 3GMLA 5IKCA 4Q2ZA 3U7WL 2EDXA 4XBEH 5D72L 4EZMA 5AZ2H 2FH6A 1A9BB 1A6VL 5FO8B 1BX2B 4QTHA 1KCLA 3LZFH 5IVNA 3T3PE 1G7MB 1NDGB 3K4AA 3MROB 1X5ZA 4KDWA 4JRXA 3CX2A 1WZLA 4OF7A 3MRHA 4JG1L 3P0GB 3U4EB 3LS5L 3ZE0F 1RIHL 3CLFH 4J23A 1Q8MA 2PO6A 4WEUD 3ULUF 4P99A 4K94C 2R29L 4JO2H 4MJ6B 3C8DA 1NL0H 3HE7C 4MAYA 1ZV5A 5ICYB 4YO0A 4L8DB 3UYPA 1N59A 1QSZA 1INEH 4B41A 1S9XA 3D3VE 4O2EB 5E2JA 4A6YL 4GFTB 4U6XA 1F3RB 5EBMA 1CBVH 1KV3A 3UTSD 4UQ2B 4FQJH 5IVOA 4AL8L 3TC9A 3DI3B 4YHPB 1R3LA 4JM4H 4KK6C 1NUDA 1OVZA 4F9LA 3D3VD 3FT4A 3MA9L 5CP3A 1HSAB 4FZ8H 2ZCLL 3ZKSD 1A2YA 5EO9B 3MJ8A 1IGFH 3L5HA 3LEYL 2J8UB 3MMEA 5I1AA 1N7MH 1FBIL 3AB0C 2XN9D 4PY7B 5CJBA 4KRMB 3GGWB 5JPNA 4OM1H 2X4TA 4PRHA 2ESVD 1EHAA 1QRND 4M1GH 5JTWA 1AP2B 3RWGA 3BSZL 4HFUH 2ZG2A 2PW1A 3IJSB 4YQXL 4LVEA 3ZKXC 1KTRL 2WUBL 1G6RB 5BRZB 2OX5A 1UG9A 1J0YA 2AV1A 1R3IH 5A16B 5EZJA 3LEXA 2RFXB 1WGOA 2EDLA 3QUXC 3GMQB 4MA7L 2M1KA 1NGZB 4R8WH 2DWDA 4MJ5B 2B8OT 3L3KA 4WHDA 1H8SA 3OHXB 5JQ6L 5KSAB 3RIFK 1UB6B 2NY1C 4QRUB 3H42L 1FH5L 4J3SA 4CN4A 5K9QG 1CK0L 3WIFB 1G7IA 2R69L 1KCSH 1YNTB 1JNLL 4PJIB 5HHQB 3QXAB 3K3QA 2JCCF 5LGKA 2H2SD 3O3AB 3DIFB 3OJ2C 1IE5A 4FFVD 4U6VL 5DMGC 4Z7VE 4ZXBD 4JHAL 4UU9A 4B7IA 3ESUF 1HINL 4CW1A 1KN4L 1GXEA 5ID1B 4IRSD 5D9SA 4BFGA 2F5BL 5T3ZH 1EAPA 1GZQA 2WP3T 5IBUG 2JIXA 4OZHE 4UIKH 4XCNB 5C0NC 1KLUB 1A0QL 4N8CL 4XP1L 5SWZD 4BA8A 3PGDA 4BSVA 1J88A 1FVCB 3ILPB 3SDYL 4OLEA 4RFEA 1LEIA 1CQYA 1MHEB 3QYCA 3MXVH 4JCLA 4URTB 4XCCL 1X5GA 2CDEA 2ADGA 3MRPB 1IM9A 1T2QH 5JPMB 2DQIH 1RMFH 35C8H 1G6VK 3BKCL 5C08D 3BP4A 2NTFA 1FN4B 4MXWL 1ZVYA 2KKQA 1Z5LB 2FYYA 5DRWB 3ZHDA 3ARFD 4ZFZA 1DEEB 4G8GB 3TBTA 3D18A 3BQUA 4QNPF 4TULH 3MZGB 2JB6B 4OUUB 1A47A 5DTFB 3I6LE 4Y4KC 4K7PH 1F3JB 3PGCA 2B1HH 3TT3H 4E41A 3DPBA 3TF7C 3B9DA 4QLRA 4HW6A 1SY6A 1JF6A 5D7IA 3LS4L 2JB5L 2AXHA 2X4UA 4WGVB 3DVGB 4DGVH 3HRZA 4MNQA 5F6IC 1JL8A 5AYUH 3MRDA 4UTBL 2QADC 3FFCE 2DDQL 5HGHB 3O6LL 5JIPA 5T1KB 3LPFA 4YBHA 1LE9A 5C0BE 3D5OF 4NT6A 2BSTB 4Q6IC 1J8HE 4J1UB 1K85A 3BP5A 3Q3GB 2R9HD 3O2DH 2P45B 3E8UH 4NZJA 1MCHA 2WZPD 2EYRB 3HB3D 1BGXL 5C7XL 2D4DA 2OR9H 4ZFGH 3DUSB 4L3EB 1OF2A 5LKNA 4XTRC 5DYOA 5FYKE 2F8XC 4R4FL 5HHOD 1J8HD 2FHBA 5L2KA 4P9HL 4J3VA 3L5WA 1VGEL 3WNPA 4CDGC 1MOEA 4NQXB 1W72L 1ADQL 4KROD 1PVHA 1FZJA 2F54A 2FECI 5EOQH 2NY4B 2Q8BL 2OXHA 3GSNH 4LAQH 5EU3A 4NN6C 5IBTL 5BO1L 4KQ3L 5FYKD 3VA2C 1EFXB 1KGCD 4HS3A 5E00A 4OFVA 3X11A 1BD2D 2Q76A 4U1MB 1RUPL 3P77A 4X4YB 3GSVA 3RBGA 1AO7E 3AXLA 4H8WL 1KB5B 5J7CC 4G8FA 4Q0XL 1RHFA 3HZKB 1I3RA 1M7DB 4P3CL 3QUYC 4LMQI 2EZ0C 3K0WA 3W0WE 5EPMB 4UIMB 2NY3C 3VE0A 1CU4L 1NDMA 3L7FA 5EDXA 5T3ZD 2E27H 1IBGL 4X8JA 1CWVA 1ACYH 1F4XH 4WWKA 5L2JA 1XGPB 4Y5VC 4BZ2H 4UTAH 4OTXH 2P5WB 1NC2A 1B6DA 1W0WB 5DC9B 2PYED 1LO3L 5FA3B 4K55A 2A6DA 2Z8VC 1QKZH 5KVMC 4CJ1A 3CMOL 1FVEB 1DUZA 4Z8FL 4HBCH 3FO0H 1JHLH 4WFGD 5DZNA 1CXLA 1CL7I 2VITA 4PR5B 3VFWA 4N1CA 4KJWD 1WCQA 4GT7A 4JM2D 1BLNA 4OGAD 2P49B 3TNNA 4ZO7A 1T7WA 1NAMH 4UOW0 4YXHL 4MHHI 4BFEA 3DETC 4TUKH 1JCKA 1ZMYA 4OZ4A 1C08B 2BHYA 2ED8A 5MI0B 5BZWB 1GIGL 2K1MA 2V5RA 4NJAL 3IYLW 2NX5E 4MGXA 4EIZC 1R5WA 1EO5A 4MQXD 5DUMH 4KJQC 3S4SB 3RVXD 4KZEH 2EE6A 1I3GH 4P3WA 3IAGC 2BNUB 5C1MB 2HKFL 5IROA 4LVHC 3MJ9A 5BS0D 1UKSA 2NZ9D 3DMMA 4Y19D 5CSZA 5KVGH 4N90D 4XPFH 1JGVH 1DBKL 4CRPA 1NC4B 5K9JH 4CMMA 1HHIA 1EBPA 1B2WL 1QBAA 4Z7UE 1I8MB 4XBEL 5H37H 3NCCB 4KDTC 5AZ2L 4NNXA 3PWVB 3LZFL 3V5DA 2C7UB 5I17A 1H3VA 1EZVX 3VG0H 3WN5B 3FN9A 3MRJA 5KZCB 4X5XB 3O3BA 3ISWA 4N1HB 3ILQD 5I0DA 1SJVA 5T1MB 4ZFOL 5DD1H 3CLFL 1A1OA 1NANI 2EDBA 3L5XH 4JO2L 5EWIH 3RI5K 1NL0L 2R0ZH 5T5FH 1Q38A 3E6HB 2LVCA 2ATPB 1PZUB 2RJMA 1P2CA 1INEL 5K33A 3ZE2E 1J05A 4I3RH 4YXKH 1LDPH 5FO7A 4RMWA 2GI7A 3QT2A 1CBVL 3CPLA 2EYTA 4R4BA 4FQJL 1ZHLA 1TJGL 1B6UA 3HMXA 5CIPB 1RJLB 4ZDHB 4Z7WF 1NFKA 1QBBA 1K4DB 4F15B 4PB9H 1RUMH 3EGSA 3QPXH 3RUGF 3STLB 4JM4L 4HJGA 5HI5C 3C6SB 1ZVSA 4LLWA 4HIIB 1CFBA 3VMPA 5KG9B 1I7UB 2XWBB 3V7AG 4FZ8L 4M00A 1F13A 3ULSA 3QHTC 1IGFL 4LPUA 3MLZH 1MIMH 2FO4A 5EBWA 2A0LD 3LPGA 4XNZC 5EU7C 1N7ML 4JVUA 3SEPA 1Q72H 2BK8A 3JV4A 1BVLB 1HH9A 1V3LA 4OM1L 5IJVB 3DTXA 1UQSB 4QXUH 5DF0A 3GI9H 4M1GL 3SCMB 2VXUH 4F33A 3SY0B 2WWKT 1MLBA 4HFUL 3JVGC 5EU6E 3U4AA 3VJ6A 1XT5A 1TZIA 5TF1H 2AQ1A 2AJVH 2B1AH 5IG7B 1ZSDB 4OCYH 4GXVH 1XGUA 4PS4H 5T3XE 1NMAH 3MBEB 3GSRB 5EN2B 4ORGA 5DSCB 1R3IL 3RZCB 3RJDA 5EU6D 4TNVF 4O02H 3TGXA 4R8WL 3HG1B 4A6YB 1FP5A 5CEXB 5H8DA 3HPJB 3T4AB 3O11A 4Y2DC 2AQ3A 4HKZB 1JZ8A 1I1AD 4OKVA 4K9EC 2ICWA 4LCWD 1T7VA 2AVGA 5DJ2B 1FHGA 2YPLA 1KCSL 2N4IA 4JY5H 1A7NH 5JW4M 1FDLH 3MLRL 5BVJA 1Q0XH 1W8NA 4QCIA 4GAYB 4RMVA 5C0DB 4HS8H 1AD0A 1OAZL 1XCQA 1ACZA 3QIBA 5DWUH 3ZTNH 4LSRL 1YN7B 2PW2A 4YDVA 1AQDA 5T3ZL 1YDPA 1IM3A 5FYJH 2XNAB 1SJXA 4UIKL 5ERWA 4XHQA 5D1QD 5JR1H 3QQ9C 3IKCA 2IH1A 3RJQB 1QVOB 1X4XA 4P4KB 5FECB 4HWZA 4KKBD 2DYPA 5IMLB 3MCKA 2VLRA 2Q87A 4X6DA 3PL6A 3MXVL 1NGQH 2X1OA 1E4WH 1KB9J 1HK6A 1KTDB 1AGDA 4LF3B 1T2QL 2DQIL 1RMFL 5GGQH 3MNVA 3D69A 2P24A 35C8L 2UZYB 4NQVA 1QO3A 4PJIE 3ULUC 3H6JA 4J4PC 4TULL 3TCLB 3ECBB 3F6IA 3V6OE 1IGTA 4K7PL 1EBAA 2B1HL 3TT3L 2HFEA 4F8QA 5TDOB 4V2BA 1DQLH 1T5XB 3L3IA 2D0HA 1I7ZB 3VXSE 2WBJB 4PGZA 4MJIA 1MFNA 5AYUL 2P5ED 4M4PA 3VFTB 4HIJB 4CKVX 4P49A 1BFOA 4I18B 2BSED 1S7VB 2ADJB 5EO0A 4EUPB 5GJTH 3TLRA 1NFDF 4JANB 4V1DD 3QEHA 5AWNH 3B43A 3O2DL 1CE6B 4HH9B 4MSWB 4E0RB 3MC0A 2LTQB 1VFMA 2AXFB 3ZKMD 3E8UL 4WV1A 3VG9B 4IRJA 3QO1A 4LKXB 3B9KC 2GCYB 5KOVC 2OR9L 2VSDA 2XWJA 4DUVA 4KI5F 4ZFGL 1XF5B 1MCOH 1OTUC 3H9SD 4G8EB 5BV7C 2FR4A 4YK4C 3MA7B 4F3FB 1S9WB 3OXSA 2VL4A 1AGEA 4ZOEA 3WFHB 4G8GE 1IGYB 1BBDH 2WINB 5EOCH 5SWSB 5EOQL 4L9LC 2VLJB 3GSNL 2RQ8A 4LAQL 1D9KC 5GHWH 4H0GA 4UBDD 4AYFA 2DQFA 4OZIB 3N06B 5JDJA 3W9EA 3FT2B 1U8PA 4K7FA 5D6DA 3CFBB 4PP2A 3RDTC 4Y16C 3EIFA 2SEBA 1VFAB 4JDZB 2X4OB 3D2UB 2HT2C 4YZFF 5GGTA 4X99A 1V7NL 3TZVD 2AERT 2CLVA 4MA1B 1ZWIB 2HJLA 1U8LA 3ZE1F 3HLAA 4OFKA 2IBZX 2JTDA 1AHWB 4CAGA 1H3PH 2FIRT 2E27L 3ARGA 4PGDB 3CZFA 1ACYL 1F4XL 3F62A 1G9MC 5CUSH 4NM8H 5DHVH 4BZ2L 1CICC 5C8JA 3S37X 4UTAL 1UC6A 3A6BH 4WHTB 1KCRH 2Q6WB 5DJYA 3HCVA 4BK5A 5FCUL 4L3EE 1I4FB 4PRDB 3X14A 1QKZL 4KRPD 3QXDB 3AAZB 1XGQA 3QEGH 4K8RC 2IGFH 3QJFA 2VB5A 4MYWB 2BNRA 1AGBB 4WFHD 4HBCL 3BKMH 1JHLL 1W72B 4WW2C 5L0QC 4MD4B 4XMKH 3CVHH 2VR4A 3EOAB 3LN5A 5KSBB 4PP1D 3NBNA 4PJCE 4P4RB 1NGYB 3QIWC 4G6JH 4MXQC 3SJVD 1Q9LA 2VLKA 1IGJB 3ZMRA 5F1SA 1NAML 1I9EA 3QDAA 3GO1H 5ANME 1JGLH 4TUKL 3VD4A 2OSLA 4XVTH 4KTYA 1DVFA 5D1XD 1S7RB 4QHNB 4B53A 4YHYB 4PJFB 3WYRA 1DUYB 3TN0C 5DUML 4PJGF 4KPHH 3O81A 1I3GL 3SDDB 5DJCB 2H32H 4HHAB 4NQCB 1KELH 3QDJA 3BDYH 2P5WE 5C0JA 4NZDA 1KIPB 4JHWH 4TN9A 2HP4A 2E5EA 1JHKH 4XPFL 1JGVL 1FNFA 4NKOA 2DI7A 4W6YB 3V52L 5K9JL 3TO4C 3HI6H 2QTEA 4NKMB 3E2HB 4JFOA 1B0GB 2G5BB 3RA7H 2K7QA 4M9OA 3DXAB 5F7FA 1WT5C 5DRNB 3SOBH 3IU3A 1FYHB 4OIBA 3IDMA 3PHSA 4G6FB 5FM5M 3VG0L 3ZO0A 1U8HB 3CFDA 4JZNA 5CILH 3IRZA 4U1GC 4MVBC 5DD1L 3L5XL 5EWIL 3WO4C 4F7MA 3WD5H 2R0ZL 2YEZA 5T5FL 4ZAKB 5GGVY 3R8BB 2ARJQ 4HCRA 4KJYB 5HVFB 4PJXB 1LQSR 1WSST 1VADB 2IANB 1K4CA 4MLIA 3VU2A 3DV6B 4I3RL 4YXKL 4JFDA 3SQBA 1LDPL 1MFCH 4BJLA 3RWHA 3O6ML 1AR1D 1OP9A 4WI8A 1D5BB 1O7VA 4PB9L 1T5WB 1FC2D 1RUML 3QPXL 4NN7C 1M05A 4LU5H 1OTTD 5JW4R 1JZ4A 3NN8B 2VRAA 4HJJH 4JLRA 3IFLH 4YDIH 4S1DD 2ZWLT 4ERSL 3MLZL 1MIML 4CADB 4DZ8A 4BH8A 1Q72L 2GFBA 3GMNB 5D7JD 2NMSA 5AG9A 4QXUL 1WTGT 1YEEH 1WUNT 3GI9L 3O3EB 4NQUA 2VXUL 4ODVH 4JZJC 1ZANH 2FZ3B 3FQWB 5ILTH 1C1EH 2D2OA 5J3HC 1IAKB 5I8CA 5LAXB 3EYSH 3V0AC 4DCQB 5L9DH 5TF1L 3MACH 2AJVL 2B1AL 4NJ9L 4ZFOB 3E3QE 1G7LB 4OCYL 4GXVL 2FJGA 2F53A 4PS4L 1NMAL 1DLFH 4LNVA 4U33A 4RNRB 5HYJA 4R4NC 4NPYA 2R23B 1UYWH 4H1LH 1U95A 1D7FA 3IF1B 4FQXB 5DEFB 4O02L 3AREA 2G75A 1U91B 1UKQA 2H2PC 4WI2A 1QSEA 1KLGA 2DKSA 2Q3ZA 5IVZB 5E94B 4HFWA 4P2QE 1LEKB 5SV4A 2CR6A 4LOUC 3C60C 4D0BB 3VFUB 3VFMB 2HT3D 3L6FA 4PGBB 5ISZD 4RAVA 5DRZB 1T22B 4LPYA 3MNZB 3FL7A 4R6UA 4JY5L 1A7NL 3UPRA 2APBA 5GRUL 1FDLL 4POZD 5ESQB 1OAXH 1Q0XL 1GAFH 1DTUA 4HS8L 1RUKH 2W65B 3FT3A 3O41B 3S7GA 4YEEA 4YGVA 2G2RB 2FGWH 3CAFA 5HDQH 5DWUL 3V6ZA 1HNFA 1F2QA 3ZTNL 3RNKA 4QOKD 3HZMB 3MV9D 1JK8A 1FG2B 3U6RB 3MODH 1T66C 2QQKH 4HV8A 4CBPA 2X7LB 3E0GA 3BX7C 4F57H 5FYJL 2HJKB 5EH1A 2W07A 5GSVB 4BZYA 5JR1L 1BM3H 5IKCB 1YYLH 1UWXH 1XF4A 4L9DA 5IBLD 2ITDB 4ISVB 1JF5A 2HLAB 3STBA 1NGQL 4EQ2A 2ZZUT 1BWWA 1P4IH 1RU9H 4C4KO 1CDBA 4PJAF 4KROB 4N0FA 1FZKA 5HHVH 1AD9B 2NQCA 5DMKA 4J8RA 3D0LA 1I9JH 4Z7VF 2PO6B 3MGTA 1FRGH 4HGWA 2F8OA 5GS1C 4NZRH 3UEZA 3MJ7B 5EIIB 3OXRA 3QUKA 4IDLA 3AM8C 4WO4C 1BD2B 3IJHA 2XICA 5ADPH 2JELH 3ARDC 3NIGF 1X5JA 2Z0BA 1S9XB 4WHCA 3WLBA 1U3HC 2E9IA 4IMLA 3T3ME 1IEBA 4U1IA 2H41A 4P23A 4X9IA 4EI5C 4S0TD 1DQLL 1MJUL 3MRBA 5CWSB 3V4UH 4XNMA 1CGVA 1D5XA 1QSFD 5D71H 3KDMB 4J3WA 2VUYA 3WFCH 1K2DB 2GSIA 1PFCA 1YY9D 3O45B 4ZNEE 5GJTL 5I1AB 2LVEA 2XFXA 4J12A 4U1NB 5AWNL 1FFOA 5FA4A 4KVCH 2A73B 5K9OA 1RZJC 3MV8A 4I48B 1JTTA 3KPSE 4GUPA 3P4MA 3J8F7 1EK3A 1MQ8A 3NCMA 3EDFA 1IAOB 3IDYC 3RWGB 5KSVB 3NGBB 2V7HA 4M9PA 5IOPA 2WLYA 4O2CA 4WUUA 3M17A 1D6EB 1QFHA 5TDNA 2H6PB 3QIUD 1IZJA 2IH3A 2ARWA 2E7BA 1R3KB 3P73B 1BBDL 4GKSA 5EOCL 4QWWD 3KPSD 3QUMH 2QR0A 3C6LA 4ONFH 3U2SB 1UEYA 2GTWA 5EZJB 3BPNC 5GHWL 1D5MA 2FX7L 1J0JA 4X6EA 5DDHA 1RFDH 3J7HA 4JY4B 3F12A 1T89C 3UTZA 3W39B 1SJEA 5FM5O 5HHNB 4EVNA 5HSFA 3T77B 1PJ9A 2Q86B 5HD8C 1U8MA 3ARXA 4MB3A 5DUPH 2CIKB 2R2BB 2FB4H 4Y19B 1NLBL 2HLFC 2QSQA 2VLLA 4NM8L 3U0PB 1XR8A 3A6BL 1KCRL 4APQA 1NAKL 4R97B 4I0PD 3Q0HA 3BO8B 3SHSA 3SKJH 1L0QA 1E27B 1B88A 1OB1A 3QEGL 4KRLB 1QYGH 2IGFL 5EOCJ 3HR6A 2PYFA 3OGCA 1ZHKB 3BKML 4I8DA 5SWSE 3PGDB 4XI5D 4BSVB 3FQXB 3FTGA 3QJHB 2IAMC 5DZOA 3ARZA 3RHWK 1M7IA 2YD1A 2P8LB 1DQML 1S78C 2EDNA 3GSNB 4OZIE 4XMKL 3CVHL 4RBPH 5D96C 4OI7A 4PJ5E 3WNLA 3FN0L 1Z9OA 4G6JL 3S3PA 4WU7A 2XG4A 5CZVH 3DRTB 1J0IA 1A1MB 1LP9A 3GO1L 4F2MA 1JGLL 1I8KA 5KANI 4XVTL 2FCBA 4ZOBA 3QNXB 3UZVB 5JDSB 2JJUA 1J8KA 4PJ5D 4FQHA 4QXGH 4C58B 3IFPB 3D18B 4Y1AE 4JM2F 2OTUA 3LKPB 5DVLA 5IMMA 1OQOA 1ZTXH 2IJ0C 4KPHL 4WUKL 5ICXA 2XKNA 1UXWB 3PGCB 3O9WC 3RIAK 1KELL 4JRYB 2BRRH 3BDYL 4IOFC 1JP5A 4JHWL 4ZO6A 1JHKL 1V3KA 4EQ3A 5IHBA 5C09A 5JOEA 4ZPTB 1YQVH 4Y1AD 2X4UB 5D7KE 4JHBA 2ZP0T 4OBRA 3HI6L 3MRCA 3OAYH 3MRDB 4TRPH 2OXGA 3U0WL 4JAMB 3RA7L 3BWAA 3C2SA 1S5IH 4Q9CA 3BGFB 3S9DB 3SOBL 3O3DB 4GRWH 5LQBH 3TBYA 2P4AB 2P42B 3GMMB 5CGYC 2YBRB 1MCQA 3MRIA 1FSKB 2W92A 5DVKA 3QDGD 3QFJD 2V2TA 3V0WH 4HUWB 1NAMB 3IKKA 5L2KB 4UNTA 3WD5L 3LKNA 4HUXA 5IFAH 2X89D 5JHLH 4XXDB 5HVWA 1FZJB 4PJFE 3QA3B 1I85A 2F54B 1IJ9A 5D2LA 5JHDD 3ZL4H 4PJ9D 2YD9A 5H35B 4JY6B 1MFCL 2XIDA 1U8OA 2KUTA 1D5IH 5I1DB 1BVKA 5DS8A 1BIIB 2HVJA 5CBAB 4RWYH 5F72S 1BOYA 4NQCE 3QXVA 3GIZH 1F58H 1PQZB 5SV3A 5TE4H 3HNVH 1HHGA 3QAZB 4QRSB 5D2NB 1RZGA 3M45A 3KYNA 3CZJA 4LU5L 1CLOH 2XYCA 4M8VA 4JKMA 1J1PH 1G1CA 1SYSB 4X7TB 2VAAA 1I3RB 4HJJL 4PRIB 3CFKA 4KI1A 3EYQC 3IFLL 5CEZE 4YDIL 5IMKA 4Y4HB 2KL6A 2ZSVB 4JFED 3DXAE 4AG4H 4RDQG 3MRMA 3L7FB 4OGXH 4M62H 2BVOA 4JKKA 1YEEL 3C08H 4ODVL 1QACA 2BNQB 3FONB 5ILTL 5B3JE 5CEZD 1C1EL 1NC2B 5F21B 3ARRA 3EYSL 2C1OB 3O4OB 5L9DL 3T0EE 3MACL 2XA3A 3VFRA 3DROA 2ADIB 1KCVH 4QRPE 4OCXH 3CSYB 1DLFL 2J1KA 4P5TC 1Q9WA 3LQZA 3VFGH 4EN3A 2R1XA 2VO5A 4PJXE 1UYWL 1FIGH 2IANE 4MX7A 3RKPA 2ZUXA 3W11D 4NUJA 5FGSA 4HZLA 5D1ZB 1CIDA 1KJMA 3O4LD 4D0CA 3QUZA 1E28A 5IVXE 1BLNB 4QRPD 5EZOH 1YEJH 3BP7A 2ZNXA 5HYSB 1JZ5A 1MCNA 2YPKB 2EXYD 1XH3A 2GTZB 3AS0A 3GMRB 5DQDH 4ZFFB 4GO6B 2F8VA 4C56A 1VFBB 2HRLA 2V6HA 3KPMB 4HC1A 4JKPH 1OAXL 4LVNB 5EZLA 3BKJH 4X7CC 5ID0A 1RUKL 4L8BB 4HUUB 5F9JA 2NY5C 5HDQL 2ERJC 2LU3A 1PEWA 4BQ6A 5MENA 4OD2B 3IDGA 4GXUN 4GBXA 3DMMB 1J87A 3MODL 4DZBA 4OQTH 5DJAA 4PREB 4F57L 1LMKA 4XH2A 5D7LB 3DHJA 5I16B 1BM3L 4ZUVB 4LSVH 1U42A 1YYLL 2GK2A 2VOTA 2XV6B 5IHUH 3HPLA 1A7PH 1BZ9A 3H9SB 1WAAA 3FB6B 4X6CA 5I73C 3S4SG 2W0FA 3SQOH 2MKLC 2L7UA 1CDJA 2R0KH 1P4IL 4JDVB 3LN4A 4LEXH 3ME0A 1RU9L 4O51A 1JTPA 5JXEA 2BVUA 1H3GA 1VEMA 5HHVL 5FGBC 3V5HA 2UUDH 5A3ID 1I9JL 1G9NH 1FRGL 3QPQC 1AC6A 1OWWA 2R4SH 3KLHD 2Y6SD 3KJ6H 4FHBD 1T21B 1CLYH 2JELL 1DSFL 3D48R 2EDFA 3RGVD 4FFYL 5F93C 5FO7B 4PBWD 5DUBA 1ES0B 1WWAX 2EYTB 1ZHLB 4RMTA 1D6VH 1SYVB 2HYMA 4N9GA 4WIQA 3TIDB 3EGSB 4PGEB 3SGEH 4ZUSA 3MRKA 4HJGB 4LCCA 4LPCA 3V4UL 5D71L 1ZVSB 2A9MH 2EO9A 3WFCL 5J4MA 3OB0K 1ORSA 4JJ5A 4QRRA 3JTSA 1FO0A 2AKRB 4JR9H 5TQ2H 1H8NA 3HE6A 1Q0YH 3MYJA 5A2LH 5I1CH 2CDFA 1HH9B 3GNMH 3QBTB 1WWBX 2FEEL 3DO7B 3ARBD 3Q6FA 4MCZB 3H7BA 3SE4A 5AUMB 4PJDA 4X5WB 4JRXE 3G6JB 3LIZH 1RJZA 1QBMH 2HFFB 4HUNB 4UINH 5HGAB 4BH7B 1WWCA 3BYYA 4YFLI 1IQDA 2X40A 1G7PA 2JK5B 2BMKB 1UWXK 4NSKA 1XGUB 3SDCA 1T83C 1CGWA 1S7QB 3TBVB 4KKLD 5CZXD 3U0TA 4NZUH 1WFNA 3QUML 2GHWB 3KPNA 4ONFL 2R4RL 4BQCA 2ED9A 4PJBA 4ODUB 1LNUB 2QQLH 1MCCA 5F6HJ 4J6RH 2DWEA 1EERB 4MAYD 4OLYH 2FBJH 1RFDL 2AI0H 1JTOA 4WNQB 3OB8A 3O11B 2NTSP 1A6ZB 3DX9B 4OKVB 1I9IL 3O8XA 4OF3A 1OHQA 2OJZH 4C57C 1T2JA 2YPLB 5EBLB 4L8CA 4AT6A 5DUPL 4DVRH 4FQLH 2HTLC 5BVJB 2FB4L 2JJWA 1IAMA 4PJ8D 5GIRA 3JWOC 1AD0B 3TBSA 5E9DA 4UAOB 4PRHE 4C83B 5I0ZA 3DVIA 1T20A 3G5VA 5D93B 3QIBB 1RJYB 4RGND 4LL9A 4M7LH 1DDHA 4XAWH 2LV4A 4RFOH 1KCUH 1QOKA 2PW2B 3SKJL 1TDQA 4KKNA 3BRGC 3VWJA 1QYGL 2V5YA 1FJ1B 3RWFA 3VXOA 4CU6A 3FN3A 5ERWB 4AEIH 4PRHD 4K94H 3DNKA 3QEUB 1Z0NA 1KG0B 4JFHE 2YRPA 3S3JA 5KVFH 1LO5A 5JO5B 3NFSL 4ZUWB 3MCKB 2H2SC 4X6DB 5ALBH 2DQEH 4FXKA 3CFJA 4ZSOB 3TVMD 3OTTA 5CZVL 3WXWH 4JFHD 5E5UB 2FGZA 1KTKE 4MB5A 4HKJA 3VFSA 3SDAC 2GAZA 1GC1H 4UUJA 4QXGL 1X7QB 3ZTJH 4PJ7B 3F5WB 4HG4K 3N1FC 1ZTXL 5DEGA 5DURB 4H25B 1P5VA 3DVNB 4TSAH 3OGOE 4BKLB 2BRRL 5J12C 5DHVB 3CFCH 3BN9D 1U3JA 2OQJA 3I6KB 2HJFA 2GK0A 1KPVA 2B0SH 3L7EB 1AJ7H 3MFFA 4MQ7B 4PJCF 43C9B 5BCAA 5CGTA 4TRPL 3LDBC 4GW4A 1BFOB 5FGCE 3BJLA 1ODAA 1S5IL 2ZUWA 1K9TA 3ARFC 3BPOB 1KIRA 3ARSA 4I3SH 5E24E 3QEHB 5LQBL 2VWEE 4R7NB 4ACPA 2A9NH 4OF6A 1YEHH 5HHXH 3CVHB 4WV1B 2JIXD 4P2RA 1JHTB 1JWUA 1CXIA 2XWJB 3V0WL 4TUJA 2VR9A 4AEHH 4DOHB 1YEKH 5F8QC 2W9DH 3IDNA 5JHLL 3MUY1 4F9PC 5MERA 5ADOH 4RBPK 3ZL4L 1IM9D 4EUPG 1NEZB 4C59B 4NQTA 3SDXB 4MCYA 3PJSA 1D5IL 2E8YA 1H5BA 4PYGA 3QHFH 4E41E 4I0KA 4YDLB 5TE4L 3GIZL 1F58L 4JRYE 5T33H 4HAFA