1RVKA

Crystal structure of enolase agr_l_2751 from agrobacterium tumefaciens
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
381
structure length
381
Chain Sequence
b'MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isomerase/lactonizing enzyme
publication title Evolution of enzymatic activites in the Enolase superfamily: 1.7 A crystal structure of the hypothetical protein MR.GI-17937161 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Structural genomics, unknown function
total genus 121
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1rvkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1rvkA01
3R0UA 1BQGA 4DYEA 4ENLA 4H2HA 2P8CA 2ZADA 1MRAA 3R1ZA 2POZA 2HXUA 3U9IA 4Z17A 3R11A 3TOYA 2DW6A 4IHCA 4YWSA 2MUCA 3UXLA 2GL5A 2QJJA 3GO2A 3DEQA 3MUCA 3S47A 3U4FA 3PWGA 4A6GA 2PTZA 4GGBA 2P8BA 3CAWA 1E9IA 4ROPA 5ENLA 4IP4A 3TJIA 3DERA 3H7VA 4GYPC 2PTXA 2FYMA 2GGIA 1EBGA 3OP2A 3PK7A 4M6UA 3N6JA 4DX3A 4GFIA 2AL1A 1TZZA 1SJCA 5BOEA 1JDFA 1R6WA 3UCDA 3VCNA 3H70A 3N6HA 1ELSA 3RITA 2XH0A 3RO6A 1DTNA 1NELA 4JN7A 2OO6A 3T9PA 1BKHA 4HPNA 3BSMA 2PP0A 4H1ZA 3SBFA 4IL0A 5FJTA 3DDMA 1R0MA 3RR1A 3ZVIA 1EC9A 3DESA 1MDRA 3IJIA 4GIRA 4IZGA 4Z1YA 3RGTA 2HXTA 3MZNA 2PU0A 4M0XA 1OEPA 3V5FA 4K1WA 2PODA 2OLAA 1PDYA 3ZVHB 3CYJA 3TWAA 3D46A 1P48A 3OTRA 2CHRA 1JPMA 3R10A 1FHVA 4KEMA 3FJ4A 3ES7A 3UXKA 3DFYA 2XH7A 3MKCA 3I4KA 3IJLA 2QJMA 1MUCA 3VC5A 1RVKA 4IP5A 3V3WA 3GC2A 3V4BA 4ZA0A 1KCZA 1P43A 2P88A 1EBHA 2GGHA 3K1GA 2PTYA 3ZVHA 2QGYA 3EEZA 3GY1A 5FJRA 2OKTA 3OPSA 3MQTA 4DHGA 3P0WA 4HYRA 2GGEA 5J04A 4HCLA 2ZC8A 3SSZA 4G8TA 2ONEA 3P3BA 3JZUA 4DWDA 1ONEA 2PGWA 3VDGA 4GISA 2PPGA 7ENLA 1JPDX 1TKKA 3DFHA 2AL2B 3FVDA 2XH4A 3DIPA 3H8AA 4FP1A 3PFRA 3TWBA 4HCDA 2GDQA 1SJBA 2OZTA 3S5SA 2PP3A 3QPEA 2PU1A 3IJQA 1SJAA 1NU5A 2P0IA 2GSHA 3UJ2A 4MMWA 2O56A 2PS2A 4GMEA 3TTEA 4H19A 1XPYA 3STPA 2PCEA 2AL2A 3MSYA 2I5QA 2XGZA 2MNRA 3SQSA 4DN1A 3ZLFA 4J1OA 2QDEA 1XS2A 3T6CA 3IK4A 4A35A 3QTPA 3ZLGA 3UJFA 3JW7A 2PSNA 4K2SA 4E4UA 2FKPA 3NZGA 3N4FA 3MWCA 3HPFA 3DG7A 1EC7A 1WUEA 5FJOA 1F9CA 2PA6A 1SJDA 4MKSA 3TQPA 3CT2A 4E6MA 1TE6A 2RDXA 3DG6A 4KWSA 3ENLA 2NQLA 4GYPA 3KUMA 3SN4A 3QLDA 4FI4A 2HNEA 3ZLHA 2OPJA 2OZ8A 4JHMA 4HN8A 5EU9A 1PDZA 2QQ6A 3CK5A 3SN1A 1WUFA 1EC8A 3T8QA 1FHUA 1KKRA 3Q45A 2OFJA 2OVLA 3GD6A 4GGHA 2DW7A 2GGGA 1ECQA 3TCSA 3MY9A 3I6TA 3TJ4A 4E8GA 2PGEA 3FYYA 5IDZA 1IYXA 4E5TA 3SN0A 6ENLA 3R25A 5FJUA 1KKOA 3OW1A 1L8PA 3BJSA 3R0KA 3B97A 3I6EA 3N4EA 1YEYA 4A3RA 4IT1A 2P3ZA 4JN8A 3UJEA 4X2PA 3FCPA 3T4WA 1MDLA 3TW9A 3P93A 3NXLA 2QDDA 3D47A 4HCHA 3RRAA 2OQHA 2OZ3A 4EWJA 4F4RA 4DXKA 3UCCA 3V5CA 4J3ZA 3THUA 5FJPA 3PWIA 3Q4DA 5BOFA 1KD0A 2GGJA 2PP1A 3OZYA 3ES8A 3JVAA 4K8GA 3SJNA 4G7FA 3DG3A 3BOXA 4HNLA 1JCTA 3VC6A 3QKEA 3VCCA 4IL2A 2AKMA 2OX4A 3UJRA 2PMQA 3EKGA 2HZGA 3UJSA 3NO1A 2PTWA 3DGBA 3CB3A 4KPLA 3FXGA 4KT2A 3RCYA 3UGVA 3QN3A 2QVHA 2XSXA 3NFUA 1W6TA 3H12A 3VFCA 2OG9A 3FV9A 4HNCA 1MNSA 4MGGA 2OQYA 3OZMA 3CXOA 2AKZA 2XH2A 4E4FA 4ZCWA 3VA8A 4H83A 2QJNA
chains in the Genus database with same CATH superfamily
3CM4A 1A5UA 3DC8A 4XKYB 2F6KA 3PR2A 4G7EB 1SUXA 5EBKA 2GOKA 1OIFA 3LZ5A 3WFAA 3GNOA 4HSOA 4DUXA 4I8DA 3N13A 1TVNA 3AJ7A 1J10A 4H4UA 3VDCA 4IHCA 4M56A 4CQCA 5CC6A 1XLGA 3LGEA 3S2CA 3WKZA 1A5CA 1EUNA 3NQBA 4LBSA 4FF5A 4S3AA 4Q7IA 4CD7A 2PTZA 4MTVA 5CPNA 3WEOA 1BPLB 2A85A 3HRDC 1JFXA 1XANA 4QE1A 1BWCA 1QI3A 1HG3A 3DYOA 2WZEA 1IZJA 1LBLA 1O95A 1HVXA 3QV7A 4J2PA 2CCRA 2GGIA 4P7OA 4Q22A 4M6UA 3ZS4A 3MCMA 2J4GA 4CQAA 2CLKA 3V75A 1L6FA 2PWVA 3RITA 3GW3A 4EAYA 4FB7A 3NZQA 1Q7QA 3ALFA 2CZ5A 1OFPA 4GI8A 2H3DA 4WXYA 2OO6A 3KWXA 1MQPA 3VGGA 3GS6A 4ILSA 3L5OA 3W71A 3U2ZA 2ZZ7A 4H1ZA 4LUTA 5IM51 3KBMA 4BKNA 3LQLA 1WP6A 4WGXA 5GQBA 5T91A 4Z08A 3SUTA 1ZZMA 4C6FA 1LL6A 1T96A 2BOEX 4GC4A 3NNTA 3OHMB 2UY3A 3LM3A 4GCXA 2DSKA 3TSBA 1SW3A 3WK0A 4I9TA 4GQBA 3MCOA 1KO0A 1PYFA 2EPOA 2HE5A 2XIJA 3DFYA 3THQA 4GYFA 1V3JA 2EEXA 3MKCA 1F2JA 1PPIA 1RA0A 3MP4A 4K3ZA 2QJMA 2FHBA 3NVYB 5C0QA 3PUOA 4MHBA 3QFWA 1F76A 1LP6A 3CMFA 4AIUA 3FVMA 2XGIA 5AB3A 2ZDRA 2BG5A 4LH8A 5AVNA 2E68A 5CH9A 3MQTA 1UPPA 4QAWA 3AUOA 1JCJA 1LF1A 2NT0A 2C19A 3W28A 1RLCL 5DCBA 1OADA 1X1ZA 5A2BA 2QAEA 3S1GA 1TV7A 1UP0A 4H9TA 4I7VA 1GG0A 3IAPA 3LX9A 4JTIA 3U3HA 4US6A 5LNVA 3W37A 4CQBA 2ZA2A 3VDAA 5HATA 4POCA 3GWQA 4H4PA 4E3TA 3L12A 4M7SA 1S5NA 1XGEA 3GFZA 3ZT6A 3EBVA 3W2LA 7TAAA 1H0GA 3LHZA 1IWBA 2PU1A 4R9XA 4H6QA 1XV8A 5JU6A 1NAL1 4H9UA 3MC5A 1T8XA 1VCFA 3KRBA 3N14A 2OEKA 1KTBA 5EMLA 5I79A 5FMHA 1QUMA 2NX9A 1EZWA 3I7SA 1SGJA 1LOSA 3S6TA 3NPWA 3M5YA 4Q8VA 2DP3A 2IXUA 3NSXA 3NPXA 3D0CA 5I24A 1JYXA 5U25A 2W63A 3VKKA 2AAQA 2E3ZA 2FZ9A 3M5XA 3SM0A 1G0CA 3QR0A 3W07A 1JNDA 3IGSA 2OSYA 3HM7A 2PF0A 4E2VA 1VYRA 4NQ1A 4C90A 5A6AA 1GOIA 4C6PA 1BQCA 4O17A 5RUBA 3SFKA 3NCOA 4AHOA 3AZTA 3V5OA 1UUMA 4FI4A 4LUJA 3BURA 2OZ8A 3ATZA 1VRDA 1FVPA 2W67A 4NNCA 3SN1A 1FDZA 2WSYA 3HG3A 4O1AA 2VZVA 1CNVA 3DAQA 2HNHA 3OBKA 2PFHA 5FJIA 3ARXA 3HGOA 1Q8JA 2INFA 2WOVA 3E0FA 5AC6A 1HNYA 1W1ZA 4P7QA 3IVTA 1B0IA 3A22A 1UWUA 3U8GA 1QNRA 4UTWC 4IP7A 4WJEA 3A4WA 4P7NA 1Q6FA 3TH6A 3WDPP 4E8GA 2Y7EA 3WX7A 1A3XA 3A6OA 3RJYA 2GK1A 1OZQA 1W8GA 3E12A 2O0TA 1XBYA 2EGZA 4XO7A 4GXMA 5CZKA 3WK3A 4ZQMA 1U1HA 4NT0A 3BW2A 3KL3A 4GG9A 2HK0A 3I6EA 3AMLA 4UFMA 1GORA 2CZVA 1JZ6A 3WLKX 3W25A 4EXQA 2XIQA 4TVCA 3T7VA 5IBXA 4UTFA 4DUWA 5BMXA 1JGMA 5BZAA 1SPQA 1I1WA 3N9RA 4PEKA 1PV8A 3GZ3A 5K4XA 2BASA 3G1RA 1XHGA 1IE7C 1AZ2A 3CUGA 1JI2A 4ZZ9A 4AX6A 5FS9A 4JEQA 2INZA 3TSMA 4ERAA 4BFAA 4EQXA 4FF7A 1HW6A 4AFYA 2VP8A 3LCGA 2V0TA 4MB3A 3S6DA 4CNNA 3RCMA 1EF3A 4JQ3A 3S5NA 1PSCA 1S38A 5FL1A 3ITYA 2WB5A 1R3QA 3OYXA 2XSXA 4S23A 1XKJA 1AOGA 4TOQA 4GQQA 2CWNA 4ZOEA 3CPGA 1UMYA 5A8MA 4MY8A 3N9SA 2HRWA 2FPVA 4Q4QA 4H01A 3EGJA 4IMAA 4PRTA 4RL3A 1UD3A 4YHGA 4R5EA 2WPCA 4O10A 3VKCA 2PDKA 5A6MA 4K68A 3RR4A 3P14A 4IQEA 4C6LA 3INPA 2AQWA 2YL5A 1XWYA 4RZ4A 3M6DA 4O54A 3H26A 3VE7A 4PL1A 3RX3A 5EPDA 1DQXA 3IIPA 4TMCA 3W22A 3G6MA 4DB7A 3BAIA 4I7UA 4TX9A 2XWEA 4UQDA 1R85A 4JY9A 4XKYA 1LG1A 3RM4A 4D6JA 4G7EA 3QV6A 3KHJA 4QCEA 1UASA 3IC9A 3TE9A 3GR7A 4Q4PA 2YDAA 4OOZA 5HMEA 2R9ZA 4LB3A 2F7FA 2NX1A 3K8KA 5CSRA 3F4DA 3SEPA 2B31A 1EBGA 1FWDC 1AJ2A 3HZ3A 4RUBA 1ZAHA 3LSCA 4UXDA 5AYBA 5I5RA 4XO6A 1SZNA 5DXYA 1R3SA 1PIIA 3LCHA 5HJLA 1PZ3A 1Q3NA 4UOJA 1IF2A 3W7HA 2W79A 3UF9A 1IGWA 3R07C 3HG2A 1I0DA 1E55A 5D2WA 4B5XA 1GQJA 4HHMA 1X39A 4FLSA 1VFHA 1V3MA 1JD9A 3W0KA 3PBWA 4DF1A 4G5DA 2FJUB 2TODA 2YVFA 4OVXA 2CETA 3LRLA 3WDQA 2ESCA 4HOWA 2R1NA 2R24A 3GDLA 2E6DA 3AHTA 5HBFA 1JUBA 1UH4A 4PMZA 5I3DA 4LS2A 3KRSA 4W7VA 2VQTA 4HGXA 1R9XA 3H4XA 4W7UA 3PVFA 1KXHA 3SURA 4HMNA 3ORWA 2GOUA 1MUCA 2DFAA 2NLIA 3IIVA 3LLFA 3W70A 2FVLA 3PAJA 1T99A 1PUDA 1DE5A 1LORA 3QY6A 1FTXA 3F4VA 1G94A 1CDGA 3KHDA 4AEEA 1EP2A 2VGIA 1HXJA 3GX9A 5D8ZA 2HQMA 2QGYA 1ITQA 4DZAA 1XD0A 4MWAE 4WUIA 4KIEA 2ZXAA 1Y8BA 4BI5A 4O16A 4HZMA 3KL0A 2JKAA 4EANA 3NEHA 2D20A 1RD5A 3WLTA 5U1OA 4PC8A 1MWOA 4Q4MA 3OVGA 4S3DA 1YHTA 1GWJA 5AYXA 4AQLA 2J8GA 5KTLA 4AWUA 2PB1A 4JY8A 5BU9A 1OF8A 4DNMA 5DRIA 3BTNA 4ADSA 3TIMA 1RPKA 4YWOA 1BVWA 4WOQA 5I77A 4M19A 5H2ZA 3PZTA 1M53A 1N8IA 4WGHA 4Q8UA 3GK0A 2GQAA 4HHLA 1JXJA 2OEJA 1B57A 2DZXA 3VD9A 2ZZ3A 1BHGA 1DIDA 4CUCA 1XM3A 5KETA 1VBJA 2RDWA 1HO4A 5CBBA 3HOJA 1XW8A 4UTJA 1JUKA 3G1FA 1TA3B 4I7WA 2XFWA 2PE4A 2BODX 3CL7A 1TUXA 3C86A 4K1GA 4B2DA 2O56A 3QXBA 1PYMA 4B9YA 3QR3A 2O7QA 4H19A 4PUDA 3WUFA 2GQWA 4LALA 4MSSA 3DFOA 1XI3A 4KS0A 2BGNE 3ZLFA 5DY2A 2YL8A 4C6KA 4DUVA 3MUY1 3VIFA 1XIJA 1QOPA 4HQVA 2FH6A 4TTUA 3CS2A 3NS1B 3U5YA 2C91A 2Y4SA 3CGDA 4EKJA 4C91A 1M41A 3HURA 3LG3A 4H8HA 2DSWA 1QPRA 2CYGA 3HPFA 4GJIA 2DUXA 3VYLA 2P53A 3G22A 4MJ4A 4GE8A 3DZ1A 3QH2A 2PAJA 1V7AA 1Q1WA 1XIEA 3B9AA 4DNHA 1IEQA 2YR1A 1F6PA 3NSMA 1AH3A 3DU0A 1EXPA 3MSRA 4PCFA 2W27A 1FXQA 4GNJA 3VKDA 4DF0A 5FEXA 1IXNA 1CX9A 2TAAA 3PNZA 1EQCA 4JHMA 3UPMA 1XYFA 1Z9AA 4N9DA 4ERGA 2Z29A 4FS9A 2V3BA 3G18A 5JIPA 1BG4A 5LNRA 3QQ0A 3EDKA 4NJHA 2J7BA 4IIEA 4Y2WA 4O28A 2IW0A 3MJYA 3CQIA 4YXGA 2VYOA 3ZJKA 1OFRA 1YPXA 3O6YX 4DO6A 4RNHA 4GCAA 4FNQA 1IYXA 4H4ZA 4EMWA 2ADAA 2R1MA 3B0UX 1CTNA 2WOQA 4O0QA 3CYVA 2J77A 4GVHA 1AZ1A 4LT9A 5LYRA 3U4AA 4H4IA 1TWSA 1GQIA 1B3YA 4JXCA 7CGTA 1VYPX 4CN1A 3F4CA 5JRBA 1VENA 3LERA 1E3XA 4D71A 2J7FA 1ZDLA 1TPC1 4M6VA 1YKWA 2YA0A 3S2MA 4B16A 1TR1A 1QPQA 1QW9A 3AFBA 3DHPA 1D2KA 5B80A 2NW0A 2Y5JA 2VEPA 4JNZA 5FJPA 1R8LA 4N4PA 1Q6OA 4H8NA 2V3EA 1HP4A 4HNLA 2E25A 1HKMA 1XDLA 3ABZA 1U1JA 4HNTA 4D6EA 2WWCA 4G2DA 1XYCA 4QEEA 5TNVA 3DGBA 1MYRA 1XLCA 2ISWA 1PEZA 1W5MA 2YW4A 4ICMA 4BI7A 3GXFA 5GPRA 1W5PA 5EMMA 1WXJA 1XLDA 3BG3A 4S3GA 4NP7A 4L1GA 2X1UA 2XH2A 4G9PA 2YZ5A 1XJBA 1XLBA 3LV5A 4Z0SA 1RM6B 3LRKA 3N12A 3WSUA 1V02A 3T07A 3N29A 4OBRA 4K39A 1NEYA 1Q1RA 4RE0A 2CFFA 4U5KA 2PDWA 4ZOHB 3GBEA 3W72A 3UPBA 4QLJA 4HA3A 4WCJA 4M80A 4ZO9A 2DH3A 3LM7A 4UZUA 1QMLA 4ROPA 2DV0A 3W7MA 4IP4A 1W9VA 2BOGX 3QFEA 1ZTVA 2BHUA 1PKLA 5A8GA 2C79A 5FI8A 2J9ZA 3FIGA 3M9YA 4Q8QA 3V0UA 2QULA 1SB3B 4QTGA 5DELA 3OVQA 4WKAA 3HPSA 2OSXA 1KGXA 4LC6A 3VOGA 1V3IA 3DC0A 3WBEA 4F0MA 2E5DA 4H9VA 3L4XA 1CLKA 3QZ6A 4Y9OA 3QV8A 1UJPA 1GZGA 3GVGA 3LMYA 1M9HA 4UZSA 2Z1WA 3W1PA 5ER0A 2OYKA 4D6CA 5GRTA 1XIFA 3O0FA 3MTWA 1U2YA 1YDYA 4NI3A 3CMGA 1R38A 1TPB1 1R46A 3RGTA 3W82A 1UD8A 1UR8A 4WY0B 3W29A 2VT0A 2WPBA 5KINA 4C1NB 2WCSA 2A4AA 4LC8A 1FCVA 1GPWA 1U22A 1UZ1A 1GSNA 4PB3A 1KR0A 1L6WA 2KX9A 1CCWB 2VFDA 3NQ2A 1U5HA 2Y5SA 2ZUUA 3L9CA 1XR2A 2D2JA 3AHVA 4EIVA 1V59A 3HV8A 1NDYA 4Q8OA 3NPVA 4N7QA 1VKFA 4ZA0A 3OZPA 2PUZA 3B8DA 4UC5A 3MV01 3EB4A 5FD0A 1K7EA 1LBMA 2YYTA 1GG1A 3NL6A 3RX2A 3GY1A 1AH4A 3L68A 1GHRA 1C8XA 5DT7A 2BB0A 3ARQA 3AZSA 1RH9A 1BVZA 3WLRA 4RZ6A 3SSZA 3DYPA 3AIQA 3W23A 1MMFA 2CPUA 3H4GA 3NQGA 1SO5A 2WKGA 4CNSA 4NJJA 4Q8TA 3C0LA 1TV5A 3NL2A 1ONEA 3NWRA 1S2AA 3WH8A 3PBYA 4XZNX 5BRBA 3AXXA 2BC1A 1NY1A 1DHPA 5KSWA 1AD1A 4MNJA 3CGCA 3DIPA 3EOUA 4JTDA 4DY1A 1K3UA 5LGXA 2A5HA 1V3HA 1E9YB 3TN5A 3CZKA 2FLIA 1EJUC 4F0RA 4KH2A 5CSSA 1J0HA 3STPA 5T9BG 2V8ZA 4XBJA 2J7HA 3HJZA 2PWUA 5JCIA 1RUSA 4ASTA 1VPQA 3I3BA 2QS8A 3UG3A 5AHEA 4MYXA 2WOWA 4TX6A 4GX8A 3LXBA 1E56A 2G50A 4DVOA 2YBUA 2NSXA 2OTDA 1TA3A 5AYZA 1VPYA 3U7BA 1P4CA 5I6SA 1W56A 3M41A 3NTYA 2W66A 1PKNA 3HMCA 2TSYA 3HQNA 3W53A 4E4PA 4UQBA 3ENLA 3IV8A 4IM4A 4GYPA 3WD1A 1QK0A 5JCNA 4LYPA 4PSPA 4KCUA 5FEWA 1JPHA 2A21A 3ZLHA 1KM6A 1FBAA 5K2ZA 1TJ0A 1UMLA 1FX6A 1HL8A 2WM1A 1TO3A 2GR3A 2V3AA 5AHLA 2ZUNA 1EZ2A 2ZXQA 1RK6A 5G4HC 4JKMA 2F2KA 4XVEA 1KWGA 4AXKA 2AGKA 1K77A 3QVQA 3BG5A 1KCXA 3HO8A 2C1HA 4IOTA 4D6DA 3R8RA 4WZHA 1Y5VA 2CWXA 3KLKA 2HMCA 4LAOA 4AMCA 2JK6A 4KPRA 4WOZA 4C65A 3VABA 4XD5A 1X6UA 3MT1A 2GRTA 3O6DA 3B8SA 3OW1A 1JDAA 1WZKA 2VC5A 3LS9A 1L0PA 2XINA 3GRIA 1Z42A 3HB9A 3T0AA 3VMOA 1HIZA 3P60A 3VNYA 2VXNA 1H7PA 4LRSA 2WMKA 5J5RA 2G4JA 4HCHA 1NFPA 2X2GA 4Q4KA 2V38A 2ZZ1A 4Y9NA 2A79A 3GVVA 3W7LA 1MO9A 1MRQA 1AW1A 3QJAA 3BLPX 1IXQA 5BWFA 3A7RA 1UR2A 2EHHA 3MDUA 3AISA 4HTBA 3PZOA 1Z8AA 5CPQA 5K9DA 3ES8A 1TVLA 1I2PA 2I56A 4AD1A 3P74A 3VC6A 2J7DA 5TIMA 2PDNA 5H6HA 4O13A 5EBAA 3UJRA 1ZKQA 1WX0A 4KGLA 5F7UA 2WMIB 4IGMA 4BS0A 3H2FA 4ICCX 1UQYA 4ZOAA 2AAMA 4LU0A 3PUEA 5D9NA 1UYQA 3BVJA 4JIQA 2B81A 4AB4A 4AEOA 4DEFA 5DEZA 4V33A 4FEZA 1KM4A 4LTSA 1L2QA 1AQMA 4GOAA 2ZUSA 4FHAA 5HMSA 2G3MA 1S39A 2E1WA 1B9BA 1Z69A 3GXIA 2FGBA 4GYKA 4MNMA 1L9WA 1DWGM 3SRHA 1LTDA 1MRAA 2W4XA 1G4TA 3H6OA 4GH3A 3U9IA 3R11A 3NVZB 4H9YA 4XAPA 7XIMA 8XIAA 1AQ0A 3TOYA 4YWSA 4K7ZA 1TE1A 4GBDA 1PHWA 4B5UA 1N63C 3TW7A 1H3GA 3GO2A 3UXDA 3KBWA 3ALGA 3VKBA 2C14A 2DJXA 3AXMA 3E2VA 4O1EA 1QU4A 4IGNA 5AC5A 3T4CA 3EOEA 4B90A 3TJIA 3ZXWA 2QAFA 2PTXA 4XQ6A 3BLDA 2QCDB 3RO8A 3MMTA 2VHLA 2ANUA 3TDFA 2HE8A 1V77A 1XP3A 4DX3A 4ZGYA 5LIYX 3W7DA 5FSEC 1RJPA 3AZRA 3N25A 1HJWA 2ZICA 2V69A 3V1HA 2HJPA 3QC0A 3VGBA 5JCKA 4QE5A 2ZZ4A 3PB0A 3WZ0E 2W0HA 1E73M 3RO6A 4EQRA 1LYXA 2QUMA 4RKAA 2XVKA 4AD2A 3CHCA 4CU6A 1B3ZA 1DORA 2FZNA 3DN5A 3K4WA 2VKZG 2JF7A 1GZ1A 2WZHA 2AAAA 1G5AA 4AWEA 1E6QM 1X6LA 2VFGA 4EPEC 4UFLA 1N8WA 3TONA 1F8MA 4E2BA 4TR9A 2Y7FA 4GY7A 4M0XA 2W3RA 4NNBA 3ID7A 3UYCA 2DDXA 3QY8A 3I6RA 3BAJA 5FACA 3IGXA 2HSAA 4S39A 3HQ1A 3E0IA 1VR6A 1U5JA 1IWPA 3LLXA 4NJIA 4GIYA 1HKKA 2PLCA 3IIZA 2HVOA 4AZHA 2WXDM 4RE4A 3FGCB 1T3QC 1XUZA 3W1XA 4K38A 2WBAA 2OQLA 4WVXA 4XTDA 1KCKA 3EWXA 4K7YA 3TROA 4HA0A 4XSMA 2WNZA 4WY0A 4NSBA 4JL1A 1PJ9A 2ZX7A 5DT5A 1XHCA 1QI4A 1MO0A 4NZ3A 4C1NA 4S3JA 3QLLA 1X6NA 3DHFA 1XRTA 3GUWA 1TIWA 2Y62A 3KBVA 1W9UA 2CEQA 1NSJA 5DFAA 3RLGA 1J0YA 2TMDA 4J56A 2R91A 4J5NA 4HZ6A 3ARPA 1GW1A 4JS3A 3KW3A 3SADA 4Y8EA 4GISA 2BOFX 4LB4A 3J7HA 4KESA 4IPLA 3DFHA 2DZVA 2X1SA 4U33A 2AL2B 3RCNA 3MHUA 3B8VA 3O0HA 5KZMA 3NQ8A 2VVNA 4TU1A 5HJXA 2JK2A 4GUIA 2BXVA 4IQJA 2WC3A 3C2OA 4FP1A 4D2JA 5I02A 1V79A 3U2EA 3ZFHA 3QEZA 3BAKA 3EB2A 1NDVA 5LIWX 3QPEA 2D2GA 5CC7A 2CHNA 5A8QA 4ALDA 3UZJA 1GERA 1XFBA 2O55A 1IEIA 1OJXA 3VNZA 1OQFA 1ZALA 1QHPA 4A29A 4OBSA 3CHEA 1KB3A 4U2YA 2RFGA 1TB3A 3BICA 1EGVA 1DVJA 1XG3A 3AI0A 3U7VA 2JEQA 3C4UA 3NQ7A 1KM1A 1KN0A 3ARUA 4AD5A 4ADWA 2W3ZA 2NUWA 4MZ1A 4KCVA 3UT0A 1P0DA 4LCQA 4ZXOA 3GYCA 3VNKA 4JQ4A 2WQDA 4OT7A 5BXPA 3VGFA 3ZR6A 3CT2A 2BFGA 3DG6A 2ZUTA 4JCLA 2EPNA 2UZ9A 4H50A 3PANA 4L6DA 4REQB 1VDVA 3MZ2A 3CWHA 1KFCA 5FF0A 1CB2A 3VNIA 1YPFA 3SIZA 3T0TA 3AOFA 4J57A 3NSNA 1BXCA 2O9PA 3UQNA 1B54A 4ZEPA 3FSUA 5HK4A 4GVGA 2J9XA 3CWNA 3UZZA 3VILA 4OJYA 1FEBA 4JTTA 1A5SA 1SSDA 2PC4A 2E3TA 1E71M 2PDQA 3GHSA 3FHAA 4DJFA 1Y0EA 1VZWA 1Q85A 1NHSA 2ICSA 3TC3A 1P6WA 1BLIA 3IVSA 4Z2GA 5FJUA 3P5ZA 3P80A 1CENA 1EDTA 3B9EA 3LENA 2QUUA 4J9JA 3SR6B 1R86A 2NPXA 1NFBA 3SIMA 2X05A 4PR4A 3T0BA 4JD4A 1WCGA 4DXXA 2G41A 3UJEA 1AJ0A 1K8ZA 1T6MA 3BGGA 3BOLA 1US0A 4QCFA 2BBFA 1AA1B 2CW6A 5I3HA 1R2SA 2YQUA 1SZFA 1NWRA 3G6LA 2VCCA 1R3YA 2QMKA 4P5UA 5AVHA 4CQ8A 3DGRA 3GNXA 1OJTA 4FSAA 4PYSA 2DVTA 3BARA 2XIIA 1KM3A 2ZWYA 1SO4A 1BVNP 1UR9A 4YPJA 3CAKA 4IL2A 4AVNA 3LHYA 1Z3NA 4HKPA 4FLRA 2C13A 1OC5A 3NO1A 2C0HA 4PMNA 5IOBA 5AC7A 3PPCA 4FXJA 4ACYA 5PTDA 4UMBA 2UY5A 2CLIA 3AICA 2X09A 2VGFA 1A50A 1DXFA 4WJXA 3CXOA 5K9XA 3N34A 4XWUA 3RM8A 4S3EA 2PGRA 2Y7GA 1LPFA 4NG3A 4H4VA 1R7OA 4B3LA 4TVYA 1US3A 3AALA 1E15A 3OGVA 3LADA 2GVLA 2WMIA 3G8RA 3SCPA 1TPFA 4GFSA 3UWYA 3GBDA 1OCNA 1WZMA 3T40A 3UYIA 4JIIX 2I17A 3HJEA 4Z17A 4BURA 4I9AA 2VTFA 1S2CA 1RK5A 5D03A 1JRBA 5FF2A 1LWHA 4D8LA 3TAOA 1TPDA 3VZYA 3OBEA 1M7JA 2QJJA 1VBHA 1Z41A 4WXZA 5CKSA 1JD7A 1XLMA 4MZYA 2QUVA 2WVUA 1OG6A 1TIMA 1XIHA 5C55A 3T0DA 3H7VA 5LKYA 1ZHAA 3P7YA 1DWAM 4FOJA 4J4KA 5D02A 4DO4A 4F9DA 3GG8A 2QF8A 2OCZA 2CLFA 1FH8A 2PGFA 2YBVA 1JI1A 1QNVA 3C52A 3NM1A 3LTSA 3SRDA 5HDRA 1FWFC 2XHYA 4HPGA 3CUHA 3MU7A 4UQEA 3TU9A 1O5XA 3CXBA 1RY8A 2FB3A 2ON3A 1NELA 3GKAA 5JQ9A 4GZEA 4QM1A 1V97A 2F9RA 1KRCC 3HMJG 1IT8A 2QYGA 1W1A1 2FMNA 4GIRA 1UKOA 3I3DA 4CEXC 2ZFAA 2PU0A 2VO5A 1D3CA 3UPWA 2F8QA 1GVQA 4ZL1A 2X8GA 1ISWA 2OLAA 3P2VA 3E0LA 3CPUA 4DIAA 1W31A 4Y7EA 2UY2A 2CBIA 2GSEA 1JZ4A 1AUSL 4AAJA 5JVLA 4O0ZA 2ISFA 1RP8A 4YTRA 3LRMA 4QQUA 2J66A 4AEFA 5B7ZA 3VC5A 2X1TA 1S2VA 3NDOA 4BWLA 2Z00A 5HR7A 2PTDA 1AK5A 5A6JA 4B5TA 4GI4A 1S2WA 3WQ5A 4FX9A 2WOIA 1KLYA 3W1MA 1QNSA 1CECA 4PUEA 1P0BA 3TJLA 1XGDA 4Q8NA 1ZNNA 1BTMA 2PF8A 1FRBA 1JDCA 3WUEA 2DPEA 1C29A 1FWBC 2QCNA 3DK8A 3FGCA 4GQ0A 4PTMA 5G5GB 3L2IA 4Z2LA 5FAJA 4GYJA 1GOOA 2ZUWA 2CITA 4G8TA 3BQ5A 4JDYA 2C18A 3H22A 4L7ZA 3OO2A 5E09A 1UHVA 1PBGA 1TKKA 3GNDA 4NZ4A 1F07A 4PH6A 4M52A 2WP5A 2XYLA 3WF2A 1TX0A 4GC3A 2B7NA 3AROA 1HF6A 3LCIA 3WLPA 1ZU8A 1FO4A 3IJ6A 3URQA 3C2VA 4GA8A 1QBBA 3W2NA 4ZODA 2B7OA 2VVSA 3PTKA 1BG9A 2EKCA 1WYIA 3S5SA 3KVJA 1OWQA 4MM1A 1DTUA 3IJQA 2H90A 3U5UA 1TYGA 1IWAA 3KAOA 5DRCA 3LMZA 4N9BA 3E2QA 5A6KA 4HVXA 4ZO7A 2AL2A 2OYLA 3E0WA 4LAZA 1DPMA 2E09A 3I7RA 1GYLA 3G1SA 2QDEA 3CGBA 3NQVA 2XISA 4GY1A 1H7NA 3IANA 1NIUA 4B5SA 3QSRA 1JZ3A 2GR1A 3NZGA 4HK5A 3PPGA 2QXWA 3T08A 2NQZA 3KOWA 2BV9A 4NX5A 5K3VA 2ABAA 3EX4A 3B4UA 3BAXA 3ITLA 4EPBC 1FFVC 4NEWA 2OKOA 1XLJA 5HQMA 4MKSA 4DO7A 3LGDA 1TE6A 2XFYA 2I16A 5HPCA 2BXYA 3A3XA 3URNA 4KFOA 1J79A 2TYSA 1AD4A 2GLKA 4ZQRA 1MZRA 1FEAA 1RAKA 4C6IA 1AMYA 4BQ5A 5I3JA 1WZAA 5KZ6A 3NQMA 3T8QA 4RZ5A 1WQ5A 2ZX5A 2X0SA 1XH0A 3CUFA 4OTKA 1W32A 4EP8C 1JR1A 1ZY9A 3AIUA 1E9ZB 4ATWA 4TVWA 4IFKB 4MDPA 4REQA 3VO0A 3Q94A 3L21A 1FHLA 1W3JA 1OFDA 4C5YA 4LS1A 3WMLA 4A8LA 2J3NA 1WE5A 1W1TA 2VEFA 1GGOA 2VWTA 4RDWA 3RIKA 4R7WA 1HVQA 1GRAA 4WSJA 4LEQA 2UY4A 4LWWA 2YGYA 3BH4A 5EMYA 1Q2SA 1IT7A 2A8XA 1A49A 3FCPA 3UNTA 1E0WA 5FKYA 3SY1A 2W6RA 1O1HA 2XVNA 3P8JA 2PLJA 4J3TA 3SUUA 3UETA 1QI2A 4Q8WA 2OWCA 4C1LA 3S9ZA 3WF0A 2EPLX 2RJGA 4CGTA 3TVAA 3RU6A 3SCVA 3O05A 1SM9A 2QCHA 3EWUA 4BQ3A 3VNLA 3WMBA 3BPWA 5BROA 1W3NA 2PP1A 1VFTA 2WW5A 2Z7KA 4QFUA 4JTAA 1REQB 4QDMA 1XLAA 1NDZA 1JCTA 3PN8A 4KEVA 4XISA 3R79A 2VX5A 1FDYA 4R9OA 1W3IA 2OX4A 1V0NA 1YDOA 3QY7A 4LV4A 1GYNA 1B90A 1KR1A 3CUIA 1LG2A 4TVDA 4ZQCA 3VM7A 4ACZB 2OQYA 3OZMA 1E5JA 4DYKA 2IXVA 3WUBA 1PHQA 1H09A 3W24A 3WJWA 1F4AA 2R1LA 1WZLA 4IISA 3QSTA 1CT5A 1GQKA 4UTLA 3HN3A 3NIYA 1U30A 2W9MA 1B4EA 2PDCA 3WQDA 2QF7A 1BF6A 3KOYA 2YAUA 1KRBC 1SFSA 5DY3A 1LQAA 4NAEB 2C1GA 3T8LA 3LA4A 2WZMA 3M7WA 3ITGA 1GW9A 3P0XA 4AY1A 3ITXA 3PPHA 1DJIA 3S9YA 5ABEA 3G1XA 3WH5A 5CLWA 3E02A 3U4FA 1UJQA 2V5BA 1XGZA 4EF9A 9XIAA 3WUGA 1FQ0A 3UWQA 2WP6A 4N02A 4YVVA 1R47A 2PDIA 4HPHA 3H2NA 1W54A 3OVPA 3H4KA 3OODA 4GPNA 3ARZA 3NM3A 4HMDA 4C7DA 3A7UA 2GWGA 1J6OA 1R30A 4PFMA 5J5DA 1S2TA 3STGA 1JPIA 2P76A 2PDYA 2QV4A 2DZBA 3L66A 3N6HA 5ABFB 1DEDA 1QPOA 3QQWA 2YLLA 2DEPA 4PTVA 1TWWA 1EHNA 1R9ZA 3M6YA 5I3KA 4KF1A 1XIBA 1WAUA 2ZRXA 5D05A 2OT0A 4LOCA 2UWFA 1BKHA 1IV8A 4EXAA 3EYPA 2EPMX 1D3GA 1PO9A 1UWIA 5DBUA 2JF6A 3CQHA 3TN3A 1BEUA 1V3KA 2ODOA 2WHJA 1H63A 2GYIA 2JBMA 3W38A 4JOMA 2CZDA 3P84A 3B0PA 4JQ9A 1QNOA 4XD6A 1KFKA 5AKQA 5B7YA 5C9ZA 2QR6A 3VM5A 1P0EA 1ZQ5A 1J5TA 3E6EA 3H7UA 2YFNA 1E4LA 3UA4A 3NDZA 2QJIA 3FJ4A 3WELA 5AOUA 2JGYA 4HN4A 4QQ3A 5F4WA 2Q71A 4U5IA 2G0WA 1V3LA 2G3IA 4JAWA 3SUVA 3WDRA 1RVKA 3EF6A 2WQPA 4PBEA 3DHDA 3WCZA 4MAVA 4AYSA 1EJSC 2OJPA 3WO8A 1GESA 1AJZA 1JAEA 5MKGB 2GGHA 4XSLA 2CKSA 5A6TC 3ANVA 4WHBA 1EL3A 3KDOA 5CZJA 1ZXIC 3N2XA 3GU9A 3GXNA 1B3VA 4S2BA 2OODA 3TR2A 2I57A 3UR7A 2WKJA 3G1HA 3LGGA 3MO7A 4QNWA 4FOUA 3KP0A 4B3KA 1EYEA 3WL1A 1LT7A 1ZBCA 2XSBA 3PTDA 3EWYA 4S3CA 1X8CA 1T7LA 3CL6A 5C9XA 1QDSA 3W83A 2Y8VA 1XSKA 3MVTA 3QMSA 5C54A 3K30A 1DWIM 3A4XA 3VINA 1I9CB 3R94A 1SJBA 3GNPA 3TTYA 1QPNA 1ICSA 3DH7A 4OGZA 1J12A 4LAUA 1R5YA 2J13A 3LI1A 5IDIA 2A1YA 4AU0A 1T41A 3BGJA 5JXQA 4NRSA 4UMCA 4RZBA 3ZM8A 1Q8AA 1CGYA 4I6VA 3REQB 2BY2A 1UD2A 2YCKX 2ZZ5A 3CLWA 1Y7VA 2PWHA 3OIHA 4FNSA 5DMLA 5M3WA 3LCXA 3E74A 2EJ1A 3B0XA 4HOZA 2RHGA 4AZBA 2DZSA 3W7QA 3PG8A 4UFHA 2ZA1A 1M6IA 3VNMA 1GV4A 2CBVA 1EH9A 2WMHA 3K2GA 2X1RA 3SCRA 3CQKA 2WK2A 4DZIA 4J3VA 4Q6XA 2YPIA 2YB1A 3OLGA 4W84A 5LGZA 3W7IA 4YHEA 2ZX9A 3W7RA 4OZOA 1PDZA 3MHFA 3E9AA 1WUFA 1UR0A 2Z1SA 4QNEA 5TAOA 2PD9A 4L4PA 4MB1A 1EDGA 1G4EA 4UB9A 4N0RA 3W4RA 5LIUX 2WVTA 3HPZA 1QO5A 4O11A 1VEPA 3AMGA 4UOQA 5G2WA 1KA9F 4WDUA 5I00A 5LZLA 5FF7A 4QG6A 2HPIA 4L9YA 3RNMA 1M68A 6PTDA 2C71A 1HFBA 3GTNA 3BDKA 1JL8A 2QCCA 4BF9A 3SCSA 3T78A 1E0XA 2WPGA 1Q7MA 4K8HA 4L9ZA 2HPMA 1WDPA 3ARWA 3OC4A 1YTDA 2QZRA 1XICA 1UWSA 1EB3A 1K1DA 3WLLA 4IFKA 1OCJA 1RJQA 1W8SA 1KM2A 1KRAC 3BXWA 4IXXA 5HINA 4BEQA 1BWVA 2GR0A 4DBUA 2P5NA 3RRAA 4GLEA 3BK0A 2YYUA 1LUCB 3VKAA 5E9XA 4H6EA 3BV4A 1UWQA 3O15A 1YXDA 3W86A 4CNUA 4IPPA 1RBAA 1JOAA 3BCDA 3GUGA 3L4UA 4XAFA 5FS6A 2YB4A 4JTSA 3N11A 1V6VA 3ZJ6A 1EPXA 1D8CA 5KZDA 1FDJA 2FH8A 3EB3A 1U5VA 3QKEA 1W2VA 4X61A 2PDJA 4QBXA 3IJ9A 1A4MA 3EXRA 3WMSA 5C7VA 1ZLPA 1JF5A 3R4IA 5GNZA 1GK8A 3H21A 2QPSA 3F2BA 1S3TC 3HBLA 1JEZA 3FAWA 3RCYA 4FK9A 1DIEA 4FZIA 1F8WA 3VIHA 3QPZA 3RMJA 4G6CA 3NO3A 1REQA 4A8IA 2HISA 2FDSA 4UR9A 4E38A 5M03A 3K8MA 2BY1A 3N2OA 1D7KA 1XXXA 2ZADA 1J01A 2YSWA 3BLEA 1LL4A 3L2MA 4AZ7A 4XAZA 2FZMA 4C6DA 4B4FA 2AQOA 1EEXA 5D30A 4HA1A 2HROA 3WYZA 3EDDA 1W9DM 2WANA 4ACZA 2IPFA 2XVLA 4JBRA 3UZ5A 4X3ZA 3L4VA 1L6SA 1K9DA 3PJUA 1KV5A 3PZVA 4H41A 5E0KA 2R94A 1GVSA 3LI0A 1GREA 1SW7A 4M6QA 3LBCA 5A69A 3MUCA 1M7XA 3ARVA 3THAA 3B0VC 2PDPA 5A6LA 1EJWC 1E9IA 1LLOA 5T9CE 1ZP3A 4O52A 1T40A 1YXYA 2D0HA 2QPXA 2Q8XA 3RLVA 4M81A 4DRSA 4NAEA 1JCNA 3OA3A 5LA1A 2H8ZA 3B05A 1JVNA 3S2LA 3B8IA 1GOWA 4AC1X 2BGSA 2Q09A 4ZSUA 4GUFA 3K1DA 3ZO9A 2J25A 1FKWA 2E7FA 2E9BA 2FVKA 3V18A 4GINA 4DAIA 2PURA 4DJDC 3WJYA 1V6WA 1JCYA 2WLZA 1GQLA 2POTA 5ECVA 1R0MA 3RR1A 3BSGA 1QNQA 5CG0A 3BAWA 1GEQA 3VOIA 2GUBA 2DIEA 3CWOX 3DCPA 4Z1YA 5ABFA 2J9YA 2E1DA 3ITVA 3MW7A 1ODZA 2BC0A 4KKXA 3BV7A 2J88A 3T42A 2DVUA 1PDYA 4WY0F 4TX8A 2E4TA 5LA2A 3TWAA 1TPUA 2ALDA 5HWMA 3QZEA 4H3DA 7A3HA 1ONRA 3IJLA 2J74A 1E5NA 5C8BB 4OUEA 3WQFA 3KOFA 2VI0A 5FEZA 3AYRA 3ABRA 2P1FA 3SCTA 4HD5A 1H6VA 4CD8A 3W7NA 1NH6A 1UCWA 1JUEA 1KBJA 4TVUA 4QROA 1TPVA 1J2WA 3FJNA 4UBPC 3GTHA 3P0WA 4HJWA 3C3NA 1XYLA 1K6AA 4L4LA 1UWAA 3N1AA 4HCLA 4DNAA 4QSFA 4PODA 1AODA 2EAWA 3MV11 2R8WA 3MBDA 4DWDA 3N15A 4MWAB 5ECUA 1GPFA 3VDGA 1TJ1A 4B5NA 1MXGA 1POJA 1YE4A 5MKGA 7ENLA 2RGMA 4RXFA 1O1ZA 3IUIA 4CCEA 3TQVA 5E1QA 1W1YA 3VOHA 3PP7A 1HTIA 1FWAC 1CPUA 2VC7A 5DBTA 3O9NA 3MA8A 5HUPA 3GR8A 3TWBA 3W7CA 2OWWA 1B3OA 4D72A 3QBUA 3GU2A 1FECA 4B9ZA 4P8XA 2VRQA 1G4SA 3N6QA 1OSEA 3NQ6A 1TWZA 4MMWA 2QLYA 4EACA 2PS2A 4GH1A 3TTEA 1W3TA 3MSYA 3FKRA 1RV8A 1SZGA 2FHFA 2MNRA 3DFQA 5HJYA 1O5KA 2ZOXA 3GC5A 2J78A 4DWSB 1UOZA 4YVPA 4FALA 4QJ3B 4JL2A 4C6JA 5FJJA 2E67A 2XM1A 3EMCA 1HKVA 1IEWA 5FS7A 3DJGX 4GKTA 1SO3A 1GTEA 2DIKA 2H6RA 2GDVA 4ZSTA 1TMHA 3UR5A 3SCQA 5D33A 2ALRA 2X7VA 2FQIA 3W87A 5IFTA 5CC5A 2PBGA 4BY3A 1E6RA 2BX7A 1GOMA 1QATA 1O7AA 2GQ3A 3REQA 5KZEA 2ZIDA 4XAGA 4ZB5A 2NQLA 5AYIA 1VEOA 5D38A 3W1AA 5AHNA 5BU6A 1F05A 3CNYA 4JR5A 2GJPA 3KTSA 1X2HA 3CK5A 4S3FA 3LV6A 1FHUA 1Z7AA 2G3JA 1A5OC 1I2NA 2FFCA 2VX6A 3PPFA 1V6TA 1G7VA 1TR9A 2YBTA 4OWGA 3ZMRA 3CUXA 2QW5A 4GI6A 1RVGA 2Y7DA 1FY6A 2DVXA 4P8UA 1XYZA 3LQGA 3UR8A 4PCSA 3TCSA 4YYFA 1F3XA 1IEVA 4PMVA 3WF1A 3XISA 1CGWA 2ISDA 1SSGA 1TFVA 1FWIC 1ML1A 2O9RA 1UP3A 5FEPA 1EP1A 4QISA 1TZ9A 3LPFA 2BLEA 2ZZ2A 4P61A 1YNQA 4L61A 3TC6A 2WPEA 1HZYA 4RXGA 3BE7A 4KETA 5DQPA 4YU1A 1LT8A 4XBSA 1W2PA 5JH1A 4W7WA 1IT0A 3O07A 4XBKA 2BHYA 3ARYA 3P93A 4XG1A 5LIKX 4FLQA 4QJ1A 1V08A 3H2EA 4PZVA 1EJVC 2YXOA 3VUPA 3DFPA 4X63A 1JGIA 3NQEA 1FWSA 4XKMA 1EGZA 1W9XA 3M07A 1Q6GA 3TMLA 3H24A 1JXKA 1OF6A 3KZSA 4AH7A 1ZJAA 4M1BA 5F2LA 3NPUA 4AIEA 3SZ8A 4B3ZA 1LOLA 1YPIA 1VFLA 3UW6A 3UZWA 1EJ7L 3EANA 4ZTYA 4JFVA 2OO0A 2OZ0A 1LUCA 1W91A 4JYDA 3LTYA 3MP5A 3FXGA 1OYBA 1JJKA 2E40A 4OBTA 2CLOA 5T8GA 3OB8A 3GM8A 4PTXA 3FV9A 1BYBA 3BOFA 3V16A 4QE4A 3TYEA 4ATDA 1P1XA 1DHKA 1ZUAX 4X9YA 4H83A 5BRQA 2ZZ0A 1QI0A 3FFSA 1JNEA 4IFOA 4DYEA 2P8CA 3RUBL 3PZQA 3BAYA 4F40A 2GPTA 1OM0A 2X42A 3OLDA 1K70A 2POZA 4A05A 3DGZA 2Y8UA 1OFBA 1ZL1A 3L8KA 6CGTA 1F3WA 2VC6A 1D7FA 2YL6A 3WLMA 3TQ0A 2FTPA 4U31A 3ZQ9A 1FIQB 2NVKX 4H6RA 2BVTA 4WDTA 4ZFCA 1ZMDA 4PRWA 3EOLA 4U10A 1H7WA 4A6GA 4S2CA 1DYSA 2ATSA 3QHOA 3PJWA 2ZYFA 3STEA 4N6FA 3WL0A 3AMDA 3NURA 4Q3MA 4LYQA 1UC4A 4KCTA 4L64A 3DFSA 4O53A 1RR2A 3W81A 3EDEA 1EEPA 1ZMCA 3EX2A 3UCDA 5H8UA 1ELSA 3W7PA 1TMQA 3GDKA 1DJQA 4ZENA 3BMXA 3OZOA 5DLCA 1G7UA 3I65A 4JTFA 2XTKA 3MKKA 4DJED 1P6CA 2PCQA 2WMFA 3LU2A 4XZIA 4XK2A 1O66A 2NZLA 3RK8A 2OGYA 5FSDC 3BUVA 3SBFA 4QSHA 1QOXA 3VD3A 3LY0A 3G2GA 3F2CA 1EC9A 1S1PA 2CLPA 2P0OA 1TG7A 4FO4A 4EQSA 5E0FA 1H62A 1F3PA 1GXFA 2PODA 5CGMA 3R6IA 3LPPA 3AYVA 3GNNA 3KTCA 1O6IA 3RLHA 3ZR5A 1E6ZA 2PRMA 4LNCA 3CIWA 3OTRA 1HKIA 4L6OA 4F0KA 2C8NA 1C7TA 3TKFA 2IUZA 3UERA 2WHLA 2XU2A 4GR1A 4IFRA 3TYZA 2ZE3A 1YW1A 4KGJA 1MSSA 2W62A 4IMGA 4AZ5A 5REQB 3AMCA 2Z27A 4KRTA 5DO8A 3LXCA 3W1TA 1E0TA 4PL2A 4Q7NA 1PZ0A 3ZSSA 1PZ1A 4JDBA 3ONCA 4H00A 2YLAA 3RHGA 3UEQA 5H8MA 1XL9A 3VIIA 4NJGA 3GQYA 3MWAA 3MP3A 5GNXA 3AWNA 3GG7A 3WQEA 1BF2A 5M1TA 1SO6A 1HGWA 2E6YA 4LJ3A 3P3BA 4ROQA 1VPXA 4W85A 3HGRA 3U6WA 1MXSA 2WYSA 3SJ3A 1C7SA 3FVDA 4GQGA 1Z32X 4A22A 3UA3A 1MQQA 4CU7A 3UNDA 2X0YA 3H55A 4DJEC 3B3DA 4HCDA 3SI9A 4PUWA 1MOKA 3LCWA 4Z1CA 4MFEA 5F2IA 2DT2A 2PP3A 5EKYA 3LN3A 4MWAA 1VCGA 2ASHA 3T55A 3RNDA 4X0VA 2GVEA 3VGHA 1X38A 3M0VA 1ZBKA 1KBIA 2DIJA 4Y6GA 1CB7B 2WAGA 4EAMA 4GKLA 1CWYA 4QGCA 3IK4A 1JCXA 3JZEA 3CO4A 4IPJA 3UU0A 1PX8A 2JKEA 3ARSA 4XD3A 4UCGA 4LCSA 4K2SA 5AHMA 4E4UA 2FKPA 2FMOA 1X7IA 4LUSB 6ALDA 2WZIA 3IRSA 1CGUA 3ME3A 2FGZA 3W75A 3FYPA 3QKZA 3E5BA 4NXKA 4DWSA 2RDXA 1ME8A 3RXZA 1UW9A 1VIWA 3PJTA 4YIWA 3RN6A 3OBAA 4JTGA 4JIHA 2ZXDA 4AHQA 5EY5A 3MCNA 1KFJA 4E3VA 4BF5A 2CLMA 4IQLA 3QQ1A 1CXEA 1V8EA 4HPXA 4KWWA 1NP0A 4NIRA 2Z0IA 5HNNA 3IS4A 4A8NA 2WC7A 3EX6A 1UZHA 3B04A 4PUUA 4GABA 2I9UA 4QJ4B 4BZYA 2E9MA 3VNDA 4KFPA 2PC8A 3CH0A 4W4QA 1WOBA 1PE1A 5G1MA 3EOOA 1ECQA 3VE9A 4UTMA 1DV7A 3W2UA 3BANA 1Q65A 1X1OA 1C9WA 4ZO8A 3R25A 1OX6A 3G0SA 4IMCA 3CAVA 1YBQB 3GTFA 4IJBA 1ICPA 2ZWZA 3P5YA 4LEFA 3WH9A 5K4ZA 2A3EA 4XAYA 4F2UA 3LBOA 1GTHA 3LXDA 1QTWA 4ZXLA 4UTKA 3RPTA 4IT1A 1SYTA 3V0TA 1BZLA 2P3ZA 3GU1A 1CXIA 1SVDA 4X2PA 1M7OA 4US5A 4GWEA 3OJGA 8XIMA 2HK1A 3TAKA 1JRPA 4KERA 4RV8A 3CIXA 3DECA 1CXLA 1X97A 2W0UA 3V5CA 4PB5A 1MW2A 4AG0A 5I3FA 1UKSA 3PWIA 1D9EA 3N17A 5HXMA 2GGJA 4FXFA 4NF7A 2PWGA 4UIOA 1TYPA 1TWIA 1W9PA 2PWDA 5ABGA 4N4QA 3WNNA 4H04A 2AKMA 4ZE4A 3TK7A 3EKGA 2Z2AA 2QDGA 4JHZA 4W88A 3LHTA 4CCZA 2V5JA 1AL8A 3D3FA 1CLVA 1MXDA 4O0KA 1TPH1 2O92A 4PFHA 4Z2HA 3MUZ1 1HJSA 1KRMA 4EWND 2WMJA 1TX2A 1EX1A 1XDIA 1PWMA 1BSIA 3WLNA 1KGUA 3GD4A 1PAMA 3W74A 1MNSA 1YNPA 4E8CA 4R7OA 1XLIA 3H4WA 1N5XA 2NWRA 3PY2A 1TSIA 1RQEA 1XYBA 2A6LA 1HUVA 1HKWA 1UH2A 3BW4A 4ENLA 3UWWA 1BGGA 1DP0A 2TPRA 3DFTA 4N9CA 4E2OA 3S1VA 4RR4A 4LANA 3PUDA 5D8WA 2VC9A 3L0GA 3VZXA 2DW6A 3N2TA 5FIPA 4N9EA 3OYZA 2J62A 1DXIA 1PXGA 4UCFA 3GG0A 1EOMA 4MJ2A 1EX5A 3F4WA 2AGTA 3V36A 3NVTA 2QNEA 4PA8A 3AU6A 2ZCGA 4LPCA 1XINA 4S3BA 1ZGDA 2CU0A 4NRRA 3R0DA 1ONWA 2EF9A 2OYMA 4R3UA 2BHZA 1T8QA 2VRJA 3W1UA 4HOXA 3VVGA 1Q7ZA 2RDUA 1AH0A 1CI1A 1R6WA 5HUOA 3DI1A 3CB8A 4JKKA 3WENA 8A3HA 3CV7A 5DMYA 2JFEX 1XDJA 4JQ1A 1DTNA 2VZOA 4UTTA 1KCLA 3EKZA 1B3XA 1EWDA 3T9PA 3FYOA 5A8PA 2AMGA 4A21A 4XV0A 4MYAA 1W1B1 2PP0A 1XIGA 4W8LA 2J6XA 2IKJA 3UWZA 1EDQA 1P0NA 4MZ8A 3CLMA 3STFA 3VPLA 3L2LA 2G3FA 1H7OA 3LB0A 3V7PA 2CIPA 3KVKA 4AWTA 4MVAA 3V5FA 1PIGA 4AW7A 1M04A 3HPXA 1ALDA 3EAOA 1XRSA 2GZXA 3TXVA 3M64A 4O1CA 2XPKA 1OFOA 3LDVA 1B1YA 4JNYA 4KEMA 1HJXA 5IBXC 3DGHA 2OT1A 3B9OA 2PWFA 2CKRA 5I3GA 3UZYA 2VDGA 3EAUA 3UVIA 2WZTA 4U28A 4US5D 3B03A 4LVFA 4AY8A 4IG2B 1W3KA 1DJYA 1JFHA 1P43A 2P88A 4Q4SA 3GH5A 3K1GA 1H1ZA 5TF0A 3DOPA 4K7VA 1TV3A 4FLOA 5CSUA 4OFCA 1THFD 1LROA 3A47A 4FAMA 3T1GA 3WQGA 2WJFA 4HYRA 2ZDSA 5CGTA 2Y89A 5LA0A 1YMYA 2GSJA 1X2GA 4EQWA 3B8UA 5F4XA 5REQA 5GJPA 1RY0A 1DBTA 1FCBA 4PSRA 3QMRA 5IRPA 1ADDA 1E9LA 2XFFA 3AJXA 3W76A 3TOPA 1GVYA 3DBPA 1ECEA 4H9MA 4JYEA 1FP8A 1MEWA 2Z4GA 3WQWA 4JDRA 1Q6DA 3E0VA 3G0XA 4I6KA 2QUTA 3HPAA 3L5LA 3O1NA 3TXZA 5BWAA 2J8TA 5I06A 1R2TA 3IJDA 2XUCA 3R89A 2OZTA 4GJ1A 2W91A 1X96A 4XZBA 4MOZA 2W5FA 4AZ6A 1FWRA 3TQKA 1W1PA 1W5QA 3LSBA 3GDMA 4NZFA 4JFWA 4JQAA 3LB8A 3G24A 1N5WC 1WO2A 4Z0JA 1KM5A 4GQRA 3PZ9A 4GZJA 1QXLA 4DPQA 3NQAA 2R1KA 3UJFA 2WSRA 4EM3A 1M03A 4MUZA 1TJRA 2BXZA 3EWZA 4YS1A 5FJOA 2VFEA 1V4YA 4EM4A 4I5RA 1F9CA 2D3LA 2PA6A 2V82A 1E70M 5DXXA 1DKWA 3SRKA 4NAFB 4CKQA 3SW6A 3O0KA 1KM0A 2Y88A 2DZPA 5A2CA 4HP5A 4GO8A 2OU4A 2QCFA 2VZTA 1S2UA 2VX4A 4EMJA 4WSKA 3OOQA 4GXWA 5D9PA 1UZDA 4LUSA 3VIGA 3N3TA 7REQB 1VRXA 1R87A 4QXIA 3WLHA 3S5ZA 1YDVA 4CCCA 1VBRA 3W84A 1RLDA 3RF9A 5GJMA 4IPIA 4MY1A 4B2DD 5C70A 4AD3A 1F73A 4H6KA 7ODCA 3W2KA 4O12A 6TAAA 1XIDA 3AS0A 1OD8A 3S42A 1PWLA 4ATLA 4H8UA 1I4NA 4OU1A 3U2OA 1M01A 5A2AA 6ENLA 2FDMA 3ZT7A 4DBEA 1NHQA 5MF5A 1L6GA 4W87A 3II4A 3PWAA 3R0KA 1DWHM 4IMEA 1GRBA 4IIGA 1JQVA 5FS8A 3CEUA 3POCA 4LCRA 5FF4A 1CIUA 5D09A 3NZPA 1YEYA 4O50A 4A3RA 3EUB3 3VD5A 1LBFA 1Q45A 3B40A 4PEEA 2I1OA 5GJNA 1JZ8A 1QWKA 4DM2A 1IR1A 3M44A 4O4WA 3MYPA 1ZENA 4D6GA 4HHPA 1ISZA 5FF3A 1BAGA 2D24A 2QCLA 3CUJA 2WPFA 1VHNA 1SFTA 4EWJA 2D2HA 1YBQA 3GXMA 4YMZA 4F4RA 3OLIA 1EWEA 4R27A 2JIWA 2W54A 2KAUC 3UCCA 3A5VA 3NGJA 3N04A 2VFFA 5AY7A 3TNBA 3L0NA 5C7HA 3WK2A 3WDIA 4M1RA 4BA0A 3OZYA 2EKGA 4AYGA 1TQJA 5LNWA 3VCCA 3G1DA 3WEZA 5E6ZA 4M8UA 1OFQA 3VIOA 1QR7A 4BHYA 1ZRQA 3WQOA 5EMKA 2PTWA 2FPTA 1CXKA 2GUYA 3EWBX 6REQB 4YVXA 4MG4A 4D1JA 3ABSA 3P6LA 4MB5A 3QOMA 5D2YA 4XVDA 1J11A 4HNCA 4ZQOA 4MGGA 3BCFA 3CV6A 1QRQA 3DX5A 5FCZA 1LWIA 3W73A 1CXHA 4UNLA 5K7JA 4ZCWA 3A4JA 3VA8A 1VC4A 1LZOA 1KQYA 4DPPA 3URHA 1O60A 1PTGA 1HQTA 3CGEA 4LAMA 2ACRA 3WQ4A 2ABBA 3UWVA 3FAXA 1ZSXA 1CGXA 1X98A 1Q6QA 1KQZA 2BNJA 1B30A 1B3WA 1U33A 3APGA 2ATMA 4MIMA 1GKQA 1LJYA 2Y5EA 4XUGA 5CBIA 2IKHA 3W1NA 4U3CA 5AZ1A 4JTUA 2V5CA 2Y24A 3S47A 3TUUA 4P8WA 2V68A 3CAWA 5C9RA 2CBJA 5ENLA 1ISYA 2ZE0A 3HG5A 4ZOBA 5E0CA 3DERA 3RAOA 1OHLA 1PKMA 3ATYA 2EG7A 3CZ8A 4V15A 1ISXA 1C92A 5BW6A 5MHBA 4U4MA 3M46A 2PDLA 3RPMA 3N6JA 2EQ9A 4GFIA 4GY0A 1SZEA 5BOEA 4CNPA 1QFEA 4NL1A 3TN6A 3F5JA 4O18A 3TLLA 5CQ1A 2Y63A 2VUYA 4GRTA 4JN7A 4ORIA 3SCNA 4JTCA 1RBLA 1BYAA 5JBFA 5D37A 3BMWA 3PBVA 3WN6A 2VR5A 1E4MM 3I4EA 1NWUA 4MB4A 3QR1A 1Y65A 3OLEA 1EOKA 2E8YA 3CQ0A 2V2DA 4UTWA 3MMDA 1ZBWA 1P1MA 5JMUA 1EQPA 2PDBA 1FCUA 1AW2A 2CLHA 3MVIA 3D46A 1ZJHA 5CEWA 2X30A 1P48A 1TWDA 1FHVA 3GXTA 2Z2UA 5I03A 4ICNA 4A8RA 1JYWA 2VEKA 4YN5A 3TTSA 3AHZA 3KCOA 2A7PA 1CGVA 2NXHA 1OK6A 4QITA 4M82A 1H49A 4IP5A 3SRFA 3GC2A 3PS7A 4EPDC 2OGJA 2FTWA 3HTWA 2XN2A 3ZJ7A 2PTYA 2ZRZA 2ZTJA 4HJFA 1EFZA 3CZEA 2VEMA 4P7RA 2A3AA 1OT1A 3WJSA 3OPSA 2VQUA 4XZHA 3DHUA 4DBDA 1RPXA 4DHGA 2XM2A 4BK9A 1XUUA 5I0DA 1M6JA 1ME9A 4IUGA 5F1VA 4IG2A 1UD4A 4PMOA 1JULA 1U1UA 3TYCA 3EDFA 3GAKA 1I2QA 4C7FA 1E6NA 1MI3A 1A5LC 2WV8A 1TJ2A 3E49A 5DF0A 2VCBA 1UD5A 2JIEA 3NVVB 1V6XA 3LYEA 1Q4NX 4C60A 1UOKA 2NQJA 3WNPA 4OOUA 2QIWA 4DF2A 4F9JA 3KX6A 5IHRA 3SSJA 3MB9A 5F1UA 1EA9C 1E1FA 2V6OA 4DI8A 3DXIA 2VDHA 4JTLA 4Q4OA 4AMAA 4RE2A 1XPYA 1JDDA 1OX5A 4FX6M 1S5WA 5KMYA 4AD0A 2R9RA 1G67A 1QHZA 1P0KA 2WNNA 3LBMA 2PLMA 4FNRA 2BY0A 1ENUA 1W5OA 3DENA 3PJXA 1QO2A 1SR9A 4J35A 1F3EA 5I07A 1OYCA 2VR2A 5D4YA 4LX4A 4UNKA 1S5TA 1SMDA 4L65A 3KOZA 3QW4B 4UTIA 3GDTA 2A6NA 4NJKA 3IRDA 5A1AA 2XIMA 1WBJA 5CPMA 2IPJA 3BZJA 5FA5A 4V27A 1PX3A 3N9KA 4FX8A 1POKA 3CASA 4V1XA 1PS9A 4U2ZA 2OPJA 1B4KA 4HN8A 4M5PA 1CLXA 1RCQA 4H4YA 3W2JA 2ZRWA 4FX7A 4F2BA 4E2DA 3MI2A 1A53A 4ZB2A 4C6MA 2YOCA 3F03K 3M0KA 4PMUA 3QZAA 4F0HA 4NAFA 4R85A 4H4XA 3UGRA 2V5DA 5EA9A 2FZBA 1XRFA 4B91A 2DW7A 2WSKA 1XQKA 1K7FA 5FOOA 4HYWA 4HNNA 3ZJ8A 5SWUA 3MY9A 4LSBA 3ZIZA 3I6TA 1BD0A 3KEHA 3MSGA 4IJCA 5HNTA 2GUUA 5BYWA 1GETA 5J8LA 1EA0A 7REQA 1NOUA 1YLVA 5AN7A 1DJHA 2KZHA 3LHUA 3RILA 3A3WA 3K46A 2D2OA 1JCMP 2JKPA 2REQB 3RDKA 3POHA 2VD9A 4NX0A 5EYWA 1FH7A 1LWJA 1E0VA 5GNYA 2QCMA 1XKYA 4JX6A 5A5WA 2BTMA 4JTKA 3W26A 4QDPA 2VURA 4IIDA 1A47A 2OLSA 2CLEA 2F2HA 1BFNA 2ISVA 2J7GA 2VWSA 1KTCA 5A8OA 4A4AA 4J3ZA 9RUBA 3E2RA 1BYDA 2J7EA 1WKFA 2OSWA 1N82A 4A2RA 1RQHA 4Q32A 3AIEA 3A21A 4PTDA 5BXSA 4G7FA 3ZZ1A 3O6AA 3BOXA 3IIOA 3N73A 1SZRA 1FUYA 2XSAA 4LRTA 1VCVA 1KFWA 3T09A 1R3VA 4L9XA 3KS6A 4UR7A 1YTEA 3CU2A 1ONFA 3IGHX 2DT1A 3C0QA 4MKNA 1HP5A 4GRSA 4RPPA 4WJ8A 1TV2A 1FH9A 1N62C 3W01A 2YCLB 5JH2A 5TQLA 3O6CA 3ISIX 5IHSA 1H1YA 1X8FA 4GNKB 4RV3A 3H54A 1UKQA 2AMXA 3LXAA 4UWMA 3FKKA 1XG4A 1EHAA 2VRKA 2IMRA 4NZ1A 1BQGA 1ZS2A 1WB0A 4K37A 6REQA 5AZ0A 1XLLA 5GVJA 3PUGA 2BSLA 5DCDA 1OGBA 3IJ7A 1R3TA 4DUOA 3FY1A 1YYAA 2DZTA 2PZNA 4TTGA 2NUYA 3AM9A 3G1AA 3UXLA 4MADA 1XF0A 3DK4A 3BLIA 2C0AA 1KLZA 5KEZA 1DQWA 6TIMA 3RJXA 4QS6A 3DJJA 4YCPA 4LF1A 4XZ9A 4LY8A 2DORA 1CXFA 3L7RA 3WQ8A 3GIQA 1UA3A 2DSUA 1C90A 4GYPC 1JDEA 5G5HB 3GYEA 2EPHA 3I68A 2NXIA 1S5MA 2DT0A 4KQNA 5DANA 5KITA 5C2GA 3MJMA 4FIQA 3WDHA 2BP1A 4WEVX 3L4TA 1SJCA 1UBSA 4RDZA 4JTJA 3GW0A 3KVMA 3T0CA 3AYSA 1GOQA 1R3RA 1G69A 4HZ8A 3TYDA 2GWNA 1FWWA 4KRUA 4MKVA 3ITOA 5M5DA 2V63A 1I2OA 1PCKA 2X8RA 3FW6A 1ICQA 3LOTA 4Y8FA 3JU2A 5FJTA 5M2FX 3ZVIA 4J7RA 3XIMA 2C3ZA 5L6UA 3G8EA 3NQDA 1MDRA 3IJIA 3TLQA 4KCWA 1W1VA 4K1WA 4MJMA 3S0CA 3EA2A 3WFZA 1C9DA 3F5LA 5I78A 4JFTA 4CCDA 3PBGA 3KXQA 2YDSA 1UWTA 4R33A 4DELA 3A12A 1JPMA 3R10A 3KZPA 3UXKA 1YIXA 5D2VA 3M47A 4W8BA 3VIJA 5AFDA 2FPYA 1O4UA 3MO4A 1V5XA 2IPWA 2X1IA 3FEQA 3CHVA 3HQOA 3KL5A 1UR1A 1I60A 3G1VA 4ADUA 5BRPA 3KLJA 4LIIA 1N2VA 2YFOA 1XX1A 2WJEA 3EEZA 4Q8MA 4ZVJA 2PDXA 3EX1A 2OMAA 3MS8A 2OKTA 3OG3A 3PG6A 2IQTA 1JPKA 2CZEA 1OB0A 1ISVA 3O7UA 4AZGA 5CZSA 1HJQA 2G3NA 4M24A 4LNYA 2BMBA 3GTXA 4QS5A 4RDYA 3DFNA 4JTQA 2VEIA 3LEPA 2PGWA 4C6EA 2PPGA 1XPGA 1SR0A 5HWNA 2RUSA 3BO9A 3HW2A 4IMDA 3WJZA 3EPOA 3AQUA 4PMQA 3LTPA 1WAWA 2HS8A 1XCFA 3CQJA 3IACA 4ZBCA 5CZTA 1EIXA 3PFRA 1Q6CA 4LY4A 3M0MA 3VOFA 1GOKA 3IUDA 2GDQA 4Y96A 1ZK7A 1E6SM 2PI6A 3TMQA 3SQMA 3NL5A 4ZO6A 4EX4A 5F2MA 3UJ2A 3FHQA 4GMEA 3S8HA 3M5VA 3H53A 1XFCA 1KFLA 2ZKMX 1G6CA 2BY3A 3AO0A 2VOMA 1VBGA 2DSVA 3GKFA 1ZPTA 5K9CA 2QUNA 1VFMA 3VOCA 3SCUA 4NEVA 1C8QA 2WBGA 3KOXA 3JW7A 3VCRA 2EPKX 2VFHA 3O06A 2RAGA 3URBA 1XLHA 1EC7A 1LRNA 3A4AA 4X0NA 2J24A 2QJGA 2H8XA 3KP1A 3UXIA 4BCEA 4CD4A 3VKJA 3NR0A 3R12A 3MBFA 4TV6A 3TTQA 4DXVA 1I6NA 4HHHA 3MYOA 4LGXA 3TQPA 3C8NA 3UG4A 2PRHA 4HU8A 3H2MA 1GVIA 1EO7A 3CZGA 1VAHA 5E93A 1AQFA 3HF3A 3AXIA 3JR2A 3QLDA 3UP8A 2HNEA 1NQ6A 2WNWA 3ZR4A 3TV8A 4WX2A 3PSWA 1RCXB 1GYMA 3VD4A 4GJJA 3SECA 5XINA 4HNVA 1KKRA 3WBYA 2NT1A 2PWEA 3QPYA 1VJIA 3TEVA 1H0IA 2E5CA 3N2MA 1K03A 1UKTA 5G4EA 1UC5A 5CGQA 3MPGA 2G37A 3SCWA 1CEOA 2X2YA 4GGHA 1K4GA 4EOUA 1GRFA 1MUWA 3CUZA 2O7SA 4L4OA 4IIBA 3QOKA 3W00A 3WG6A 1UA7A 1F8IA 4B15A 5L9FA 3CZJA 2IPGA 1Q6EA 3M0LA 3M7SA 3I7QA 1KKOA 3O3RA 4GXPA 5EFFA 4KRZA 3VIMA 1GJUA 4NZ5A 1P7TB 1VP5A 1TTJA 5JIWA 4F66A 2FZ8A 2P10A 4JN8A 2BVDA 3NUKA 4FDCB 4RNFA 3MI3A 1MNZA 2CHOA 5G5IA 2XZ7A 1NARA 3FA4A 4MNKA 1US2A 3NYZA 3ANYA 3KRZA 2XN0A 3C2FA 4K8EA 3W6YA 4GIAA 1W9BM 4UQCA 2REQA 2XVGA 5E6YA 2Q3OA 5HANA 3H2OA 4FPSA 5FL0A 1VB9A 3T2OA 1QW7A 3ZWSA 5IFPA 1XRVA 1XSIA 1GQNA 2V3GA 2QCDA 1ME7A 4HMCA 1XH2A 3WFLA 3IWPA 2CERA 2YDRA 2Y70A 5HR6A 5H91A 2CZFA 3AIWA 5LHFA 3CO8A 5G2IA 1AQHA 3FOKA 4A2SA 3ONBA 3CB3A 3QHNA 4DJFD 3TR9A 1E51A 2VX7A 4ES4A 2YL9A 1EXBA 5CPOA 2QVHA 3GIYA 3XINA 3NFUA 3P81A 3H12A 4GUHA 3FN9A 3KRUA 4LS0A 4CN6A 2V3FA 1VLIA 3AIRA 4Q6JA 2E77A 4E4FA 1VYSX 4H4TA 3PC0A 4JQ2A 3L4ZA 1XSJA 3LCFA 2ZRYA 4YTQA 1A0EA 1XC4A 2YKKA 4Y90A 2YCLA 3FDGA 2H9AB 2OLHA 4B92A 2C16A 2FVMA 2MUCA 4AXNA 2GFTA 1WBHA 3PHAA 1VH7A 3LNPA 5LSMA 3LCLA 3EDJA 1KW1A 4YLWA 1RZMA 1GJPA 2NV1A 2PZ0A 5C2CA 4XZWA 4NY2A 1FP9A 3DI0A 2X0HA 2RKXA 3P8IA 1PTDA 2AL1A 4Y9MA 1TZZA 4HTYA 4L4MA 5IXEA 1XISA 4PULA 2GR2A 3QW3A 2EXOA 1J5SA 2B7PA 3OU8A 4XIMA 1GJWA 2QPUA 3VUSA 3EX3A 1IZCA 1LLZA 5CC3A 2Q6ZA 1JZ5A 1QPKA 2XIBA 3LLDA 4MFDA 1DIOA 4WK9A 2CXGA 4M29A 4DJFC 1ONXA 2P50A 2A0NA 4AIOA 4IL0A 4ZQNA 3RM9A 4PTNA 2NUXA 4NZCA 1RA5A 1OIMA 3DESA 1V0LA 3O2LA 2QJHA 3EMQA 3UXAA 3ANUA 3SCOA 3WLIA 2NQHA 1OGGA 4D8ZA 1H60A 2D3NA 4IGSA 1NWSA 2FZDA 5A6SA 2HWGA 1GCYA 1NDWA 1OX4B 2CHRA 3ES7A 1QVBA 3AU2A 1BRLB 3B4YA 1ESWA 3E5PA 4Z1BA 2VNCA 4LYKA 3CAQA 5D32A 1DXLA 4LUYA 2VFIA 1HL9A 2Y0FA 2D22A 2EG8A 3OIXA 4XUYA 3SDOA 3CTLA 1S1RA 3CHFA 3QRHA 4MDOA 1O94A 4FA3A 1FWTA 1R9YA 4HU0A 3ZWTA 1WDQA 1BYCA 3WBWA 1XCWA 4P8VA 3JS3A 4M51A 1TCMA 4O19A 3WF4A 4H7VA 3DUGA 3GC4A 1S7MA 3H2CA 4TXEA 3NZRA 1AL7A 1FXPA 3S6OA 1DJNA 1EJRC 1RSCA 2C3CA 4IX0A 3JZUA 2DY3A 2X41A 2FGLA 2VZSA 2R82A 2E6FA 4Z42C 3MANA 1OCBA 3UWEA 4AHPA 4RE3A 5CLTA 2OX1A 3BGAA 2P3EA 4UMAA 4J28A 4ADTA 4NYYA 3C2YA 3IARA 4CVUA 7TIMA 3BWWA 3TZFA 1OC7A 2IKGA 2YDQA 5G1TA 1H50A 6XIMA 1EF2A 3VXGA 2P0IA 4AWSA 1W3LA 2PDHA 2R1PA 2PCEA 4K36A 3PTQA 1BXNA 2XGZA 1WDWA 3SQSA 5EMJA 5CJMA 3WBAA 4RK8A 1RXOB 4KEZA 5AHFA 3TP4A 3T6CA 4NHVA 1H7XA 1I8JA 4YTTA 5CBJA 1OT2A 5HQEA 2XVPA 2HV5A 3VOJA 3N4FA 2ZZCA 1TV8A 2FIQA 1E6PA 3TW6A 2QMJA 3SR7A 2ZRVA 4HU3A 5T26A 1UUQA 3CPRA 1XQLA 4UQ9A 1LLWA 3W7GA 4GNVA 4J3WA 1GT8A 3OEXA 1DXEA 3C0JA 1UIOA 1GRHA 1OYAA 5F2GA 1UWRA 3ICJA 4XD4A 4KBXA 4C6CA 1FA2A 3A9BA 4XX6A 2EJAA 2QCGA 3SY8A 1K8CA 2QQ6A 3BLKA 3CTTA 2CXEA 1MFUA 3LD5A 4LF2A 3QF0A 3GG1A 2PRLA 1MZHA 4I90A 3SGUA 2OFJA 2QVNA 2C6QA 1IEXA 4UOZA 2BVWA 4FNTA 3CH9A 2E0PA 5CAKA 2QGHA 2GGGA 2X99A 1FCQA 4GZ7A 3RG6A 2EQ8A 2WM0A 1J2BA 4DI9A 1A5KC 5JCMA 3GVWA 4LVBA 2OB3A 3U0HA 1S46A 1A0DA 2VDIA 3APTA 1M1BA 2HBXA 1UIPA 5D04C 1DJGA 4W5ZA 3PAOA 2EQ6A 1TQXA 2O9OA 3GE7A 3UBPC 4S3KA 3R7MA 4L5ZA 3UG5A 1TPWA 5HMFA 1OG0A 2LLEA 4BWLC 2ZZ6A 4O8AA 1E72M 2WCAA 4WKFA 3GH7A 3TW9A 2WC4A 1H5VA 2QDDA 4JNMA 3VMPA 1MW3A 3AWOA 3FDKA 3CZLA 4IWWA 4OKDA 1C8VA 2XG9A 4ZE5A 4I9JA 3RYSA 1O12A 1P7TA 1OY0A 3RRXA 3NO5A 3Q4DA 1GEHA 1V02E 1KD0A 2W55A 3WEMA 4RW3A 4KWUA 4ZFMA 4AIBA 3N3MA 4G1NA 4I9MA 2WJZA 2PDMA 3II1A 1WYGA 3GXPA 2VR4A 4XTIA 3FX4A 1F5ZA 3V0SA 3M43A 5TD4A 3UJSA 1WDRA 2OELA 2NV2A 1J18A 3MSDA 3PZGA 4IPNB 3THDA 1WV2A 1A4LA 3KM8A 3UGVA 4KIRA 4QJ5B 3BJFA 4OE7A 4IQDA 4H4WA 3GH4A 1PIFA 4KWVA 3PFMA 4GVIA 1VHCA 2OG9A 1D7YA 2D69A 4PMDA 4Z2JA 3WIJA 3W7EA 2O4QA 3HGJA 1XD1A 1YRRA 1SFLA 3P82A 4BR1A 1X7FA 1E4NA 3I3EA 4QAIA 3R0UA 3TZNA 1O68A 1TYTA 2BWGA 2G96A 4H2HA 1UROA 1BSLA 2E5BA 2GDUA 1NTHA 4AX7A 2YW3A 4PBGA 3DKJA 2ZA3A 4JKLA 1LVLA 2YXGA 4JN6A 1IIHA 3CHDA 3M16A 1XBVA 2HXUA 4L80A 4J2MA 1QI5A 4CNOA 2XZ9A 1A5MC 3C56A 1Q66A 4P7LA 1DQUA 3STCA 2GL5A 4MAZA 3DEQA 1R2RA 3PWGA 4GGBA 5I7GA 4D6IA 1VS1A 5BMWA 3AMKA 3QTGA 3KBNA 3NZ1A 3PZUA 2QV5A 3A9IA 2H9AA 3MUIA 1P6BA 4PUKA 3PNUA 2WCGA 4HNUA 5M17A 2VENA 1E6XM 1PCWA 1A5AA 2IQ0A 1WA3A 2CC0A 3AS2A 1F4HA 1NDAA 2GJRA 1PZ2A 3MMUA 3EPMA 3IEBA 3PZNA 4WDWA 5CG7A 2NV9A 4XIAA 1WXYA 2PDUA 3PB2A 3PULA 1N8FA 5ABTA 3HIJA 5I23A 1IR2A 3FJLA 1J96A 3IUHA 1K4HA 4B4HA 3F2DA 1DIKA 2B0MA 4UTUA 1MEIA 3WQCA 3KVLA 2ZBTA 4JIPA 1HJUA 3SAZA 1DWFM 1J0JA 3BSMA 1YADA 2G95A 3NAVA 2Z6JA 3PBUA 2GH5A 4EF8A 4IX2A 3Q58A 2HVMA 4A3UA 2VD8A 1HO1A 4G1KA 3RPDA 1UB3A 3KBJA 3ZVHB 4CLMA 1QCWA 5AC8A 1I0BA 4MNLA 4F0LA 5C2XA 4EMIA 1YNYA 5H8PA 3S2NA 3NDYA 1Y5WA 3WLJA 1TREA 1XLEA 3ZOAA 4WDXA 2JQXA 4HNOA 1KXQA 3PG9A 3UFYA 2CBUA 2VGBA 4JZ5A 3HFTA 3V3WA 4QHRA 3V4BA 4AZIA 3WNKA 3WQ6A 6XIAA 3Q65A 3NVWB 3BW3A 3RLUA 1B2YA 3TC7A 2YIHA 1Q13A 4QP0A 4NILA 1OX4A 1CW2A 5HAOA 1K9TA 3UG8A 2ACQA 4W9TA 4CVWA 4YTSA 5DX7A 3FEMA 3B9NA 1BRLA 2GGEA 3WLSA 3SQPA 5LIXX 2VJXA 4RNIA 3CIVA 1G1YA 2HTMA 3Q6JA 3S9IA 3TJXA 4ML9A 1VFFA 1SU5A 4PRRA 1Q5MA 4GBUA 5I2UA 2IQDA 1LCOA 1JROA 3GDRA 3HFYA 3EXSA 3BMVA 2WWDA 4JFSA 4L56A 1J0KA 4GX9A 4FXSA 1QASA 4UFIA 3H8AA 4O1FA 1EPVA 1LDCA 3FS2A 4O1DA 2NXGA 1M5WA 1ZCCA 1LQ2A 3L65A 1QT1A 4J3UA 3VMNA 1L8NA 2IS7A 2WBKA 1V03A 1U83A 4U3AA 4V1YA 1A5BA 2Z7GA 3FSTA 1MQRA 1WOAA 4N2YA 2I5QA 4DN1A 2D0FA 5EB8A 3VAVA 3OVRA 4J1OA 3SGZA 1S5VA 1H2IA 1RBOB 2J27A 1XS2A 5JCLA 2BDQA 1RALA 4AVFA 1OZMA 4O1BA 3OGRA 3QGVA 3SY5A 4CQDA 3ZLGA 4MY9A 1C8YA 3HGSA 4INFA 3VDHA 3RU8X 3TNOA 3AS3A 4TO8A 4GHRA 2Z25A 4PMRA 2YCIX 2DZWA 2O9TA 2ACSA 3CT7A 4WQ6A 3BL3A 2ZX6A 1KXTA 1EO5A 1YQZA 1H1NA 3CV1A 3TFCA 3R8HA 3VDBA 1W1IE 4MPQA 4LW7A 1L2UA 1EJTC 4PE8A 1EC8A 2DQWA 1XC6A 2F84A 3EEGA 3M4HA 1K8XA 3O63A 4QG9A 1TMLA 4DBSA 3HA1A 4HMEA 1J0IA 4GVFA 4K6AA 2Y85A 1V6YA 1UUOA 2YJQA 4N42A 3W3OA 1LM1A 4LFYA 1K9EA 2VGGA 3QV9A 3TFXA 3UY7A 5LHEA 4RCXA 3S1UA 2C1IA 1ZB5A 3F7JA 3FYYA 1KFEA 2NX3A 5I3IA 2VM8A 3SN0A 3E1F1 3W27A 3A5FA 3BJSA 1JF6A 3TX9A 2D73A 2WVSA 4PCPA 4JIEA 4AZCB 3IJ8A 4EXBA 2IKIA 2E28A 3B06A 3URAA 2GJXB 4M6PA 5HOSA 1W17A 1DE6A 2F61A 3QHMA 3EPNA 1H7RA 3GZAA 3R43A 3EWDA 4PCNA 3F4NA 3K8LA 3ARRA 4FXRA 1SMAA 3WD2A 2I7GA 2OZ3A 4JIRA 1TUFA 5A94A 2V6AA 2EQ7A 2UBPC 3PM6A 1V7YA 3KLLA 3THUA 3UCQA 2OOFA 4RW5A 3TA6A 3B9JB 2QDHA 4PN2A 3SJNA 4X60A 4LVGA 3KTXA 2GVGA 2DT3A 3WNLA 1KGWA 1GVRA 3T2QA 4NNAA 3BLOA 3TTOA 4QIUA 5AECA 4FMVA 1GKRA 5CPTA 4KT2A 2ISSA 3AXKA 1S3HA 5LNSA 3AHYA 3VFCA 3R8GA 4Q4RA 1UR3M 3T44A 1N55A 1KFBA 4FR1A 4LBUA 2WSQA 1VF8A 1VQZA 1UPMB 4PMXA 2W3SA 4HK6A 3GVQA 3L0KA 3NQFA 4KMQA 1QNPA 3QC3A 1W5NA 3COTA 5G2HA 1A80A 5HNRA 2NSOA 3S1WA 4H9XA 4FOKA 3C8FA 4R88A 4AF0B 2XWDA 1R3WA 1H41A 1UH3A 1JZ2A 3LPGA 2Q8ZA 2D23A 1VJSA 3RFAA 2P8BA 2RDTA 1PB0A 1C3FA 1GVOA 1XLFA 3U48A 3G3MA 2ZUMA 4FNUA 3C6CA 2H3BA 1MUMA 3BZGA 4M7TA 3Q2DA 4B5WA 4QLKA 3QM3A 2EQDA 3PK7A 2A7NA 2L5HA 2EO7A 5D2XA 3N18A 4O8RA 2WLYA 4PCTA 3H70A 4A3QA 4C5ZA 1MEHA 2V9DA 1XIIA 3S4TA 1GUVA 1DWJM 1WPCA 1N60C 4URIA 3AXHA 2Z6IA 3SO7A 5U7SA 3V35A 4GK8A 4HPNA 4APNA 4WKHA 3ERPA 1EP3A 4NZJA 1J9YA 2CFYA 1IHIA 5I09A 3WD4A 3MZNA 2Q8LA 4TMBA 5EBUA 2RABA 3E2SA 1OEPA 2PDGA 4PTWA 4LUIA 3S1XA 3TYAA 4MJZA 3WNMA 4LAKA 1XBZA 3ELFA 1NM9A 1X1NA 3C61A 2FFIA 1BKSA 2D1ZA 2XH7A 5DMNA 1VBUA 2JE8A 4C6QA 4RLIA 3GB6A 3I4KA 3IPWA 1OFEA 3L5AA 1RQBA 4F2TA 2V30A 3T81A 2Q3RA 2XJ7A 4HPJA 4ZB0A 1EBHA 1OCQA 2I14A 3LUTA 1YDNA 4O57A 3ZVHA 1H11A 1QOQA 4X2RA 4MLRA 1SFJA 3QGAC 4R7JA 1V6UA 4FR6A 4YL2A 5CAHA 4YYCA 3NEVA 3A64A 1XDMA 3FA5A 3LNMA 1H4PA 4RNJA 1HN1A 2ZVIA 1Q2RA 1NVMA 1AW5A 1Z89A 3GAYA 3JRKA 1Q63A 3APYA 4LVAA 3M0JA 3BC9A