1RVKA

Crystal structure of enolase agr_l_2751 from agrobacterium tumefaciens
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
381
structure length
381
Chain Sequence
MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isomerase/lactonizing enzyme
publication title Evolution of enzymatic activites in the Enolase superfamily: 1.7 A crystal structure of the hypothetical protein MR.GI-17937161 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Structural genomics, unknown function
total genus 121
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1rvkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1rvkA01
2MUCA 2QDDA 2FKPA 2QJMA 2AKZA 2GGJA 3SN0A 1KKRA 3T4WA 3QN3A 3NXLA 2XH4A 4GMEA 1ONEA 5FJUA 2GDQA 3GO2A 3U4FA 4M6UA 4ZCWA 2PTWA 4JHMA 2HNEA 3STPA 5BOEA 4A6GA 2XSXA 5FJOA 2OQHA 3ZLHA 3VDGA 4K1WA 1MRAA 3PK7A 1RVKA 3TWAA 4IL2A 3BOXA 4E4UA 3CB3A 1L8PA 2PTYA 1W6TA 2OG9A 3UJEA 3U9IA 4H83A 2RDXA 4GGBA 1MDRA 2PP3A 3OTRA 4Z1YA 3UJFA 3SBFA 3T8QA 1WUEA 2PSNA 3VC6A 3P0WA 2PGWA 1TZZA 2AL2B 2PTZA 1IYXA 2QQ6A 3FVDA 1XS2A 3ZLGA 2PMQA 2ZC8A 1BKHA 3ZLFA 4DXKA 4MGGA 2XGZA 2QGYA 3TOYA 4HPNA 2QJJA 1SJCA 2OZ3A 3FJ4A 1OEPA 1NELA 3MKCA 2QDEA 2QVHA 3EKGA 1ECQA 3ES8A 3TJIA 3DIPA 3RRAA 3HPFA 3ZVHA 2XH2A 4GIRA 2OO6A 3MUCA 3N4EA 2HXTA 3RGTA 3R0KA 3V4BA 3QKEA 4K2SA 1FHVA 2NQLA 3IJLA 3MSYA 2PODA 2PS2A 3QTPA 3NFUA 1MUCA 4HCLA 3N6HA 5FJRA 3UJ2A 3DG6A 4X2PA 3JW7A 1JDFA 3PWIA 5IDZA 2GGIA 1PDZA 2OX4A 2P8BA 3S47A 3IK4A 4HCDA 1KKOA 5J04A 2PP0A 3DESA 4IZGA 3SJNA 4DWDA 5ENLA 1BQGA 3SSZA 2HXUA 1JPDX 4H2HA 1JCTA 1FHUA 2OFJA 3ES7A 3FYYA 3OP2A 2XH0A 4ENLA 3T9PA 2ONEA 3DGBA 2DW7A 2PPGA 2FYMA 2O56A 3B97A 3R10A 3GY1A 3DG7A 1EBGA 1MDLA 3CT2A 3K1GA 4F4RA 3ENLA 3ZVIA 3D46A 1PDYA 5FJTA 3CAWA 3TWBA 4YWSA 4DHGA 3I6EA 3RCYA 1SJBA 4IP5A 3N6JA 4H19A 3DFHA 3H8AA 1NU5A 3VA8A 1MNSA 2ZADA 3R25A 3VFCA 3P3BA 4Z17A 3PWGA 3T6CA 3TQPA 4G7FA 2PGEA 3FV9A 1E9IA 3VCNA 3V5CA 3TJ4A 2P3ZA 4HN8A 3H7VA 4MMWA 5BOFA 3R0UA 3DG3A 4KWSA 2HZGA 2AL2A 3R11A 4H1ZA 4ROPA 2OQYA 4GYPC 4K8GA 2GGEA 2OLAA 7ENLA 3OPSA 4J1OA 3UXLA 4HYRA 3NO1A 3OW1A 2OZ8A 3Q45A 2AKMA 4M0XA 2CHRA 3BJSA 6ENLA 4DX3A 3D47A 4E4FA 1TKKA 4IT1A 4ZA0A 1JPMA 5EU9A 2PCEA 2I5QA 3N4FA 2P8CA 3VC5A 1EBHA 4KPLA 3GD6A 3DFYA 3RO6A 4DN1A 1SJAA 3KUMA 4E6MA 1KD0A 1P48A 4HNLA 1F9CA 1ELSA 1R6WA 2PP1A 4FI4A 4J3ZA 2DW6A 4A35A 1EC8A 3SQSA 4G8TA 4GYPA 3S5SA 3SN1A 1R0MA 1YEYA 2GGGA 2POZA 4GISA 4MKSA 2PA6A 3H12A 3QPEA 4IHCA 1TE6A 3Q4DA 3CXOA 4JN7A 3OZMA 1DTNA 3JVAA 2OVLA 3BSMA 3RR1A 2OZTA 3V3WA 3H70A 3IJIA 3GC2A 3TTEA 4KT2A 1SJDA 3FXGA 3UCDA 4JN8A 5FJPA 4E5TA 4HNCA 1EC9A 1WUFA 2XH7A 2GSHA 3FCPA 3DEQA 4HCHA 2PU1A 3P93A 4IL0A 3ZVHB 2PU0A 3I4KA 4A3RA 4EWJA 3THUA 3CYJA 2OPJA 3EEZA 3MZNA 4DYEA 4GFIA 3I6TA 2QJNA 4IP4A 2OKTA 2AL1A 3SN4A 3VCCA 2GGHA 3OZYA 3V5FA 3RITA 2PTXA 4GGHA 3DERA 1EC7A 3UGVA 3UXKA 3JZUA 2P0IA 3MQTA 2P88A 1XPYA 3R1ZA 3PFRA 1KCZA 2MNRA 3UCCA 3MY9A 2GL5A 4KEMA 3IJQA 3QLDA 3MWCA 3TW9A 3UJRA 3CK5A 3NZGA 3TCSA 1P43A 3UJSA 4E8GA 3DDMA 4FP1A
chains in the Genus database with same CATH superfamily
1V51A 3MUIA 4DWSB 2CZEA 1T99A 5K3VA 4X63A 3KEHA 4E2DA 3HJZA 1F76A 8A3HA 1W1PA 2G4FA 5JCIA 3DI1A 4C6PA 4BQ3A 1W5OA 1DBTA 5I3DA 3BSHA 5U4NA 3QFWA 4JHMA 3ITCA 1WKFA 4BWLA 1PUDA 3MT1A 2E09A 4HQVA 5C9XA 3L4XA 2XSXA 4DPQA 3NVDA 2YVJA 5B80A 5KZEA 5I0DA 2BVWA 4Y9MA 1MQRA 3SIZA 1GORA 2C1IA 3OLEA 4Q4SA 3TWAA 4GRTA 3M46A 3A4AA 4BF5A 5AC7A 3F4CA 3DC0A 1GJPA 1GQKA 3H2OA 2C16A 3MV11 5F4SA 3VGHA 3NGFA 1HO4A 1PXGA 3GC5A 4REQB 1LVLA 2HMCA 1TX2A 4GI9A 4QM1A 2IKIA 3QQWA 4R85A 1HJVA 4Q8MA 4G1NA 3K5XA 3NQAA 4MNLA 5DFAA 1HKJA 1HX0A 5H1WA 2GR2A 3ZLGA 1DWFM 1W3IA 4PL2A 5REQA 2E5BA 3RHGA 5GJPA 3W29A 4U28A 3TOYA 3VK5A 1ITCA 2OEJA 4ATDA 4EPDC 1KWKA 4N9DA 2VEIA 4LUSB 4W84A 3GM8A 4PUKA 2QDEA 3EKGA 3VKDA 1WB0A 3I10A 4XTDA 1QJWA 3PB0A 3TIMA 3DIPA 1S5MA 1QPNA 3RRAA 4M7SA 3IIXA 4I8DA 4ZXLA 1TYPA 3GG7A 1FWAC 1J11A 5FEPA 2PDIA 4UOJA 4CQCA 1JIBA 3N2TA 2C14A 2PUZA 4BK9A 2R6OA 4UTIA 1EB3A 4PTWA 4A05A 5C2GA 1Z48A 3PG8A 1U5VA 3WD2A 1K7FA 1E51A 3W24A 5I3IA 3AXXA 1O6IA 3W6LA 3OGRA 3QJAA 1OX5A 3UY8A 3R8RA 3N2OA 2HS6A 5DEZA 3HF3A 1AW5A 5ENLA 4I5XA 1GOKA 2CITA 4C6DA 3R0DA 1OGGA 2EJ1A 2EKCA 2OEKA 3HTWA 2GUYA 4UTKA 1TZ7A 4CN6A 5DMMA 1TE1A 4Y9OA 3T9PA 4J40A 1FCVA 3B9DA 2Y62A 3CBWA 5CC3A 1GQIA 4IMAA 4OUEA 4M8UA 4WDXA 3MO7A 5EKYA 1XYLA 2GVGA 3BAYA 1PTDA 1TCDA 2BWGA 1PX4A 3GY1A 1MDLA 2DT3A 5DCDA 5BWAA 4WOQA 2WMKA 2WVTA 4IFKA 1JUKA 3EAUA 3F4WA 2E4TA 3QPZA 4Y7EA 4AVNA 1TYGA 1K9EA 5HUPA 1RBOB 1DNCA 5CGTA 1MVYA 3GNPA 4MB5A 4H19A 1QO5A 3N3MA 2F9RA 3H8AA 1RCXB 2PWEA 1X38A 2EQ7A 2A3EA 1UROA 2GFTA 5KMYA 3TQPA 4PUUA 3W1TA 1J0IA 2TPRA 4MVAA 3HW2A 3HG5A 3TJ4A 3WDJA 4YHGA 2BVTA 1HJQA 1Z69A 4MMWA 2QAEA 1UYQA 4MZ1A 2J9XA 1TVLA 3E2VA 3ARVA 4YVXA 5HWNA 1EF3A 2UV8G 1G7UA 2BFGA 3B9AA 4H1ZA 2OEMA 3TSBA 4AG0A 4Z2JA 2PAJA 2V5LA 2OLAA 5CAHA 3OLDA 3LHTA 2YLLA 1H1YA 5EGRA 5IDIA 4XTIA 3VIKA 2WJZA 3C4UA 3AAMA 2EQ9A 3U7BA 4WKHA 1YKWA 1I9CB 3CWNA 4TVCA 1B31A 3LI1A 2CBJA 3BWWA 1G67A 2JKPA 4KMQA 2VCAA 3WF4A 3OVRA 2UY2A 2ISDA 1US0A 2VL4A 4JTUA 2VEPA 4KPLA 1ZKQA 4XUYA 5IBXA 4JYDA 3UESA 1T8XA 1SJAA 2DT2A 1AH0A 4N0RA 1DP0A 2ALDA 3WK3A 1V6VA 3EPOA 3L21A 4IFKB 1AJZA 1A5AA 3ZZ1A 1V3HA 1FRBA 1Q65A 4AWTA 4DO5A 3WF2A 4IIGA 4JQ4A 1EGMA 3EF6A 4H9TA 4HPJA 3ZIZA 4AY7A 2D3NA 1UR1A 2C1GA 4XKYB 1EFZA 3O1NA 3S1GA 1RH9A 4F0KA 4CQDA 3H2FA 4ZQMA 3WMCA 2PDLA 2VWSA 4HHPA 3G1XA 2OWXA 1VJZA 4BS0A 1XJBA 1QMLA 3SY8A 3I68A 5I3KA 1LM1A 4DAFA 4HMDA 4FALA 4U10A 3I4EA 1J93A 2DEPA 2WLYA 4AD4A 4IPJA 4LW7A 4Q8OA 3ZR4A 5LSMA 5DCBA 2EO7A 1YRRA 3VU2A 1AD4A 5FS6A 3PTKA 3KS6A 4OOZA 1R7AA 1UP0A 2PTXA 3WMBA 2I5IA 5AZ0A 3LXDA 3AO0A 4MNKA 3GG8A 4C60A 1A0CA 1QASA 2DZTA 3DAQA 3E02A 1V3KA 4S3AA 4NJJA 1TRDA 2BCPA 3TDFA 4KH2A 1WDPA 3OQEA 1JULA 5FSDC 3A7RA 1Z8AA 2POTA 1XP3A 4QLKA 3B0PA 1XRVA 1H63A 4IMCA 1E6RA 2ZZ1A 2D0FA 1ZJBA 1M41A 2WMGA 4IJCA 3K8KA 4BR1A 5BYWA 4N7QA 1PE1A 1UD4A 3AIWA 3LK6A 2I9UA 3UWEA 1Q6GA 1N62C 3TH6A 3PBGA 4ZO9A 1TQXA 3TOPA 4GKTA 3W0KA 2ZRZA 4RE0A 1XYZA 4ADSA 3ITXA 4TV5A 3ICJA 4F2TA 4DNAA 3C61A 4GY1A 3W7EA 5B7YA 3HB9A 1DYSA 2BSLA 4FEZA 3HQNA 1UJQA 2NV1A 5I2UA 4N6EA 1HKWA 4EVZA 1PAMA 2X1SA 4K37A 6ALDA 5FD0A 4HU8A 3C2EA 4L9ZA 3MV01 5FMHA 1UC5A 5GVJA 1OJTA 1QFEA 4ACZA 4MLJA 4ZQNA 3PZVA 2HVNA 4KGJA 2E25A 2Z2BA 3VKCA 3SY1A 4WKFA 4D6JA 4HBKA 4GVGA 3COTA 5I00A 2PB1A 1GEHA 3CZJA 3S8HA 3M0LA 1H0IA 4OECA 3RR4A 1TV8A 5D05A 1NWRA 3U7VA 1XIBA 4H8NA 2ZX9A 4XVEA 5H2ZA 3PZIA 1QI4A 4M51A 4RZBA 2GVEA 5D9MA 3W85A 4C7GA 1OEPA 3C0LA 2ZBTA 2XGBA 1NF7A 3GYEA 4UQDA 3BJTA 3NVYB 4H4UA 4L6DA 3BZGA 1E6XM 4GXWA 4W85A 1CEOA 4M29A 2A5HA 3EWUA 3GYCA 2W66A 1UP2A 1VEMA 1BYDA 1VBGA 3GIQA 1V59A 2W55A 3LMZA 1KBIA 3RDKA 2W3ZA 5FCZA 2FB3A 2JKAA 2W63A 4WY0F 5FEZA 3CIVA 3SY5A 2PS2A 3LN3A 1XICA 4D6HA 2V3GA 3R4IA 2VOTA 4TTUA 1RQHA 4H6EA 3VIJA 1FQ0A 3R7MA 2VO5A 4TX6A 2HTMA 1U22A 3S47A 3WEOA 2R1PA 2XYLA 4O11A 1N61C 5CJ5A 3V35A 2INZA 1EA0A 2Z2AA 4O0ZA 2HPIA 1OWQA 4EQSA 1FHUA 1FWNA 2EPOA 1QBAA 3S6OA 4L4MA 3DFSA 3WFAA 3N29A 1JYVA 1VBJA 4WY0A 2ZZ3A 2NWSA 1GTHA 1R86A 3CL7A 3TC6A 1ZLPA 2FYMA 1DXLA 1GT8A 1A5CA 3LCWA 3NGJA 2E8ZA 2WWDA 1YTEA 1S2AA 3WCZA 3WSUA 1FWSA 1TYTA 2C15A 1XDIA 3ZVIA 4ASTA 4IIFA 3AC0A 4PUJA 2ZA1A 3HGJA 3VIMA 3CWOX 3S5OA 3W2LA 2WVUA 4IP5A 1TPFA 1YDVA 5KZ6A 1REQA 4AAJA 2O7QA 2YB1A 5DRIA 3MI3A 3OZPA 5GJNA 4C5YA 2WZHA 3G1DA 4K68A 3LV5A 1GGOA 2PDFA 1HKVA 1WXJA 3GFZA 1XX1A 1Q6FA 1FCUA 4C6MA 4L7ZA 1JAEA 1R47A 3CHEA 3FA5A 4Q7BA 1QCWA 4DYKA 3QMRA 4K1GA 4WCJA 1OG6A 2I17A 3WF0A 2J74A 3CQHA 4CN1A 2ZYFA 1XH2A 1RXOB 3LLFA 1GW1A 5F1UA 1E9ZB 1ZAHA 1TR9A 2QV4A 5U7SA 1XI3A 2DORA 2V3DA 1Z7AA 3GBDA 3UXLA 3EMCA 1R2TA 4O4VA 2NQ9A 5BXRA 4ERAA 1E0WA 2YL5A 2Y8KA 1LOQA 3BAKA 4LYPA 1B57A 7TIMA 1CW2A 3W7NA 3N4FA 3IS4A 4S2CA 3B04A 3CMJA 4FOKA 1C92A 3VKJA 2BXZA 1H7WA 1UR4A 1GQLA 3WF1A 2XIMA 1V0LA 4FDCB 2ZX7A 4CNUA 1P48A 3AYRA 1LT8A 2O9RA 1UUQA 3OU8A 3G1FA 3HPSA 4UFHA 2E67A 4J3ZA 5HBFA 1ZX9A 4CNSA 2PA6A 3H12A 3QPEA 2EG7A 3Q4DA 1REQB 3PZTA 1DWJM 1Q45A 1T7LA 1JYNA 1O94A 2Z1BA 5A6BD 8XIMA 1JPHA 1AG1O 1JEZA 4UNKA 1ISWA 1E70M 3FXGA 4B5SA 4HK7A 4GHRA 3UCQA 3VI2A 5CPTA 2XH7A 4B5XA 2J24A 3FIGA 4FXFA 1PTGA 4O1EA 4A21A 4ZMGA 3TKFA 1FTXA 3F1QA 4UR8A 3HN3A 1EL3A 1R5YA 3MSDA 2HWGA 2V3EA 3OG3A 5FS7A 5D9NA 3TTSA 2V5CA 3WQVA 3P61A 2IKJA 3O15A 3G0SA 1VENA 3RITA 3TYZA 1CDGA 2F6UA 3P80A 1VP5A 3VNMA 6TAAA 2J27A 1CLXA 2GK1A 3APGA 3EDKA 4C1KA 1V0MA 3WJXA 3CIXA 6CGTA 1UWRA 4ONVA 4KEMA 3RM8A 4OWGA 3VIFA 2A2IA 3UJRA 3VX1A 2QCNA 3VDBA 4JDYA 2TYSA 4BEUA 5F2GA 4EOUA 3GD3A 4QJ3B 3KX6A 2NXHA 1OABA 4RE3A 5DMYA 1KKRA 2PLCA 4WSHA 5HWMA 2GVYA 3GUGA 2JKEA 2A4AA 1BLIA 1LL6A 3MZ2A 1TTJA 2H9AA 1EGVA 2Z1VA 4IMEA 1ZGDA 4P8VA 3TR9A 2WMJA 5AOUA 1OZQA 1S2TA 1HT6A 1H41A 3BW4A 1EHAA 3CQIA 5A6BA 4K38A 4A8RA 4GCAA 2F5ZA 3IV8A 1C8VA 3UZJA 1BYCA 3W2JA 4H4IA 2GLKA 4K8EA 3XIMA 1SFLA 3JZEA 1C9WA 5I03A 4I7WA 1FOBA 3E5PA 3IAPA 1XXXA 5BROA 1YHTA 2Y5SA 2CHNA 2VMFA 1A47A 1GOWA 3H7RA 5J5RA 2I7GA 3PB2A 1NVMA 3O63A 6XIAA 2YCLA 3DYOA 2PCQA 3ZLFA 3VIPA 2WMIB 4K7YA 2VFHA 3GVRA 4H8HA 2ZDRA 1QDSA 5I77A 4OV9A 3AS2A 2DUZA 3L67A 3U8GA 3GQYA 2XSAA 4LAMA 4WXZA 3MSGA 3UYCA 1MW3A 4H8UA 2HNHA 1XGEA 5HATA 1RBAA 3N25A 3MC5A 1W8SA 3L5OA 3ABOA 3CUZA 2HSAA 4LVBA 1NQKA 3PBVA 2Y8UA 5EMMA 2J62A 3APTA 4GO9A 2HROA 1ZFJA 2CLHA 1W1A1 2OXNA 2WWCA 5BXSA 3W2UA 4JTAA 1OSEA 1I2RA 3S6TA 4H2CA 4YTQA 1HKKA 3C0SA 1CGUA 5DY2A 3GDLA 3LPOA 1K77A 3PAJA 3K8MA 3SCUA 2GOKA 1KWGA 1BXNA 5AVHA 2H9AB 1UBPC 3B06A 5IDZA 1XGDA 2FDMA 3G1YA 4XAPA 4AUBA 1EDGA 2F6XA 4D71A 1KKOA 1X97A 1UR8A 4GUGA 4PTDA 5J04A 5TR3A 3T2PA 3QHMA 1KQZA 5E09A 3JU2A 2NWRA 1E9YB 3CQKA 5D2XA 2VZOA 3QMTA 3A3HA 2IXVA 1JRCA 4WIWA 4HHMA 3GKFA 3W1RA 1VH7A 1IEQA 4D1IA 3T2OA 3VNDA 3C86A 4WJXA 4B5TA 2OWWA 4A3QA 3LADA 2OKOA 2ATMA 1ZK7A 2YCLB 1LL7A 2XM1A 1OYCA 4JNMA 3UG3A 1N60C 3I3DA 3NJ3A 3ENLA 4EIVA 3D46A 2Q71A 3LTSA 3AMGA 2FH6A 3N13A 4NRSA 1VFLA 4X3ZA 4JYEA 3OVQA 3OG2A 1H5YA 2FHCA 4PODA 1HVXA 1IV8A 4F9JA 1BQCA 4BURA 2XPKA 3CASA 4ZEPA 1K4GA 5BW6A 4BQ5A 4G7FA 4DF0A 2BXVA 2GJRA 4M6QA 2PGEA 4QG9A 3INPA 4NU7A 4OV4A 3C6CA 3M9YA 1KFCA 5ABTA 3B8WA 1DWGM 1DTUA 2J4GA 3N2XA 3NDOA 1N8FA 3TZFA 2PDNA 1D3GA 1CT5A 2ZUMA 3ATYA 3OYZA 4FLSA 2ZZCA 4B3KA 3VNYA 1NP0A 1V6WA 5XIMA 4NZ4A 1B4KA 2X8GA 4EANA 4HU4A 1R3WA 5FEWA 2CHRA 3WX7A 1LQ0A 1U83A 5D33A 3A5FA 1TZ9A 4LC8A 3KOXA 4H9ZA 1TKKA 4ZA0A 4CNOA 2WCSA 4W7WA 4ATWA 4W7UA 4BHYA 1V3MA 3B9OA 3DFYA 3C52A 2E1WA 5AHNA 1QOXA 3VNJA 3TUUA 3TV8A 2J47A 1D3CA 4L1GA 2YXGA 4TVUA 1LQ2A 4YN5A 4RE2A 4JYFA 1VPYA 4W8LA 3W2KA 2I5GA 3W1QA 2YQUA 4PTNA 1XDMA 2XSBA 3LU2A 3GXDA 5HJXA 5AYBA 1GJWA 1XDJA 5E6YA 4I9AA 2PZ0A 1DE5A 4GI4A 4MOZA 3CC1A 4GG9A 1BZLA 3DCPA 1MQQA 7PTDA 5K9DA 1QOQA 3NO3A 1EEPA 1DE6A 3BMXA 3BAIA 4F0RA 2B7OA 2PLMA 3CTTA 5LXEA 3BW3A 5D2YA 3BW2A 1RAKA 1FWRA 2J7GA 1WUFA 4LGXA 2GSHA 1DQUA 3AZRA 3F5JA 1AL8A 1ALDA 4AXKA 2C19A 1H61A 3KVLA 1UD8A 4F0LA 2PI6A 2A3AA 1TX0A 3FX4A 4HNVA 2QJNA 5HQMA 4FS9A 4OTKA 2ZVIA 3FKKA 3GXTA 4O13A 5HA7A 1Q4WA 1WOAA 3HPZA 3AALA 2NVDA 2FVLA 3PC0A 3SZ8A 2D2OA 1JCLA 2IPFA 4GD0A 5JBDA 3VE9A 3PFRA 1KLYA 4R7OA 2FZBA 3NQ8A 4K36A 2ISVA 3W1PA 3OLIA 4HD5A 3AJ7A 1TPDA 3W3OA 1EA9C 4UFIA 3CPGA 4RV3A 5K4ZA 2OMAA 4F2UA 3S2CA 3VMPA 2YDRA 1PTAA 3ITTA 2YCJA 3U2OA 4UQBA 1XLJA 3QOMA 1MZRA 1IWBA 4AZ7A 1C9DA 1OD0A 1F8MA 1V93A 2E9LA 1T8QA 4IICA 3F2CA 3NXLA 4GMEA 2J6XA 3BGGA 3FEMA 4O4WA 2CESA 2GDQA 2O9TA 2PDKA 5A6MA 4ZSTA 2EQDA 4AIOA 4MSSA 3DU0A 2QUUA 4BJHA 3AU6A 1J9YA 3OA3A 5CPNA 3GKAA 3GTIA 4L80A 5PTDA 4GZ7A 3RUBL 1FWDC 2Y7GA 3TYUA 3VDGA 4E3VA 2WV8A 3V16A 4EPEC 2GSJA 1UASA 1K6WA 4CU7A 3QTGA 1OADA 1QI0A 3GD4A 3OBEA 1AZ2A 1CZ1A 6A3HA 1N82A 3OGVA 3JUGA 3G0XA 2GR1A 4ORMA 2JQXA 3W70A 4FOUA 4E3TA 1XDLA 1ZSXA 1FFQA 3AS0A 1UUOA 1X6UA 3FVDA 2ZC8A 3LNMA 1WDRA 3DJJA 1KM0A 4JX4A 2BS9A 2Z1WA 1E4MM 1W32A 4C6OA 5BRQA 3M0ZA 1KCLA 2F2KA 3TN3A 4E2OA 4CCCA 2WHMA 2PDMA 4B3ZA 3H22A 3WNOA 2F6KA 4LWWA 3LA4A 5LIKX 3K1DA 3N4EA 4XUGA 1UPMB 4QJ5B 1E56A 4WK9A 5U1OA 2CKRA 4C6IA 3CZKA 4EPBC 2R1KA 3C2VA 1HP4A 4DBEA 3MYOA 2CWNA 1NFPA 2HV5A 4Q4PA 2VC9A 1DJQA 3T7VA 4ZOAA 2V2CA 3M0XA 1XYAA 1JR1A 3SDOA 5IRPA 1CXKA 4GQ0A 2P8BA 1HNYA 1X98A 1R46A 1EUAA 1N5WC 4HA0A 5FESA 1W56A 4LANA 5DXYA 1XG4A 1JCTA 3KLKA 1KTCA 2G3FA 1LBLA 3N17A 1S1PA 3LENA 1JXJA 3ES7A 1K7XA 1NOUA 3FYYA 3MYPA 2WB5A 5CZTA 4U2ZA 3HGSA 4GFSA 3CV1A 1NAL1 4NXSA 3II1A 4U2YA 4GBDA 4DI9A 1R3YA 2WOVA 5AHLA 3Q2DA 4WXYA 2GVLA 1EH9A 2C18A 4IPLA 3Q6JA 4QLJA 1HUVA 1BRLA 2BHUA 2JFEX 2C6QA 1SFSA 2D2JA 2EPNA 3NA8A 3B8DA 2Q3OA 3FA3A 1QW9A 3WL1A 5ABHA 3RCYA 1BVZA 5A8PA 1EQPA 3QR1A 5IOBA 1UCWA 3CV6A 1Q3NA 3PVFA 1NU5A 3TMQA 4OQVA 1W5NA 3U48A 1J10A 4OBTA 3O6DA 1U33A 4JX6A 3DFTA 3KL5A 3VABA 3NM1A 4O1BA 2BC1A 2I9EA 5E0KA 3ABZA 3GIYA 4JDRA 2X05A 4GQGA 4XISA 2OYKA 4JZ5A 1S2UA 3IRDA 1E6ZA 1S5VA 1ZNNA 2CLPA 1TPEA 3VIGA 1Z42A 4K39A 3G6LA 1IF2A 2IMRA 4UB9A 2FPVA 2XIOA 3SURA 1DV7A 1J2BA 4DF2A 3EBVA 1N8IA 2I14A 3F5LA 3KDOA 4K8GA 2ISSA 3A9IA 4RDWA 5D30A 4C65A 4MUZA 2D1ZA 4O1CA 3NO5A 3NCOA 4A2SA 1JUEA 3GBEA 4WSJA 3GDRA 2PDYA 3L66A 1ZHAA 2X2GA 3QSTA 1E1EA 4UQ9A 3WQOA 4LUYA 3WQWA 5HR6A 3L4VA 1UHVA 2V5JA 4NYYA 2B7PA 2ICSA 3EOSA 2J13A 5D2WA 3RMEA 3WQPA 5A6AA 1LT7A 1PZ0A 1POKA 2OTDA 3KUMA 3ZS4A 2WPFA 3LI0A 4JKMA 1NHPA 2ZXBA 1I2OA 1KD0A 3WUGA 4ERGA 1F9CA 4YTRA 3PFMA 3FYOA 1TV4A 1ZBKA 2DZUA 2VDIA 4KRTA 3O6YX 1EC8A 3NL5A 3VFLA 4W8BA 4CVUA 4ICCX 5G2IA 3WELA 1P6WA 3HQPA 3MCOA 3I7SA 4OBRA 1XSIA 2PDWA 3V3WA 1V6YA 3BCFA 2GDVA 2PDJA 3D5HA 1E0UA 3MUAA 3C0QA 1SO4A 3F7JA 4D6FA 2ZRUA 1TJ2A 4JCMA 1UQZA 3HMJG 2REQB 3ZVHB 3B0UX 1N7KA 2XU2A 3A64A 1LLOA 4AZ5A 1FECA 3PJUA 2PRMA 5FKYA 2DP3A 3NQMA 4A29A 4PSPA 4IFRA 2CLLA 3QXBA 4A3HA 2OPJA 4INFA 5LNVA 3ARQA 2ACQA 4AISA 3N9RA 4I90A 4QISA 2NLYA 3S2LA 1H60A 2CEQA 3VXGA 3TSMA 1A5BA 3QY8A 4GA8A 3QGVA 4XO7A 3KWXA 3AHVA 4PSRA 5CC7A 4WUIA 1C8QA 1LWHA 2F38A 3GX9A 3RNDA 3PWAA 2QCDA 3BLPX 1EZ2A 3CTLA 1TWZA 4IIHA 2P0IA 1NH6A 1HF6A 3MQTA 2P88A 1KFLA 1FVPA 1BVWA 3MP4A 3WZ0E 4Y90A 1EGZA 1LROA 1V0KA 2EPHA 3QLDA 2X8HA 1TR1A 1VFOA 5JMUA 3AUOA 5KSWA 1JDCA 3HG2A 1AQ0A 2OOGA 1C3FA 3SIMA 1D9EA 1NY1A 1O5RA 3V0SA 1BWLA 2P0OA 1RPKA 2PFHA 2D20A 1CECA 4EF8A 5I3FA 1Q63A 1AH3A 2YFOA 2VCCA 3C2YA 1SO6A 2ODOA 4M6UA 4X60A 1GPWA 1AQFA 3WMLA 1XIGA 4V2XA 4FXJA 1S3HA 4IWWA 2WJDA 5C9RA 4ADTA 3A13A 3SCNA 3WBWA 2ABBA 1AODA 3W23A 1XISA 2QUNA 3QRHA 4OZOA 1EYWA 4QS5A 3H2MA 1R3SA 4G7EB 3E9AA 1K9TA 5I09A 2YZ5A 1M5WA 1L8PA 2Y85A 2R1MA 3LUTA 3W7IA 2OX1A 3ARYA 2PWDA 3OTRA 1XG3A 2W9MA 3SCWA 3VE7A 1M53A 3BURA 3LRMA 1EXPA 3VC6A 4KWOA 4WX2A 1IYXA 5HQEA 1L6WA 1VBRA 4S1FA 4F0HA 2PMQA 3VDAA 1VCGA 1JDEA 4ACYA 1KR1A 3DKLA 1QI5A 3QW3A 4MGGA 4N02A 1HJXA 3B9NA 1BWVA 2W0HA 3CGTA 4EX4A 5CQ1A 1SJCA 3W22A 1SQ7A 5EYWA 3D6NA 2Y0FA 1Y5VA 4A22A 4YJ5A 1J01A 3ES8A 2YCIX 3TJIA 3WL0A 2BX7A 3EGJA 4C6QA 3W71A 2NV9A 1IWAA 4OE7A 2BP1A 1O1ZA 1RK5A 3MUCA 3KAOA 4XZBA 4AD2A 1IZKA 1ZJHA 1R7OA 2PLJA 2PRHA 4K2SA 2W91A 2J7CA 2ZZBA 2W27A 5A8OA 2TAAA 3ITOA 4H4YA 4NAFA 1RQBA 2PGFA 3LHZA 4B5VA 1E55A 4W5ZA 1KRBC 2PEVA 4LF1A 4LYRA 2V63A 3MUY1 4A2RA 1XHCA 3Q58A 3SCSA 3O8AA 2P3EA 1W1TA 4JQ1A 1JPDX 2C0AA 4H2HA 4RXGA 3USZA 4E8CA 2IPGA 4N42A 1VCVA 4RZ4A 2V5KA 4JTCA 3LCHA 4OT7A 4V33A 1KBKA 2E9BA 4KBXA 1FXQA 3DJGX 1OVDA 1NIUA 4CD7A 3T08A 4JIIX 1SPQA 3N11A 3GDMA 3UR5A 4UBPC 4QCEA 3REQA 3CT2A 1MW1A 3FDKA 2WP5A 3SQLA 1LG2A 1LZOA 3MCMA 3UPWA 2E5AA 1UWIA 1YBQA 1Q66A 2WC7A 4QQUA 2OSYA 4M52A 3RX3A 2HVOA 4DQWA 3WLSA 3NWRA 1JD9A 1XWYA 4O8RA 4N9EA 3KM8A 1Q1RA 2CXGA 4N4PA 4IXHA 3CH9A 3UG4A 3SB0A 1EJUC 3VNLA 5K7JA 3H2NA 1KGXA 4XAZA 1V6UA 1DJHA 3M7WA 1PO9A 4PC8A 3HFYA 1B2YA 4B90A 1IR1A 3KZSA 4NEWA 2G3NA 1XLCA 2V8ZA 1CB2A 3E5BA 1TA3A 4FIRA 2XVKA 2X40A 3QFBA 4FB7A 4M1RA 3GC4A 4PBEA 3W1UA 3KLLA 4GYPC 3FDGA 3N18A 3P2VA 4UOQA 2FJKA 2CLIA 2FTPA 9CGTA 4DXXA 3OW1A 2YW3A 3ZM8A 4MFEA 1OK6A 1VFMA 3ALGA 3L5MA 1F6PA 1IZJA 4W7VA 3DKJA 4US6A 3GDBA 2ZDSA 4CCEA 4LUIA 3GB6A 3EDDA 2HBVA 4FNUA 1ECEA 4FNRA 1EBHA 3WLRA 1JCMP 3RO6A 4ZL1A 5G1YA 3REQB 3LTYA 3OBKA 3SQMA 2OYMA 1EZWA 1VZWA 3BTNA 3CL8A 3HMCA 4WF7A 2L5HA 4ZVJA 2PP1A 3A4WA 4JTEA 4A35A 1X2HA 2R9RA 3UF9A 1RP9A 4MKVA 4GISA 4WOZA 4XAFA 4YIWA 3WQ4A 3VIIA 1TV5A 3JVAA 3W6MA 3NVWB 3LCXA 1K1DA 1EJTC 4GK8A 3H70A 3MS8A 1JXKA 4PMOA 3KTXA 3IVSA 4I5RA 2YDSA 1XYBA 3EMZA 1ZU8A 2WPEA 2WOQA 3NR0A 4PYSA 5JCNA 1X7FA 2VXNA 3BLOA 1TA3B 3VILA 1S2WA 3LY0A 4G56A 2HPMA 1RUSA 1KCKA 3MHFA 3EAOA 4LALA 5CPLA 3H53A 3L23A 5H91A 5HOSA 2Q8LA 1FUYA 3EA2A 1GG1A 1OGBA 1RK6A 2VFFA 4TTGA 4LXFA 5DLCA 3RG6A 1ONRA 3UXKA 5LGXA 3FK4A 2ZA2A 2VEFA 2XFWA 4XBKA 3I3BA 4QDWA 5KETA 1Y5WA 4O28A 2GL5A 2X16A 4OGZA 3O06A 1Q7MA 1V3LA 1UKQA 1UW9A 4I3GA 1MOKA 3LHWA 1YXDA 5CC5A 4HHLA 1Q13A 1P1MA 2B0MA 2X1UA 3CK5A 3CGEA 3O16A 2VEGA 3W73A 4E8GA 2WOIA 3THQA 2NV2A 1UBSA 3BMVA 1W1VA 4E8DA 3STCA 2QDDA 3FY1A 2QJMA 1EJRC 3ZSSA 2GGJA 2VENA 4DEFA 1VB9A 4XV0A 4H4QA 1OT2A 4UIOA 1W5MA 5FI8A 3NNTA 2CYGA 4PMNA 5IFTA 4QNEA 2ZC1A 2CXEA 2PWUA 3G1RA 4RDVA 4JTTA 2PTWA 3W38A 7CGTA 2IQTA 1GOQA 1WE5A 3NDZA 5DT7A 1UWUA 3NZ1A 1E9LA 2FVMA 4RZ5A 4ZOHB 1NDZA 2EAWA 4I6VA 2V3FA 1UH3A 5BXTA 3IPWA 4CU8A 1XIDA 4Y9PA 3G18A 3DFQA 1UMLA 3B0XA 2BTMA 1TWIA 2YLAA 3DK9A 4Q8NA 3FW6A 4ZOCA 3QM3A 4R88A 1VAHA 1EXBA 1L2UA 3TZNA 1AVAA 4H83A 1BKSA 1Q6OA 1NP2A 1M7OA 1AJ2A 4RV8A 1BD0A 1XH1A 2PGWA 5A2CA 4YYCA 1O60A 1RHCA 1UIPA 1KXQA 3FGCA 5DY3A 4FSAA 3UPBA 4O50A 3ZT7A 2VZVA 3NZQA 3PZMA 2WJEA 4JOMA 3UQNA 4YCOA 4QDPA 1FP9A 3UGRA 1Q8JA 4LNCA 4RCXA 2A7RA 4QHRA 1TREA 1QU4A 1O1HA 4M81A 4A4AA 1WO2A 1RCOB 2DT0A 2EBNA 3B8SA 4XAGA 4PH6A 4A8NA 5TF0A 3D3AA 3QKEA 2ZRWA 5C54A 4IUOA 4DWSC 1QUMA 3QTPA 1S2VA 3NFUA 4HU3A 4UTJA 2VELA 1NDVA 1WYGA 5LA0A 4JN6A 4D1JA 1QT1A 1C91A 1T5AA 2A85A 1JDFA 1ZBCA 5F4WA 1ONWA 1PDZA 3SCVA 1XFCA 1EF2A 4YVPA 1F6YA 3DYMA 3GRSA 1W2VA 4DM2A 5CZ0A 2J8FA 1RJRA 1LUCA 2DH3A 3GZAA 1J96A 2WJFA 1P5BA 1V7YA 3CM4A 1VEPA 5I3JA 4HU0A 1XBXA 1GRFA 3UR7A 1KRAC 2GPTA 1F3TA 5IHRA 5CZJA 3VVGA 3O0KA 2QXWA 3DGBA 4PUNA 4M7TA 3O0FA 1S7MA 4Q8TA 4IQJA 1ICPA 3NYDA 3GR4A 4GUJA 1DJIA 1VR6A 2ZXAA 4RR4A 3K1GA 2BC0A 3FVMA 4F4RA 2IPWA 3NZRA 4LYQA 1E6QM 2ON3A 4CNNA 1YMYA 1MYRA 5EY5A 1SZNA 4LPCA 3LEPA 1E4LA 3UNTA 1OFBA 2Q3RA 4PCSA 3VMNA 1XRSA 5JH2A 3DFHA 5C7HA 1MFUA 2YXOA 4N2YA 1UR3M 2WCGA 2Y2WA 2JGYA 3RXZA 4HHHA 2E3ZA 4NNCA 3UVAA 1E1FA 2WNWA 2FJUB 7REQA 2F7FA 1EYEA 3F4VA 3ZMRA 1WDWA 3G5EA 5AY7A 5LKYA 2V3AA 2V6OA 3KBNA 3DGHA 1HP5A 2BY3A 3QPYA 4Q8QA 5BOFA 2AL2A 3TX9A 2VEMA 1C29A 3RLVA 1JOAA 4HZ8A 3DGRA 1QR7A 5AB3A 3SGGA 4FIQA 4P5UA 3YPIA 1XGZA 5CKSA 1QPKA 1WAWA 3LCFA 1I6NA 3OOQA 5DO8A 1KO0A 3W86A 1ISXA 4DUVA 4LCRA 4S39A 4WRHA 5LIXX 5C6MA 5I6SA 2YR1A 5EMYA 1LUCB 1ZBVA 3P5ZA 1VJSA 2BMBA 4GZJA 3PBWA 3PZNA 1IXPA 3WEZA 4B92A 3RX4A 5G1MA 1H09A 4LUTB 1TPVA 3PULA 4GYKA 1US2A 5J8LA 3AISA 1Q1WA 2ZZ6A 4JFWA 1CLVA 4RKAA 4HOWA 1TPB1 3MANA 1JF6A 4HOXA 1R85A 2GOUA 1W5QA 4QJ1A 4JQ3A 2PDGA 3L12A 1KFBA 4HVXA 2ZRYA 1QPRA 3MJYA 3NIYA 4P7QA 1ZDLA 4GYPA 2JK2A 2POZA 2FGBA 1H62A 4RJEA 4UR9A 3GNNA 2ADAA 3PTMA 1NM9A 2PD9A 3WLQA 1W3HA 1UP3A 3GVQA 4RE4A 1YNPA 1CXHA 3NL6A 4B4FA 1GHSA 5TBOA 1NWUA 1IGSA 1QNOA 4MB3A 2ISFA 1ESWA 3KRZA 3IK2A 4QX4A 1B30A 1M65A 4DUWA 3IJDA 1ZPTA 5CSSA 2OSXA 3GU1A 4AIUA 3DEQA 3KBMA 1MEIA 2BASA 5AC4A 3CJPA 1PYFA 4GLEA 1KM2A 1XLGA 2INEA 2CFFA 5CG0A 1OJXA 3CAKA 4EK7A 4GCXA 4WR3A 3M0MA 5F2IA 1AJ0A 2NW0A 1G1YA 4L61A 1QOPA 3WDIA 4LYKA 4H9XA 4UZUA 1FWJC 5G1TA 3I7QA 3V5FA 1H2IA 3EOUA 2WBGA 1KBJA 1ICQA 3W1XA 3ECQA 1QPQA 4NI3A 2BY2A 3KBSA 4Q3MA 4KFOA 4UTTC 3A7AA 4GUFA 1W3NA 3FSTA 1V03A 3R1ZA 2ZRXA 2IPJA 1SVDA 3MUXA 1DIOA 4O16A 4P8WA 3F4DA 1PS9A 4I6KA 1W54A 4NRRA 3DH7A 1ME9A 2NX3A 3ARUA 2YBVA 4ZQRA 4PE8A 4GZIA 3UYIA 3E12A 2QHAA 5CPMA 4BV6A 2EGZA 3NXFA 2G0WA 4MNJA 2VR2A 4AB4A 4IPNB 4TXEA 4IGMA 3SFWA 1RY8A 3LCGA 1L2QA 4IGSA 4GYJA 5D37A 3CXBA 3EWDA 1ZQ5A 1D2KA 1BG9A 1J0JA 3VCRA 1A4LA 3VNKA 3KOZA 4UZSA 3E2SA 2ESCA 1QRQA 3W01A 2Y6ZA 4A6GA 1DXIA 1Y7VA 3GRTA 3G1SA 5DELA 1ZTVA 1FDZA 1V3JA 1G4EA 3TN6A 3GXMA 1Q6QA 4YHEA 5SWUA 3MBFA 3FNDA 3UZWA 3TU9A 1IHIA 4GPNA 4E4UA 1JFHA 3UPMA 1VYRA 5FL1A 4NZ5A 1U5HA 3VZXA 4O19A 1MDRA 5I3GA 1VQTA 5C2CA 3O6AA 1GRAA 1VIWA 4GABA 3NRZB 4B4HA 3LLDA 1M68A 2DT1A 4D6EA 5DMLA 4HK5A 1XS2A 4OOUA 1JZ2A 4JNZA 4J2MA 1EX1A 3EWZA 4AHOA 2RGLA 1IEIA 4KCVA 1PZ1A 3O07A 4MM1A 2G3IA 4PRWA 3CUIA 5I24A 1WDDA 2ACSA 1X8FA 2OZ3A 3FJ4A 3GXNA 1CXFA 2Z00A 1JAKA 3W75A 3M44A 2ZCGA 3S5NA 1X1OA 2WZTA 4H3DA 3GDKA 4H9MA 5IBXC 4BQ4A 4H6RA 4D8AA 3W26A 4WLCA 3W2MA 3E0WA 3GG0A 2PDCA 3LD5A 4KEVA 3TYCA 2VGGA 5G4WA 3MSYA 1XIMA 4MZ8A 3H4WA 3SCTA 4ICNA 4BCEA 3FS2A 3GZ3A 3BAXA 3CUHA 2EQ8A 4S38A 3WNNA 2J66A 3MKVA 3DHUA 3PJWA 1I1WA 4BI5A 1F8WA 2GGIA 3N73A 3GFYA 4HCDA 3QV6A 4IGNA 2PP0A 2DDXA 4AX6A 2VC7A 2YJQA 1OIMA 2QUMA 4ADUA 4HNUA 4PBGA 4P7OA 2ZUNA 2VWTA 1NTHA 3ITLA 4PULA 4WVXA 1GKPA 1VFTA 3SCRA 3URBA 4DB7A 3OYXA 4EQWA 2WZIA 1PHQA 5CXPA 5CEWA 1X39A 4L4PA 3N2MA 1KA9F 4TVYA 3OLGA 2CC0A 3W1LA 3PF3A 4AZGA 2AAQA 4TIMA 3R10A 3AIBA 1KFJA 3W7DA 5CGQA 1EBGA 1DJNA 3VKKA 3OGSA 3VD4A 1T3QC 5L6UA 2E8YA 3NEVA 4GI6A 3TWBA 2E6YA 1TPC1 3EX1A 5A6TC 2PF0A 1E4IA 1A5SA 1UZHA 2CZ5A 1WX0A 2D0GA 1ZENA 4CVWA 2QZRA 1V02A 3MWAA 4B5WA 4AVOA 3P60A 1XW8A 4ZOEA 1OC6A 1J0KA 1GRBA 3VFCA 4QBXA 2IW0A 1ITXA 3FV9A 3E2QA 1S5NA 4REQA 5LNSA 5CBJA 1OD8A 1D3HA 1HL2A 2VD9A 5H8UA 4BKNA 1EP3A 1PX3A 3ARWA 3T4CA 1GTEA 1IEXA 1R2SA 3NVVB 4QR6A 4IPIA 4PUEA 3KOYA 1P6BA 3QH2A 3NAVA 4XD4A 3DYPA 1G0CA 3THAA 1EDQA 1HKMA 4HNTA 3CNYA 4EP8C 4HYRA 1S2CA 4L9YA 3LM3A 3NVTA 1ZB5A 2AKMA 4HZ7A 4LUSA 4M0XA 4G2DA 2AGTA 3W53A 1Z3NA 2X1RA 3LZ3A 3E49A 1N2VA 3VMOA 2YL9A 2CPUA 4TUFA 3D47A 1OK4A 4X61A 3M5VA 1V6XA 1NOFA 1QPOA 3N9KA 3S9YA 4ADWA 1RD5A 1UWAA 1I0DA 3RN6A 3EMQA 2ZRVA 1JEHA 3CZGA 3CV7A 3T0AA 4HN4A 4V28A 3KCJA 1TTPA 1PBGA 3HO8A 3LDVA 4LVAA 5CLWA 2A1YA 1M01A 2UY3A 2OSWA 5A6SA 3EA3A 1WYIA 4I9MA 3W1MA 2OB3A 4GX8A 1RY0A 3I3EA 3BARA 3KTSA 3C8FA 1RSCA 3TMLA 5T8GA 1W9PA 2XGIA 2QMKA 4JN8A 1EX5A 3GNOA 4R7JA 1KN0A 1UPPA 1S39A 5CSRA 3K46A 2J75A 3UY7A 5JVLA 4UQEA 2PZNA 2WSYA 5CZSA 1EWDA 2ZUVA 3WQ6A 1YW1A 3GDTA 4R34A 3VM5A 3PSVA 2W79A 3UU0A 4U33A 2GJXA 1XQLA 4JTQA 3DHFA 2DIEA 3F03K 3WH7A 1QXLA 1GONA 1E1CB 3HRDC 3B0YA 5IXEA 1Q2RA 3FN9A 2Y89A 3RRXA 4W8AA 1W9VA 5XINA 5HMFA 5E70A 3MKKA 2ZWYA 2GQWA 5DBTA 1XBZA 4RW3A 3M0IA 3TQVA 5AZ1A 3L0GA 1E0TA 4DBUA 3BUVA 3IIOA 4S3CA 4K3ZA 1XD0A 4LS2A 1FWWA 3GU2A 2FGLA 2QMJA 2QCEA 4LFYA 3B8TA 4W5UA 3GTHA 1TPWA 1Q7QA 2EG8A 1MXDA 4UNLA 1P6CA 3BPWA 1U1HA 4MJ2A 1U30A 3UZZA 1A4MA 1ZRQA 5RUBA 1DHKA 4HSOA 1OCNA 3SGZA 3T4WA 4JHOA 2RJHA 2Z1KA 4S3JA 4OKDA 3VNIA 5M2FX 3BLLA 5LA2A 5D2TA 2NPXA 1O95A 4YTSA 1SYTA 1GSNA 2W5FA 1OFQA 4UTTA 2VRKA 5JH1A 3R89A 1AW1A 1TSIA 2E7FA 4KEZA 1Y0EA 4C6JA 1JVNA 4XKMA 3B8UA 1EDTA 3CEUA 2A21A 3M0HA 1FDYA 2FHFA 1GYNA 5FF4A 4JIPA 3W9ZA 3FLUA 1FWGC 1PKMA 2XDFA 4UMAA 5C70A 3S1WA 3AWNA 1NFGA 3OO2A 2ALRA 2H3BA 2R82A 2RDXA 5G5IA 3BXWA 2AMGA 4Z1YA 2GJXB 1SSGA 1MEWA 3ONCA 2D2HA 1WA3A 5EMUA 3NVZB 3HZ3A 4UTLA 5FA5A 3I7RA 4HA1A 1HG3A 1DKWA 3T2QA 4PN2A 5JCKA 4DXKA 4OIFA 4NEVA 4LAUA 1KFKA 3TYEA 1CXIA 1M04A 3QMSA 2FGZA 2ZZ7A 4JIEA 2IQDA 4OBSA 5A8GA 4XKYA 1O66A 2PBOA 1ZCCA 2D22A 2FMNA 2XIJA 3MKCA 2NUXA 3KBVA 3ZT6A 1GVYA 1MZHA 3H4GA 3HPFA 2XH2A 3NSMA 3KE0A 3N2BA 3DFOA 3UD6A 6REQB 3OJGA 3DBNA 5CAKA 2NQHA 1G4TA 3MU7A 3GTNA 1RALA 3MPGA 1SMAA 4QRNA 4KWVA 3O0HA 2C3DA 4PTVA 2YVFA 4HCLA 1ZP4A 4FR1A 4AEOA 2OYLA 4F66A 2VX4A 3WQDA 4KESA 1QAPA 3DG6A 3G3DA 3JW7A 2GQ9A 3PWIA 3WNKA 1I8JA 2OX4A 2QCFA 3IK4A 2HQMA 3MVTA 6PTDA 1YTKA 4PMQA 2R8WA 2QJHA 4MHBA 1EHNA 3PM6A 3LM7A 2A6LA 3SFKA 2Z24A 1UA7A 4AD1A 4EE9A 4JTKA 5FJIA 3ZR5A 1WZAA 1TV3A 2ISWA 2WNQA 3CUFA 2YW4A 3EANA 3IIPA 4H7ZA 3PPGA 5DF0A 3WENA 4HK6A 2C8NA 4NY2A 3A9BA 3PTDA 3HFTA 1LF1A 1LDCA 2Q01A 1SO5A 1TVNA 3DGZA 5I7GA 3UZXA 2WM1A 4H04A 2YCKX 3W00A 5T26A 5AHFA 2ZE0A 1RV8A 3SR7A 1SO3A 2X1TA 3CT7A 1RVGA 5JIPA 3NQCA 2WBAA 1FWIC 1N5XA 4M24A 4MUPA 5CPOA 4AX7A 4ZBCA 3TN5A 1DORA 1XRTA 1H7NA 4YTUA 5AYYA 4WEVX 3UP8A 4MTVA 1A5OC 4LVDA 3PZUA 1PL9A 3HG4A 4A3UA 3E38A 1DL3A 3W28A 2ZADA 4JTGA 3E3HA 3ZR6A 2G95A 4DXVA 1GZGA 1FWTA 1QHOA 2QCHA 4W89A 2XVGA 5BXPA 1IQ8A 5EBUA 3PZ9A 3B03A 4LNYA 1OF6A 1NQ6A 3FHQA 4ZOBA 4Q33A 1TJPA 3AICA 1NWSA 2Q6ZA 1P1XA 1ZCOA 4XAYA 1EPVA 1KQYA 1OF8A 1DJGA 3LGGA 5LNRA 1VFFA 2CZFA 3MMTA 3GW0A 1L0PA 4EAYA 2A79A 2OQYA 4AXNA 1F73A 2DVXA 3QGKC 4KEUA 1ISZA 2CBVA 4AZHA 4QIUA 3VDHA 2WVVA 2D23A 4DO4A 3ABRA 2NVAA 5MKGB 4GIYA 4LS1A 2JF6A 2J7DA 5E0FA 3SJ3A 3S5ZA 4N4QA 3H2EA 1YLVA 2CU0A 3WDRA 4DBWA 1RR2A 2I5QA 2WPGA 1AH4A 1G69A 1N8WA 5E5CA 1VYPX 2I16A 3ABSA 4LCSA 2FTYA 3MJMA 3UNDA 3CWHA 2BHZA 1W1IE 3QR0A 1B90A 4JKLA 4K6AA 1FA2A 4JL1A 2ZKMX 2CETA 3W1AA 2QDHA 3UWYA 4MWAD 4QEHA 1Z6KA 2VRJA 1FWHC 3CZ8A 1P7TB 3SQSA 1HIZA 2FMOA 3LQGA 5D4YA 1DQXA 4XIAA 3T40A 3L4ZA 4AZIA 2YCEA 1TE6A 3P6LA 3CXOA 1B1YA 3JRKA 4JN7A 2DZAA 3OZMA 2RKXA 3IANA 3RAOA 4L4OA 2VOMA 1LRTA 4ORIA 3BSMA 4JHZA 1XCXA 1XHGA 4HJFA 4B5NA 1SZGA 3KTCA 1SSDA 1A80A 3WUFA 3LXAA 3OVPA 4IOTA 4A8LA 1HGYA 2QT3A 4XIMA 4FAMA 3G2GA 4D8ZA 5G4HC 4M3PA 5G5GB 3U2CA 4WGXA 3HPXA 2KAUC 4NJKA 1OGSA 2Y7DA 3K30A 1PZ3A 3SCPA 1G7VA 3POCA 3TN4A 3CYJA 4JKKA 3LS9A 5KINA 4F48A 3QSRA 3EEGA 1WP6A 1RBLA 4Z1DA 2WVVB 2AL1A 3S2MA 3ANVA 2EXOA 1KBBA 3GNDA 2GGHA 5D04C 3EKLA 4W4QA 4ZTXA 1MRQA 3T8LA 5EFFA 4QEEA 2G4JA 3ZT5A 5DANA 2QLYA 3WIJA 2VFGA 3BCDA 2W67A 4P8UA 4HB7A 4GZEA 2VYOA 1YDYA 3LRLA 1Z89A 2NVCA 4GH1A 4AWEA 3VYLA 4C90A 1XSJA 3CZEA 5EL1A 3W7PA 3AN1A 4PEEA 2JE8A 1R87A 5DMNA 3ITGA 4MB4A 3UJSA 4CEXC 3DDMA 4FP1A 1JGMA 2MUCA 4AFYA 2FKPA 3MP3A 1F61A 1G01A 2FH8A 4LRTA 2VX7A 3L9CA 2PWHA 1SB3B 1S5TA 2HQAA 2XH4A 5D38A 4I7UA 3KCOA 4MWAA 3GH4A 3AIQA 2FZ8A 3WH5A 3GO2A 1A49A 1DJXA 4ZCWA 1XL9A 4UMCA 1E6PA 3L2LA 4J7RA 3S9IA 4Q4OA 2PGRA 1JG9A 3T0BA 5BRBA 3LSBA 3AYSA 4CLMA 3ZLHA 1J4EA 2FZ9A 2BOGX 3UZ5A 1DWAM 2HCVA 4QSHA 2OG9A 3UJEA 1X6LA 1EJ7L 5CSYA 4MAVA 1GXFA 3VM7A 2CLKA 1J0YA 4POCA 2E77A 2PSNA 5LNWA 1KTBA 4YPJA 1W9DM 4NX0A 1ZY8A 1WOBA 4DPPA 2PWGA 3WDPP 1OFDA 3C3UA 4CN4A 1XLAA 1Y5XA 1GYLA 3QOKA 2NSXA 2DVTA 3I6RA 2QGYA 3W2NA 3JS3A 1ZMCA 2PWFA 3GAYA 2QJJA 3BGJA 4NI8A 4UCGA 5DQPA 1X8CA 2CCRA 3VIHA 3VOIA 5KVIA 2XN1A 1G6CA 2BOEX 3NPXA 4FLOA 3MBDA 4O0KA 2A7NA 1Q4NX 2HXTA 3OIXA 3KXQA 3WK1A 3NURA 3QZ6A 2QPUA 4ZR8A 4ICMA 3B4YA 3EPNA 1LOLA 2J7EA 1UIOA 1GK8A 3TQ0A 5I3HA 3AMZA 2YDQA 3B9JB 3MVIA 1JUBA 1F8IA 3UEQA 2O7SA 3TTOA 4MWAB 5EMJA 1MUCA 2TRSA 2A7PA 1XSKA 3UJ2A 3O3RA 3O6CA 1PVNA 3GNXA 2B31A 3R2GA 3VX0A 3AXMA 5G5HB 1RM6B 1MUWA 4LBSA 3FFSA 3F5KA 4CU6A 3B0VC 3AU2A 1KM5A 3TC7A 2PURA 3M5YA 1BWKA 1B5TA 2AQOA 1BQGA 1XLHA 4TMBA 1CENA 2QYGA 1M03A 1GV4A 4EM4A 2JF7A 3OHIA 3N15A 1G5AA 1XINA 1B9BA 2ZUWA 3J7HA 4JY8A 3EUB3 1V4YA 3BDKA 2ONEA 2BGNE 2YVGA 1A3WA 2PDXA 3M0YA 2WC3A 2XN2A 1UWTA 2BGQA 3RLHA 3TAKA 5LIWX 3W72A 3QF0A 1PPIA 2CLEA 4E38A 1ADSA 1D7FA 4DM1A 3LCIA 1DXFA 3CL6A 1YE4A 1HO1A 4GY0A 4AVFA 3IJ7A 4KS0A 3ZWTA 1OZMA 2C3ZA 5AC8A 2G8ZA 3BK0A 4DO7A 2ZA3A 5AVNA 1NDYA 5C5YA 4H4SA 1WKYA 1CNVA 2IUZA 3DN5A 1X1NA 3V5OA 1EIXA 2VR4A 4EM3A 4DVOA 4MG4A 2HVMA 1PKLA 3R25A 3LPPA 1E43A 3PWGA 3EB3A 5F4XA 1TV2A 1JZ8A 4M80A 1J8VA 2XN0A 4NNAA 4E2VA 3WY1A 5TIMA 4PTMA 4WHBA 3AHTA 3FA4A 3ARXA 4TMCA 1XLFA 4HN8A 1ZMDA 3G22A 2J3NA 3DG3A 3MI2A 3GFXA 3USBA 3TQKA 2HJPA 2Y7EA 3MDUA 4Q32A 4IG2B 5ABFB 3SECA 4HIBA 4XB3A 1F4AA 1TIWA 1JPIA 1QWGA 2WMIA 1QVBA 1ZS2A 1N55A 2VX5A 1EBDA 4K7VA 1H2JA 1OCBA 1IT0A 3H26A 3GR8A 3C2RA 4M6VA 4X2RA 1JQVA 1PCKA 4GC3A 2VUNA 2DJLA 2WQPA 5CLTA 3W7KA 1XBVA 3LG3A 1ITUA 4GRSA 2CIPA 4YL2A 5K9CA 1Q6EA 5LIYX 3PBUA 4DAIA 1KGUA 2FIQA 3UERA 3GXIA 4FR6A 2ZZ2A 5DCEA 4W86A 5LGZA 4E4PA 4QLLA 2GJLA 4ZENA 3M16A 1TTQA 5HMDA 4Z1BA 3RX2A 1JI2A 4HMCA 4L1WA 1FWBC 2EHHA 3W7QA 4Q4QA 4XSMA 2G3MA 1E73M 2A3CA 1IZCA 2ZUSA 4JS3A 1DTNA 1VHCA 3UR8A 1R8LA 2C71A 2Z7GA 5M1TA 3WUEA 2W3RA 2D73A 2XJ7A 1BGAA 4KW2A 1JF5A 1C8YA 1GW9A 4JTDA 4HOZA 1MW0A 4Y96A 1WXYA 3UXDA 3H4KA 5T91A 3LB8A 4HPHA 1U2YA 1WAUA 3GTFA 4LY4A 2Z27A 4EAMA 4A3RA 3UFYA 5CPSA 1KFEA 3SUVA 3O7UA 2JALA 3U57A 1FWFC 3ZJ6A 4AYGA 4F2BA 4RPPA 3TAOA 2BY1A 3CB8A 3UWVA 4S3EA 2E5CA 5HULA 3WJSA 3CAVA 2OKTA 1C8XA 5GNXA 3BQ6A 5JXQA 3GG1A 4TQTA 1OHLA 4HNNA 1E3XA 1H50A 3PBMA 4GGHA 4UFLA 2QNEA 5KITA 1XV8A 3RO8A 5T9BG 1FWEC 1SGJA 3GVVA 1GRHA 1P4CA 3ZWSA 4Y6GA 4PMRA 1UOKA 1ZXIC 3P5YA 3UW6A 1V3IA 2WHLA 3GW3A 5LIUX 3VO0A 3SAZA 4AWSA 4AZCA 4L4LA 3T05A 5AFDA 5U25A 2JEPA 3U4AA 4FNSA 3TJXA 3AS1A 1P0EA 2TSYA 4K8DA 1P43A 2GJNA 2H90A 1RA5A 3BAWA 3W02A 3ARPA 3TYDA 4QSFA 3V0TA 2X7VA 4LIIA 3WMSA 1IXOA 4Q8VA 1JL8A 3S2JA 3MDWA 1UKTA 4DUOA 4QQ3A 5FJUA 5CZKA 4ZE5A 4QE4A 3W7MA 3WDQA 5JQ9A 3T0CA 5BOEA 1G9HA 4UFMA 5CCZA 2VZTA 2V82A 3IGSA 4O53A 2J6VA 1B3XA 3T0DA 3M47A 4O0QA 1Q7ZA 2DSVA 1EQCA 4PZVA 2J7FA 3B8VA 1KTNA 2G5WA 3ARRA 3AI0A 3CB3A 4C6LA 3IUDA 3VIOA 2OQLA 3DENA 3EOOA 4HMEA 2DIKA 2PP3A 2WSQA 4JL2A 1RP8A 2DQWA 2V30A 1YDNA 4JY9A 3OQ8A 4WD0A 3M0KA 4DJEC 3VGFA 4DI8A 2H8XA 3ORWA 3CLWA 4LTSA 1KCXA 3CGBA 2VFIA 4GNKB 3C56A 3DOPA 1IT8A 2XZ7A 4HPNA 1F2JA 1W3TA 3MHUA 3CPUA 1GZJA 1NELA 4O15A 4NAEA 3WH6A 2OJPA 3C2OA 1ZZMA 1FP8A 4AZCB 5A1AA 4GACA 3UR2A 4B2DD 3TROA 1LG1A 3MB9A 1MEHA 3AHXA 1VFSA 3KP0A 5XIAA 4GE8A 2YAUA 4YMZA 4R3UA 3RGTA 3R0KA 1GVEA 4LCQA 5C8BB 4GWEA 4US5D 3AIUA 2ACRA 4H9UA 4J4KA 2DUAA 3ARTA 2E6FA 1J0HA 3BICA 5LHEA 2NXGA 1GKQA 1TMLA 3W6YA 4AZ6A 3LBCA 4RX0A 4FX8A 1GG0A 4PR4A 3L4TA 1NSJA 3BG9A 4J3VA 3N34A 2VHLA 1HN1A 1J5TA 3IARA 3P62A 3P67A 2VM8A 3DESA 4EF9A 5LNUA 1QBBA 2TODA 4JCLA 2FVKA 1H7PA 3SUWA 4HKPA 1J5SA 4GQQA 4GUHA 1KM4A 1T41A 1HW6A 1KR0A 4JFTA 4MJMA 3T81A 2NLIA 4MLRA 4PMZA 1Q6LA 2GSEA 5BCAA 3KP1A 5K4XA 1F4HA 3BAJA 2A0NA 4XZLX 2NVKX 3W25A 2G37A 1XCWA 1VLIA 2VCBA 3IGXA 3K2GA 1AD1A 2V69A 1KNWA 1K7EA 2A3HA 3GU9A 4NZ1A 5FJTA 3WLJA 3THDA 2DPEA 1TV7A 4AIEA 2GUBA 4P7LA 2XFRA 3AS3A 3VDCA 4ZB5A 3NQ6A 4NAEB 3PNUA 1CGXA 3GSMA 3KVMA 3L0NA 4NXKA 2WC4A 1MO9A 4HYWA 1LLWA 3VA8A 4BI6A 3AMLA 1JCJA 3WLKX 3H7UA 2ZUTA 4PCNA 3U5UA 3G1AA 5EA9A 3B40A 1P0NA 1OC7A 1QNQA 3R58A 4B2DA 3KW3A 2WAGA 1TWWA 2YSWA 1FH9A 3GLCA 3WLIA 3O2LA 4CNPA 1G4SA 3UWQA 3PJXA 1CIUA 3R0UA 1JDAA 4NVTA 1F07A 4NUWA 3CMFA 1HJWA 3ZJKA 4US5A 5FF3A 3GXFA 5AC5A 3QV9A 3RPDA 4H4RA 2GGEA 4KF1A 2OWCA 3TYAA 5HJYA 5D9OA 2JK6A 4JQ2A 3WH8A 4LS0A 4LV9A 4J3UA 1EWEA 3V1HA 4OVXA 4Q8PA 2VQUA 4WQ6A 1EPXA 3WQ8A 1EJXC 1A50A 4S3FA 3CGDA 5HMSA 3PG9A 5EU9A 2O4MA 3QLLA 1L6GA 2I56A 3B8IA 1FDJA 3HU7A 3UZYA 2VR5A 1CLKA 3SW6A 1SW3A 1M6JA 2P76A 4UR7A 1IEVA 3MI6A 2XM2A 3IAQA 2W3SA 4MF4A 2Y5JA 1EJVC 1R6WA 4HJWA 4C6CA 2G50A 2X2YA 4G8TA 4DJFC 3A22A 3VUPA 2GR0A 5REQB 4RNFA 4KCUA 2WSRA 3VZZA 2WSPA 5TD4A 4OFCA 5A8NA 1K8XA 2E0PA 3RJXA 1UD5A 2CZDA 1TMQA 1YNQA 3UBPC 3PN8A 4O57A 1AZ1A 3UCDA 5HNNA 4LBUA 5FJPA 4ZODA 3WD1A 2CERA 3AIVA 2BVDA 2Y63A 4LT9A 4HCHA 1M9HA 2PU1A 2PU0A 1ZUAX 3AMCA 3MA8A 4QDMA 3DX5A 4CQAA 3M1ZA 1W9XA 1IIGA 4UQCA 4G5DA 1B3WA 3MZNA 4L56A 4GFIA 2AQWA 3P7YA 4H7CA 3AFBA 3PNZA 4PGLA 3A21A 3BANA 3LMYA 5H6HA 3AM9A 4DF1A 3PPHA 4HTYA 3A5VA 2PDPA 3R5EA 3L4YA 4XO6A 4EQXA 2OGYA 1WKDA 1HFBA 1XPYA 3C3NA 3NOEA 4ZXOA 4LAKA 3W74A 1XIHA 3DXIA 4M1BA 3WN6A 4AMCA 2CLMA 3EB4A 1S5WA 1BYBA 5BMXA 3MWCA 2GR3A 2QPXA 3LHVA 3SUSA 3W37A 1WBJA 3NQVA 5HR7A 2QPSA 3TFCA 4PBFA 2VI0A 4LB4A 1YQZA 4DJED 3FKRA 3TTYA 1L6FA 3GH7A 3VGDA 1H6VA 1JZ7A 3WJZA 2YL8A 1NDWA 4MFDA 3EWWA 4JXCA 4MKNA 4KIRA 2UY5A 4OHQA 4JDBA 2X50A 1I0BA 2X09A 1VRDA 3E0IA 3WD0A 4XK2A 1FFVC 3VUSA 4B16A 1QK0A 1WXZA 4O10A 5DXXA 3STPA 2VD8A 2X1IA 2ASHA 3BLFA 4GVHA 1JGIA 1R3RA 3QY7A 1MRAA 1QWKA 4PEKA 1DJYA 2CHOA 2DY3A 4KQNA 3OVGA 5BU6A 4OUIA 4QCFA 2BV9A 4Y8FA 2V67A 1H7XA 1AMYA 1YDOA 1TG7A 4PL1A 3BLIA 1TZZA 1T0OA 4KWWA 1JFXA 1TJ1A 3EXSA 2FQIA 1YE6A 2DZWA 1VKFA 4QXIA 5BU9A 2GDUA 4W9TA 5C2XA 2Z1XA 2WPBA 3E96A 3WFZA 1GNXA 3HA1A 4HPGA 2CBUA 3PZGA 3MMWA 3TFXA 2TMDA 4EMJA 1A0DA 4BA0A 4RDZA 3AXIA 4B9YA 3WYZA 1SU5A 3GVWA 2Y7FA 4XD6A 3NQDA 4X0NA 4R7WA 2REQA 3ZVHA 1ZBWA 3EPMA 3KOWA 3AZSA 2OO6A 3CEPA 3GTXA 2XIBA 4HGXA 3TTQA 3HQ1A 1XLEA 3N04A 3D3FA 4FPSA 3L7RA 4UTUA 2Z28A 3EWCA 2R1NA 2VZSA 3CUJA 1F5ZA 4DJEA 2RABA 3L2IA 3WEMA 1H3GA 4JQAA 1Z32X 2PD5A 4P8XA 3CH0A 1WDQA 1J6PA 3EOEA 2QJIA 4YCPA 2V2HA 3N14A 3BE7A 4JIQA 2OU4A 3ALFA 3KLJA 4MJ4A 2PLKA 1HTIA 1HGWA 4O54A 4MY9A 2V9DA 3SJNA 3OA5A 4K7ZA 1DHPA 2BVYA 4AW7A 4JEJA 2WKLA 1QNVA 1NHQA 3G3MA 4KGLA 3WD3A 1DWIM 1JRPA 4IUGA 4FX7A 4LAOA 1W9UA 4LC6A 2PPGA 3PZQA 4H4PA 4ZB2A 3HV8A 3ITVA 3WLTA 3NPUA 4R9XA 4MDOA 2W4XA 1E71M 2DFAA 4MPQA 1MXGA 1QI2A 4RNJA 5TNVA 3WDHA 2INFA 5G2WA 1PDYA 3IVUA 3NQBA 5FL0A 1U1JA 1HQTA 1SZRA 4W87A 4D6CA 1SJBA 2OLSA 3N6JA 4LVGA 4XD5A 3RMJA 4O1AA 2GJPA 5A2AA 3TP4A 4MAZA 5GPRA 4G7EA 3TXZA 2J8TA 1CGYA 3TLLA 4U3CA 4Z17A 3WNLA 1RD6A 1XUUA 3T6CA 4HSHA 1FWCC 2DGAA 2FDSA 1Z41A 3WBYA 2V5BA 3V5CA 2YBTA 4R5EA 5EPDA 4OU1A 1W3LA 4AIBA 3H7VA 4BZYA 1NARA 5DRCA 1TB3A 4JTRA 4GINA 2RGMA 2FTWA 2OO0A 4DJFD 1W9BM 2IS7A 3IGHX 4LEFA 1P0KA 4ZE4A 4AMAA 3IWPA 3P8JA 1UR9A 4MYAA 1QATA 3DHDA 1ADOA 5DBUA 2D2GA 3RNMA 2J78A 1P0BA 1DPMA 4O1FA 2HRWA 3QVQA 2XUCA 3BV4A 4PUDA 3MSRA 2D69A 3A6OA 2YYTA 1SUXA 4HT3A 2NX9A 4GR1A 3E74A 4OJYA 1UZ4A 3F2BA 2O55A 4IT1A 3W76A 2VT0A 1EJWC 3HBLA 2XWDA 3GRIA 4EMIA 1D8WA 4ACZB 1MFVA 1H0GA 1ZY9A 3VPLA 4Q4RA 1H51A 4QJ4B 4C6BA 4JFSA 4HNLA 3RYSA 1N63C 4JIRA 4DZ5A 2RDUA 4NASA 1AQMA 4FI4A 3SRFA 2DW6A 2JBMA 2DV0A 3S5SA 1W5PA 2VEKA 4L6OA 1RLCL 2GGGA 4LSBA 1C90A 3FAWA 2VGFA 4IHCA 4H4TA 1FIQB 1RPXA 3ME3A 1OYAA 1E0XA 3LXBA 1TJRA 3UA3A 2DZXA 2OVLA 1VQZA 1UR0A 2OZ0A 3SEPA 3L68A 4M56A 4UOZA 5D32A 4NL1A 3ZYZA 1A5MC 3CLMA 3IJIA 5I79A 3TTEA 4Z2LA 1SJDA 1PJ9A 3A24A 3KRUA 1UD6A 3KDNA 3IACA 4JX5A 4GO8A 2BLEA 2O92A 2DZBA 4DYJA 1GWJA 4BFAA 1PCWA 3P93A 2UWFA 1JYWA 3CUXA 2CLOA 4LAZA 2Z0IA 4EMWA 2QF7A 4B91A 1OM0A 4APNA 1MNZA 4I8YA 4DYEA 3S6DA 3MP5A 4Q4KA 5KTLA 1VS1A 3WG6A 1ME8A 4I9JA 5AYXA 4DJFA 3W7GA 4JTFA 1OFRA 3RCNA 1UB3A 1KB3A 4X9YA 1W37A 1C7SA 3VGGA 2Q02A 4YNGA 2Y5EA 4QE1A 1UJPA 3WLNA 3BO9A 3WLHA 2HBXA 5FSEC 5ECVA 4UQAA 3KWSA 4FNTA 3ETRB 2DSUA 2QAPA 3LSCA 3HURA 3AIEA 3TW9A 3M07A 1XLLA 3NSNA 2X42A 4Z1AA 3NZGA 4WY0B 1XC4A 1WZKA 5H8PA 3EDJA 2Z29A 1GERA 1EEXA 4RNIA 5LA1A 3RILA 2XHYA 2XIQA 4ZFCA 3WQGA 3BG5A 2G96A 1ONEA 3QC0A 3BMWA 4DY1A 2GQ8A 4MYXA 4LH8A 3WFLA 4HNOA 1JI1A 1DOSA 3N19B 3M0VA 4JGDA 3H55A 3TE9A 2D0HA 4IPPA 1V02E 5IHSA 4C91A 5FJOA 1ADDA 4NJIA 3UA4A 4BEQA 3VD3A 3PK7A 1KGWA 5FF0A 2QS8A 3A3WA 3S0CA 2VDGA 5EB8A 5FF2A 3BOXA 2YKKA 3RLUA 3L0KA 2PTYA 2JIWA 1CGTA 3BVJA 2CDUA 2W0UA 4C6NA 2VP8A 1E72M 3TK7A 1JROA 3MO4A 1US3A 1F3WA 2W62A 1XYMA 4YTTA 3VOCA 3T8QA 2UY4A 3W07A 4DUXA 4EACA 3SO7A 4O1DA 2B7QA 3CHCA 2VFDA 3QQ1A 2QQ6A 2BDQA 3T07A 3WNPA 4V15A 3T42A 1DIDA 4PMYA 4DBDA 1OFOA 3RLGA 5LZLA 4UMBA 3STGA 3TA9A 2GZXA 4Z0JA 2BZNA 4GYFA 2P10A 4CUCA 3R13A 2B7NA 3CYVA 4GH3A 2OT0A 5A69A 3EA1A 3VD7A 4CNTA 4LF2A 4Z2GA 5D9PA 3Q65A 1J2WA 2QVNA 5AHEA 4G6CA 4YWOA 5GNYA 2JGQA 3W7LA 4QTGA 4CEUC 1FH7A 3EZ4A 2YGYA 3NQEA 1L6YA 3MCNA 1I45A 1NOWA 4TVDA 1BSIA 3ZSTA 3E1F1 1I2NA 4CQ9A 2IQ0A 1CI1A 1K03A 1QNPA 2VUYA 5BRPA 4X2PA 1UD2A 2ZQ0A 2NUYA 3W84A 3S5YA 2UZ9A 5HINA 1VJIA 2I1OA 4B15A 1X1ZA 4O14A 1GRTA 4WSKA 3PUGA 1K8YA 2ZOXA 1V97A 1GCYA 2J25A 4PMXA 3SSZA 2QUTA 4RL3A 5AC6A 4LVFA 2YX0A 8XIAA 2PBGA 4IIBA 2DU2A 3B9EA 3VD9A 3NG3A 1NPXA 5GRTA 3CU2A 3NQGA 1U5JA 4KCTA 4IH3A 2C91A 4UTFA 4RPQA 5LYRA 4PA8A 3TSDA 4CQ8A 4Q7IA 3B97A 1EP2A 3LHYA 5CSUA 4H9VA 1TELA 1PWMA 4DLFA 4Y8EA 4LRSA 3DK8A 4YWSA 2R91A 4FNQA 1K02A 4DHGA 3CQ0A 2GUUA 1VLWA 4BF9A 1KXVA 1YPXA 1O5KA 1PIFA 3PHAA 4MZYA 5CG7A 3UETA 3BQ5A 3NSXA 4DNHA 1K9DA 1EO5A 2VC6A 2Z7KA 3GHRA 1EUNA 3VGBA 4LB3A 4JPGA 2GK1B 2OELA 3GHTA 3H6OA 3QZEA 2ZWZA 2F8QA 3NYZA 3RF9A 1W2PA 3NDYA 2Z1SA 4BF7A 1MO0A 3GIPA 3EXRA 2ACUA 1LQAA 2QCLA 3W82A 1DJWA 1M7JA 1FKXA 1W1YA 2GH5A 3NOYA 4S23A 5I02A 4IGHA 3A3XA 5JRBA 4FLRA 2P3ZA 5E93A 3WH9A 1RJQA 4G9PA 3IVTA 3LNPA 3QW4B 1OCQA 2OR2A 4BI7A 3SCOA 1T40A 3GHUA 1GOXA 4Q7NA 4Y2WA 2J79A 5A2BA 3GS6A 2VTFA 1FEAA 3W4RA 1L9WA 1V79A 2DUXA 2EPMX 2WKJA 3A4XA 4GJJA 2RUSA 3FHAA 3U6WA 4RW5A 1HJUA 1OINA 2J9ZA 4S3KA 5JUVA 3BJSA 4ZQCA 1I2QA 3Q94A 3ATZA 3SRHA 4IM4A 1E40A 3TA6A 1VF8A 3W1NA 2Z26A 3BC9A 1LP6A 1VFHA 4C7FA 4HZMA 3LB0A 5BOOA 4DN1A 4XWUA 2X8RA 5HNUA 4UTMA 4JQ9A 5K9XA 4TV6A 4DZIA 4RXFA 1W1B1 4MADA 1OIFA 1L8NA 1GQNA 3F2DA 4EWND 1GOIA 3ZFHA 4L65A 3ARSA 2PF8A 2RAGA 3W7HA 3ERPA 2XVLA 4AD5A 2OT1A 2V3BA 5DT5A 1VC4A 1F3XA 4TX9A 3E6EA 3GNRA 1E5NA 4GX9A 1JRBA 1MUMA 2VZUA 4X9SA 3N3TA 3RR1A 4LY8A 4HP5A 4B5UA 3CHVA 3AROA 4YYFA 1IE7C 2PWVA 2RDWA 4CD5A 4GJIA 4Z0SA 3URAA 3W7CA 3P84A 4DJDC 3ANUA 1XKYA 4IMDA 4YXGA 2YB4A 4O52A 1LOSA 2QIWA 3R07C 4H4ZA 1RZMA 2AOSA 3UXAA 3MMDA 4XBJA 4AYSA 4ZZ9A 4N9CA 3OZOA 1AL7A 4ML4A 3RU6A 1M3UA 1WDSA 5B7ZA 1ONXA 4QAIA 4KRUA 4XZ9A 3SRKA 1OB0A 1JCNA 1XLKA 3U3HA 1W8GA 4JTJA 3WJYA 1IWPA 1LJYA 1V8EA 2Y1HA 3LGDA 5CPQA 5EFDA 3TW7A 5C0QA 2QAFA 2QV5A 2ZICA 1JZ4A 4YLWA 1KCZA 5KZDA 3ZJ8A 2GVJA 2WK2A 3L2MA 4HZ6A 1VEOA 2BB0A 1QNSA 4JTSA 2VX6A 1V7AA 3A23A 3GH5A 1OFAA 1O68A 2IKGA 4U4MA 1SZFA 3U0HA 2PRLA 2A6NA 1X6NA 3P82A 3MMUA 4PCPA 4H4XA 2YBUA 2AKZA 2JEQA 3OBAA 2Z6JA 5D02A 3KS5A 4H50A 4JTLA 4WDTA 4A8IA 1YPIA 3VGEA 3M64A 1K4HA 1TUXA 2V2DA 1R3VA 3U2ZA 4CCZA 4Z08A 5DX7A 2HNEA 4J3XA 3S2NA 2VNCA 3K4AA 4NNBA 1BTMA 4PUMA 5ER0A 1S3TC 3JR2A 4HA4A 1BSLA 4LUTA 3PZOA 4LOCA 1F3EA 4GQRA 1A5NC 2WM0A 4NILA 2G97A 4P7RA 2NQ5A 3WQFA 1POJA 1CTNA 1KFWA 5FAGA 1SFJA 3U9IA 1H4PA 3G24A 1OBAA 1EJSC 4UNIA 3UJFA 1WUEA 1O12A 1M1BA 2HE8A 3HGOA 3NPVA 1PEZA 2GWNA 2H3DA 1A3HA 2V68A 5F1VA 3P81A 2FFCA 4M19A 3IJ8A 3VNZA 1IXQA 2GYIA 1Q8AA 1PIIA 1THFD 2F61A 1GQJA 4WDWA 3M6YA 1LBFA 2OODA 3VOGA 1EOMA 2E40A 4KIEA 4NJHA 2XFYA 1SZEA 4XD3A 4Q8UA 1LTDA 1QHZA 2HE5A 3TW6A 3DZ1A 1ZP3A 4I9TA 1ECQA 4F9DA 1FEBA 2FZNA 4GJ1A 5A6JA 3K8LA 1I1XA 2QKFA 3Q37A 4U31A 2DQXA 2O4QA 4LUJA 3C5QA 4LJ3A 1PIGA 2OLHA 1WPCA 1XKJA 4V1XA 3S42A 4H6KA 3ONBA 1G4PA 1FY6A 3KRSA 3IJLA 4Z2IA 3TR2A 1XRFA 2W92A 3FOKA 3R94A 2PC8A 3N6HA 5FJRA 1FCBA 1JJKA 1GZ1A 3A4JA 3IV3A 5HUOA 3SQPA 3TNOA 1P0DA 4XG1A 2J9YA 4UTHA 4PMVA 3BZJA 1VCFA 2DZPA 3UT0A 1TRIA 4CD6A 4QE5A 4V27A 1A5LC 3RFAA 1MWOA 1TCMA 1GOMA 2E1DA 3ANYA 4UXDA 4J56A 2PDQA 2R1LA 2CBIA 3EOLA 2WP6A 3PR2A 3DFPA 4GXMA 4ENLA 3A12A 2F2HA 4L64A 1UWSA 4NQ1A 2YA1A 3QY6A 2FPTA 2KX9A 3HQOA 2R24A 5AKQA 4FMVA 4HMNA 1NHRA 2BGSA 5HK4A 1X96A 2WNNA 3DG7A 1WV2A 4NT0A 4YS1A 3N2CA 3E0FA 5BMWA 1AUSL 1RJPA 2MANA 2VVSA 3POHA 2VC5A 5I5RA 4H8VA 2VJXA 3PTQA 1JZ5A 3AUJA 3EX3A 3R8HA 1L6SA 3I6EA 4BY3A 1CXEA 1LL4A 3C0JA 2C79A 3PG6A 2NQZA 4AWUA 4Q22A 3R79A 3HJEA 5A95A 1R38A 3H2AA 1PHWA 4NG3A 1KRCC 3S1VA 4IQEA 1KXHA 4AEFA 2XFFA 2X0SA 5EMLA 1OX6A 3GK0A 4CD8A 5HXMA 2AMXA 2DIJA 3W81A 4EQRA 3SRDA 4JICA 3CO4A 3LPFA 4KERA 1ZAJA 4L6HA 4MWAE 1QO2A 4D6GA 1AMKA 4J1OA 3V7PA 1GOOA 3Q45A 1PWLA 2IKHA 4ZQOA 4PB5A 2ZE3A 4GC4A 4ZB0A 4JNYA 4DX3A 3H23A 4DJDD 1TIMA 5CH9A 5M3WA 1EOKA 3P14A 4W88A 5L9FA 2X99A 3I65A 2PC4A 3EKZA 4XSLA 4QNWA 4DIAA 1EIBA 1UR2A 3CO8A 4PCTA 4D2JA 1LLZA 4FF5A 2VGBA 3A47A 3AYTA 4CD4A 1E0VA 3MW7A 1QK2A 4LU0A 4QP0A 4ECLA 4MKSA 1BF6A 1ISVA 5AYZA 2Z4GA 3VOHA 4UC5A 4JTIA 4CCDA 3W7JA 4FX9A 1BG4A 1W0MA 3UG8A 1FXPA 1WQ5A 4ZO8A 3AXKA 3EB2A 1RQEA 4NZCA 5HANA 4WGHA 4IISA 1UKPA 4XQ6A 3BSGA 2HK1A 4P61A 3OHMB 2XINA 5I23A 1EC9A 3FCPA 1U1UA 3E2RA 7XIMA 4JFVA 1W1ZA 3S4TA 5TQLA 3AQUA 2WLZA 3I4KA 2YA2A 1TFVA 3IJ9A 3PSWA 1HJSA 2EPLX 2QUVA 1O7AA 5CGMA 3EEZA 1OCJA 1NEYA 2EJAA 1YQ2A 1LYXA 1JDDA 4PB4A 2WHJA 1BYAA 2Y61A 3TEVA 1A0EA 2ZVRA 2UBPC 5FEXA 1RLDA 5EBAA 1WZLA 5A94A 5TAOA 1EC7A 1MQPA 3E0VA 1TWDA 1FX6A 1D7YA 3XISA 2YIHA 2QR6A 1JZ6A 2VGIA 4FA3A 1V77A 5JBFA 5FAJA 3IJQA 1R3QA 3RPTA 4DJDA 2EG6A 4W93A 2C13A 4JD4A 3OC4A 4HA3A 4CGTA 4YU1A 3LRKA 3AHYA 4Y9AA 1F3PA 4ATLA 4TR9A 2LLEA 3M5XA 1BF2A 2IXUA 3AYVA 2Z25A 4NSBA 3QYQA 1Q6CA 5HMEA 2WW5A 4PMJA 2XWEA 5CJMA 4X22A 1F05A 4PUWA 1BRLB 4BQ2A 3URHA 3DBPA 2E3TA 4URIA 1A5UA 3CQJA 4D6IA 2HK0A 1GRGA 3UVIA 1RA0A 1VYSX 4IMGA 4WZHA 5HPCA 2OQHA 2RDTA 3BOLA 2QF8A 3UWWA 1B4EA 4K1WA 3STFA 1UH4A 1S1RA 3S1UA 1DEDA 1RVKA 1OG0A 4L5ZA 3RJYA 1DXEA 1W31A 3HOJA 3NL3A 1B3VA 2YA0A 3GVGA 1W6TA 2XIIA 2CFYA 2W54A 1H1ZA 1VD6A 1VBHA 3U5YA 1XFBA 5I07A 3NQ7A 5MF5A 3IRSA 1ZALA 3UG5A 4NF7A 3P0WA 4DNMA 1XIJA 1FFUC 1FH8A 1Y65A 2PTZA 3DI0A 1VDVA 3NTYA 1LORA 3S1XA 4B3LA 3QQ0A 1YPFA 4KFNA 4HTBA 4Z2HA 4ZO6A 3TLQA 2NZLA 2XTKA 2VKZG 1UQYA 3FG2P 1MW2A 4QFUA 1E4NA 2NT0A 1T6MA 4F0SA 2XZ9A 3ARZA 1MXSA 3WD4A 3EWBX 5ABEA 4IJBA 4AZBA 3AXHA 3R12A 1H7RA 4NYUA 2CWXA 4FK9A 3C2FA 2VURA 3WLMA 4GIRA 2Q8ZA 3W7OA 1VPQA 2GQ3A 1PSCA 3PANA 3V4BA 3WK0A 3H2CA 2Q09A 4E2BA 2H6RA 1UC4A 3FAXA 2B81A 1X2GA 4KPRA 1ITQA 1OYBA 1FKWA 1T96A 4WJEA 4JIHA 5HQLA 3A7UA 1CGVA 1BTCA 2DSWA 1B54A 4TU1A 1E1CA 4D72A 3TCEA 1PZ2A 2VQTA 4XX6A 5D09A 3GWQA 1X7IA 1ODZA 2ZFAA 1HVQA 2XVPA 1JZ3A 4TVWA 2YFNA 4S3DA 3WBEA 1ZAIA 3QBUA 1Z44A 1EO7A 3N6QA 2RHGA 3STEA 2F84A 2OCZA 5AHIA 5BWFA 4J57A 4PMDA 3MUZ1 3QR3A 3PPFA 4O8AA 1GKRA 2DZSA 3B05A 3HG3A 3P0XA 1UUMA 2J88A 3P74A 1KV5A 3G6MA 1AK5A 1ICSA 2CKSA 1XLIA 2D3LA 5JCMA 4WJ8A 3OODA 4IJRA 4H7VA