1RURL

Crystal structure (i) of native diels-alder antibody 13g5 fab at ph 8.0 with a data set collected at ssrl beamline 9-1.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
b'DIVLTQAAFSNPVTLGASASISCRSSKSLLNSNGIIHMYWYLQKPGQSPQLLIYQMSKLASGAPDRFSGSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDTKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin 13G5, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rurL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rurL01
4OIIH 3QG7H 4JEGB 3SGKC 1LWRA 4L29B 1D5BB 1G6RH 4HQQL 1NFIB 4OZGE 4ZD3L 3BYYA 2YEZA 2VQ1B 5DK0B 5ECJE 2X1PA 2A6KB 4Y2DC 4S11A 3VFOB 5E2VL 2FL5B 4TRPL 1MREH 1U8JB 3ARED 4PJ8D 4OAWA 4FQHB 3PV6B 3I02A 4P4KA 3IU3A 1KTKE 2PETA 4ODHH 3MRQA 1CTOA 4Z7OF 5I9QC 3PNWB 1KGCD 1HK6A 4UNVA 4F15B 1CICD 1I3GH 5H37H 2YMXH 2GI7A 4BSVB 3VFNA 5E2UL 4XCYB 4MQXC 2PO6B 2BDNH 2DTMH 1U8KA 3RKDC 1BOGA 1JL8A 3NCYP 2RR3A 5T3ZL 2ITDB 4U2YA 4MD4A 2E7HA 2HMID 1HXMA 1EO8H 1HIMH 1NCNA 1U8NB 2R2BB 5I73B 4R7DA 3DUSB 3DO7A 4Y16D 3ZKXC 2AV1B 1R6VA 1X5LA 1TENA 4WWID 3CVHH 5DLML 1RAMA 5CEYB 2AXFB 5HGAB 5H8DA 4IRSA 3MGTB 3L7EA 5C09E 3QEHB 4W6YB 5I17A 4QRQB 1EPFA 3QZWA 2AP2A 3GMPB 3BH8A 4NRXA 4PJXF 5CSZB 1QBML 4MSWB 2DLEA 3DX6B 4MB3A 4Z18A 5EU6A 3R0NA 1LE9B 1NGXB 4MCYA 4PRIB 4HZAA 4L8SB 1FNFA 4OFIA 4MCZA 1V8HA 5FO9B 1R0AH 2R39A 1JI1A 2IFGA 4PJ5E 3DBXB 1HQ4B 3CK0L 4OM1H 2C7UB 4NT6B 1INEL 4XBEH 1IAOA 3EYUH 5DD3H 3D25A 3M1BB 3X3FH 3LPWA 4LRIC 1G6RA 3LD8C 4E41A 3ECBB 4UDUB 4Q0XL 4TVSa 4KJWC 4AIZB 4BFBD 3RDTD 2VLJB 2C3VA 4K3JH 1AD0B 2R2HA 3HRZA 2UYLA 4DCQB 1IARB 3FO2A 1SM3L 5C07E 4AG4H 2A73A 4QRPA 4S1DC 5DQJB 3VRLF 3T0EB 3B9KD 4XMKL 3WSQH 4BZ1H 1UCBH 4O2EB 3MPCA 1HKFA 4JN1H 4HK3J 3LS5H 3ET9F 3ARGB 3OJVC 1KYOJ 4KUZH 4NQCA 3OB8A 4J8RB 5IFJB 1IAII 1IL1A 2BMKA 2W1NA 4MAYB 1AD9B 1FZJA 1KCUH 4H26A 4HIJB 4FHBD 4KHTL 4KU1A 5L9DH 3PXJA 3H9ZA 3QDAA 2NZ9D 3Q1SH 1M6OA 4YHOL 5J1AB 1J1OL 4BSJA 1NFDB 3BDYH 1YUHA 3L3HA 4NZTL 1TCMA 4Z7UE 4EKXA 5GIRA 2NNAA 1M7IB 1X7QA 2EE3A 4WUUD 1ND0A 1IEHA 1A4JA 3G6DL 3IS1X 4Y2DB 5J9PB 5DJ2A 1HQRB 4PUBL 4KQ4L 3R8BB 3P40A 5KS9F 1KNOB 2VXTH 4NQDA 4CUCA 3P4OB 4G3YL 4HG4J 4LCYB 4TVPH 2VLKE 3CVHA 1ED3A 3FB6A 5I9QB 3PP3H 2E9WA 3MUHL 1HKLH 2O5YH 2JB5L 1MCPL 5T5FL 1R3KA 4A6YH 2X4UA 1BAFL 3P9MB 5ANMA 3TO4D 2CUIA 3LKNB 1R3HA 4HXAL 5C71A 1MLCA 2G5BA 1LE5A 4HBCL 5EPMB 3T65B 1NEUA 3HFML 2FR4B 1J05B 5EC1B 3OJDA 2R1YA 3VGEA 1RUAH 2CRZA 5IQ7L 1INQA 1ZVSA 5IVZB 3KXFD 1ZGLP 1DE4A 1V7NL 2UWEB 3U0PA 2YD8A 2G60H 3ULSA 1I7TB 3W0WD 2J8UF 43C9B 2CGRL 1J8HE 4GMTH 4ZFGH 3ULUD 3SE3A 2OZ4L 4LLWA 1LO3H 4P3CH 3GEWB 5K59F 4WHCA 3JV5A 3IGAA 1OF2B 3GSRB 1JPFA 3BSZH 3MA7B 4MA3A 5CJ5A 5IF0B 1UWXK 2CK2A 3IRPX 1D5MB 4FQ2L 3WS6C 1FL5B 4CU8A 3K4ZA 3MODH 5C6WH 4LHQB 4XPGL 2HKFH 3NCCB 1DANT 1P6FA 5HD8D 4M1CD 2V17L 2EECA 5ACZA 3SOBL 4ONFH 1TQBB 3QUYD 3E3QE 4PRAA 4TSAH 2FJGA 1CG9B 4LSTL 4NHCH 4V1DE 5IG7B 4PBWD 1DBJH 3BH9A 4L9DA 1EXUB 2JJSC 4QTHB 2NY7L 2HN7B 2SEBB 5HGHA 1QACA 4LCCC 4QHUB 1RVFL 2EDKA 4G6KH 3D48R 1JGUH 3WKNA 4ZO7A 4JHAH 4QHNA 3SO3B 1QP1A 2IWGA 3BN9C 1IBGH 4EOWL 5F3BB 1ZT1B 4APQC 5I0DA 2X1OA 2YD9A 5ERWA 2VDQL 4JAMB 4PRPD 5E03A 2XN9D 4AEIH 4FQCL 5D7LB 1BEYL 5K9OA 4A6YA 3RGVD 4PJCA 3K8KA 1Y6KR 4TOYL 1CFSA 1U41A 3TA3C 3D69A 3O3EB 4D0CB 2CH8A 1PG7X 2QSVA 2DIJA 4GBXD 5D7JA 4M9PA 5L0QC 3N1PC 1CR9H 1PKQB 3CXDH 4L3ED 3CFBA 2ZPKH 5IB5A 2A6DA 1P1ZB 4I3SH 5SX5K 4K94L 3ZE0F 4LIQL 4G5ZH 1KBGH 5AUMB 3C5ZA 3CSBA 1AXTL 1AC0A 4M1GL 3GO1L 4FZ8H 1MVFA 3DYPA 1EX0A 3HMWL 2X4NB 4XCFH 5D93C 4OLYH 3WEXB 5MENA 3OF6A 4Y5VB 1NLDH 5DEGA 3BW9A 3TYGL 2JK5A 4LCUB 4YDJA 1BD2B 3KLAA 1OW0A 4LEXL 5GS0H 4IRJC 4R4ND 3JV0A 1DQJB 3BD4A 3C5SA 5DHYA 1B2WL 2Y72A 3UROR 3DHMA 1MHPH 1UACH 4PB9H 1MPAH 3CVIL 2CR6A 2YPLE 1OP9A 4H1LH 1CZ8H 4Z7WF 2XQYK 4BFIB 2V7NB 3BQUB 1EVUA 1FNAA 2W60A 2BC4A 1B0RA 4BSWB 1A6ZA 4YQXL 4ZODA 4XPHL 1VPOH 4JFQA 2YBRB 1N5AB 3MRDA 1RK0A 1I1CA 5HHXH 2WBWB 3UYRL 3KHOA 2MCPH 4KHXH 2YD5A 4WFHE 3D9AH 1I1AD 3UTQB 1RZIB 5DJZB 2FEEL 4BK4A 5A40E 1A6UL 4P2OB 5T5NG 1EEYA 4N8CL 1ZT4B 4FQQA 4G9DA 4CMHC 2AXGA 4U1NB 2D7TL 5DEFB 5EU5B 2GUOB 4F37F 3AS3A 2CKBH 3LB6C 3ROLB 3F7PC 4YDKH 1T2JA 2OLDA 1KYOK 1IVLA 1NAKH 3G6JB 5B3JE 3PJSA 4RMUA 1MCQA 2X4OB 4YXHH 4PV9A 1RMFH 5BO1L 1TTGA 4NC1E 2BSTA 2HJKB 3QEQB 2BERA 4X5LA 1L9NA 2R69H 3QNYA 3VFMB 5FOBA 2AJUL 4RMWA 1HH9A 2ICWA 1JNJA 1E4JA 4JPIB 3MLRH 4HG4K 1OY3B 2IPKB 4FFZL 1KGCE 2J88L 3WJLC 4AM0B 1L7IH 4WEBL 1IGJA 2VE6A 1AIFA 2ZJSL 3IDUA 4MJID 3DVNB 1N5YL 2JB6B 1NMAH 4NBXB 4NNYA 4JZNA 1LK3L 4JREB 4HKBA 5INCA 5DYOB 1A8JH 1KXTB 3BZDA 1AY1L 5BOPA 1D9KB 2D9CA 2I60L 2J4WL 4H1LA 1LO0L 4WFEE 1KIPB 4ERSH 4KDTA 2V5RA 1RJZA 4N9GB 4XTRC 3MLXL 3FT4A 2F19L 4LU5L 1OLLA 3MRFB 1PFCA 2PXYB 4XNXH 4WW2C 2Y23A 4UUJB 5EO1A 4F7CB 1CWVA 3WNLA 2NX5B 2DBJA 3U83A 1WFTA 3QULB 4YUEL 3D39D 5D93B 4QT5A 2B1HL 4YHKL 4PJ9D 1YPZA 4UV7L 4JY4B 1BIIA 3X11B 1AI1H 5C3TA 5TDNB 3TH4T 3SKOA 1RI8A 3GSVA 3IDIA 1S7XA 2CLRB 4G8GB 5HVHB 5T1KD 3QUXC 5CAYB 3FN9A 3MNZB 4U3XA 1FG2A 2HT4C 3E6HB 1ORQB 1TXKA 3F7YB 5C0BD 5E0QA 4EJ1C 4M7ZC 4ORGA 2CKBA 3OKNA 3V0VA 4PP1C 32C2B 3G5XA 2YUWA 3T2QA 3VGDA 4JJHA 3W5MA 5CEZD 1BZ7A 4ZPVA 3RWEA 4S0SD 1QLEH 3PUCA 4LKCA 2NY4C 3MV9A 5HYJE 1UEMA 4UT6H 4HZLA 3MRGA 3UAJC 4Z0BL 2PTVA 1S7SB 5LAXB 1EEZB 2N56A 3JWDH 3P4NB 3GI8H 1MELA 2HFTA 5FK9A 5ICXA 5E6ID 3O2DL 3S5LG 4GAYA 2DYPA 5DMIH 3V6OE 1CICC 4Z5RB 3ULVF 1J11A 1CDCA 4P2RA 1HCFX 1MI5B 4L8BA 4ZO6A 4B41A 4I5BA 5ILTH 4OGXH 4X9GA 4BK5A 1FL6A 2KDGA 5DWUL 1ERNA 4PGEA 1HHHA 3KDMA 3WNNA 1FYTA 4ZS6D 1AP2A 1HEZB 2CXKA 3CNKA 1MFAH 5FUCE 3AS2A 2VQTA 5JA9A 1Z5LA 3KVQA 3EJYC 1UXWB 1G7PB 4Y16C 4CU6A 2FIRT 3RWIA 1MCEA 4JQXC 3VG0L 1RJLB 3VXSD 3L1OL 4ZYKB 3P9LA 1VENA 3S3JA 2AABH 4FQXB 2RIKA 4WUUE 4XCEA 4C56A 1ZGLM 1MCOH 3OX8B 3AU1B 1JYWA 1C5BL 3IJHA 4HKXA 2Z92B 4IOFC 4NQED 3VFPB 5LQBL 2YD6A 2OR9L 5BZWA 4GJTB 3PHOA 4X6DB 3FQXB 1FL3B 5SWZD 4OLZH 1I3RA 3CDYA 3SY0B 5JPMB 2FYYA 2CUMA 5C9KA 3B9VA 5E9DB 1FVDB 4S1QH 2YUZA 3GJEB 3FO1B 4NP4H 4JRXB 2GCYB 2HRPH 3FFCB 2A9NH 1A64A 4OLXL 4FFYH 4LPCA 2EKJA 3BWAA 3QRGL 1BOYA 1CFQB 4X7SL 2AV7B 3KXFE 4JO4L 2WINA 2IAMD 3QB7C 2X05A 1GAFH 4N0FA 1N59B 5DJXB 1WGOA 5C2BH 1S9XB 1ZLSL 3ULUE 1KCVL 1OGAD 3LKRB 3DI3B 3B9KC 1E28B 1M4KA 4TTDD 5D2NB 1K5NA 2DJSA 4HWEL 1IGCH 3TBVB 1IT9H 2O5ZL 4LASL 4MA8L 1A1MB 3MRMB 3ARBB 2A1WH 5CBEB 2MKLC 3QXVA 1WICA 3LCYA 2Y25A 2PW1A 5FUCC 2DRUA 1ZSDB 3QUXB 4P46A 3DJ9A 3ZL4H 5GRXG 3HE7D 4M7ZB 1KJVB 4F58L 1S9YB 2EIEA 2C1OB 3FAWA 4RMVA 1R24B 4MXVE 3VFTA 1F4YH 1JVKA 1U8PA 4NQDD 4R6UA 3VXTA 1RZJH 1T5WA 1U3JA 3BZ4A 2CDEB 2PW2B 3MNWB 1EGJH 1VGKA 2AEPH 3EO9H 4RAUA 2DQJL 2R0LL 2XZCH 5DJ8B 3H9SB 3IU4H 2XQBH 4NOBA 1KFAH 2UVEA 4MD5B 3U7AA 2JJTA 1XF4A 4LQFL 2H1PL 1CE1L 5CEXB 5ESVA 3JSSA 3TO4C 4PR5A 4KVNL 1U8QB 4QHLA 5L6YL 2YD2A 4DQOL 4L4JA 5MERB 3S88H 3O9WB 2VDRH 4PRPE 3WHE1 4LARH 1U91B 5IVXB 1I8IB 2FGWL 1FV1A 2XN9E 1MEXH 1R3IL 3B3IB 3UPCA 2Z35A 3RX7A 3PG2A 2GFBB 4P2QB 4WHDA 3PWPB 2RHEA 4POZD 4ELKB 3P2TA 4FFVC 1UB5A 2ERJC 4PLJD 4LOUD 3BRDA 1UADC 4M6NL 1TVBA 5DQ9A 4U1MB 4LLMA 2NY5H 1IQWH 4L3EE 1FE8H 1UEYA 3O2WL 5IB1B 3FO9B 1VERA 5FYLL 1A6WH 3IDJA 1A1NA 5FM5M 2EXWD 1OAKH 2DDQH 3P77A 2Z91B 3PWUA 4M43H 4CNIA 1SBSH 2R29H 2VXUH 3KJ6H 2D2OA 1QHPA 2VR9A 1FRGH 4PJEE 5DZOA 4JG0L 4P5MA 4X0KA 5FGBA 5TQ0L 3F7VA 4L4VB 5D6DC 4LNVA 5FIEA 1YMHB 5MI0B 1QA9B 5KSBE 3CPLA 3GM8A 5LXGH 4N1EA 4RFOH 3SDYH 4KKCC 3BEVA 1U92A 3L7FB 5C08A 1IC5L 5F88B 1WV7T 2DJ4A 4EIZC 4I2XE 4L1DA 2DQTH 1S7VA 5I1LA 2FEDC 3U30B 3VA2C 3C6LC 5A1AA 3AROA 2WW8A 3RTQA 1JZ3A 4MNQE 2BVUA 4K8RH 4N5ED 4D2NA 1EGJA 3EO0A 4M7JH 2ARJA 3QIUB 3WIIH 3MUZ1 4G8EB 2YD7A 3UBXA 3FHAA 4Z7QF 3N06B 4LCWA 5KVFH 1F4HA 2YN5A 3KWWB 4MJ6A 4NOFA 4Q9CA 1HINH 3O4OB 1SYVB 4O2CA 3X3GH 4U1LA 1IZJA 4K7PY 5DD0H 1W0WA 2XOTA 4QXGH 2VMFA 3PL6B 2E3VA 4EZMA 5B8CC 2H26A 2JCCB 1KLFA 1P4LA 5LVEA 1X5FA 5CUSH 5E5MA 3T04D 3VXMA 2G2RA 3LDBB 4GOSA 4KTEH 5D1ZD 5IHUL 1FNSL 4EVNB 3L3DA 3AXLA 3SCMA 5JIPA 3OGCA 5CBAA 2P5WA 3L9RA 4ZUUA 4M62L 4S1SL 4EDXB 4MJ2A 1WITA 2OMBA 4XPTH 1KJ3L 1UM4L 3MUJA 3S35L 1WFOA 1T66C 2N7AA 4M6OH 2IH1A 3FT3A 5ABDE 1JGLL 4WV1B 2D03H 2N1KA 4Z9KB 2FJHB 5D9SB 4YC2B 5IB2B 1A6AA 4UIKH 5GRVK 4HAFA 4IM8A 3RRQA 3EDEA 3HNTL 3ZO0A 3PWJB 4GKNA 3U7WL 5BV7B 4JJ5A 1VACA 2YOCA 4YE4H 4HX1B 2VTFA 4J4PC 3CH1B 4HJGA 2W65B 4O58L 1MCWW 1NMCC 4Y7MA 1MHEA 4M5YH 4MJIE 1P4BH 3QCTL 5D71L 2YXFA 5FECB 3VXRD 1DBMH 1OB1B 1MUJB 1FZOB 4MA7L 4PG2C 5ESQB 2XZAH 1E6OL 4Y5XA 1FG9C 1PEZA 3HG1A 5INDB 4V2BA 2OJZH 1QSFD 1FGVL 1YC7A 1G84A 3LRGA 1I1RA 4QGTA 2GJ6D 4NSKA 4QY8A 3V6FA 3RBSA 1JGDA 2I27N 1QSEB 5DJYB 3K2MC 3MA9H 4ZTPL 5TE7H 2EC9T 4NGHH 1TZIB 2LAGB 3QHZL 4Z8FH 3OXRB 4G6FD 3OWEA 5MEPB 4KK9D 4YDLC 2VDLH 3D39E 2CDGA 5JUEH 3GK8H 1EFXB 4LPYA 4FMKA 3TYFB 1BHGA 4QLRA 1V3KA 2QHRL 1AQDA 1WBZA 1WFUA 3EGSB 2VAAA 4KQ3H 3HNSH 5C0BE 4FFWD 4PYHA 3QDMA 1T4KB 3UTZA 4PRHB 1CGTA 1YYML 2NTSP 3D6GA 3QPQD 4XP5H 2ZSVA 4HKZB 1D6VH 1CK0L 1D5XA 1F3DH 3RGHA 5J06A 4GRLC 1WT5A 3C6LB 2ZZUT 2BNRB 4POUB 1NMBH 5HDQL 1JF1B 2JKXA 1VADA 5CZXD 2CJUH 3WE6A 4U1KB 3SJVD 1E6JH 4PY7A 3ULVD 4PJGB 1NUDA 1EEUA 3VFVA 3HCVA 4HLJA 4KTDL 4R3SB 3TN0B 1XF5A 3VRLE 2H8PB 1EHXA 1MVUB 2IADA 3LQAH 1FGNH 5T1LB 3BZFB 1CGXA 1HSAB 2R2EA 3B43A 1BFTA 4R96A 1FIGH 4P23A 5JOFA 4FOMA 5E99H 4GRWB 2KL6A 4O02L 4EBQL 3SKNA 4F2MA 4DGVH 5D6CB 3EFDH 4UINL 1RZFH 3B83A 5GRYA 1IFHH 2YC1B 5E8DL 3VXPA 4OFVA 5C6TH 5GZOC 5SWQA 5C3LD 1NBVH 5DMKB 1BVLA 1MRDH 1WF5A 5EB9A 5GS1A 3M17B 1ZWIB 4Y4KA 3JTTB 4QOKD 3RVWC 1JI2A 2MKWA 1R5WA 4X7DC 1AJ7L 4HGMA 4FXGA 3MSPA 5BRZB 1XR8B 5CIPH 1A2YA 3CX5K 1YJDC 2JF1A 5KS9E 2WUBH 5DRXA 4N68A 3HPJA 1OAXL 5EU6E 1CF8H 4AEHH 3VCLB 3DXAD 1GGYA 3HI1A 5IQ9A 4R2GB 1YECH 3C60B 4Q9QH 4AENB 4GG6A 3I9GL 3CFJB 2WAHA 5HYSB 1ONQA 1R5VB 1SHMA 2GAZA 3MRCB 3RX8A 2CO6B 2VLRA 5SWZE 3MV9D 4UQ2A 3HC3H 4OCLC 1CLCA 1JHLL 3O3BB 1Z0MA 4OUUB 3OAUL 3W5NA 4LLQA 4P4KC 4OZ4B 1CXEA 5F7EL 5T1DL 1GHFH 1RURL 1YNTB 4JO1L 2J8UE 4LF3B 2XG5A 4QRPE 2Q7YB 3DROA 2AVGA 3RVTD 3GMQA 2DLHA 5ID0B 4HT1L 5K59E 3B2UD 2WLYA 3H42L 5DRZB 1OGAE 2HH0H 3RNKA 3FFDA 2FX9H 4M7LT 3QDJD 4JFDB 1H5BB 1JPTH 3MLYL 1G7QA 5J13C 4E5XA 1JRHI 3OB0K 4PD4J 3D3VA 4YJZL 1OARL 4ETQB 2R4SL 2BSSA 3ARRA 4W6WB 1M7DB 3WNMA 1HYSD 1ZTXH 3CSYA 3U4BL 4E9LA 2WBJB 1S9VA 2Z31D 1OTSC 4QTIL 2H3NA 1IRAY 3LAFA 4IRSC 1QYGH 2L4OA 2OSLB 3IKCB 1NCWL 4HC1L 3RX5A 3GSXB 1T89A 2NR6D 2QSQA 5FB8A 1YMMA 2FWOB 1E27B 4NQDE 4PYGA 3RZCA 3HMXH 3MBXL 1QSZA 2LU3A 3O11A 4YAQB 4EUPH 2BNUA 3AM8A 2EYSB 2FX7L 3EYVB 4RQQB 1KG0A 3QUKB 5CIPA 5ANME 5FUOH 3RI5F 5IV2A 3OV6A 1WVZA 3NIDF 4OZFG 2AK4A 2Y07L 4OD1H 1MWAH 1E4XI 2D31A 4WY7H 3NCYS 4WHTB 3GSOA 3EFFA 1UWGL 2IMMA 4X80H 3C87A 5D72H 3RA7L 3BD3A 3TBSA 1SEBA 3E6FB 3V0AC 4M61A 2PCPB 3MROB 3MCLL 5EC2B 1XF3A 3ARSA 3O6LH 3UTTD 4PJDB 4HCRH 1XGYH 1DBKL 3WUWA 5K9JH 5ALBH 4ZTOH 4JO2L 1F11B 3I6GA 2CPCA 5F3HA 3IXTA 4TTDC 1LO2H 1SJHB 1UVQA 2Y06H 4ZFFA 2LABA 1MLBB 5TPWL 5ICYB 4ZFZB 1KEML 2VNCA 4LPWA 1WUNT 2W07A 1B6UA 4NO5A 2WV3A 1C08A 1WK0A 1SYSB 1ZK9A 2EDEA 2YEZB 4D9LL 1U3ZA 4N8VG 4I3RH 3S37X 3VFGH 2ZCHL 4J12A 1OPGH 1A14H 5JO5B 4Z7WE 1FFOA 2Q7NA 2XKUA 2DAVA 3BEWA 4OIAA 3GSNH 4OZHA 1DL7L 2OBGA 1HHIA 3O8XD 4NO3A 4KKBC 5TE4H 2F54B 3D2UA 5MP6L 4KKNA 5CZVH 4HWBH 1NEZB 3HMXA 5E8OA 1Q1JH 1XIWA 4TVPE 3QJFA 4UIMA 3H7BA 2C1PA 1T1XB 3QIWD 5E6ZA 5FYJL 1T7VA 4EUPA 3QFJB 5SV3A 5D1XA 5D7SL 3CJJA 3MJ8B 1NCCH 1ADQL 1A5FL 1DANU 3CH8A 4QXWA 1LMKA 3ZTJG 4ODVL 2F58H 3I50L 4AT6A 4ODWB 3DO7B 3SE3C 5CFHA 4ACPA 2O61A 4Z78B 4PLJC 1ZLUH 5GRZA 1P84K 4IRSB 4IOIA 2IPUK 4F9LA 4DUXA 2JIXB 3MV11 3ZSSA 3WN5B 4KTYA 2E7BA 3BH8B 4NRXB 4P0DA 4ZQKB 4PRDB 4L3CB 1ZLVH 1RK1B 5JIHA 3UPRA 3TBYA 3GIZH 3DYMA 1QFWL 4G9FB 1T3FA 4MCZB 2FH8A 1CXIA 2E9BA 2V2WB 3OG4B 4XAWL 5DUPH 4D3CH 3ZE2F 4RX4D 3CFCH 3BMVA 4X98A 2ICEA 1K2DA 2V2TA 4K71B 5HHMD 1I9JL 4ELMA 4NNXA 1MFBL 3P0YH 5ETUB 1XR9A 2HWZL 4G42A 4E41B 4NC0B 1MFEH 3VW3H 1CLYH 1DVFD 5F6HJ 4B5EA 4PJIB 2CLVA 2EDHA 2R2HB 4EIGB 3MFFA 3VXRE 2EXYC 2Y5TB 4OQ1A 4MNGE 1OAQL 4D0BA 1L7TH 2PYFA 4K23L 4MA1B 4N5EC 4ODSL 5BS0B 3HB3D 3GSNA 1MCIA 2EE6A 2IEPA 2VDOH 1QSFE 2P4AB 3BMWA 1SJEB 1V3MA 4CL7A 4JCMA 1ZXQA 1CL7I 1CDBA 1DQML 4DN3L 4HWBA 5D7JC 2ORBH 3GJFB 5EBGA 12E8L 2JELL 3GIVA 4DGYH 2WUCH 4UZGA 2I25N 4MXQC 1KELH 2V2XA 2XWTA 3JV6A 5DURD 1EUTA 4WO4A 5JQ6H 1X7QB 1KSRA 3C5ZC 4N8PA 1OCWL 4KJPC 3VJ6A 5I71C 1A4JB 1PLGL 5EOTB 3U0TB 1MF2L 5IMOA 3BPOC 2RCSL 5T3XH 4JCLA 4O2FA 1RIHL 2MSPA 4HHAA 1YJDL 3BN3B 1ED3B 3UYPA 5L88H 3VDAA 1HXYA 1M05A 1Q0YH 2X4UB 1X5JA 3FQUB 3WFBL 1P5UA 4ZNEA 3LH2H 1MLCB 4S10A 1AQKL 5E00A 2Q8BH 1LE5B 4MD0A 4Z7VB 2DIBA 2HTKD 3SJVE 3ULVE 1T0NB 3I6KA 3PDGA 3KPMA 1UM5H 1BM3L 3S9DB 2ADIA 1NC2A 1ZVSB 2A9MH 4K7PH 2ICCA 4XPBH 1DE4B 1HYRC 2AI0H 3U0PB 2XT1B 3GMOA 4U6XB 3ULSB 1AR2A 1CTNA 2QHLA 4G80B 4BZ2H 3PGFH 1Z3GH 4NJAL 3GGWB 3IT8D 3FOLB 3EIFA 1BQHG 2XI9A 4I3GA 4OZGB 1KTRL 3IETA 4WDIB 5I8CB 3P73B 3IFLH 4MA3B 4ZAKA 2MTPA 3ZDZF 1P69B 3EYSH 4WU5B 5IJVA 1S78C 2GJJA 3DX8A 5I66A 4E0RB 4QOKE 1FFPA 3A0OA 3P0VH 5JMOC 4XCCH 5BZDB 3ARDB 3Q6FB 4RFNB 3KPRA 3U79A 3MUGB 4JZJA 1GGIL 1KEGL 5D8JH 2XTJD 1NAMB 1VFUA 2OJEA 2V7HB 4JDTL 1I3VA 1T03L 3DXAE 2QADC 3AUVA 3BH9B 3QIBA 5DDHB 5DT1L 5F96L 4LAQH 1UM6H 2WNGA 1G9NC 4OGAD 3O4LD 1CGWA 5FO7B 3MV7D 3KGRA 4XHJD 4TNWK 5I15L 1T7ZA 2DQHL 3KPLB 4JFEA 2BFVL 3MV9E 4WENB 5FKPB 4RBPK 2IAND 1KF9B 2HJFB 4NQVA 3LKOB 5CJQL 5GGQH 43CAB 4HXBH 3IAPA 1Y0LA 4F7PA 1VFBA 3LPGA 3TBWA 1S5HB 3C8KA 4JR9L 4P2RE 5K9OB 1LEIB 4OIIL 1CFBA 5GS0C 4OZIF 3QG7L 5I1CH 1YDPB 4HWUA 2P8LA 1G6RL 1ZHLB 1MAMH 1IAKA 1FDLH 1MOEA 1FYTE 4D0DA 1LP9A 5J7CC 5C0NC 4G6AD 1MREL 4FZEH 2NZIA 5IB5B 5ISZA 4KDTC 4MMXC 4PJ5B 1P2CB 3T0WA 2M2DA 3T1FB 2BZDA 4ODHL 4F7EA 3C5ZB 4JM2A 3OKMB 4OLWH 3VWKB 1I3GL 4NHUB 2V6HA 4F7MA 4LPVA 5J0BA 3MJ7B 4JY6A 5MENB 3QNZA 1X5IA 2XV6B 5DEGB 3BW9B 2JK5B 2BDNL 3QXUA 2DTML 4YDJB 2OM5A 5T1MA 1C5CH 3RWFA 5DUBA 1PBYA 3KLAB 4DAGH 2MCG1 3LKPB 1AKJD 5C07B 4EXPX 1JUFB 2X7LA 5DUML 4FTVA 2ZSWA 1I3UA 3JUZA 2ENYA 3B8YA 2RFXB 3DO3A 1EO8L 2YA1A 4PV8B 3I2CH 2PYEB 2BOCB 4NO0A 3S4SA 3NFNB 4XBGB 3MXVH 5GISH 4EDWH 3W81A 1JMXA 4PGZA 3QQ4B 2NY2C 4WI8A 4CADA 3BT2H 3CVHL 3DETD 1R3LA 4U1JB 4XNMB 3DTXB 5I1JH 4OQTH 5IMKA 1RK0B 2CIIA 4NCC1 4JVUA 5JR1H 5DJDB 4MJ5B 4JKKA 2LVCA 5IP4A 4LBEA 1Q94A 1DN2A 4FN0A 2FSEA 3V8OA 4GKSA 4O5LL 4YFDB 1TQCC 3UTSB 3MRNB 4GXVH 2W38A 1EEYB 1G6VK 3UTTE 3GB7A 4CDHA 1XGPA 3FN0H 2EIZA 4KROD 4OM1L 4MS8D 4XBEL 5GRUH 3DGCR 1I7ZB 3EYUL 5DD3L 1V3JA 4HPYH 1NCAH 4WWKA 3X3FL 3KAAA 5D2LF 4NYLA 4MQSB 3Q2CA 5D7IA 1EV2E 3S36X 1QQDA 3IS0X 2QADB 2E7LA 1UCTA 3L3IA 4AG4L 2YPVH 3DMMD 5DI8B 1JPSH 1KIQA 5IFAH 4ZDHA 3WSQL 4BZ1L 2ICWB 1UCBL 3VMOA 3ALPA 4G6JH 5JHDA 3H3PH 2ZUWA 4P2CG 3TVMD 4JN1L 4JHWH 2MQ0A 3LS5L 1J8HB 3V79C 3BUYA 3HI5H 3MV8A 4U1SA 5B21A 1IGJB 3V8CA 1KCUL 4YXKH 1DFBH 4P5TA 3HPLB 3RAJL 4JN2A 5L9DL 3G5YA 1S7TA 2VYRE 4IIQC 3SDAD 4Y1AB 3FCTB 3RPIA 5EG6C 1QRND 5J56B 5D1QD 3SGJA 2VXTL 5HHOB 3OAYK 4Z77B 4TVPL 5E1AA 2BNQA 5K93A 4LEOA 4V1DB 1HKLL 2O5YL 2VL5B 3LKSB 4DFIA 4LVNC 2YKLH 1M7XA 1CT8A 4OQTA 4OLVH 1MJ7H 2V9TA 1H15A 4A6YL 3JWDC 5IR1B 1Z9SA 3T8XB 4GQPH 1X6NA 9CGTA 1LDPH 2AKRA 3S96A 5BW7A 3O6KL 3NAAH 1YPZB 1AE6H 4KZDL 1KXVC 1P4IH 1JN6A 1BLNA 3G5VA 3BJLA 3HUJF 4L8DA 4DKEH 3GSVB 3IDIB 5F1NA 1RUAL 2IQAB 3NIGE 4ZXBB 3MRKA 3VG9C 1OP3K 4QNPF 1IKNA 1AGBA 1RUKL 1LNUB 4GW4B 3OKNB 2HT3C 3RL2B 1VEOA 1SMOA 2G60L 4HK0B 2X4SA 5KSAD 1ROWA 4GMTL 1CGSH 4DFHA 4ZFGL 2QQKH 4ZPVB 4NFDA 4OV5A 1FN4A 1NQBA 4HUKB 4IHOA 3QA3A 3FQWA 3SKMA 1LO3L 4P3CL 5HHME 3SDXF 3T77A 4HZLB 2RJMA 5CS7A 1IAIH 4OBSA 5CP7B 3UJTL 2JJTC 4JDZB 5ICXB 4IDLA 1NSNH 3MODL 5H35A 2DYPB 2HKFL 5LBSH 1TZHA 1MRCH 5B22A 3U82B 5EU7E 4L8BB 3GHEH 4I5BB 2A83B 4L9LB 4ONFL 3TIEB 3BKYH 4PGDB 4F7TA 4Y4HB 3L3JB 4MZ3A 4PJAF 4TSAL 5IIEA 1HHHB 4NHCL 1D5BA 1DBJL 1AP2B 2UUDH 2EIBA 1OAUL 1A7PH 1F42A 1YEHH 1Z5LB 2YPKB 2ZUTA 2VQ1A 5DK0A 2A6KA 2BY0A 3VFOA 1XMWA 4CMMA 2FL5A 4KWUA 1U8JA 4Y19D 5HPMB 2P42B 4G6KL 1JGUL 4BUHA 2YPLB 2P5WE 5FKAA 1YZZA 4NUJA 4JHAL 5E8EA 4KRMB 1IBGL 2D7QA 2NXYB 2DMKA 3PNWA 1UXSB 2W91A 1JPGB 1KN2H 2EDBA 4XWOC 1TIUA 4AEIL 3CFDB 4BSVA 3TZVB 4XCYA 4XI5C 5FGRA 4PB0H 1KC5H 1U6AL 4U6HB 4ZUSA 4RMTA 3PHOB 5KSVA 4G43A 5FGBC 5FV2A 1RHHB 3V7MA 4JQIH 1ZHBA 5LJYH 4F8TA 1CR9L 1ZA3B 3CLEH 1G9NL 3CXDL 1U8NA 1GC1H 2ZPKL 2R2BA 3L5XH 3IFOB 3B2VH 3OR6B 4I3SL 3WHXA 2APXA 1JWUA 4G5ZL 1GZQB 1KBGL 2AV1A 2GT9B 4FZ8L 2PUQT 5SWSD 3I3DA 1MCJA 3RTQC 1KT2B 4PJ7E 1RZJC 1ODAA 5HGAA 3U46A 1HOCB 3QEHA 4YO0B 3MMEB 3HNVL 4XCFL 4QRQA 2ED9A 4OLYL 5IBUG 1NLDL 1IM9D 2EZ0C 3GMPA 1N3NA 5CSZA 1K5NB 2DM4A 5D5MF 4MSWA 5I8OL 4HFWB 5GS0L 3HB3C 1LE9A 4FNLH 1NGXA 1F5WA 1A1OA 4PRIA 1CD0A 2WSKA 3QAZC 2B0SL 4L8SA 5KW9H 1CDHA 5I75B 2EC8A 5FO9A 1MHPL 1UACL 4PB9L 3ESVF 1MPAL 4GFTB 3ZDXE 3AREB 3DBXA 1HQ4A 4PJ8B 3P9WB 2GITA 2YD4A 1CZ8L 2QLVB 2C7UA 3VGFA 3PE9A 4P46B 5DC4B 3SCMC 3MJ6A 5TFSH 3LHPH 1LDSA 4DN4H 1VPOL 1U8HB 4DOHB 2XTJE 3ECBA 5I1AA 1U8PB 5HHXL 5JXED 4AIZA 1T5WB 5CJXA 3BRGC 2VLJA 2MCPL 2J7LA 4KHXL 4DCQA 2NY5C 3O4LE 5DQJA 3ALXA 3MV7E 1BGXL 3T0EA 5HDBE 3BKJH 3MRBB 1NBYB 3M07A 4OF8A 1XF4B 4O2EA 4I48B 2IANE 2X6MA 3MLZH 1JZ6A 3ARGA 2EH7H 4PR5B 2CKBL 2B20A 5EIQA 4YDKL 4J8RA 5IFJA 1NAKL 4GW1B 4MAYA 1NBZB 3JWOC 1I8LA 3NN8A 2AXJA 5L2KD 4HIJA 3DSNA 4YXHL 1RMFL 2EC9U 5ITFA 3WO3B 3S98A 3HZKB 3DRQB 4XNYH 2R0ZH 1FO0H 4X7TA 3VH8G 1GIGH 4GUPB 5K33A 4YNYB 4Y5XC 1M7IA 2R69L 2VLLB 4X4YB 4OI7A 1UB5B 4NWUH 5J9PA 5FGCE 1HQRA 1L6XA 4GLRI 4LLMB 1QLFB 1KNOA 2FATH 3BGFB 5TE6L 3P4OA 2W9DH 3MGAA 4LCYA 4K3DH 2K7QA 3S97C 3MLRL 2AGJH 4K8RC 1KN4H 1OOAA 1L7IL 5TDPA 3LKNA 2LE9A 5F6IC 4XWGH 5IEHA 4J3VA 3CMOH 3GFUA 3JZ7A 2HKHH 2ICWJ 2FR4A 2QBWA 3MNVB 3RDTB 3F7VB 1BZQK 2P8MB 5F9OL 3VGBA 4N0UE 2I5YH 5B39G 1TJHH 4YDVB 4H25B 5IVZA 3KJ4B 4NKMB 3NIDE 2UWEA 1I7TA 43C9A 3L3KB 1G0YR 1TDQA 3IVKB 2QR0B 1WWCA 4XNXL 3S5LB 1WT5C 4OFKA 1OF2A 1L0XA 3GSRA 2VKXA 2DKSA 3T2PA 3T0VA 3EO0B 3QPXH 3PQYD 1ITBB 2NCMA 1FL5A 2HLAB 2DJUA 3V2AR 3V4UH 1AI1L 4NZUH 4MJ6B 2W9EL 4FP8H 4PJBF 4WUUB 3QAZB 4O9HH 1GH7A 4U1LB 1A3QA 3LQZA 4P23C 1CD8A 1MIMH 4PS4H 5IUSA 2EYTB 4HIIB 5JIIA 3VXMB 5IG7A 5DZNA 25C8H 2EDQA 1EXUA 1H3VA 4QTHA 1QLEL 2SEBA 3N9GH 3RIFK 3SCMB 1D5IH 4UT6L 5CBAB 2KUTA 3HZVB 3ZKMD 5GS1C 5DC9B 1FO0A 4Y4KC 4QHUA 3JWDL 5E56A 3GI8L 3MCKB 3OKLB 5HBBA 1QTYT 1OQOA 4X5XA 3SQBA 5F3BA 1ZT1A 4FABH 4I77H 1ZLWK 1U3YA 3DVGB 4I8DA 3FRUB 4JAMA 4N1CA 5JPNB 1C12B 3ZKNC 3AB0B 4OGXL 5D7LA 1CCZA 1RU9H 2C3WA 3W0WB 1HILB 4D0CA 4XVSH 5DA4A 1KUMA 2HFGH 1MFAL 4WTZG 3LEVH 4LLVA 1PKQA 3WIFA 1AGFB 1JGEA 1Q9WB 1N0XH 3WUWG 3H2WA 1DQDL 2GTZA 1P1ZA 4QRUB 1K3ZA 2MPAH 3TIDB 4HFUH 4RGMC 5AUMA 5HHQA 2AABL 1MCOL 4GSDH 3VGHA 5CHNB 4KMTH 1UB6A 2X4NA 4XVTH 4M9OA 2VZSA 2Y7QB 2GK2A 3WEXA 4LHUD 4Y5VA 4G8IA 1JGDB 4LCUA 4DTGH 4OFYD 3EZJB 5DD1H 4PTTA 1DQJA 4MAUH 3LQAC 2VKWA 1U2HA 1OP5H 5T3ZD 4JRYD 4NP4L 1MCCA 5CZKA 4BFIA 2A9NL 2V7NA 2VAAB 2GIYA 5I1DB 4FFYL 1LHZA 4BSWA 3GMNB 4PRPB 4AQ1B 1KOAA 2XN9B 3ZE2E 2A0LD 3UTZB 2YBRA 4RMSA 4K7FB 1GAFL 1T89C 3RGVB 5C2BL 4LDEB 1HZHH 1X4XA 3EJJX 4L8CB 3WJJA 1YC8A 3UTQA 3O6MH 1IT9L 1AH1A 4S1RH 1RZIA 4X5WB 2GHWB 5EZOH 3AM8C 5DJZA 5IFHH 1GOFA 4P2OA 3SDDA 3WE6B 1I8MB 2A1WL 4TULH 2B5IC 4R0LB 5HVFB 1CXKA 4UV4H 4L3EB 5DEFA 1XF5B 5B38G 2PNDA 1UC6A 3PIQB 4N1HB 1G9EA 3FRPG 1OTUC 3ROLA 2BVOB 2DQDH 2W92A 1CXHA 3NA9H 3ZL4L 4MNHA 3IDGB 1L0QA 3MOAH 3WLBA 5AZ2H 3VXUA 2X4OA 4LKXA 4WI7A 4F2MB 4YPJA 1F4YL 3OJMB 3ZHDA 1RZJL 1U3HA 4GT7A 3K4DA 2WWMD 3VXPB 4DZ8B 1EGJL 2AEPL 3EO9L 4JFZH 1BVLB 3VFMA 5KSBB 2NY0C 5GS1B 3IU4L 2XQBL 2O26U 1KFAL 1JF5A 1R5WB 2NXZC 4Y19E 3TEUA 4JPIA 2MHAA 4JZOB 1U8IB 4FXGB 4XC3L 1I7RA 1A2YB 4I2XB 2YD3A 3O45B 4AM0A 3S88L 3HPJB 1N6VA 1NDGA 4LARL 4OCSH 2XRAH 1MEXL 3DVNA 3HI1B 2JB6A 3UTPD 4HUXB 4MQ7B 5EOCH 1H8OA 3O3AB 5IMMB 1ONQB 4XNUH 4ONGH 4ALAH 1C1EH 4EQ3A 5DYOA 2VLRB 3BIBX 4GAJL 4WJ5B 1JCKA 4UQ2B 3SQOH 4QHKI 1D9KA 1I1AB 2XFXB 4ELME 4PBVC 3IDYB 1KIPA 1Q9OB 2NY5L 1RIUH 1T7YA 4N9GA 4K9EH 4M4RA 4PJHA 3MRFA 4RGND 1A6WL 2P49B 2PXYA 4UUJA 3IAQA 4F7CA 2NX5A 1VB9A 2YWZA 5F7LB 2DDQL 5SWSE 3QUZA 4OI8A 4M43L 3Q5YA 2KQNA 5HGDA 3VFWA 3QULA 3DROB 3DIFB 4OD2B 1XIWC 3TFKC 2ZUYA 1SBSL 2R29L 2VXUL 3KJ6L 2VITA 3JWOL 4JY4A 5IOPB 5D1XC 1MFCH 4PIRF 3X11A 4Z7UF 2YA2A 5TDNA 4G8GA 1RY7B 4M02A 2CLRA 1EIBA 2DB8A 3DLQR 1G7QB 1KJMB 4E5XB 3F7YA 1ORQA 2NY3C 5LXGL 4OCYH 1JGVH 3I85A 4RFOL 3SDYL 3D3VB 1VHPA 3PF2A 1NC4D 1UKTA 2BSSB 2GKIA 5E2TH 2Q3AA 4MWFA 2R0WH 5JA8B 3CSYB 2DQTL 1F02I 2X9YA 4NN6C 3GMLB 2DMBA 4NN5C 2WWKT 4NKIH 2KZ1B 2CO7B 4YFLI 4RIRB 1JFQH 2F74B 5CILH 1D5ZA 4HLZG 4F9LC 4K8RL 1S7SA 5LAXA 1EEZA 2OTUB 1YMMB 3WIIL 3RZCB 1CIDA 3B9DA 3WXWH 2PO6D 5KVFL 4Z5RA 4RSVA 1VFAA 3LZFH 2XICA 2XWBB 3NPZB 1KG0B 2B5IB 5DD0L 4BH7B 3BJ91 1OTTC 3RUGE 1FZKA 5IV2B 5AAWA 5F9WC 1IGFH 4QXGL 4RZCA 1YNLH 3DURA 2D4FA 4QRRD 5I76B 5CUSL 2VAJA 4KTEL 3C9NB 1HEZA 5FF6B 1JNLH 3ESUF 2K9UA 3TBSB 1SEBB 1UXWA 5L2KE 5CKAA 1CLOH 1G7PA 2H2PC 3N85H 3VD3A 3D39B 4M61B 4PJXB 2PR4H 4PJ9B 5GRWA 3QQ9C 4M6OL 1RJLA 3NPSC 2R1XB 5A2FA 4ZYKA 4KXZI 3PV7A 1XF3B 4FQXA 2D03L 4YGAB 1T21A 5T1KB 2OI9C 3KPNB 5C0BB 4XNZC 4UIKL 1U8LA 2NXZB 3AU1A 2OQJB 5F3HB 1TZGH 2Z92A 3TNNB 2I07B 5FM8A 3VFPA 3UO1H 4KJYB 2FD6H 4X6DA 3FQXA 3QWRD 1F00I 4YE4L 3OPZH 1FL3A 1LILA 5EIVA 3B6SB 1F3RB 2LAAA 3SY0A 3DHJA 5JPMA 2I9TB 2E27H 4NO5B 4M5YL 1P4BL 4WO4C 5E9DA 4KRPD 1WTGT 1EMTH 1DBML 5E6IB 1P9MA 2OK0H 3FKUS 3MLSL 3FFCA 1R5IB 4YK4B 1H3WM 3ARVA 3GUTB 3IFPB 4J3SA 5JXEC 3SDCD 4O4YH 2AV7A 5KSUB 4JKMA 3BEWB 5IB3B 3FB5B 5EFIB 1NCDH 1NPUA 5DHVH 1WZ1H 5DJAB 1N59A 3ARFD 5DJXA 5E08H 1RZ7H 5DVOA 4QHMB 1S9XA 3BUTA 3LKRA 1E28A 3M8OH 1DTUA 3MA9L 5TE7L 4DGIH 4ZPTA 4YWGH 4D9QD 4E42A 3U4EA 5HPOA 1A1MA 3MRMA 2VABA 3ARBA 2NMSA 2C1PB 4JG1H 2YD1A 1PG7H 2VDLL 3PQYE 1G1YA 5JUEL 4M8QB 3GK8L 4UT9H 3VXSB 3AFLA 1ZSDA 5KS9B 4KQ3L 4NZDA 3HNSL 2K3TA 1MWAB 1KJVA 2XQYG 3LRSB 2OL3B 1S9YA 4Y2DD 2C1OA 5HJ3B 1TTUA 1UWXH 1R24A 3OHXB 2D3VA 4Y8DC 4J3UA 4XP5L 4NQEB 1ZHNB 1IAMA 1D6VL 1KB5B 2CDEA 2Z8VC 1YQVH 6FABH 3MNWA 4NN5B 4IOIB 4ZAKC 2Z8SA 1NMBL 1OAYH 1Z0NA 2CJUL 5DJ8A 4MD5A 4Y5YA 1E6JL 2GW5A 3OR7B 3VGAB 3UZQA 5C0CD 4MQXD 4OCXH 4XPAH 3RKDD 3TBYB 4JZJC 3LQAL 1U8QA 1FGNL 3G04A 4OJFH 5MERA 2OTWA 4JY5H 3HHRB 3LIZH 3O9WA 1FIGL 1U91A 5IVXA 2P24A 5F9WB 1I8IA 5E99L 4DW2H 3TJHC 3B3IA 2X4PA 3QIBC 4U1GC 2ICEB 3D85A 4DGVL 1IE5A 3EFDL 1RZFL 3CXHK 2GFBA 3BPNB 4P2QA 3KPSA 1OGAB 3PWPA 2IALB 5C6TL 4MDJB 1NBVL 1XR9B 4ELKA 3W11C 3IRZA 2D7OA 4LP4A 1UQSA 2ZCKH 4WW2F 4U1MA 3A6CH 3DARA 3FO0H 4LHUG 2DQIH 4KGLA 4LSPH 3FO9A 1WBXB 5IGXH 5AG9A 1J0ZA 1ZOXA 3RNQB 2MFNA 3VRIB 2VUYA 2WUBL 1FLRH 5DHVA 2Z91A 5BV7H 5B3JF 4AEHL 3HE7B 1N64H 4NZRH 2O5XH 3WYRA 5J3HD 2J6EA 3RHWK 3OZ9H 1YECL 2DWDB 4Q9QL 4KI1A 1I9IL 2VXVH 1WAAA 5SX5H 1YQ2A 3Q3GB 2EDYA 1WJ3A 4L4VA 2XA8L 3ME0A 4HPOH 1HDMB 1YMHA 1QA9A 3HC3L 3HUJE 4QF1B 5HHVH 1RULL 4JM2C 4WI4A 5F88A 5T3ZE 3WFDH 1WFNA 3QUMH 4F8QA 1QFHA 3IFNH 1GHFL 1VESA 4P99A 3ZTNH 4NN7B 2Q86B 4S1DD 3SKJH 1S8DB 4O2FB 4HHAB 1RQ5A 3A6BH 5FYKU 3K8LA 3L5IA 3EOAB 4UAOB 1M05B 3QIUA 3V5HA 4OZFB 3EDJA 3TM6A 5IJKA 4KI5C 4GS7C 3KWWA 2FX9L 1JPTL 5E00B 4OSUH 1LEGA 1OD7A 1UYWH 1QKZH 1H3GA 3PL6A 1HWGB 3I6KB 1CDUA 3LY6A 1F3DJ 5KZCB 3RFZC 2JCCA 2WP3T 1QRKA 4NC2B 1B4JH 1ZTXL 3BKMH 3HS0B 3FONB 1MJJB 4EVNA 2A38A 5C09D 1G9MC 4PGBA 4PP2A 2DIAA 1QYGL 3GMOB 3RY5A 4PJAE 4EDXA 2QQQA 2VL4A 4HGWB 5I8KH 5ACLA 2DLTA 3HMXL 5HI3C 3MYJA 1BD2D 4GMSL 1ZAGA 2D7PA 3MO1B 4WV1A 3CDGB 4HQQH 2FJHA 1T5XB 4N0YH 1JZ5A 3QHTC 1FFPB 1P53A 2CMRH 4K3EH 2W0LA 3PWJA 1N2RA 1QPXA 4I0PA 4WY7L 1QFOA 4GRWH 3C08H 4WWKC 4CW1B 4HX1A 1BPVA 3BQUD 4X80L 4N8VB 1CFVH 3CH1A 5D72L 2W65A 3PHQB 5GHWH 4S2SB 5EWIL 3RBGA 2ATKB 3UTPE 5FECA 1K4CB 1XGUA 2E7LC 2P7TA 1OB1A 4N90D 3T0DA 4OLEA 1MUJA 1FZOA 3Q5TA 4JM4H 5ESQA 3U1SH 2EDTA 3O6LL 1E0OB 3ES6B 4XH2B 5INDA 1KLUA 4ZUWB 5FFLA 5K9JL 5DJ0A 3QUMA 5ALBL 1IILE 4ZTOL 1JRHH 1LO2L 5C0IB 2Y06L 4RGNE 1QSEA 5DJYA 4UILH 5D1ZB 2FECI 5D2LA 3KYOA 1RZGB 4P5TC 5FDWB 5F7UA 1TZIA 2MOVA 3OXRA 1GGCH 1F45A 5D5ME 5H2BB 1EFXA 3JWNC 3V0WH 3TYFA 1A7OH 4QXTB 3QEQD 3EGSA 4I3RL 1ZKAA 3VFGL 5ISZB 3SGJC 2VLKD 2Y9RT 2GSIB 1OPGL 1T4KA 1A14L 1NGZB 3MRIB 3GSNL 3NFPB 3GBMH 4HKZA 1JZ8A 3BN9D 2BSRB 4GQ9H 4GAFB 2J1KA 1LK2B 1NUFA 4TNWF 4APQD 4B7IA 1E4XH 2BNRA 3T08A 4M3JA 5TE4L 1JF1A 3T2NH 5CZVL 5BW7C 4HWBL 1FHGA 1Q1JL 1B0WA 4LMQE 4U1KA 2ZOKB 4XP1H 5T1MB 2IBBA 4PJGA 5DUBB 5EO9A 4FQIH 4R3SA 3TN0A 2LFGA 2ZSWB 2DD8L 2H8PA 3CX2A 1NCCL 4MNGB 5T1LA 4HAGA 1IKNC 3BZFA 1PX4A 4YBQC 1FNGA 1BQLH 2AERT 4NO0B 2NY6C 2F58L 1QSFB 2XXMB 4XMKH 3BP4B 4PG9B 3MRLA 4H88H 5D6CA 2GJ6B 4QRRE 1QOKA 1Q72L 3UJJH 1IGIH 3K0WA 4UOJA 5IMKB 3EYFB 4UMGA 5HYIA 1KLGB 4RWYH 2CIIB 4EQ2A 1RZ8B 3ARTA 4RA3A 3M17A 1FVCA 1ZWIA 5AG8A 5E7FA 3JTTA 3WFHB 1Q94B 1Q9LB 3CU7A 1KPRA 4GKSB 4YHOH 5BRZA 1XR8A 3NGBC 5C1MB 4OCMC 4P9MH 2DS4A 4D9RE 2EE9A 3GIZL 2RBLA 3GB7B 3W2DL 4IRJD 2C4FT 1XGPB 2OMNA 4LAJH 2EIZB 3IKKA 3VCLA 4FG6C 4PRIE 3Q0HA 5DUPL 4D3CL 1DEDA 1W72L 3CFCL 4F57H 4XB7A 4AENA 5DVMA 3PGCB 2BCKB 3CFJA 5HYSA 1R5VA 2VJXA 1U8OB 3MRCA 3K2UH 5DJ6A 3P0YL 1MCPH 1MFEL 3VW3L 1CLYL 2ZP0T 3O3BA 1J0IA 4DK6A 4OUUA 2C5DC 4A2MA 2P1YA 4IRZL 3MLUH 5J6HB 2HVJB 4OZ4A 4F15C 5AD0B 3UXFA 1L7TL 1DLHB 4ZDHB 5FM4A 1LEKA 3WMSA 4GH7B 4F9PC 4HGKC 1YNTA 7CGTA 4LF3A 1MI5D 2Q7YA 5FYLD 2VDOL 3VXNB 1DZBA 1GSMA 1T7XA 4XT1C 4D8PB 5ID0A 3MV8B 4MVBC 4U1SB 4U3CA 3E2HC 3L5WB 1UZ8B 3LB6D 3N1GC 2ORBL 4JFOB 1FVEA 3S7GA 4JFDA 1H5BA 4DGYL 2WUCL 1S7WA 3RVXC 4GKOA 1JBJA 5I6XB 4D9QE 5JW3L 1NGPH 5FHAH 1KELL 1LD9A 1ZGLB 2EE2A 1FLTX 2DM3A 4ETQA 5EUOF 5JQ6L 4NCC2 1VCAA 1II4E 4FQ2H 3RPIB 1BQHB 1NFDE 1PZUB 2WBJA 4C59B 2VR4A 5T3XL 2V17H 2GK0B 5E1AB 2CDFB 3DXAB 3GSXA 4EN3A 5L88L 2FWOA 4ZS7H 1E27A 3C8HA 1Q0YL 4PJEF 1N4XH 3LH2L 4H0HB 4YAQA 2OXGA 4L8SC 2AKRB 1EBPA 5CWSB 3HAEH 2DTSA 3EYVA 2EYSA 4DUWA 2Q8BL 3IDXH 4RQQA 4OV6F 3G5VB 3WNOA 3QUKA 1UWEH 5JORB 3QFDA 5C0CE 1UM5L 5I1IL 1ZHKA 3E0GA 4L4TB 4WHTA 4X7FC 2A9ML 4K7PL 2X41A 4JRXD 1AGBB 5EUKA 3VFUB 3T3PE 2WMPA 4UU9B 1HWHB 4JFFB 4XPBL 2AI0L 5CLWA 4R97B 5JXAL 1YYLH 4BZ2L 1MAKA 3E6FA 5CJXC 1Z3GL 3K80A 2PCPA 1LO5A 4IHOB 3MROA 4XTRD 4EI6A 1BEYH 1CL7H 1TETH 4OFDA 5IM7A 3T0EC 5EC2A 3IFLL 3QDGD 3RWHA 3QDJB 1F2XK 4PJDA 1KULA 5LGHL 3EYSL 5E7BA 2EICA 5H35B 4O00A 3DV4B 3ARBD 3ARGC 3KPTA 1TZHB 4UTAH 3ALWA 3P0VL 4XCCL 2BP3A 3F62A 1UG9A 5CKGA 4K94H 2VSCA 4G7VH 4MAYC 4LIQH 2Z31B 1I8LC 4XP6H 5C0AA 4F7TB 3QUXD 5D8JL 3BPLB 1MLBA 2HT4D 5ICYA 2DKUA 4ZFZA 5ID1B 5IIEB 3GDBA 1QFWM 1G9ML 4JGJA 4XMLH 3SGDI 1YEJH 4PP1D 4MB5A 4LAQL 4XVUD 1UM6L 5GJTL 1SYSA 5GS2H 3RWGB 1YEEH 4R26H 1GC1C 2H9GB 2NY4D 4CMMB 1DQLH 2ZG1A 3UAJD 4H0GA 4HV8B 3WNPA 5FKAB 3H9SD 3WO4B 4NUJB 5E8EB 5JO5A 4ZFOA 1U58B 3GNMH 4X6CF 4RISH 5GGQL 4HXBL 3TESA 5J89A 4J23A 4WI6A 3QR2A 2F54A 1BF8A 1NEZA 1WBYB 4PJFF 5I1CL 1T1XA 3GJFH 4ZUSB 5F89A 4PY8I 5KSVB 4G43B 4YLQT 1VFMA 5I1GH 1MAML 3QFJA 5D7LE 2EDLA 1FDLL 3E2HB 3HAEA 2P5ED 3MJ8A 2CRIA 1ZHBB 3DX7A 4P2QD 3RIAK 4WFED 2FNBA 3UYRH 1SY6H 2ITCA 3BKCH 4FZEL 3EJYD 3QWOB 3KR3H 3OSKA 1URLA 4ODWA 3WHXB 1JWUB 1PKQE 5CGYC 1FJ1A 4U4BA 5FCUH 4Z78A 2YHGA 1QSVA 4OLWL 2BX5A 2XTLA 1EDQA 1CDYA 3U46B 1L6ZA 5D70H 5GSVB 2JIXA 1BIHA 3WN5A 1N3NB 3HI6H 4IOFD 1C5CL 4ZQKA 5JZ7C 4PRDA 4DAGL 4L3CA 1RK1A 3BRFA 1A1OB 2GQHA 3V95A 1G7HA 1XGRA 1BD2E 2D7NA 3I2CL 4G9FA 5KVDH 2F8OA 5J3HC 1TQBC 2KZWA 4GW5B 1TVDA 4GG8B 2V2WA 1U42A 1Q8MA 3QRFM 2GITB 3MXVL 1AO7D 3EOBB 5GISL 4EDWL 4OF5A 1MH5A 5CLTA 5HYJD 1JZ2A 4L5FH 4LDOB 3A67H 5DGQA 3BT2L 1AFVH 3L5HA 5KANG 1J87A 3O8XB 4PLKC 2R2CA 5ETUA 5I1JL 4OQTL 4FFZH 5I1AB 4F33B 4PJIA 2QL1A 3SO3C 1N5YH 1EJOH 1A9EB 2Y5TA 4N90E 5BS0A 5E24E 1LK3H 5JW5B 5K9QG 4KK5C 4JGUA 2J4WH 1SJEA 5TH2A 1NAMH 5JNYB 5GRUL 4ZOCA 3S3SA 3MJGX 4LU5H 4HPYL 1NCAL 3GSUB 3NN8B 2DWEB 3GJFA 1AGEB 3EHBC 5DF0A 5ITFB 1HSBB 3G6JE 3H9HB 3OL2A 4X7TB 5E5RB 1GVIA 4HS6B 5F7KC 2B1HH 1SY6A 2YPVL 5EOTA 3U0TA 1CBVH 4Y4FB 1JPSL 2W0PA 1I85A 3OKYA 1QR4A 2F53D 5IFAL 3QEQE 3RZWA 2P8PB 1QR1B 3BWUC 4Q9BA 5GQBA 4G6JL 3QCVH 1BBJB 1F90H 1DSFH 3H3PL 2IH3B 2L7UA 4Y5VC 1S7QB 5IW1B 3TNMB 2X89A 3WXVH 1A7BA 3HI5L 5HHMB 3FQUA 5TDPB 4YXKL 3K3QA 5EOQH 1CDJA 5IEHB 1MIEH 4I4WB 1U93B 1DVFB 3HN3A 4Z7VA 1TTFA 4Z0BH 1T0NA 3JXAA 1OSZA 1ZV5A 1JV5B 4BFEA 3BQUC 2VZ3A 2ZOLB 4DZBB 3KYNB 4HF5H 2B8OT 4J3OC 4U6XA 4FFVD 3MTRA 4LLYB 4G80A 2DQFB 4Z0XB 3KHQA 3GGWA 1JWSB 3FOLA 4X4ME 4DVRH 2YKLL 4OLVL 4DKAA 1MJ7L 1QFUL 5I8EB 4OZGA 3WJJC 4XRCB 1ZLVK 1PD6A 4WDIA 5I8CA 3P73A 3NFSH 4P2OC 1LDPL 3NAAL 2NX5E 1N26A 1AE6L 1WLHA 1P4IL 4WU5A 3QXAB 4E0RA 3SPVB 5DURB 1JTTA 5BZDA 3ARDA 3Q6FA 1EFXD 1T6VN 3MUGA 2ARWA 3LQZB 4K55A 5B4MC 5ADOH 1NAMA 2V7HA 5F8RC 5EU4B 1CGSL 1U3HC 1M1SA 2QQKL 3VXOA 4KKCD 5DDHA 4RRPG 2ZUQB 4PRHD 1IMHC 1C5BH 1J88A 5FO7A 4JPKH 4MHHI 2FEDD 2OR9H 3NACH 1FO0B 5KAQF 4Q97A 3KPLA 4FQ1H 1IAIL 3C6LD 2J2ZA 4YH6A 1JIBA 1A3RH 4U7SA 2CKNA 5FKPA 2W0KA 3BO8B 3EKCA 1BZ9A 2HJFA 1NKRA 4X5XB 3LKOA 5LBSL 3HE6A 43CAA 1QBLH 3HRPA 4CVXB 1EHLL 2AK1H 3GHBH 4YX2H 5JMRA 3BKYL 1S5HA 3QT2A 2YS4A 1LEIA 1MI5E 3PWVB 5FYLE 1YDPA 4YHYB 5HVGB 1HHGB 1ZHLA 4JREC 2F8XC 3VWJA 1A7PL 1FAIH 4RFEB 3WS3B 4LLVB 1D9KC 5DMYA 3WIFB 3FQNB 1JGEB 1R3JB 3TV3L 2GTZB 1MCSA 4PJ5A 1P2CA 4MA8H 4YGVB 2Q8AH 5IW6B 4PGJA 3DGGA 3T1FA 5IBUB 1XEDA 2EO9A 2PXYC 3MQIA 5HHQB 3OKMA 5JLZA 5DC0A 4XGZB 1T66D 3RIFF 4HDIA 3I3EA 4UBDC 3VWKA 3QUZC 1UB6B 4NHUA 3AS0A 3U0WH 3MJ7A 4G8IB 5KTEH 3LKPA 4MLIA 4R2GD 2ADJA 3C60D 5HVHC 5C07A 1JUFA 4JQIL 3O4LB 3C6SB 3MV7B 2RFXA 4PV8A 4PTTB 2A6JB 3CLEL 4RGOH 5FYJD 4J4PD 2PYEA 1GC1L 3RVVC 2BOCA 3L5XL 3B2VL 3NFNA 4XBGA 2IANB 2YXMA 3TC9A 3IDMB 1U9KA 3S37H 4UQ3A 4OKVB 3MBEA 3WS6A 1YEIH 2X1XR 3QQ4A 4MNQD 4U1JA 2APVA 4XNMA 5CCKH 4JRXE 3DTXA 3FFCE 5I2IB 2AEQH 4AL8L 4HUMB 4KZEH 5DJDA 4MJ5A 1XFPA 1RZKH 2IPUG 2FGWH 1WWWX 3UTSA 4HS3A 3MRNA 4FNLL 3CCHB 4U05A 4MZ2A 4PJCF 3SDDB 1F58H 5KW9L 1JHKL 3QDGE 2WIMA 3LS4H 5D2NE 2ZKHH 2QKIB 2R56H 5HYFA 4I9WE 3WUZA 3SE4A 3QI9A 3W9DB 1I7ZA 5DSCB 3L6FA 4MNHB 5A3IC 4B53A 5TFSL 3WLBB 2W59A 5GGVY 2YN3A 3VXUB 4DN4L 4LKXB 3V52L 1T22B 3QDHA 2NW2B 1U3HB 2IGFH 5AEAA 5ICZB 4OI9A 1MJ8L 2NY1C 3P3YA 4EI5A 2X4RB 4BYHA 1XCQB 4N0UB 4FQXC 1D6EB 5DI8A 4JLRA 2XY1A 4K9EC 4GRLD 4LP5A 3BKJL 3BOVA 5TQ0H 4HWNA 5D4QA 3ZYJA 2APFA 3UJIH 3ZYZA 2MHAB 3T0BA 3MLZL 1I7RB 3H9SE 1J8HA 2R23B 2EH7L 2B4CC 2M26A 3F58H 1P6AB 1CU4H 4K7PX 1OGTB 1KJ2B 4XCNA 2X42A 3EO1B 1NDGB 5B39B 5JDSB 3HPLA 3U4AA 2UZIL 5T33H 4XNYL 2R0ZL 1FO0L 4WHYG 5IVXE 2VXQH 1GIGL 1P9MC 1JJUA 3C5JA 3WKMH 4Y1AA 1OLZA 3FCTA 2X40A 2P5EE 1B0GB 4UTBH 2XACC 4P2QE 5AAMA 5GZOD 5L8JB 3PWPE 2FATL 5HHOA 2W9DL 4Z77A 4KROB 4K3DL 3MLVH 4PJHB 3RVWD 3DVIA 5IBLC 4V1DA 3LKSA 2VL5A 1TCRA 2AGJL 1C7TA 4UDTB 5D2NC 5IR1A 3T8XA 3QUZB 4W70A 5HGDB 3VFWB 3ARBC 4XWGL 3LRHA 2H45A 3CMOL 4M93B 2VITB 3BHBB 2HKHL 3B8SA 1X4ZA 5BXFA 3EOTH 2DM2A 2IQAA 2ZUUA 4ZXBA 3DMMB 1LNUA 2Q6WB 4GW4A 3OKDB 4PGCB 4R9HA 3RL2A 3O6FA 4XVUC 4HK0A 4MWFB 2DQCL 1F4XH 1AO7E 1FNHA 2WIIB 4P4KD 2VDKH 4N0CC 4WU7B 1D5ZB 1T1YA 1A4KA 3DUUB 3QPXL 4Y5YC 5E4IA 1WWAX 5CP7A 4JDZA 1K6QH 1MQKH 1O7SA 1YEGH 1PYWB 3V4UL 3MRRB 2JJUA 3MACH 4LVHC 4NZUL 5C0DB 1VFAB 3SDAB 2Q1EA 4FP8L 1I75A 1FZMB 1ZS8B 4O9HL 3T4AB 3O9WC 2AEWA 1QRNB 1OSPL 2A83A 1FSKC 1FZKB 4L9LA 4WTWA 4PGDA 3TIEA 3ZHLA 2DLFH 1MIML 4PS4L 4RZCB 3DURB 4Y4HA 3L3JA 3K1DA 3AS1A 4GLRH 3Q48A 3NTCH 25C8L 1FGVH 4LK4A 4XXCA 2ZNXA 3N9GL 1B4RA 2RQ8A 1X5GA 1D5IL 1JWMB 2YPKA 1OTSD 3X14B 3G9AB 2B1AH 4NO2A 4IRSD 3D18A 2ESVB 5HPMA 4PRNB 3NCJL 2NY1B 2YPLA 3RY6A 2B7DT 2DF3A 2OR7A 4Z7NE 1QHOA 3KLHC 4QCIB 4I77L 3ZSTA 1HNFA 4RAHA 1P7QB 1UXSA 1T21B 1YPZF 5EU6D 2IPTH 1JPGA 1U8LB 2F53E 5EBWB 3CFDA 3TZVA 1RU9L 5BQ7B 3RWDB 5KSAB 4MXWH 4U6HA 1O5DT 3ARZA 3U36B 4XVSL 1RHHA 4Y89A 2HFGL 5MI0C 3TT1H 2APBA 2JJVA 2MQCA 1ZA3A 3QHFH 3QNXB 3TCXA 3F7RA 3STLB 1N0XL 4KDWA 1CGUA 4E41D 5CINL 4YZFF 2AJYH 3IFOA 3OR6A 4DKDC 4AJ0A 2MPAL 1GZQA 4HFUL 2GT9A 3U30C 5MEOB 5I30L 1MCFA 2H6PB 4GSDL 4KTDH 2AJSL 4QRPD 4KMTL 1KT2A 5GJSH 3LMJH 2Y4SA 4XVTL 1HOCA 4YO0A 3MMEA 1N0LA 1DBAL 3CZJA 2IBZX 5C2UB 3QIUC 4JPVH 4UNUA 2HFEB 1ZA6B 3PP4H 4DTGL 5B38B 5IJKC 4NQCD 3LSOB 5DRWB 4HFWA 4ZPTB 5IK3B 1CN4A 3O4OC 5DD1L 4E42B 3U4EB 2VABB 1QSEE 5E8DH 3RVUC 1BF2A 1FORH 1QLRB 2YA0A 2E9IA 5F9JB 4Y19B 3PL6C 3AREA 4PJ8A 1XCTB 3KG5A 3LDBC 2DL2A 5CMAA 1AJ7H 2V5SA 1CICA 5FCSH 1U8HA 3KPQB 5H94A 5FOJA 4WFFD 1WTLA 1EUUA 2GTWB 1HZHL 4PRHE 2OS7A 1FNLA 1WSST 2I9LB 2ZG2A 3RWCA 4WV1C 2ZWLT 2OR8A 3O6ML 5GZNC 3PABB 4S1RL 4G7YH 5IFHL 2J5LB 4KKBD 4NRZB 3MRBA 4YC2C 1JK8B 1NBYA 3BVNB 4Y5YB 4TULL 2BNRE 4I48A 4P5KA 4UV4L 2X70B 1UJ3B 2WM0A 2AJ3B 4CGTA 4I0PC 5F1SA 4LVHB 5BV7C 3G04B 2OTWB 2DQDL 3NA9L 4GW1A 5SWSB 1UZ6E 1NBZA 3MOAL 1FSKB 5HI5C 2P24B 5AZ2L 4XZUA 5T1DH 1XGTB 5I18H 2X4PB 4LVEA 4IMKC 3T0AA 3D85B 3EDDA 3HZKA 3DRQA 1SVZA 4JO1H 3F8UB 1AGDB 1IM9B 3CZFA 4GUPA 2A74B 3KPSB 4YNYA 1YY8B 4U31A 4JFZL 2Z0BA 4XMPH 15C8H 2VLLA 4X4YA 3MRJB 1UQSB 4GAGH 1IGMH 1QLFA 3FTGB 5EUOE 2BXYA 1F8TH 5IKCB 1F2QA 4N0RA 2EDDA 5DHVB 3V5DA 5HYSG 5IHBA 3E8UH 3ULUH 4OCSL 2XRAL 2RB8A 3N50A 1KTLB 1F6AB 5EOCL 5DFVC 4A2LA 3MNVA 3RDTA 4XNUL 4ONGL 4ALAL 2P8MA 3V6OA 3S36H 2GY5A 2KPNA 4DKFH 1MY5A 1H8SA 3ARUA 4JFHE 4OUOA 3SQOL 4YDVA 4H25A 1EJ6A 1AR1C 4NKMA 3B9KA 2XA3A 2F15A 1RIUL 5FYJE 1J9CT 4K9EL 3LOWA 1FPTH 4LQ1A 2P45B 3L3KA 3IVKA 2QR0A 3RJQB 3SKUD 4I13B 3WDIA 2IFFH 4Y2OA 3S5LA 2CSPA 2EXYD 3RY4A 1PZ5A 1KCLA 3ZE1E 1IC7H 5HGGS 2B4CL 4TVPD 3QH3B 4OZIB 1T2QH 3BGMB 5GXBB 4NDMA 5L2KB 3RQ3A 3V5HB 2NYYD 3TN0C 2HLAA 4OCWL 2FO4A 1MFCL 3OKEB 3WIHH 3SE8H 3DNKA 4WUUA 4WGWB 5KVEH 5D7JD 1LEGB 8CGTA 4OCYL 1JGVL 1A6VH 3RHWF 4NWTH 2C4FU 2EYTA 4HIIA 5E2TL 2R0WL 4MXQD 2VH5H 1HHJB 1LO4H 4NKIL 3C5ZD 4U0RC 1JZ4A 2VZTA 4PGBB 4PP2B 4KJPD 4P4RB 1JFQL 5CILL 3TCLB 1U2CA 4Z95H 2OYPA 3HZVA 3X17A 5JOPD 2C3XA 4NQUA 1BFVH 4NKDB 3MCKA 3OKLA 3B9AA 5MEND 3OF6D 3WXWL 3MYJB 2XZQH 3DVGA 3LZFL 4KH2A 3NIGF 1ZVYA 2XKSA 3FRUA 4XP4H 1MQ8A 3WFCH 5JPNA 3U2SB 1C12A 3KXFA 1IGFL 4X6CE 5C9JB 1N2RB 1YNLL 4R2GC 1I7UB 4I0PB 3C60C 3W0WA 4KUCF 3OAZK 4Y88A 1HILA 3QWQB 2FZ3B 1I4FB 2ED8A 5HGBB 3TJEH 1JNLL 1VKXB 4H8WH 4PJFE 5I1KH 4BM7A 4ZOEA 5E4EB 3QQNA 3WDJA 1AGFA 1AXIB 1CLOL 3N85L 1Q9WA 2Y36H 3PQYB 2PR4L 1XGUB 2P7TB 3ABZA 4QRUA 4C58B 5DJCA 1DEEB 3TIDA 1HN1A 1S3KH 4X4XB 4FA8A 1J1PL 5KN5B 3UC0H 2CLZA 2FIKB 1OD9A 5CHNA 5D7SH 1KLUB 5DJ0B 3QUMB 5DXWA 4U7MA 4MB4A 2Y7QA 3QUYA 1TZGL 3HR5B 5EOCJ 1JZ7A 3OKOB 1V7MH 4ONOA 5IEKB 1MHCB 1BJ8A 1S78D 3BIAX 3DPBA 3UO1L 1JNHB 1IEBB 4KAQH 5D2LB 3KYOB 3OPZL 4DVBB 2FJFB 1H5BC 5L2JB 4BJLA 5LGJA 4WIQA 3WIHA 2E27L 1SEQL 3TO2B 1EMTL 3B9EA 4ZSOB 3OAYH 2QADD 2PF6A 2OK0L 5I74B 2XNAB 2WBJC 5I1DA 2VZUA 4H20H 1K9TA 5AYUH 3GMNA 4PRPA 4AK1A 2LTQB 4O4YL 2XN9A 5GGUB 3SE9L 4K7FA 1NCDL 5E08L 1WZ1L 2X9XA 2HJLB 1RZ7L 2V9QA 3RGVA 4JDVB 2R15A 1AC6A 2DQUH 2J6EL 4P9HC 4L8CA 4JVPA 5EH1A 4DGIL 4WEUD 4X5WA 4GBXA 4YWGL 2E6QA 5GPRA 1I8MA 4JG1L 1PG7L 3C2AH 4R0LA 3PWLB 5EO9B 4L3EA 3P11H 1YNKL 5GS0D 1GOHA 4UT9L 1NGYB 4KC3B 2E8ZA 3PIQA 2R9HC 5DMJB 5GRJH 2BVOA 1QO3A 1FNGB 1GCFA 2FCBA 4KXZH 3IDGA 4LSQH 1QNZH 4PJ7F 2FX8H 1MHHB 5EZLB 4JQVA 3FQRB 1BBDH 5C0ND 2HT2C 3LEYH 3MRLB 1FFNB 1H9VA 3QZWG 4NM4H 3VD9A 5HHOD 4MLSA 4PJEA 1YQVL 6FABL 4DZ8A 5GGVH 3FB7A 4Q58C 4U0RB 4GKZB 3REVA 3LKQB 1YEFH 4X99A 1PJ9A 5KSBA 2AJVL 4LLDA 1OAYL 3IXAB 1DQMH 1FVCB 4KY1H 2NTFB 1KPRB 5C0RL 3KYMB 5FUZH 3ZDXF 4JZOA 1U8IA 3OKKB 3EJZC 4XPAL 1PAMA 4I2XA 5J4MA 4JRYB 1TLKA 2PN5A 1T20A 4OJFL 4YBLB 3O45A 2FB4L 3LIZL 4ZXBD 4HJJL 4B0MM 1PLGH 4HWZB 4J7RA 4M7LH 2COQA 3CIQA 4HUXA 1CGYA 2HRLA 4MQ7A 3SDXB 3O3AA 5IMMA 3IJYB 5J12B 3ARPA 5DJ6B 2A77H 3VDBA 4P3DB 2NY2D 4WJ5A 2P46B 5F97E 1I1AA 2XFXA 1EERB 2ZCKL 5HDBF 4HK3N 3A6CL 4HIXH 1Q9OA 3FO0L 3ZYOA 1WIPA 1EO5A 4I0CC 4E41E 1AQKH 5ALCH 5IGXL 4PJIE 2Z8WC 5H37G 4XXDA 1DCLA 3CC5B 2DYPD 1LEKB 3SBWA 5TGBB 1FLRL 5HI4D 4P2RD 4PJAB 5BV7L 5CEZH 1N64L 5KVGH 4NZRL 3DIFA 4OD2A 2BRRH 4FS0A 5IT2H 2HFFB 2O5XL 3OZ9L 2UZYB 1WZMA 5IOPA 2VOTA 1FYTD 3I6LD 4JFXA 4HPOL 1FVEB 4NQCE 3MREB 4JANB 3QO0B 4IBLT 1S7WB 1KJMA 3KLSA 1LD9B 3ZDYE 3D0LB 5HHVL 5KAQG 3WFDL 4PREB 3QUML 3GMLA 3MGOB 1HH6B 3IFNL 4RIRA 2F74A 4C56D 4KDVA 3SKJL 4U2ZA 4XB8A 3A6BL 3WN5C 4MJIA 4WFFE 4EN3B 2BVQA 2OTUA 2Y5EA 3PXHA 3T2OA 5HHPB 2FRGP 3W39A 5GGSB 3E1F1 2XWBA 5JW4M 4GG6F 4BH7A 1UYWL 1QKZL 5I15H 2ZNWA 5EIIB 1DBBH 3TT3H 4X6FB 3QFDB 2OP4H 2BFVH 1XF2A 1ZHKB 1CI5A 3VI3F 5I76A 2OL3H 1IQDB 3O3UN 4K71C 1B4JL 3BKML 4RGNB 4C83A 3C9NA 5EUKB 5FF6A 1KB5H 3F5WB 5HDOA 5LCVL 3D39A 2H2SD 4PJXA 1LO5B 5D5MB 4PJ9A 5I8KL 4EI6B 4X4ZA 2R1XA 5SX4I 5IM7B 4OF6A 3RWHB 4MA1C 5DGRA 4HS8H 3BIKB 5T1KA 3TWCH 4U33A 1N8ZA 3KPNA 4N0YL 5C0BA 4B50A 2HTLC 2OQJA 2CMRL 4K3EL 4X7CC 3HZYB 2I07A 3TNNA 1NC4B 5K9KB 4UOW0 3AMLA 3C2SA 4KJYA 4ENEC 1GRWA 2XKNB 3QEGH 3C08L 5C0AB 4P46D 5E1HB 3B6SA 1CFVL 1PX3A 3OBAA 3EYOB 5F44A 5GHWL 2I9TA 4C4KT 2HT3D 1IGTA 4GRMA 4LSUH 4LRNL 4F80A 4ISVB 5E6IA 4HUUB 4JM4L 1DN0B 1R5IA 3U1SL 1I85C 5C92A 5FM5O 4X83A 3GUTA 3IFPA 5DUMH 5F7YC 1I1FB 4ZFOB 4FXLA 5KSUA 5IB3A 5FA3B 1JRHL 3FB5A 5EFIA 5DJAA 1DLFH 4QHMA 1SJVA 4QRRB 3IF1B 1I9RH 4NKOA 4UILL 4W4OA 1DQQA 1EZVX 1RFDL 1GGCL 3WLWC 1NJ9B 1NUGA 5F89B 4M8QA 2VISA 3HAEB 1G7LB 4JHZA 3V0WL 1A7OL 4PJCE 1SJXA 3DX7B 3VXSA 5I1HH 5KS9A 1XF1A 2ITCB 4JO3H 1MWAA 1NANI 3PDOB 4O5LH 4YXLH 3VFSA 3LRSA 2OL3A 3MXWH 4JVWA 3WBDA 5HJ3A 3OHXA 1FJ1B 4LMQI 3O3DB 3GBML 5J8OA 4NQEA 1ZHNA 5C0GB 1KB5A 4GQ9L 1KXQE 3BESR 4PTUB 3VU2A 1E4XL 5F7HA 4U6TA 1UA6H 5SWZA 3T2NL 4OZFH 3QXWA 4U7KA 1FC1A 4XWOD 4FRWA 5JOPE 4XP1L 3LEXB 3OR7A 1I1YA 2IF7A 4XI5D 2HP4A 1PDKA 4FQIL 4KRPB 5MENE 1N7MH 4HCRA 3ARDC 3FB8B 1HE7A 3VXQB 4RFNC 4WVRA 1G7HB 1XGRB 4X9BA 1BQLL 4I0KA 4RMRA 2J8UA 4IDJH 4KUCD 4LGSB 4X9FA 5I1EH 4NQSB 3SDCB 1MH5B 4FXKB 4H88L 2IAMA 1WEJL 1KTDB 5J1SC 2PYEE 3ARFB 5C08D 2BHUA 3OJ2C 1YY9C 4U6VL 5DD5L 3U7YH 1E4WH 4KVCH 1OGAA 1IGIL 4OGYL 3RIAF 3UJJL 2IALA 2H32H 1ULVA 4MDJA 1ZLWH 1A02N 2HG5B 1C16B 4OFPA 4OZHF 4RWYL 3RTQD 2WK2A 5BVJB 3G08B 1J1XH 1G0DA 4P9HL 3IJSA 3D0VB 3RAJH 1TNMA 1RUPH 4QKXB 3HE6C 4PJBB 1WBXA 2EZ0D 4HUWB 4LCWD 4P9ML 3RNQA 3VRIA 3UTSE 2YK1H 2NYYC 3HE7A 4R7NB 2DN7A 5TH2B 3QG6A 4RNRB 4NUGL 4F57L 2DWDA 4R90H 1IEAB 3DVFA 3RU8L 3VWJC 3VXMD 3Q3GA 3HLAB 3K2UL 8FABA 1UGNA 3FOMB 1HDMA 2H41A 2BY3A 2MQ3A 3QYCA 5AYQA 3SCMD 4LCIH 2P5WD 3BP6B 4M8VA 4QF1A 2CRYA 4RAVB 3S35X 1A7NL 4M3KB 5TDOB 4PD4K 1MY7A 3MLUL 5C0CB 3O6KH 2Z93B 4KZDH 1H0DB 4Q9RH 4MQTB 3RWJA 3WFEH 4J1UB 3VWKC 1CDGA 2Q86A 1EEQA 4QWWC 1S8DA 4U6YA 1Y6NR 3FN3A 3T4YB 2ADGB 2BJMH 1RUKH 3EOAA 1J5OH 1OW0C 4HKJA 4OZFA 3LVEA 4P3WA 4KK8C 3ZKXB 3ZTJH 1PGRB 1DR9A 1U0QA 4OTXH 1GYAA 2L7JA 4H1LG 1Y18B 4S0TD 4ELMF 1NGPL 5FHAL 1FBIH 1SQ2N 1CFNB 1OSZB 2BHZA 3MBEC 3UJTH 4M1DH 4C54A 2E9JA 3HS0A 4P57B 4OB5H 1MNUH 4ZFOL 3FONA 1MJJA 3Q6GH 3HG1D 4Y1AE 3BISA 5DFWH 1QUNA 1NGQH 3STZB 4BQBA 2I24N 2H32A 3NCMA 1I8KB 4HGWA 4ZS7L 2M1KA 1DDHB 5HHOE 4J6RH 1N4XL 4TPRH 4K8RD 1T2XA 3MO1A 3CDGA 4K3HA 2FEEI 1OAUH 1T5XA 3IDXL 3ILPB 1A3LH 5AWNH 1UWEL 4Z7WA 2G9HB 3LD8B 1S5IH 1U95B 3SE4C 3QI9C 1YPZE 2KBGA 4Y0GA 4CW1A 4QEGA 4M4PA 4N8VA 1ZMYA 1VGEH 3H3KA 3PHQA 1FP5A 4OF3A 1S7RB 1YYLL 5JHLH 4S2SA 3VXOB 3QDMD 3QSKB 2ATKA 3TPUB 4EI5C 1K4CA 4KKLC 4RCAA 4HJ0C 1MSPA 1F6LL 1QPPA 1CL7L 1U6AH 3BP7B 3DRTB 1TETL 2QEJA 3ES6A 4XH2A 4YZFE 4HIEB 4Y8AA 1BZ9B 4ZUWA 1CE6B 3FT2B 2CIKB 3RUGF 4CN6A 3ZLQC 1YN6B 1G9NH 3HE6B 4JPWH 4UTAL 5C0IA 3GBNL 4I18A 2AJZB 2BVPB 2VRAA 4ODUB 4G7VL 5D1ZA 1K8IB 5IBTH 5IESH 1RZGA 3B5HA 4XP6L 5FDWA 4G8FB 1N6QH 5C09B 1B88A 1B9ZA 4P23D 4XMLL 5GGRB 1YEJL 1IZKA 1TITA 5H2BA 3VWJB 3HNVH 4OKDA 1YEEL 3UEZA 4R26L 1CD1B 2VXSH 3I6LE 4QXTA 4P59H 3ULVH 5F7FA 3S34H 1DQLL 5I8OH 3E3QC 2GSIA 3IB4A 4Y4KD 2AXHA 2B0SH 3DGGB 1NGZA 3MRIA 5FYKH 3U9PH 3GNML 3NVQA 4RISL 3NFPA 5CJ8A 4KRLB 5JLZB 5E94B 3UMTA 4HDIB 5J57B 2BSRA 1LK2A 5I19H 2YMXL 1YN7A 1RZKC 4C56E 5JIKA 2HLFC 2DLIA 4IMLB 2ZOKA 3ZKND 3PGDA 5I1GL 3VXRA 2ADJB 3V4VH 2VZOA 5EN2B 4ZXBC 3UDWA 4BQ6A 4MNGA 4ODBD 2VLRD 1HIML 5DVLA 3VE0B 1SY6L 1RIVH 4BZYA 4C57C 3BKCL 3O6FC 2XWJB 1INDH 2EIDA 1A6TA 1BGXH 1KIUA 3KR3L 1QSFA 2IJ0C 4UQ3B 3O41B 3W82A 3BP4A 4PG9A 3MBEB 3JV4B 5FCUL 2GJ6A 3DI2B 5FA4B 4RWHA 4OM0H 3EYQC 3QQ3A 3EYFA 3GMMB 3C8DA 3NBNA 1KLGA 3LN5B 5D70L 5F8QC 1RZ8A 1M71B 2HVKB 5FO8A 3WFHA 3HI6L 3MOBH 4Z7UB 1Q9LA 4X6EA 2X5PA 5HTSA 5GS3A 2ZCLH 4HS3B 3SGDH 5HI4C 3K74B 1P7KB 4L9LC 3H7LA 5KVDL 1OAZH 1R0AL 4OCRH 1UT9A 4IEFB 3QISA 4Y4HC 3IAGC 2VLKB 1O7VA 4LCCB 1LP9F 3D3VD 3QI9B 4XXCC 5TE6H 3L6FB 4L5FL 3PGCA 2BCKA 3A67L 3C09C 1AFVL 1U8OA 5DO2D 4KKAC 4CJ1A 2AQ2A 4APQB 1Z9LA 4JM2F 2VIRB 2X1QA 2EYRB 5KANI 3MLTB 3CAFA 3RY6C 4K3JL 5GRVL 4EI5B 3SJVA 3OTTA 4DOHE 5J6HA 2NXYC 3LN4A 1EJOL 2HVJA 1YMMD 3RZCD 4JLRB 3P4MB 5AD0A 3TA3B 1DLHA 3F7QA 1C7SA 5F9OH 35C8H 3HZMB 3X12B 3TZVC 4AQOA 1JYVA 5L0QB 4KI5F 4KK6C 3VXNA 3DV6B 5K9QI 4KUZL 1JNNH 1NAML 4D8PA 4NRYB 2AK4D 5F1IB 4XCNB 3NZHH 3L5WA 1UZ8A 1OTUD 4CN1A 4JFOA 1A9BA 5LGKA 3DX9B 1UENA 3Q1SL