1RVKA

Crystal structure of enolase agr_l_2751 from agrobacterium tumefaciens
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
381
structure length
381
Chain Sequence
MIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activites in the Enolase superfamily: 1.7 A crystal structure of the hypothetical protein MR.GI-17937161 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Structural genomics, unknown function
molecule keywords isomerase/lactonizing enzyme
total genus 121
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1rvkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1rvkA01
3QLDA 4K8GA 4IHCA 1MDLA 1R6WA 1WUEA 4GGHA 3ZVHB 2QVHA 1FHUA 4FP1A 2PSNA 1EC8A 1YEYA 4JHMA 3UJRA 4E4UA 2OQHA 2PODA 2OZ3A 5FJUA 1NELA 3MSYA 3UJEA 2P8BA 5ENLA 4DX3A 1ONEA 3I6EA 1MUCA 4FI4A 4K2SA 3DGBA 3R0KA 3S5SA 3BSMA 2AL2A 2PTXA 1JPDX 3IJQA 4G7FA 3Q4DA 3BJSA 4ZCWA 3H70A 3SN0A 4JN8A 3SQSA 3ZVHA 2PU0A 4A35A 3T9PA 2POZA 3OPSA 1BKHA 3BOXA 2GGGA 4J3ZA 1F9CA 3ENLA 4MKSA 3R1ZA 3QKEA 3PK7A 3FVDA 3CYJA 3EEZA 3SBFA 2PP3A 3KUMA 1EC9A 1NU5A 4E6MA 2XH0A 3R25A 4DHGA 3UCDA 3NO1A 3DERA 3THUA 5BOFA 3VFCA 1SJAA 3V5FA 2QJMA 4IL0A 1SJBA 1MRAA 2DW7A 3TW9A 3U9IA 2QDDA 3MUCA 2ONEA 2PP1A 3MQTA 1EC7A 3VDGA 3JW7A 3CAWA 4A3RA 3RGTA 4GYPC 3I6TA 3OW1A 2HNEA 4A6GA 3STPA 5BOEA 3IK4A 2XH4A 2OQYA 2MNRA 3RITA 4KEMA 3CK5A 2P88A 1EBHA 1PDYA 3T4WA 2PMQA 3DFHA 3NXLA 2PS2A 4HCLA 3GD6A 3VC6A 4F4RA 3UGVA 2PGEA 3Q45A 3DESA 2NQLA 2GGEA 3UJSA 4YWSA 1ECQA 1OEPA 3DEQA 5FJTA 3ZLHA 2OZTA 1KD0A 3MY9A 3P0WA 3QN3A 3TTEA 4DWDA 4H19A 3N6JA 3ES7A 1WUFA 1TKKA 2MUCA 1EBGA 4M6UA 3CXOA 3UXKA 2PA6A 4H1ZA 4ENLA 3ES8A 4HPNA 4K1WA 3UCCA 3VCCA 3TJ4A 2GDQA 2ZC8A 4GMEA 1P48A 3VC5A 2CHRA 3U4FA 4HCHA 2AKZA 3RR1A 2PP0A 2OO6A 4E8GA 3UJ2A 1MNSA 2FKPA 3TWBA 2OG9A 4GIRA 1XPYA 1SJCA 4HN8A 1JCTA 4IT1A 4IP5A 1E9IA 4HNCA 3SJNA 1RVKA 2I5QA 3IJIA 3FCPA 3TCSA 1P43A 5FJPA 5FJOA 1TZZA 1DTNA 3RRAA 2ZADA 3FJ4A 2PGWA 3TOYA 2DW6A 3PWIA 4G8TA 2XH2A 3SN4A 4Z17A 4ZA0A 3UXLA 3D47A 2RDXA 3S47A 3R0UA 4DXKA 4GFIA 4J1OA 2QQ6A 2QGYA 3GC2A 4ROPA 3TJIA 3GO2A 5IDZA 3FYYA 2HXUA 3RO6A 3H12A 2PU1A 2XH7A 3DG7A 3V4BA 3DDMA 3R10A 1W6TA 2PCEA 1FHVA 3CT2A 2XSXA 4M0XA 1JDFA 1KKRA 2GGIA 2AKMA 1BQGA 3CB3A 3NFUA 2OVLA 3TQPA 2QJNA 4E4FA 4KPLA 1SJDA 2GSHA 3EKGA 7ENLA 1ELSA 3B97A 3SSZA 3MZNA 4IZGA 1KCZA 2OKTA 2P3ZA 3OP2A 1JPMA 4IP4A 3DG6A 2AL2B 2P0IA 3GY1A 2AL1A 3VCNA 3K1GA 3IJLA 3NZGA 6ENLA 2QDEA 2P8CA 3DFYA 3R11A 2OPJA 3N4EA 4H83A 3HPFA 3QTPA 2GGJA 1MDRA 1XS2A 3V3WA 3FV9A 3OZYA 3PWGA 3JVAA 2OLAA 3H7VA 4Z1YA 3V5CA 4EWJA 4MGGA 2GL5A 2OFJA 4DN1A 3OTRA 4H2HA 2PTYA 3SN1A 5FJRA 5J04A 3TWAA 4IL2A 3ZVIA 1PDZA 4KWSA 5EU9A 2O56A 2FYMA 4MMWA 2GGHA 3T6CA 1KKOA 4X2PA 1TE6A 3DG3A 3DIPA 3D46A 4HNLA 3UJFA 1R0MA 4GISA 3OZMA 4HYRA 3P93A 2OX4A 3MKCA 2PPGA 3ZLFA 2OZ8A 3H8AA 2PTWA 2HZGA 4KT2A 3P3BA 3ZLGA 3VA8A 2HXTA 1IYXA 3JZUA 4DYEA 3PFRA 2XGZA 2QJJA 3FXGA 2PTZA 3MWCA 3RCYA 4GGBA 3T8QA 3QPEA 1L8PA 3N6HA 4E5TA 4JN7A 3N4FA 3I4KA 4GYPA 4HCDA
chains in the Genus database with same CATH superfamily
3QLDA 1XLAA 2CLIA 2ZZBA 3W4RA 4AZIA 4HU0A 1B57A 4OU1A 3UWWA 4ZENA 3DUGA 4GH1A 5LIKX 3GG1A 3U0HA 3HPZA 4PCFA 2DZTA 4B5VA 4E4UA 3MUY1 3MTWA 1HGYA 3U4AA 2VUNA 4J57A 3F4VA 3TMLA 2RUSA 9XIAA 2LLEA 3RO8A 5D8ZA 1NWTA 3UQNA 4FHAA 3VD7A 2VOMA 2GVYA 4PTNA 2KZHA 3NSMA 2YGYA 3EWDA 2BASA 4HMDA 2AL2A 1H4PA 4IQEA 4H4RA 3C2EA 2ZUWA 3OQ8A 2B31A 4G56A 3TYDA 3ZZ1A 1UJQA 4JCMA 1PKNA 1RK6A 3K5XA 2OLHA 1QPRA 2GGGA 3E0IA 3CZKA 4GO8A 5EBUA 1SQ7A 2J9XA 3ITGA 4AYSA 3K8KA 1WO2A 1H7WA 1GKPA 1F5ZA 4B4FA 3WQ5A 3B9OA 9RUBA 1BRLB 1XIMA 3ID7A 4LVDA 3SBFA 3H21A 2QS8A 4V15A 5M03A 2Z1BA 3WQ8A 1A5AA 1BLIA 3PF3A 4NF7A 1QDSA 3GFYA 1P0KA 1Q6OA 1Z89A 4UTIA 2J7EA 4ORMA 3IGSA 1KLYA 3GB6A 5TAOA 1REQA 4F9JA 2G3IA 4LJ3A 1V3JA 2QDDA 2ONEA 4WOZA 1V02A 4ZBCA 3BAJA 3M64A 3CAWA 4MM1A 3C6CA 4B3LA 2YQUA 3TFCA 3OC4A 1P0DA 1QOQA 4NX5A 3E2VA 3D9XA 1EP2A 1A3XA 2V30A 1PYMA 5CSRA 3W7RA 1JR1A 3QHMA 3STPA 3CEPA 3FYPA 1TG7A 3BG5A 8XIMA 2GUYA 1MEHA 4HK5A 5FIPA 4R88A 1W9VA 1TRDA 4HK7A 4HHHA 3W7HA 1GPWA 1F3XA 3NOYA 3TW7A 4MG4A 3S3GA 4P8UA 1CGUA 2E1WA 5LA0A 1C3FA 4LA1A 1EGVA 4WX2A 3MUZ1 4ZOAA 3O0HA 3VI2A 1KCLA 3DHFA 3WIJA 4IQLA 4HU8A 4DUWA 2W61A 5CPLA 2HK1A 2MUCA 3S1WA 1X1NA 1LF1A 3TSMA 1VGAA 1VFTA 3EDFA 5U1OA 2GQ3A 3TLQA 4Y96A 3VAVA 2ZC1A 1MW1A 3DECA 1GVIA 2ZC8A 3GC4A 1AQMA 2OKOA 3S0CA 4DNAA 3PZMA 5BROA 1GGOA 1CENA 4ERIA 1MFUA 2O7SA 4RKAA 2A3LA 4XZBA 3UJ2A 1PSCA 4FS9A 5AC4A 2VRQA 1KTCA 1BVWA 4WLCA 1JCTA 1QI4A 4EACA 3MVIA 5I7GA 1TWZA 1F3WA 2P1FA 1TR1A 5M17A 1OFQA 3AISA 4UFJA 1Q1RA 3WYZA 2NPXA 1ZZMA 3VM7A 1CGTA 4JOMA 3G24A 2PCQA 5KZDA 1TO3A 3AO0A 1WZMA 1NWRA 4R7JA 2QQ6A 4XD4A 5A6MA 3CTTA 4LRSA 3B06A 3UG4A 2EGZA 4OUEA 4BCEA 1PHWA 2GR1A 1SZGA 3H12A 3URQA 1GV4A 3MI6A 2E1DA 2DP3A 4TTGA 1RBAA 1TVLA 1EDGA 1TWDA 4PUJA 1YXYA 2QVNA 1M9HA 1GRFA 3DHPA 4E4FA 3O07A 7XIMA 2PDJA 3WEOA 4UQBA 1WKFA 2NW0A 3T7VA 2YXOA 2Z2AA 4HNOA 1Q1WA 1VIZA 1VYSX 2YW3A 1W3LA 5C9UA 1DXFA 2WJEA 1SFSA 5G1TA 1E4LA 5HNTA 4IGNA 3DG6A 3W7IA 1P7TB 1NHRA 3T81A 1S38A 2V2DA 3NZRA 4WY0F 3SDOA 3N18A 2EQ9A 3CGDA 4CCDA 2HEJA 6A3HA 2WWDA 3S6TA 1ME7A 3LMYA 2VRJA 4H83A 2ZXQA 4JFVA 3WFAA 1D8WA 4Y9MA 3L23A 2XN0A 4ML9A 2E9BA 3W76A 1ODZA 5C5YA 3KZSA 1E0WA 1K7FA 1BSIA 4C6OA 3LHWA 4CD7A 4PBGA 2CWNA 1YRRA 4GY7A 4URIA 4MGGA 3S46A 4GC4A 3UR8A 5D32A 4UXDA 3MSRA 1DWGM 2J3NA 3CIWA 3GQYA 3VOGA 4CUCA 3BLOA 1Q3NA 4EPKA 3O16A 1S5MA 3NCOA 3MJYA 3U2ZA 3R0DA 4LW7A 4FNRA 4TMBA 2BY2A 1KCXA 2AOSA 4F48A 2V5KA 3DIPA 3OIXA 2X99A 5A8QA 1KBIA 4GISA 4G7EA 1UR3M 4YXGA 3TIMA 4RDWA 1IEQA 2O7QA 2BCPA 3WDQA 1U30A 1H7RA 4O0QA 4HMNA 3W7EA 1V0KA 1JPKA 3FXGA 4KWWA 2UWFA 2GQWA 3GDRA 1FXQA 1FWBC 1YQ2A 4UUIA 4B4HA 3QPEA 1GYMA 1S5WA 1E0TA 1X8FA 4XZNX 1SYTA 3VIJA 3M5VA 5H1WA 2D1ZA 3AS1A 4M7SA 5A6BA 3CUIA 3ZT6A 4MUPA 1CWYA 2Z1KA 3CUJA 4A22A 4RZ6A 3ZVHB 1ZU8A 4XKMA 3W9ZA 3ITXA 4LS2A 5E09A 2NX9A 1IXPA 1I9CB 3RHGA 4WKAA 1KB3A 4QBXA 1BZLA 4FIRA 4PN2A 5XINA 4EQRA 3SY1A 1Q6CA 1KLZA 2OX1A 5ENLA 3VD4A 4RE2A 1IV8A 2CZ5A 4IIGA 4XKYA 2YCLB 6REQB 1VPXA 4O12A 1PAMA 4IMCA 1QT1A 1EEXA 2BGQA 5I3JA 3Q4DA 4RV3A 1FWHC 4ZCWA 1VJSA 4GZ7A 4LT9A 4QNEA 4GLEA 2YVFA 3AZSA 2ICSA 4Z2GA 4QCFA 3H53A 3T9PA 2NSXA 1ZXIC 1B2YA 5C70A 1V6WA 2DUZA 3N14A 1J5TA 3ENLA 1NPXA 1JF5A 1LBLA 2W9MA 3R4IA 4KFNA 1K6WA 2QJHA 4LAUA 3FVDA 1GQJA 1UH2A 1KC7A 2Y5JA 3THDA 2VEKA 3LXDA 4XAZA 3EWZA 2PRMA 3PP7A 4E6MA 1UKOA 2V6AA 2WHKA 1VDVA 2QF8A 2YSWA 4R85A 1S39A 1PZ3A 1XRVA 5AYZA 3W83A 1EJXC 2RDWA 1G1YA 1ALDA 4JX5A 2YB4A 3TW9A 3GU9A 4K8HA 5C2GA 4C6MA 3TK7A 1IGSA 3ZR6A 2X0HA 1HTIA 3VDGA 1JD7A 2VEGA 4DJEA 4JCLA 1PCKA 4LIIA 1Z9AA 3O6YX 2BV9A 3C2YA 3WUGA 1JAKA 2Y24A 1TYGA 1AJ0A 1M7JA 3L4WA 4XZIA 2EJ1A 2ISVA 1S2VA 4KEMA 1N2VA 4BF7A 1KFEA 2BGNE 2EPOA 3UZXA 4LFYA 1QHPA 3WLPA 4GUGA 1OGGA 4JQAA 1E73M 2GJXB 2UY4A 4OJYA 2Z0IA 5FSEC 3LRKA 4AIUA 3Q58A 3DESA 2FTYA 1I4NA 2FZBA 5J8LA 5D4YA 1EJWC 1SO5A 3VDAA 1P0EA 3AIEA 4IF2A 1X96A 1E5JA 2GQ8A 5CKSA 3WO8A 1HJXA 4S3KA 3U5UA 4DLFA 1ZRQA 4NJKA 3DX5A 4UTFA 2NWSA 3HRDC 2CYGA 1A5UA 4D6CA 3NVVB 3QV8A 4CQ8A 3KVMA 2CZDA 3TEVA 4ALDA 1F07A 5EMMA 2GDUA 3GUWA 4AD5A 5KZMA 1UD4A 4FXSA 1UWSA 2DIEA 3HOJA 4ICCX 3L4TA 3GNXA 4XAFA 1ME9A 4HVXA 2NV9A 4MY8A 3LK6A 4MADA 4JFWA 3CGCA 3TWBA 4CNOA 3V16A 3WUEA 2OG9A 4GIRA 1AL7A 2NQ9A 3FA3A 2I1OA 4HN8A 3WNMA 3W37A 4RDYA 1FEBA 2YL9A 5DEZA 1EUAA 2PAJA 1HX0A 1QNRA 3H2EA 4WSJA 1GJPA 1YDNA 3I3DA 1GEQA 2QUTA 5XIAA 4O8RA 4ZQCA 3LZ3A 3PBMA 5HNUA 2YW4A 3S5OA 4FX6M 4Z2IA 4X60A 2FPYA 4QDPA 4IQJA 3DI0A 5B7YA 4QGCA 1JRCA 4TTUA 3W87A 2WKLA 1OZQA 2WZHA 4MJMA 2IXVA 1OB0A 2X05A 1M68A 4DXVA 3GXIA 4AZ5A 4PUMA 4S2BA 2DIJA 3ARUA 3HQ1A 2V81A 4PFHA 3WMSA 4OT7A 3WQ6A 4Q8UA 3HN3A 3SQLA 3TYAA 1JZ4A 5H6HA 1JQVA 2BOFX 1IWPA 1BWCA 4YCOA 3N15A 3G5EA 2XN2A 6XIMA 3T4CA 2CLMA 5IOBA 5XIMA 1BQGA 3V7PA 2ZTJA 2ALDA 1W1ZA 2OVLA 4UQAA 4HZ7A 3H4WA 1UBSA 2GZXA 4Q4OA 3M07A 3W7NA 4RR4A 4DZIA 2HROA 1DJWA 1OSEA 3ZR4A 5D33A 3C8NA 3OLEA 3WL1A 3RNDA 4UTWA 4CNUA 5HDRA 4RPPA 3NA8A 4LOCA 4MOZA 2E6AA 1PIGA 1A5NC 1N60C 4LRTA 2A1YA 4MYXA 3L5LA 1IT7A 4Q8TA 4DWSB 3GYCA 1JNDA 1I2PA 3UWVA 3B0VC 4JHOA 5GRTA 3GAYA 4MNMA 3VYLA 1OCNA 2GGJA 3COTA 1ICPA 4I9JA 1OX6A 3OZYA 3G1AA 3MUXA 4FLQA 4FF7A 1R30A 3E0VA 2NUXA 1X98A 3AHYA 3HURA 4KIRA 5FJRA 4EK7A 4Q6XA 3G1HA 3ATYA 2AQOA 3RJXA 4IL2A 1LRNA 4IPPA 4LB4A 3UY8A 3P2VA 3CASA 2KAUC 5LHEA 3VKJA 4XZMX 1EFZA 1KKOA 2D22A 2XN1A 3U48A 1FFUC 1E1CA 4X2PA 3IVTA 2INEA 2UY5A 3OOQA 1KWKA 1S46A 2WBGA 1KQYA 4GUIA 4C1NA 4U3CA 1D3GA 3S1VA 3R5EA 2GJPA 4KFPA 1X7IA 1BTCA 4Q8MA 4GXPA 3VA8A 4BA0A 1V7AA 5BU6A 4REQA 3INPA 2E6FA 5HNRA 4QE4A 2NXHA 2BWGA 2WAGA 4L4MA 3CV6A 5C7HA 3FVMA 3RCMA 3F4NA 4OIFA 4JN7A 2JKEA 3VDHA 2QUVA 2PDUA 3EOEA 3I4KA 4NAEB 2E28A 2YBVA 1MDLA 1WUEA 3FSTA 3VE7A 3FW6A 5C2CA 1K9TA 1GVRA 5BXTA 1FHUA 2ANUA 2CU0A 3E74A 1KR0A 3NWRA 3A7AA 2NLIA 5AHEA 3ALFA 4S3EA 3EOUA 1ZAIA 3ITTA 3W26A 4LEQA 1OK6A 3NR0A 2Y5SA 1R9XA 1TWIA 1XKYA 3CZ8A 4F2BA 1YADA 1V8EA 3GS6A 1S5VA 2CLOA 1F73A 1P7TA 2Z2BA 4CNTA 1JPDX 1Z44A 4DJFD 4E2BA 1B3OA 2F6KA 1H60A 4ZO6A 3WFZA 3FY1A 3ICJA 3NIYA 1BWVA 2POZA 2J75A 3WD3A 3JR2A 2WVVA 3OBKA 3PC0A 1QO2A 1Y5WA 3SRHA 4MB1A 3F7JA 3PK7A 2CXEA 2TSYA 3GFXA 4PBEA 4TVYA 2FQIA 1EC9A 1HKKA 1NU5A 4MPKA 2Z1VA 3BCDA 2VNCA 4H00A 3EX6A 1AL8A 1EA0A 3GR4A 2FLIA 1S3HA 5BOFA 3W70A 3VFCA 3II1A 2Z25A 2OELA 4ILSA 1SJBA 4AAJA 3MU7A 3UXDA 5TIMA 1T5AA 3SW6A 4LY4A 4IUOA 4LVGA 1H2JA 2UZ9A 2ZCGA 3OBAA 4IMGA 1QK2A 1EXPA 5DFAA 4EXAA 2QR6A 3I6TA 4EE9A 5GQBA 5KZ6A 3BVJA 5FL0A 1PS9A 1J11A 5CGQA 3RNMA 2C3DA 3LPGA 1X1ZA 1X39A 1EHNA 3S9YA 4JYDA 3G77A 3GZAA 3PBVA 5ABFA 3VIFA 4Z2JA 4WDTA 3DFHA 3FXYA 3VC6A 4GNVA 3GG8A 2G41A 5EL1A 3CUGA 4LAMA 4CQ9A 4QLKA 4DF0A 1IXQA 2AGKA 1VEPA 1W5MA 1OFEA 2FVLA 3KVLA 3QZ6A 2YXXA 2V68A 5G2IA 3WCZA 4N02A 1H41A 1FWAC 3SIZA 4A3QA 1N7KA 4H19A 3N04A 5HAOA 3NVZB 3CMFA 4G2DA 1IGWA 1G4PA 1XYMA 1OWQA 3B0XA 3NQFA 4MY9A 5BWAA 1V5XA 4DJED 1RBLA 2ZZ4A 4GZEA 1FWTA 4ACZB 1A50A 1Q7MA 2L5HA 2JIWA 1TWSA 3ABXA 1M6IA 1TPUA 2RDTA 3GD3A 1OD8A 3UXAA 4JN6A 4XO6A 4OBRA 1R38A 1SZEA 3TA6A 3AMDA 4XSLA 5AECA 2ZUNA 4LF2A 2OWXA 4ZR8A 2DY3A 2FFCA 1OG0A 3Q67A 2XWEA 5AC5A 3M0XA 3IC9A 5BYWA 3O15A 2G96A 1HJVA 4B16A 3ZIZA 3KM8A 3KRUA 3T78A 2X41A 3CL6A 3DGHA 1UUMA 7A3HA 2GWGA 4JDYA 4AY1A 4JNYA 2XH2A 3PZGA 3W1NA 5KEZA 1XLKA 2J7FA 1S7MA 3CXBA 3S2MA 3KVKA 4ZE4A 2B7PA 3LD5A 1UC5A 2PDPA 1I2QA 3KL5A 4BF9A 4J5NA 1EOKA 3UYIA 3DCPA 4WDXA 1H11A 1HO1A 3K4AA 1J8VA 3ISIX 5IHRA 2H9AA 3VK5A 4UOJA 4ADWA 2DORA 3POCA 3WUBA 4GIEA 4LXFA 4GQBA 1ZLPA 1MI3A 4RZ5A 1VJZA 3SEPA 4PMXA 3QMTA 3ONCA 4GR1A 4P8WA 1PWLA 2H90A 2GVEA 1LRQA 4AZ7A 5TQLA 2CLLA 1THFD 4O10A 1XUZA 4KPLA 5E1QA 1E3XA 1ZBCA 4NHVA 2CHNA 1LRTA 1JG9A 2E9MA 4DY1A 2VFHA 1SVDA 3EB4A 3N17A 1FFRA 1ME8A 4PBFA 1PYFA 4QAIA 4ASTA 2F61A 3VCNA 4E3TA 4MZ8A 3IJLA 3F2DA 3O6AA 3LERA 4QCEA 1NHPA 1R3YA 5AKQA 2YBUA 1R2RA 4AUBA 1IZKA 2DZXA 4ZFMA 1G67A 1XS2A 4AEEA 5EB8A 2J9ZA 5DMYA 5T91A 2ZZ5A 3HIJA 4U28A 2A85A 4HNTA 2WHJA 1TA3B 2R9RA 2GL5A 2DT3A 2XFRA 5KINA 1SU5A 4S1FA 3VNMA 1ADSA 4DLMA 3LB8A 1RHCA 3A7RA 2IQ0A 2WSYA 2NT1A 5HQMA 3W1UA 3DKLA 1TJRA 2I5GA 1UHVA 1XGDA 1OFOA 2X1SA 1LOLA 3BK0A 1WDPA 4LUTA 4JAWA 3DGRA 4QS6A 2VC5A 3M0KA 1W1YA 3ANYA 4M19A 5F2LA 4UB9A 2PLMA 3H8AA 3PBGA 2GSJA 3W88A 3E0FA 1L6SA 1W9UA 3REQA 1WZKA 4QRNA 4AIOA 4NSBA 4DUXA 4B90A 1UWUA 1T41A 3W7KA 5ABGA 2BSLA 3GHSA 2YVJA 1H6VA 1L8PA 1VLIA 4EWND 4S3GA 2DZWA 1M3UA 5DT7A 2XVKA 2I9UA 4GYPA 2E5AA 4MB5A 3VCRA 1W3IA 2YZ5A 1BWLA 4S3DA 3HZ3A 5A69A 5IBXC 4AVNA 2GPTA 5D2TA 2PSNA 4TOQA 1HW6A 4K1GA 4A21A 1GCYA 3HJZA 1DEDA 1SO3A 2CCRA 4FLSA 3RLVA 1CI1A 3D3AA 4ZB5A 5F2IA 4E3VA 4NIRA 2ZOXA 2WO5A 1ZAHA 2PDNA 1J93A 1F6PA 4R3UA 2CLFA 3HW2A 3IJ9A 2RGMA 1KFJA 3GTFA 1EJ7L 2G3FA 3QR0A 3DBPA 1HF6A 2PTXA 1W1TA 1A0EA 2GJXA 4H4VA 3CUHA 4DWSA 2WP6A 1OQFA 2NUYA 3SN0A 2WPEA 2ZZ3A 4LTSA 4F40A 2ZRXA 4L6HA 1QJWA 3L4XA 4KRZA 3W81A 4FXJA 2FHFA 3EKZA 4PMDA 5JBEA 1PZ1A 1JPHA 1ONRA 2JK2A 3DK9A 5CGMA 4L56A 1B4KA 5HJXA 1MYRA 1K3UA 4Q3MA 1J0HA 2J7HA 4GK8A 4G6CA 3S2CA 5A8OA 4PUDA 2G3MA 1O60A 2DJXA 2XVGA 7TIMA 1BXNA 3PTMA 4IFRA 4RCXA 1JZ8A 1BFNA 3EXRA 2DSVA 1SJAA 4C91A 1UWTA 2OWCA 4B9ZA 2A6NA 2C3ZA 2XUCA 1UWIA 4IIEA 1A4MA 1CTNA 2V5DA 4IXXA 2RHGA 4O14A 3WN6A 2VC6A 3SCNA 3W7JA 4A3RA 1H51A 3LHVA 3VGDA 4MVAA 4FR6A 3KOXA 4LBSA 5JCNA 3O06A 4JKMA 4W8BA 3PUOA 4YN5A 4O17A 1LUCB 2JALA 5EMKA 3VNYA 5JCKA 2P88A 4IMDA 3TYCA 1LLWA 4V2XA 2WBAA 3WEMA 1TCMA 2Y0FA 2WNNA 3VNKA 3A12A 2OSXA 3HPXA 4NAFB 5HPOA 2PGEA 3PTQA 2HS6A 1IZCA 3AS3A 3O9NA 4H9XA 3NNTA 3GTHA 3AMLA 5A8PA 3DEQA 1ENUA 4HK6A 3HTWA 5EMUA 2VGBA 3P0WA 4MLRA 4W87A 2XSBA 4H9VA 3N6JA 1ZFJA 5D9MA 4S3BA 1ZDLA 2QZRA 3R13A 3WQWA 2GJNA 4QE5A 1FQ0A 5C8BB 3CAKA 3ZT5A 4AF0A 3STCA 1KFWA 1VHNA 2QUNA 2X7VA 2VENA 3TYEA 2I16A 1E43A 1W3NA 3DFOA 3TUUA 1TYTA 1NDAA 2C91A 3NQMA 3KL3A 3U4FA 1Z3NA 5K4XA 5FS9A 1FWDC 3MZ2A 3DH9A 3L2IA 3IAQA 3LEPA 3FA5A 1V6UA 4DWSC 1PB0A 1CGWA 2RH9A 4HTYA 5A95A 1NEYA 2QCDA 1GXFA 1T0OA 3SUSA 1F6YA 3TCSA 1ODUA 1HJUA 3A4XA 1KGXA 3UD6A 3OG3A 4UMBA 1P0BA 5C71A 4NI8A 1FWIC 2F6XA 3NSNA 1TPVA 1QNPA 2ZX5A 3HQPA 3T2OA 3GW0A 3QQ0A 1JDAA 4N2YA 4M81A 3VKKA 1KQZA 1XM3A 1UZHA 3A4AA 3UU0A 3BAYA 2OGYA 2QGHA 1HUVA 4GBDA 2WV8A 3VINA 3FLUA 3HQOA 3QOKA 3NYDA 2Y7GA 2E3TA 1EWEA 2ZDRA 5K3VA 3TJIA 4ZSTA 3R89A 3OEXA 4H4ZA 4U4MA 1KXVA 2CDUA 3W6MA 5HMSA 1XRTA 4IUGA 1O4UA 6TAAA 4O0ZA 1MNZA 4GG9A 3DDMA 4F0SA 3R10A 3W53A 3NVDA 3GIPA 2OB3A 1W32A 3FAXA 5I2UA 1QI0A 4OVXA 2CWXA 1J12A 2ZE3A 1L2QA 4BI5A 2BVDA 3AI0A 1VFSA 1GZGA 3KWXA 4N4PA 1YX1A 3CV1A 3T42A 3MZNA 1VBHA 1XFCA 3UGRA 3B9JB 4QJ5B 5LHFA 3ARSA 1EH9A 3W72A 4ACZA 4CQDA 5BRBA 5BMWA 1X38A 4PB4A 1UZ1A 4ZB2A 1Y5VA 3BZGA 4C7GA 1TV7A 5GNXA 1GK8A 3WK3A 3LLFA 4RJEA 1AZ1A 4ZOEA 2NQ5A 2R1KA 2Y7DA 3TFXA 1UD2A 4PMUA 1N8IA 1V6XA 3BG3A 7REQB 4H9YA 4AU0A 3FEQA 2PDKA 3QQ1A 2OLAA 1HJQA 2Z2UA 4J3WA 3PANA 2YFOA 4KGLA 3B40A 3TZFA 4GX8A 2XM1A 5I23A 3OYZA 1JF6A 3TWAA 1ONFA 3K13A 3ZVIA 3W6YA 2CPUA 2C13A 3W27A 4DAIA 1TJPA 3OZPA 2YCLA 1AUSL 1M03A 2ON3A 3P14A 3UWEA 1XD0A 5DXYA 4O4VA 5EGRA 3NZ1A 2B4GA 1TMLA 4U33A 3HG3A 3ARZA 5AHMA 4ZXLA 5CAKA 3BTNA 3OHMB 5LXEA 1V97A 2CEQA 5A8MA 1FWJC 4V33A 4PEKA 1E1EA 4BR1A 4UC5A 1MXDA 3M41A 3UXIA 1ZBKA 4BI6A 3QMSA 4TR9A 1EJUC 1ICSA 3VGHA 3KDNA 4UZSA 3BANA 4L9YA 4B5NA 4AWTA 3KOFA 1EUNA 1GYLA 2OTDA 3TYUA 1LORA 5FMHA 2GUUA 1DL3A 4KBXA 2YAUA 3A5VA 2RJHA 3CS2A 1H09A 1XIDA 3CZEA 5I3GA 2G8ZA 5A6LA 4ZOHB 4DYJA 3N2XA 3UJRA 3EX3A 1C93A 3DH7A 3EX2A 3APGA 4MNJA 1PXGA 4M51A 4AD0A 3LHYA 1VBJA 3DENA 3EMZA 3Q2DA 2V9DA 1R9YA 3FJ6A 4K2SA 4M56A 3E1F1 3SI9A 5C9WA 1UB3A 2I5IA 1NH6A 4EMJA 4JN8A 4O1CA 3S5ZA 1KM4A 3UZWA 1AFSA 1GWJA 1XYBA 4V27A 3DFTA 4XG1A 4XTDA 1TX0A 2WOIA 3DHUA 3EOLA 4MKSA 1TVPA 3GZ3A 3A3HA 3M4HA 3SQMA 1RBOB 4NZCA 3TSDA 3E0WA 5HK4A 1G01A 2XIIA 1OYBA 3JS3A 1SSGA 2O4QA 2B7OA 3QHOA 2CLHA 5I3IA 3PWAA 5I3HA 3NQ8A 2PZ0A 1EF3A 4DHGA 4PTWA 5FEZA 1TTJA 2ACUA 3EKLA 2XVNA 3THUA 2ZQ0A 3CJPA 2E8YA 5A1AA 3GG7A 1XCXA 5G5GB 1KGUA 4DVOA 3GUGA 4HB7A 1JGMA 5KVHA 4Q6JA 1GOQA 2QF7A 2PP1A 5CAHA 1CZ1A 3MQTA 3PN8A 1SM9A 5A6AA 4CD4A 1B9ZA 4I3GA 5EMYA 4ERGA 4HT3A 2HNEA 1JEZA 4A6GA 2IQTA 4O18A 2VFFA 3MV01 3NOEA 3REQB 3ZJ8A 3MJMA 3PTDA 2ZDSA 1I2OA 2GQ9A 3LNMA 5HR6A 1UQZA 3ARRA 2VJXA 3MSGA 3IIPA 4DJDC 3ARWA 2QAEA 4KEVA 4P7NA 1WP6A 3DYOA 1OEPA 1BVZA 1JDCA 3GU1A 4HN4A 1OGBA 3WELA 1AA1B 3A22A 3OGVA 3GBEA 2VCCA 3WQGA 3H55A 3NM3A 5DO8A 4KEZA 3H2AA 3SCSA 1V6TA 1XSIA 1EO7A 3DFPA 3GX9A 3EB2A 2EHHA 4GJJA 1V4YA 3GG0A 4JX6A 4ENLA 3P8JA 4JY8A 2O55A 3NQDA 1RK5A 1E4IA 3G18A 4QDWA 4GMEA 3MKKA 3N1AA 3KTXA 4WXZA 2ZUUA 1BF2A 3KOYA 4PR4A 5AC6A 3WUFA 4FMVA 3DYPA 3QMRA 3VMPA 3GRSA 3W02A 4CN4A 4GWEA 1ZHAA 4CCZA 5DQPA 1RVKA 1W54A 3T0BA 1DOSA 2HE5A 1LOQA 3MMUA 1MEIA 2DQXA 3RRAA 1T6MA 2FPVA 3VNLA 1SMDA 4UTTC 1W91A 4PZVA 5EKYA 3W24A 1JZ2A 5I06A 2Y8VA 5E6ZA 1ZX9A 2A3HA 2A3EA 4OV9A 3TLLA 2V3FA 5HWMA 2NXGA 2XFYA 3TV8A 2XISA 4NJJA 4NJIA 1F3EA 2UY2A 2ZA1A 3SFWA 7TAAA 1F76A 2VXNA 1W3JA 3UPBA 2GGIA 2AKMA 1XDMA 4U2ZA 3WLIA 1WCGA 3FIGA 4CQAA 2WBKA 4MJZA 1JVNA 3RUBL 2CLKA 4JQ1A 3WLQA 3T2PA 3K8LA 2PFHA 3C2FA 1PVNA 3TN4A 3R79A 5U7SA 2ZXDA 3N9RA 3NO5A 4O54A 4PA8A 3WLSA 1H3GA 3C86A 4XWUA 2JEQA 1JUKA 2GOUA 4LU0A 4DJDA 1IEXA 4MPQA 3AALA 1A0DA 3VFLA 1HGWA 4BURA 4U3AA 2VR5A 2XIBA 2Z1SA 4H6RA 5C0QA 5K9XA 4POCA 2J6VA 3B8WA 1R5YA 4FLOA 1T99A 1GJWA 2BVYA 1XG3A 1N55A 3O1NA 3BMVA 3N9SA 4S3AA 3W1TA 1J6OA 1OJXA 1UKSA 3LZ5A 1QFEA 4X63A 2PTYA 2Z26A 4Q22A 1YYAA 1IR1A 1SW3A 3UP8A 2Z27A 1E4NA 3GXMA 4J28A 3GIYA 4NKCA 2CZEA 1DNCA 1ZENA 4KESA 2D0FA 3W7DA 3EA1A 3NAVA 3DK4A 2RAGA 2X50A 1BWKA 2Q01A 3GD4A 3IJDA 1XPGA 3B03A 3M0IA 3S1GA 2ZX6A 4H7VA 1VAHA 4DM2A 1R0MA 2OX4A 3ZYZA 4REQB 4WK9A 1GQLA 3RX3A 5A2AA 4H7ZA 2P0OA 3TDFA 3XIMA 4G1KA 4CD5A 2Z6JA 4IWWA 3NTYA 3L4ZA 5GVJA 2BOEX 3GH7A 1V0NA 4IGHA 3TN5A 1WKEA 1KXQA 1R3QA 3RCYA 4GGBA 4AC7C 4WKFA 2I9EA 3T8QA 1H61A 1UP3A 1OJTA 4NUWA 3NDOA 1XYZA 3P81A 1QNSA 3CWHA 3EPNA 3VMNA 5CZTA 3I7SA 1ISXA 1PWMA 3MCNA 1FWFC 4LB3A 3VDBA 1WPCA 4K8GA 2ZICA 3GTXA 1LL7A 3EDJA 3RF9A 2ALRA 2YKKA 3TTYA 3ZFHA 3ZWTA 4BKNA 1YNQA 3I3BA 3ARPA 4PEEA 1A5KC 1ZCOA 4MB4A 3RDKA 1GESA 1E0UA 4GUFA 4X0NA 1H0GA 3UR5A 1Q4NX 3MV11 1I45A 4LCQA 4PUUA 3U8GA 2WLYA 4FEZA 5CCZA 3L0KA 1BXBA 1NARA 2J9YA 1P1XA 1DIDA 4HPJA 2RFGA 3CUFA 1Z41A 2W66A 4EXQA 2FDSA 2YDSA 3NRZB 4AQLA 1VEOA 4D6HA 2XGBA 2EQ8A 4HZMA 2PDIA 1XIIA 2DGAA 4XSMA 1EX5A 2C1HA 2E40A 2HDJA 5D2VA 1BKHA 1I2NA 5CPQA 3UZ5A 4YMZA 4DBWA 3BOXA 2FH6A 3GR7A 5IFPA 3W7QA 4L65A 1R46A 3C0LA 4QISA 3IJ6A 3DJJA 4E4PA 1FCBA 2E0PA 4C6QA 4F8XA 1BXCA 3UEQA 2ACSA 5IXEA 3KUMA 2W0UA 1U5JA 4AEFA 3LGEA 4IJBA 4DEFA 3RYSA 1IXNA 5I09A 2XH0A 2FZ8A 4CCCA 3T0AA 3LXAA 1V3MA 1TVNA 2C16A 3A6OA 2SFPA 4DPQA 3PAOA 1J79A 3A21A 2Y70A 1MRAA 2BDQA 3W2UA 4XBJA 4AH7A 2ZRZA 4M6PA 1MMFA 1GNXA 3CWNA 1KRBC 1K03A 4HMCA 4GO9A 2R1NA 3SSJA 3ATZA 5JQ9A 2ZX8A 4QXIA 2ZYFA 1I2RA 1XLIA 3C2RA 4C90A 1KBJA 3I7QA 3QW3A 1QMLA 3EPMA 1VENA 1PPIA 5CXPA 3AS0A 5E6YA 4GKLA 4UQEA 5A6JA 3TQVA 4GRSA 4LX4A 3CO4A 4IJCA 8CGTA 2VRKA 1HL8A 1C29A 5E0KA 4DXXA 3GVQA 1RR2A 1V79A 5A2BA 3O8AA 3M7SA 1X6UA 2GYIA 1ECQA 4EAYA 4L64A 1J9YA 4N6FA 2C3CA 1DJNA 2HPMA 4A05A 4XD5A 2XM2A 3O0FA 4R9OA 4D8ZA 2CW6A 1TKKA 3CMGA 3KRZA 4WY0B 2GVLA 4Y6GA 2CLEA 4GA8A 4NP7A 3RG6A 1ISWA 2WW5A 4RDZA 4K1WA 4NJGA 1AH4A 2Y7EA 2ADAA 2O0TA 2VR4A 5BRPA 5C55A 1US2A 4ZTXA 4QDMA 4TV5A 1MSSA 3TYZA 3E2QA 4DZ5A 3A4JA 4EM4A 3LPFA 1OFRA 4GE8A 3WSUA 1LLZA 1YDOA 2DH2A 3QGAC 4IH3A 4L4LA 1UBPC 4L6DA 1H7XA 4HP5A 1QPOA 4XKYB 1U33A 3IEBA 1NHQA 2QULA 2DW6A 4EF9A 1R3VA 1RY8A 5DX7A 2ISDA 4PMZA 3NPWA 2A3AA 2C14A 1HKWA 4DWSD 2Q71A 3D47A 3VNZA 4ONVA 3T08A 2DZSA 2YL8A 3LY0A 2GQAA 3CGTA 3BJFA 5I77A 4JTKA 2JEPA 1WE5A 3S9IA 1N8WA 3O63A 3DKJA 5IDZA 1QASA 2X8HA 3L67A 4S23A 3H4GA 1S2UA 2G3NA 2XH7A 1KRMA 2G4FA 4PMJA 4Z1BA 4CEUC 2Z1WA 2VC9A 3M44A 4A2SA 3TTQA 3POHA 4M0XA 4YIWA 1KKRA 1V51A 1TX2A 1U22A 2QCFA 2V3DA 3ITCA 6CGTA 1R86A 3G3DA 3CQHA 4PULA 4PL2A 1JJKA 2QMJA 4C6DA 3G6LA 1GONA 4IG2B 2NVAA 4QG9A 4W93A 2AAMA 2V67A 4NYYA 3MHFA 3FAWA 2FZMA 3QKZA 3UG3A 4O28A 3WD0A 2VL4A 2W62A 2QDEA 3OG2A 1ZP3A 6ALDA 4C65A 3SR7A 3S6DA 3CPGA 1FWNA 1UYQA 2X0YA 3EDDA 4Q4RA 4W88A 3OO2A 3M0ZA 4DO7A 4FA3A 4EWJA 3AUJA 1YKWA 3AMCA 1R3WA 3HPSA 4NAFA 3BQ5A 2YXGA 3WF3A 3CEUA 3WNNA 3CUXA 4H04A 3V0SA 5FEXA 1WDSA 4FNUA 1XCFA 3VE9A 4PTDA 4D6DA 3K46A 2EKCA 3FHAA 1SZNA 1YPXA 3WLHA 1UASA 1B5TA 4FSAA 3CYVA 3LYEA 3QM3A 4K6AA 1E6SM 4GHRA 4MMWA 1L8NA 4H4QA 4JL1A 3GNPA 3I4EA 5K9CA 4UR7A 2W3SA 2A7RA 4IIHA 4IG2A 3ZLFA 1TTPA 3GXDA 4IP7A 3VGFA 3PSWA 4HPGA 4W8AA 3EWUA 5AFDA 1JCYA 3S2LA 4KPRA 2WANA 5KSWA 1SR9A 4DBEA 1F7BA 1OFAA 4WQ6A 1NFBA 4PC8A 5ECUA 1B30A 2AQWA 1ZUAX 2D2OA 3RXZA 5CH9A 1E4MM 3PG8A 4E38A 2QPSA 2GH5A 2CETA 3L4YA 4IHCA 3ELFA 1OIFA 1B3WA 1W9BM 3BAIA 2DPEA 3RAOA 3ALGA 5G4WA 4ZGYA 4LANA 1XRSA 3CWOX 3WBEA 3C8FA 4D8AA 4FDCB 1BAGA 2OEKA 4JGDA 4UQDA 2ATSA 4ATWA 4Z0SA 1K9DA 3LM3A 5F1UA 2PODA 2EQ6A 4X3ZA 4M3PA 2JE8A 1ONEA 4DO5A 3AZRA 3MHUA 3BSMA 3G0XA 1F3TA 1U1JA 1QNOA 4G7FA 4J35A 2JQXA 3VIMA 5LNVA 3BAXA 4IMEA 3K30A 4FK9A 1L6FA 1W5NA 4M7TA 4EVZA 1J5SA 3PVFA 4BEUA 3W00A 4RXGA 4AHPA 1SUXA 1T40A 2O9TA 5FF4A 2X09A 4OGZA 2ZZ6A 4HMEA 4HOZA 2E8ZA 4QG8A 1K8XA 3FS2A 1CXIA 5EBKA 1XBVA 1XWYA 3AJ7A 1CCWB 2X8GA 3S83A 3MSDA 2WZEA 2BHUA 3EANA 3DERA 1VLWA 4H2CA 1UG6A 4B15A 4RUBA 1PKLA 2QJMA 3RMEA 3GXTA 5EMLA 2D23A 5CQ1A 3MUCA 1GTEA 1NOUA 2CKRA 3GNNA 3OA3A 3CZJA 1SW7A 4MNKA 1K8YA 1PX8A 3G0UA 5BXRA 2XDFA 2OYKA 2ACQA 1E6ZA 4QLLA 4KS0A 5G1MA 2ODOA 1K77A 4QJ1A 3D6NA 1YNYA 1E6XM 2NV2A 1K8ZA 4AD2A 2WB5A 3SGGA 4P7QA 3E49A 2XG9A 4WDUA 3I65A 3O0KA 4C60A 3NGJA 3STFA 1TPH1 5DT5A 3T07A 4KMQA 1ZBWA 4WUIA 4NL1A 5JIPA 3VMOA 2JGYA 5FS6A 2OGJA 4NNCA 4HA1A 1PTDA 1WZLA 5FSDC 2XINA 3HO8A 4UR9A 3AMKA 1ZB5A 4CN6A 1CECA 5KVIA 1RQEA 3AHXA 4HPNA 2PF8A 1EQCA 3WF1A 1W1IE 1QO5A 3G1RA 2REQB 2XWDA 2WWCA 1OYAA 1WAUA 2CNCA 1ZS2A 3KVJA 2Q3RA 1KM2A 2ZZ2A 3AIUA 5JBDA 5H91A 4GNKB 2BZNA 1MNSA 3F2BA 3WQEA 4K38A 1CBGA 1Q6DA 4FZIA 2IKGA 1QOXA 4ZEPA 1NSJA 2Q8LA 5LIUX 2WSRA 4IT1A 2GUBA 4AVFA 3MMTA 4RNIA 1HKVA 3C2OA 1TZZA 5JVLA 3C3NA 4QHRA 4A3YA 1G94A 3TOYA 3PWIA 4AXNA 1JI2A 1FY6A 2IW0A 3M9YA 5HPCA 3T05A 2OSWA 1WXZA 2V5LA 1ADDA 5A3HA 4OUIA 1AW1A 2O4MA 2V5JA 4ZA0A 1YQZA 1EKOA 3S5YA 3BH4A 1DBTA 1WDRA 1UR4A 2H8ZA 1M04A 3PB2A 3PJWA 2QGYA 3SY5A 3G6MA 2YCJA 2EPMX 2W79A 4E2VA 3GO2A 3C4UA 2YJQA 1R87A 3QV9A 1R8LA 3CQKA 2YA0A 3I68A 2V5BA 4HSNA 5I78A 1EQPA 4TVWA 4H4TA 3VKCA 4W7VA 3OJGA 5BXSA 2BP1A 4XV0A 4J2PA 1TIMA 4ADUA 5FS7A 1XUUA 1MOKA 2XVLA 4LCRA 4IFOA 1QR7A 4S3FA 1GRHA 3BGAA 3E5PA 2BODX 2HQAA 3LQGA 2PDMA 1V3LA 2PWUA 2P3ZA 3TXZA 3KCLA 5GJMA 2R1MA 2AL2B 1X1OA 1HXJA 4L1WA 4KIEA 4I9TA 3VIHA 1ISVA 1FTXA 3AMGA 1W1B1 2QHAA 3RR4A 3TC6A 3W1PA 4EM3A 1RA0A 4P61A 4D6GA 2Y61A 1O5QA 4QSFA 1BHGA 3GHTA 1X2HA 3KHJA 5FEPA 4CN1A 1R9ZA 2E9LA 3HV9A 1QW9A 3N13A 4GVIA 2J79A 3LTSA 5CBIA 3MC5A 5K7JA 3L2LA 5LZLA 1X97A 1YHTA 3B8UA 1V7YA 2FVMA 3AUOA 2Y85A 1FWCC 1PDZA 3UESA 1XBYA 1XC6A 3LX9A 5HWJA 1H1ZA 3QF0A 4H4PA 2O56A 3W07A 1CGXA 1WKYA 1XF0A 2VUYA 4AG0A 3KZPA 2W91A 3G22A 1H5VA 3D46A 1YTDA 1DIOA 1NVMA 3PTKA 4YTUA 4KCUA 1HO4A 3PBUA 2HNHA 4M52A 1Z48A 1XQLA 4UR8A 3OA5A 3GH4A 1KGWA 4HD5A 5AVNA 2PBGA 4RX0A 4UTKA 1Q63A 4DYEA 3LLDA 3IARA 2EPLX 4GQQA 1NOFA 3LU2A 3FKKA 1UIOA 2PWHA 5E9AA 2C0HA 2Y8UA 1QPNA 1Q13A 2KX9A 3WLNA 4NEWA 4Y2WA 4XO7A 5LA2A 1AG1O 3N4FA 4N9DA 1DIEA 5CPNA 5BOOA 3L5OA 2BX7A 1EHAA 2IUZA 4IX0A 3W1XA 3BSHA 3PM6A 4A4AA 3L8KA 4ZTYA 2A3BA 2XJ7A 4KFOA 3WEZA 1HL2A 4C1LA 1DJXA 1XL9A 1JGIA 5D37A 1BKSA 4A3HA 2H9AB 1U5VA 2PDXA 3O6CA 3DGBA 2BNJA 3WMBA 3FEMA 2OOFA 4XB3A 4JNMA 2J8GA 2VZSA 2NVKX 5DCDA 1R85A 3CZGA 4ZXOA 5M5DA 3P80A 3SM0A 1OFBA 5CPSA 2A79A 2IPGA 1W8SA 1JZ3A 1OX4A 1TUFA 1CGYA 2B7NA 4J7RA 1HJWA 4TXEA 1GEUA 1MWOA 3PZQA 2D69A 1P0NA 4I5RA 3BV7A 2QCNA 2HPIA 3OYXA 1V02E 1CXEA 2O9PA 1X8CA 4DUVA 2PDGA 4YL2A 4LUIA 3GYEA 5LGXA 3C5QA 4NXSA 3K8MA 1WYIA 4NQ1A 3KOZA 1PIIA 3R25A 4HHPA 3VOHA 1C91A 4B5XA 1A5OC 2VFIA 3NO1A 1US3A 1RZMA 1OT2A 2GVGA 3WFLA 3FK4A 5HQLA 3DC0A 3QXBA 4XZLX 2ZX7A 2OYMA 4HBKA 1PJ9A 4WD0A 1YMYA 1ZTVA 3WF2A 4QX4A 4Q4KA 2BXYA 5CJ5A 1EC7A 3GW3A 3BZJA 3SO7A 4LSBA 3DC8A 4HPXA 3UW6A 1R7OA 5DY2A 3C52A 2ZRVA 3P74A 1NDZA 1NOWA 1CLVA 1J4EA 1XLHA 4LYKA 1U1HA 1KBLA 2JFEX 3OLDA 4S39A 1A53A 5AYBA 3NXLA 1KFCA 4QR6A 4NZ5A 3UGVA 4PODA 4CD6A 5FACA 4LS1A 3N2MA 1RPKA 2Y62A 4IOTA 4GC3A 4PUWA 5A5WA 4N9BA 2VX6A 4O16A 1YDYA 2WOQA 3W73A 1H50A 1CDGA 1YTKA 2YFNA 3ZMRA 1JCJA 4EX4A 4D6FA 4JTUA 3VZXA 2OZTA 2WMJA 3M5YA 2GLKA 1MVYA 1D7KA 3EEGA 4F66A 3K2GA 1MO0A 1GZ1A 3M6DA 2VGFA 3EDKA 1FEAA 3QFEA 3MT1A 1B3ZA 4DUOA 4ECLA 1UCWA 1UPMB 1XG4A 4XIAA 4Z42C 1EIXA 2EKGA 3TJ4A 1IEVA 2QPUA 1TJ2A 2CKSA 3BLDA 1SFLA 2CHRA 2DUXA 3W7PA 2J24A 1W2PA 1KCKA 3W84A 3TN3A 2OO6A 3W7GA 1Q6FA 3SIMA 1NY1A 2EG7A 4HPHA 2GDVA 2I7GA 2X16A 4U5IA 3UVAA 2YDQA 5T9CE 3TA9A 3TOPA 2YLLA 4J2MA 3GXFA 4JBRA 3V36A 4JTEA 4IISA 3KP1A 4NVTA 2VFEA 5T9BG 1UD8A 3SN4A 4H01A 2PDLA 1TZ9A 2YCKX 3QY8A 1FH7A 3VKBA 4TUFA 4HA3A 3W0KA 5ABTA 4US5A 1WA3A 2X42A 1SB3B 1XKJA 4Z0JA 3NQEA 3WLKX 4AD3A 2UV8G 4GFIA 5LA1A 1JXKA 4IPJA 3UZJA 1V59A 3MHGA 2FB3A 4NU7A 4UNIA 2V8ZA 3WDIA 1VCGA 1REQB 5BCAA 3MA8A 2VQUA 4BJHA 1C7TA 2XSXA 1QRQA 5DXXA 5LNRA 2J47A 1GOWA 2Y2WA 2X8RA 1SMAA 3TYBA 3AIBA 1NWSA 5DCBA 2FHCA 3AZTA 3AROA 3B97A 3KRBA 4DELA 3OGSA 1XX1A 1NIUA 1KCZA 2ISFA 1HKIA 1ZJHA 1JPMA 1TB3A 1XIJA 3TZNA 5C9ZA 5M2FX 3IVUA 3ABSA 1JFXA 1RV8A 4S2CA 1Q2SA 3EWYA 5TD4A 3MMWA 3QJAA 3PUEA 3WQPA 1N8FA 4HU3A 1VR6A 2BMBA 3EWXA 5I3FA 2R82A 4YNGA 4NEVA 1XHCA 2QUUA 1QI5A 1G4SA 1IWBA 2DZPA 4FNTA 5FL1A 1UR1A 1Q45A 3V5CA 3BW3A 1NDYA 3A3XA 2PDQA 4ZQOA 3AN1A 3HGJA 3PJUA 4W84A 3GAKA 1XI3A 2BVTA 4Z2KA 1SZFA 1FHLA 1U2YA 4Y8FA 3W71A 5A94A 1H1YA 3DG3A 4OZOA 3KBSA 2RJGA 3P6LA 4HNLA 4HYRA 1Z69A 3CQJA 3FDKA 1A80A 3VDCA 4JKKA 2P10A 2WMKA 2VMFA 1JUBA 1GKQA 1D8CA 5CSYA 4KT2A 5FAGA 1V03A 1U5HA 3W01A 3PZOA 3VIKA 3DI1A 4EIVA 3ZSSA 3WMLA 4DO4A 1FOBA 1MFVA 4HKPA 4TVDA 2CLPA 3SCUA 5LXXA 1XW8A 4JDBA 3GU2A 2WQDA 5E70A 4KRUA 4HCDA 1P6BA 4I7UA 4UFLA 4J3VA 3WD2A 3IAPA 3GXNA 3OGRA 1FHDA 3U3HA 4IICA 1C8VA 4ZQMA 3ORWA 4D8LA 4ICNA 1GTHA 1KTBA 3SCRA 3A9IA 1G7UA 1FP9A 1NELA 5ABHA 3SAZA 3B9DA 5U4NA 2XFFA 5CZSA 4DX3A 5FF7A 2BS9A 2I17A 2G0WA 1MUCA 3FDGA 3WJSA 4LVAA 3S5SA 1JYNA 3KS5A 2DSKA 4GI8A 1RP9A 5FI8A 1A0CA 1XP3A 5HOSA 1H1NA 1V3IA 1TFVA 2PRLA 3CL8A 5LIXX 1JRPA 3H4KA 3LV6A 3H70A 2OJPA 4E8CA 2EPKX 2BB0A 3ZVHA 3WENA 3RM4A 4IPLA 3T1GA 1Z42A 4UFKA 1XRFA 4J3ZA 3AXIA 4FAMA 3W6LA 4B2DD 2I56A 1JXJA 4G5DA 2OO0A 5AZ1A 1GVYA 4YWIA 2QV5A 2YYUA 4LEFA 4LF1A 3M16A 2A6LA 2X1IA 3IIXA 1XLDA 2WK2A 1XGZA 1W0MA 5CG7A 1E1FA 2BC1A 3VXGA 1XR2A 3P84A 3OLGA 1CPUA 1A5MC 4XIMA 1TV5A 1RLCL 4K7YA 4OKDA 2ABAA 5AHFA 4FXFA 1OY0A 4JQ4A 1ZY9A 2R24A 2C19A 2BXVA 1AH0A 4TQTA 1GOIA 3KBWA 4UBPC 3USZA 1HNYA 4NXKA 3N3TA 1W1VA 2VR2A 1JAEA 1TELA 3S5NA 3WKZA 3ZXWA 1E71M 2ZRWA 3HGRA 4CNNA 2XH4A 1E6PA 4F0RA 4B2DA 3SURA 1EZWA 1XH1A 5BXPA 1KFLA 3BWWA 3LPOA 3BDKA 1YE4A 2RGLA 1QUMA 5A6TC 3ABZA 3QPYA 2Y7FA 1GJUA 1D7FA 5HA7A 3BCFA 2PDYA 4O0KA 3LM7A 2GGEA 3LXCA 3M0LA 4YWSA 4LAKA 5JMUA 1SO4A 3QZAA 5G4EA 2QAFA 1EYEA 1SFJA 1KD0A 1WBJA 3QV6A 1XDJA 2O9OA 3Q65A 1Q66A 1UA7A 1WUFA 3OB8A 1G0CA 3EXTA 2INZA 1MZRA 2Z4GA 1I8JA 1K6AA 3LSBA 3WQVA 4M6UA 3WX7A 3WH5A 3FHQA 3MCOA 1PEZA 4K37A 4NY2A 1TTQA 4JR5A 1XV8A 1M1BA 4D1IA 3F4DA 1GOMA 3CIXA 2Z00A 2DFAA 2XIMA 3I7RA 1W31A 1HQTA 2Y5EA 1H7NA 3W2MA 1STZA 1PE1A 1P6WA 1WQ5A 5HANA 4A8RA 3SY8A 3WH7A 2DSZA 1E9IA 1O7AA 4L7ZA 3CPRA 4KRTA 1WV2A 3IJIA 3AFBA 1P43A 4XBKA 1JUEA 3VKAA 1IIHA 4K36A 5FJOA 2DSUA 4GPNA 3SUVA 2Z7GA 4YWOA 1I1WA 1ZP4A 1E5NA 2W63A 4FX7A 4MHBA 2D24A 4AF0B 1BPLB 1GVEA 5DMLA 2ZIDA 1GPFA 3GRTA 5EBAA 4L1XA 4GVHA 1LQ0A 4H4WA 3QQWA 1LT7A 2PRHA 4J1OA 4ZL1A 3GC2A 3M1ZA 1QNVA 4WJEA 1M41A 3HG4A 3DFNA 4UQ9A 3BICA 3WDPP 3TONA 5CC6A 1M7XA 4JIQA 2NX3A 4ERAA 2J7DA 2A3CA 1ISZA 3SUTA 1W6TA 1ZPTA 3G1VA 3AXKA 2F8QA 4BV6A 1UWAA 4Q33A 1S3TC 3U7BA 1I60A 3LHTA 3I10A 4PB3A 1SJDA 3LXBA 4UFHA 1J0KA 3WDJA 1NM9A 4ADTA 4D2JA 4DIAA 3TN6A 1L9WA 3H2NA 4WR3A 2CBVA 3OP2A 2YL6A 4H8HA 3EBVA 1C9WA 1Z6KA 5AHLA 2WMFA 4EP8C 2G37A 3O6DA 1E55A 3UA3A 2BVWA 4L4OA 2AL1A 3NURA 2ZKMX 1WYGA 3RPTA 3STGA 1IZJA 3QPZA 3W2NA 5BU9A 2R94A 4AZ6A 2IPJA 4Q4PA 4RL3A 4BS0A 4HQVA 1DTUA 2G3JA 3UNDA 4P8VA 5LNWA 3II4A 3SCOA 1AQFA 1BG4A 4YHGA 1ESWA 4N9EA 2QCMA 3KRSA 2CHOA 1JCXA 5M3WA 2QXWA 2VDIA 3VU2A 4DN1A 1EP1A 4LPCA 3GTNA 3GSMA 3S2NA 3S4TA 2NT0A 3MKVA 3QH2A 1R3RA 4I90A 3UYCA 1YLVA 3KEHA 4JY9A 3URHA 4XTIA 5I79A 1PV8A 5D38A 3TROA 2TAAA 5F7UA 4UTLA 4DAFA 4JTCA 4OWGA 4Y7EA 5LIYX 5AY7A 4FF5A 4QE1A 3MKCA 2E25A 1C8YA 3T09A 2NQJA 3HV8A 3EB3A 5CBJA 2IKJA 2IXUA 4H8UA 1GRTA 4L6OA 1EF2A 3AXXA 3LBOA 3GVGA 4YU1A 4ML4A 2QDHA 5EYWA 3CB8A 3ZJ6A 1V3HA 1JL8A 3A5FA 3QC0A 1QHZA 4PFMA 3CZLA 1N63C 3GFZA 1LVLA 1PO9A 3QZEA 1K02A 4E5TA 1XQKA 1HG3A 2QYGA 3SCTA 1JDDA 1NTHA 3BCJA 1AODA 1ITUA 1R6WA 2FVKA 1TV8A 1M6JA 1GG1A 4LH8A 4DB7A 4Z2HA 1BYAA 4E8DA 5EA9A 2EPNA 1CLKA 5LKYA 2J27A 3E02A 4JL2A 4PUEA 2Y89A 5PTDA 3W22A 5I5RA 4DI8A 4APNA 4EXBA 4CVUA 2CC0A 4FI4A 3NS1B 2WM1A 3CPUA 2FHBA 4YYFA 1UQYA 2POTA 2ZRYA 3VGEA 3RJYA 3IJQA 3A9BA 4NRRA 4OV4A 2BHYA 3BJSA 3SZ8A 1KBKA 4OE7A 1IEIA 2V6OA 3W1RA 3PB0A 1EGZA 4A35A 8TIMA 1K4QA 4IGSA 3G2GA 1VHCA 2CZVA 2BGSA 2OWWA 3SCPA 3W75A 4FX8A 3SGUA 2ACRA 1W3TA 2DU2A 4QAWA 2V38A 2YDAA 4EF8A 4QEHA 1YXCA 5U25A 1CNVA 3R8RA 4NZ1A 2VD8A 1LYXA 1J96A 1R7AA 4MKNA 4PCPA 1JRBA 1FWSA 3L2MA 4GIYA 2CBUA 1JCLA 4AMAA 1XHGA 3UCDA 4AY8A 2HBVA 1A5SA 4NZ4A 1RJRA 2WMIA 3PZ9A 1CB2A 2NX1A 3V5FA 3LI0A 5F4WA 4IL0A 2P3EA 1VFHA 2CXGA 1FKWA 4TU1A 2JGQA 2MANA 4IQDA 2R91A 2PWFA 3UA4A 3AJXA 1DJGA 3TW6A 4MTVA 4QLJA 3L5MA 3S2JA 3T40A 3JW7A 3ARQA 4FNQA 1JQXA 3F4WA 1OCQA 4WHBA 2Y8KA 5ABFB 4Q8NA 5BOEA 1MW0A 1J0ZA 1FDZA 4JTHA 1UR8A 4AYGA 1XGEA 1PDYA 3IGHX 1H7OA 3PPHA 2J66A 4HCLA 2VD9A 3CAQA 5AHNA 2NQHA 1SR0A 1V3KA 2CFFA 3BOLA 4JXCA 1O95A 3C0QA 2BG5A 3BMXA 4ZVJA 4O50A 4EANA 3RPMA 5HR7A 3KXQA 4L5ZA 2WHMA 5F2GA 5D9PA 3R94A 2JK6A 3GVVA 2PURA 2Y4SA 2HQMA 1B54A 1EBGA 2A0NA 1GVOA 4Y90A 1YDVA 5HMFA 2VX5A 3PJTA 1DJZA 3UXKA 4AB4A 2EJAA 4H1ZA 3QLLA 3ES8A 4Z1DA 3TE9A 5JRBA 1NP2A 1I0BA 3NQ2A 2VYOA 3F03K 1TSIA 5IFTA 3ITVA 4RK8A 2QCLA 3EUB3 5HBFA 2AKZA 2ZZ0A 1G7VA 3HMCA 2TMDA 1VBGA 3Q94A 3PG6A 3W2LA 2ZWZA 3SADA 2INFA 2DZUA 1XPYA 1SJCA 1WDWA 1V77A 1VPYA 3THCA 1AD1A 2VT0A 2FFIA 1LBMA 3QR3A 3RFAA 1W5OA 1HP5A 4ADSA 1KRCC 2GFTA 1YTEA 1RSCA 2ZADA 2D2HA 2BY0A 2W54A 4G8TA 3L68A 1ITXA 4KETA 1RM6B 4MWAA 1XXXA 3HG2A 3L66A 4GCXA 3RN6A 5ABEA 3GXPA 2QLYA 3OHIA 4QNWA 3WBAA 2A4AA 2VP8A 3NVTA 1LP6A 2QDGA 1F4AA 1O94A 1DWFM 4ROQA 3SUUA 1DQWA 4GY0A 3SGZA 3IRSA 3PUDA 3W28A 1Z8AA 4WKHA 1W3HA 3UFYA 3DG7A 3V4BA 1ZALA 3RIKA 2OCZA 2NV1A 2Q8ZA 2PCEA 4RPQA 4X9SA 1POJA 5CPOA 4R34A 1VKFA 1DQXA 4PRRA 1XISA 1AJZA 1H7PA 1N5WC 3VZZA 1ONXA 2WC7A 1GUVA 4HJWA 2OT1A 2VTFA 1C9DA 3W7LA 1VH7A 4KWUA 3KBVA 2XFWA 3EKGA 7ENLA 1C92A 1IQ8A 4WY0A 4CQCA 1X6LA 3P67A 3NG3A 3QGVA 5CZJA 5EPDA 4NILA 1VF8A 2PLKA 3R07C 2FPTA 1PZ2A 5CC7A 1CX9A 4A8IA 3GNOA 2PBOA 2Q8XA 1EGMA 2E6YA 1W9XA 2OODA 4ZB0A 1F8MA 4PL1A 3KE0A 1GHRA 3WJZA 3K4WA 2J62A 5MHBA 3VOCA 1B3YA 2HV5A 4G1NA 3LRLA 3BJTA 3PWGA 3VOFA 4F0LA 4DBSA 1Q2RA 3JVAA 4AZHA 4W4QA 1QTWA 4HA4A 1FX6A 1MZHA 1VYPX 4UNKA 3OIHA 1POKA 3WNKA 2WMIB 3L4VA 1A5CA 3K4DA 2PLJA 1S2TA 4MY1A 1KFKA 2WOVA 4GX9A 2GK1B 1SFTA 4KWSA 4RXFA 1PTAA 4H4YA 2ZA3A 1QAPA 5C2XA 2VURA 1CB7B 3UWZA 4MF4A 7CGTA 2FYMA 4ZQPA 3HMJG 1UR2A 4JFTA 4IFKB 3M0MA 3SCWA 3HFTA 2ZZ1A 1KM3A 2PI6A 2RKXA 1XH2A 2VZTA 5FAJA 3OZMA 2WVTA 3B0PA 5M1TA 1GYNA 4MFDA 4KQNA 2R6OA 3RLHA 4WEVX 3P3BA 3ZLGA 2NUWA 2E68A 1LQ2A 1NQKA 1IT8A 3ITYA 3O3RA 3DJGX 5CEWA 2HVOA 1J18A 2V2CA 5K2ZA 2C6QA 1XICA 3HGSA 2AMGA 4XISA 1HKMA 3IRDA 2DT0A 1LL6A 4QSHA 3FG2P 4N6EA 4FNSA 4W5UA 4WF7A 1VFFA 1GT8A 1ZMDA 4JNZA 1J01A 2BBFA 3VIGA 4JFSA 1O5XA 3AAMA 1DWIM 4H9MA 3DAQA 1RD6A 3PPGA 1PBGA 4LCSA 3CV2A 2P8BA 4US6A 1EJVC 2BLEA 2PD9A 3I6EA 5DBTA 2NQZA 1F2JA 3WF0A 4W9TA 3WK1A 3VNJA 5A8NA 3AYVA 2DV0A 4DPPA 5FF0A 5GPRA 2F2HA 3AIWA 1S2WA 3E2SA 1KM5A 2VKZG 1UD6A 2WKJA 1CEOA 1UWRA 5BNKA 4D6EA 1PHQA 3SQSA 3UBPC 5G5HB 4M1RA 3WQFA 1K9EA 1VS1A 3DHDA 2WQPA 2WCGA 2EQ7A 2YLAA 2DVXA 2BY3A 3LDVA 1CIUA 3BARA 3DK8A 1VEMA 3KBMA 3GNRA 1EOMA 1NFGA 3WQOA 2YDRA 3MP5A 3ANVA 3B9EA 4JTAA 3MCMA 1OX5A 1WAWA 2EO7A 2Z6IA 3THQA 2E77A 2A5HA 1D7YA 3WQCA 1LWIA 3CHFA 2QPXA 1PTGA 1JI1A 3FFSA 1OF8A 1L6GA 5E0CA 3MANA 5CSUA 2VHLA 3IVSA 3LS9A 3B3DA 3L21A 1JYWA 2QJIA 4NYUA 3RGTA 5DCEA 4PSPA 3WJXA 1LL4A 2VOTA 1KM6A 1OD0A 4W89A 3TXVA 4FOKA 3NEHA 1OYCA 2BC0A 1RP8A 1W8GA 1VIWA 2G97A 4MAZA 3HGOA 3ETRB 3R7MA 3O7UA 3KAOA 2R14A 4QJ4B 3AIRA 4J3XA 5D9OA 4KCVA 4UTHA 5HATA 4YTSA 5FCZA 2WSPA 5JBFA 3NJ3A 2EAWA 1BF6A 3HFYA 3EF6A 1OC7A 1XH0A 1M01A 2OXNA 5HNNA 1O5KA 5KZEA 1BEUA 1XLGA 1ITQA 3SCQA 4AC1X 2NLYA 5FJTA 3PUGA 2XU2A 4CCEA 5SWUA 4CQBA 1PCWA 2VQTA 1ECEA 1E9YB 4XZ9A 1PZ0A 4GRTA 4DWDA 1SO6A 1KM1A 1XLLA 4IJRA 1A3HA 2NWRA 3ES7A 3A64A 3AQUA 1QHOA 3IGXA 5JCIA 3CXOA 3IS4A 5REQB 2VEMA 2YL5A 3RCNA 3WMCA 3AWNA 4WDWA 3I6RA 4ES4A 4NI3A 1GW1A 4FPSA 4BK9A 4FX9A 4CU6A 2Y88A 1PX4A 3ARVA 2AGTA 1FWEC 4GXWA 3B04A 4BF5A 4Q8VA 1TPC1 1TYPA 1OCJA 1JPIA 4QQ3A 5D2WA 4IGMA 4ZQNA 1UC4A 5FESA 4JTQA 3F5JA 3NQAA 2VCAA 3KHDA 1GQNA 3S1UA 3PZVA 3QFBA 3WD4A 3PR2A 4O15A 1DXLA 3D3FA 2EG6A 3FCPA 1DE6A 3Q37A 1V0LA 3PJXA 3TC7A 1OT1A 1B9BA 3B8DA 4AX6A 2X1UA 2HISA 1DTNA 1G4EA 1OVDA 2HTMA 4MIMA 3OBEA 5DMNA 5G2WA 3EWBX 3MBFA 4J27A 1OFPA 4TX9A 5HMEA 2OR2A 1GRGA 1BRLA 3M46A 2G95A 4HSOA 1MUMA 1IEWA 3GK0A 2WZIA 1H5YA 3WF4A 1NAL1 4JIHA 2WJDA 4O1FA 1L2UA 1Q5MA 1EZ2A 4XZHA 4JX4A 3VILA 4H9TA 1J10A 4TVUA 3HBLA 4U10A 4Q32A 3LV5A 2ZA2A 4MLJA 2X2YA 4ZZ9A 4EQWA 3NEVA 5H8MA 4MYAA 1E9LA 2YB1A 4GXMA 4D6JA 1RA5A 2PWDA 3IPWA 3LPPA 3V0TA 2WHLA 1J2BA 3AWOA 3QRHA 1JOAA 3APYA 3GKAA 4DF2A 3H6OA 3M47A 3W25A 3DN5A 1EBDA 4P7OA 4GFSA 2GVJA 3G1SA 5E0FA 3MUIA 1MQQA 4HHMA 2WKGA 2PF0A 4FNPA 3WJWA 3WY1A 2P0IA 4A2RA 1O1HA 1VZWA 1OX4B 3SECA 1VFLA 1RCXB 1OCBA 1RCQA 2P8CA 1EPVA 2IMRA 2OPJA 3NL5A 1K7XA 2Q09A 1TREA 5B7ZA 5JXQA 3HPFA 2HCVA 4FB7A 2OZ0A 2J8FA 3EPOA 1MUWA 3MP3A 3FV9A 3IUDA 3GM8A 1LWJA 2I57A 1GEHA 4NNBA 3GKFA 2TRSA 4YPJA 4UMCA 2XTKA 1N62C 2J25A 1U83A 1CXFA 5E93A 1DE5A 3HG5A 5MKGB 2FZNA 3PZIA 2W6RA 1EYWA 1UOZA 2VFDA 1ZNNA 2J7GA 5GJNA 5KMYA 4JTRA 3QV7A 1BGGA 2WNZA 2ZVIA 3QBUA 3P82A 3PULA 3A23A 5FEWA 1VCVA 4F0KA 1TE6A 2P5NA 3BW4A 3ZJKA 4MAVA 4PUNA 3UJFA 4JTGA 5IRPA 4LGXA 3SRFA 5D8WA 2E5DA 5FF2A 1LT8A 3G8RA 3VD3A 4MWAB 3E3HA 5EFDA 5DN1A 1EDTA 3WLRA 3JZUA 3W38A 3YPIA 2E5BA 1V0MA 2XGZA 4LS0A 2F5ZA 3MWCA 4I7WA 1XIFA 4CKQA 3UR2A 2VWTA 4O13A 2V3GA 4IMFA 4O11A 1ZQ5A 2JBMA 3ERPA 3UT0A 2J7CA 4EAMA 4BHYA 2VI0A 1N5XA 3WNPA 3W85A 1E9ZB 1LWHA 5DBUA 1NDVA 1KV5A 4AZGA 4U5KA 2FGBA 3RMJA 1B3XA 1XLJA 2J88A 1TWWA 1RJQA 3BURA 3LHZA 4PSRA 4CLMA 3KBJA 1ZJIA 2PDFA 5FJUA 4AD4A 2GR0A 4XAGA 4C5YA 3QVQA 4MWAD 3ANUA 5AYIA 3AS2A 1ZJBA 2J78A 1MQRA 2IKHA 4P7LA 5I02A 4I9AA 3R0KA 2E09A 2TYSA 1BQCA 2DUAA 2BXZA 3N29A 3KFTA 1G69A 2FGLA 4Q7IA 2Q6ZA 1S2AA 4JYEA 2FB2A 3SCVA 4DRSA 5G4HC 1DJYA 3SB0A 1P6CA 3CUZA 2ZE0A 1GRBA 3MDUA 4P7RA 5LGZA 1DWAM 4FXRA 3GHRA 4XAPA 4C5ZA 3DU0A 1GSNA 5G5IA 4RE4A 1J0JA 1CXLA 4LY8A 4MSSA 2G4JA 4PTVA 4B92A 2EEXA 2VZVA 4FR1A 3VD9A 1JDEA 1DHPA 3BAKA 4G9PA 3EEZA 2CZFA 2A2IA 3CIVA 1RXOB 3UWYA 2E4TA 2XIQA 3WG6A 4HSHA 3URAA 4JTFA 1EL3A 2TPSA 4LBUA 4U2YA 3LG3A 3EMCA 4HHLA 2WC3A 1UD5A 2OT0A 2YCIX 1R3TA 3DBNA 3E96A 3MVTA 2JF6A 2X2GA 4C1NB 2J74A 1TPB1 2PUZA 3VX0A 6TIMA 1Q8AA 3OW1A 2FJUB 1CXKA 1J0IA 1W9PA 1B4EA 3CT7A 3L9CA 4LNCA 3E9AA 3EOOA 3TU9A 3CM4A 4BWLC 1MXSA 4JQ9A 4XUGA 3OVPA 1G5AA 1X7FA 4W86A 2DZVA 3AC0A 4L4PA 4BQ4A 1JZ6A 3CH9A 4HZ6A 1ZK7A 3EAOA 3GD6A 1WZAA 1MXGA 1IWAA 1E15A 3CV7A 4B3KA 3IV8A 4P2VA 4MJ2A 3IUIA 4GH3A 4BQ3A 2PB1A 1X6NA 2Z24A 1F05A 2WVSA 4UTTA 4GI9A 1NDWA 4YVVA 3B05A 4Z1AA 3T0TA 4UTWC 1DWJM 1GOOA 5D9NA 1JZ5A 2UBPC 4KGJA 1V6VA 2B0MA 2H3DA 4HNVA 2D0HA 1WX0A 3ZJ7A 4G7EB 2ESCA 4PCNA 3UCCA 1K9FA 3AYTA 3LI1A 1PUDA 4PCSA 3PNUA 1KM0A 1LCOA 5D02A 1JZ7A 4EOUA 4AHOA 4ZOCA 5CSSA 4LNYA 3RR1A 2V0TA 4ICMA 1O5RA 4GABA 3H2FA 4FALA 1OM0A 3V0UA 2WYSA 1NJJA 4J3SA 1W5QA 3T0CA 3LQLA 4HNCA 3O2LA 2I5QA 4B9YA 1UZ4A 4FOUA 4O1AA 3GDLA 1D3CA 1VFOA 3GHUA 1F61A 1QBAA 4R5EA 3URNA 2PGWA 3N12A 3C2VA 1F8IA 1W1A1 1W5PA 5C7VA 4MDOA 3NZQA 3D0CA 2VX7A 4DQWA 1KXTA 2VELA 4Z17A 3P60A 4MFEA 1LG2A 1XFBA 2PTDA 3R0UA 5CLWA 1UKPA 5CZ0A 4XVEA 4QEEA 4ROPA 1PKMA 5AVHA 3KTCA 3LCWA 5DELA 1M5WA 2EQDA 2RABA 3CHEA 5DY3A 1Y65A 5GNZA 4YVXA 2WPCA 1FECA 2D3NA 4DI9A 3EZ4A 1SZRA 4R7WA 4PMNA 2XIJA 2WPBA 1XLCA 3RU8X 2JIEA 2WM0A 1XJBA 1AW5A 1FCQA 2Y6ZA 3J7HA 4AZCB 4TMCA 3ABOA 4RW3A 3BAWA 4GY1A 2FIQA 3ARXA 4WOQA 2VM8A 1EO5A 3TSBA 1UP2A 1NQ6A 5I6SA 4E2OA 1J0YA 3E2RA 1Y0EA 4ZSUA 4QFUA 2WOWA 1E6QM 4GOAA 1EIBA 3FGCB 3WNOA 3DYMA 4B5WA 4Q8WA 4W85A 4WGXA 2R1LA 3WBYA 2E3ZA 1IE7C 3K1GA 2PEVA 4A3UA 4AY7A 4PMYA 2WVUA 4YHEA 4DBDA 4GINA 1QATA 3R11A 4GVFA 4ZOBA 4XQ6A 4LV9A 1EX1A 2C1IA 1XIHA 3LA4A 1D9EA 3NZPA 3QTPA 3T2QA 4W8LA 1MDRA 2X30A 1GVFA 3C0JA 2JKPA 1Y7VA 3V3WA 4IMAA 1LJYA 1UH4A 1W2VA 2PD5A 2ZUSA 1H62A 4JIEA 2OEMA 3N2OA 1TUXA 3U7VA 4H8VA 3VGGA 3HM7A 2H8XA 5CG0A 1C8QA 5GNYA 1S1RA 1FH8A 3E6EA 4XD6A 3TVAA 1VBUA 4A8NA 5T8GA 1ML1A 3CMJA 2IQDA 1GW9A 1C90A 2P50A 2W67A 3IIVA 4PMVA 5IM51 2PWEA 1Q7QA 1BTMA 1F6KA 2EG8A 3BV4A 3EDEA 4PRWA 1AMKA 4UTMA 1ZL1A 1VC4A 2EPHA 2ZTKA 2WJFA 2PDWA 1ISYA 1V08A 1CXHA 3EAUA 4Q8OA 3G0SA 4JEQA 1P5BA 3VIPA 2OZ8A 2PTWA 4C6IA 1T7LA 3TQKA 2HXTA 1VB9A 1I75A 4I8DA 3WBXA 1FO4A 1E56A 3WQDA 4Z08A 2XPKA 5BW6A 5A6BD 4GQ0A 2A7PA 1DWHM 2B7QA 2VX4A 1YNPA 1BG9A 3ITOA 3S42A 4GVGA 1TJ1A 4NZ3A 3TQ0A 2QAPA 5AYYA 5CPTA 1A5BA 4YS1A 5LNSA 1UMYA 5AYXA 3VUPA 3VPLA 4JDRA 3DFQA 4I5XA 4JKLA 1GZJA 4AW7A 3FX4A 5IHSA 3NDZA 1V6YA 1XSJA 4H3DA 4F79A 4UOQA 1FXPA 3KX6A 4ATLA 1YIXA 1XDLA 4EMIA 5FJIA 3RK8A 1DXEA 1WOBA 2F84A 1X2GA 3WL0A 4PCTA 3UJEA 2REQA 3UNTA 1UA3A 4XZWA 1MW3A 3LUTA 3NQGA 3U6WA 4WZHA 3EWWA 3NXFA 4UIOA 1VBRA 3W23A 5HWNA 2P76A 3MYPA 4DJEC 3U2CA 4Y9AA 3QYQA 4YJ5A 2OOGA 2PU0A 2PC8A 5FD0A 3B9AA 3FSUA 4H9UA 1D3HA 3UY7A 1TR9A 1TV4A 4PYSA 4BI7A 4AISA 4X9YA 5EMJA 4OBSA 4K7ZA 3QKEA 3HJEA 1KTNA 3AICA 1EWDA 4OOUA 3NYZA 1TTIA 2CITA 4V1XA 3TR9A 1A47A 1C8XA 4IXHA 4TV6A 3BPWA 1Q7ZA 4N4QA 4C6BA 3W74A 1FP8A 3WQ4A 3EWCA 3CHVA 1GVQA 3AHTA 4LC6A 1GQKA 4B5SA 4JFUA 4AEOA 1J2WA 2ASHA 4ZODA 3WLJA 1DJIA 2DW7A 1EJRC 4GNJA 2HK0A 2DSWA 4TVCA 3N2BA 1JYXA 3EGJA 2ZVRA 2NVCA 1BVNP 5BRQA 4WSHA 2C1GA 4K39A 3N19B 4GYPC 1I6NA 1NWUA 4MJ4A 4LWWA 3NPUA 2J6XA 3OVRA 2QW5A 3TCEA 4UMAA 1A5LC 5AC7A 3HB9A 3QSTA 5KETA 1LQAA 3S9ZA 3LCXA 1EBHA 3G1YA 4RNHA 5BMXA 3PS7A 2PS2A 4GCAA 3FYOA 3W7OA 3P61A 1KWGA 2H6RA 3Q45A 2OLSA 1ZBVA 3PZTA 2VVSA 2NQLA 1L0PA 3QSRA 2ZWYA 1RQHA 5CGTA 4RNFA 3F1QA 5HJYA 2JF7A 1OGSA 2C0AA 3MY9A 4K8DA 3TTEA 3NQBA 2ZXAA 1IF2A 1UUOA 4R7OA 4A8LA 5EFFA 2F7FA 1QI3A 1K4HA 2WPGA 3AXHA 3BGGA 4GI6A 3N4AA 4AWUA 1MRQA 2PA6A 2XVPA 4PMQA 5I07A 4UQCA 1FWRA 1VCFA 3UERA 2Q02A 4DJFC 1PKYA 2FTPA 4O1BA 1GHSA 5IDIA 3NL2A 3VC5A 3M0YA 3UR7A 4RLIA 1WB0A 3H4XA 1AJ2A 1S5TA 3L65A 4UWMA 1QVBA 2BY1A 4GYFA 1OC6A 4DZHA 1TV3A 5G2HA 2V63A 4N9CA 3A7UA 4FO4A 5JU6A 1DQUA 4FOJA 2GR3A 3NL6A 1OF6A 4YLWA 3V18A 3I3EA 1JNEA 3F5LA 4NZJA 3LNPA 3R6IA 2X7WA 2WZMA 2VEFA 2XSAA 1E3ZA 2O9RA 3R8GA 2C79A 2QCCA 5F1VA 3RLUA 3IIZA 3A13A 2AAAA 4JZ5A 4KEUA 1N61C 3IJ7A 4GUHA 2ZX9A 4I8YA 5E9XA 3LADA 1FIQB 3VX1A 1UP0A 2V82A 3FYYA 1E51A 2HXUA 2UY3A 4JICA 8RUCA 2AAQA 2PWVA 1MQPA 3ZM8A 2DQWA 3BLPX 5F2MA 4DYKA 4EPBC 3CT2A 1GORA 3APTA 3AHZA 3MW7A 3R12A 3S1XA 2YA2A 3CGBA 3LTPA 2NZLA 3TQPA 2A8XA 2Z29A 4HU4A 3E38A 4OECA 4XD3A 3WDHA 2PZNA 2QMKA 3VVGA 1XYCA 1TV2A 3AIQA 3B8IA 1RH9A 3C3UA 3KP0A 4PTXA 1ONWA 2WPFA 4HA0A 3HA1A 3P5ZA 3A24A 5DRIA 1ZY8A 2WCSA 4I6VA 5L9FA 1TQJA 1IIGA 3BXWA 1UOKA 3TNBA 4JTIA 3NZGA 6ENLA 3S6OA 4NNAA 4UFIA 5BWFA 1Y5XA 5HUPA 3WLTA 1B90A 3NO3A 2FMNA 2IPFA 2ATMA 4PUKA 1QWKA 1XD1A 3UG8A 3WH9A 3WD1A 2V5CA 4QIUA 1DV7A 4CU8A 4IIBA 5K9DA 1K70A 4M1BA 4BQ2A 4Z2LA 2D73A 2WZTA 1QPQA 4FLRA 5KTLA 2B81A 2VCBA 2XHYA 3CGEA 4XK2A 4H2HA 4Y8EA 4PB5A 3VOIA 4DO6A 3BLFA 2GJRA 4J3UA 5CJNA 3TJLA 4AIBA 3BC9A 5EU9A 2QJGA 5AN7A 1HL9A 1JROA 1BD0A 2DZAA 3OVQA 4YTTA 3MUAA 4P5UA 3CH0A 1XLFA 3N34A 1OK4A 4KH2A 4QJ3B 1W37A 1Q6EA 3WK2A 1ITCA 1KRAC 1Q6GA 3LCLA 3IANA 4XUYA 1FUYA 2E6DA 2YYTA 1KA9F 3SQPA 2V2HA 2CBIA 4J3TA 2O92A 3LBCA 2QJJA 4AZCA 2PTZA 3UZYA 4LYQA 1AH3A 4LALA 3TC3A 3A3WA 1GG0A 4IPIA 3KWSA 1Q6LA 3ZQ9A 1J6PA 2J13A 3VNIA 3QR1A 1FDJA 4LUSA 3EA2A 4OBTA 4QM1A 4KWOA 3N9KA 4GIAA 4JIRA 2WLZA 5LYRA 5CLTA 4ZO8A 3NQCA 1NF0A 2HJPA 2CBJA 1GVSA 1LUCA 1IR2A 1M65A 2QCGA 1XIBA 5RUBA 2F6UA 1R47A 2OQHA 5JUVA 1XYFA 2X8CA 3MYOA 3B8TA 4Q8QA 2OEJA 1RVGA 2I14A 2XIOA 3FKRA 2F9RA 1KR1A 3LOTA 1US0A 3LCHA 5AC8A 3FGCA 5JIWA 4GACA 4H6QA 1ZCCA 1W3KA 5K4ZA 5CC5A 3QOMA 4R9XA 4GJIA 1EJSC 3BG9A 4GUJA 3BUVA 3ZR5A 4AWEA 3ME3A 5BZAA 5CZKA 4JPGA 1QBBA 3CQIA 5CJMA 3OPSA 4PGLA 2WMGA 1EPXA 2VVNA 3GH5A 2VC7A 1F9CA 2PDCA 3WJYA 1O1ZA 4RZ4A 1BYCA 5EY5A 1E0VA 1KXHA 4W7WA 2W0HA 3CLWA 4L80A 4CEXC 1XANA 4C6KA 5FS8A 3SRDA 4BEQA 2DVTA 2E7FA 4GQGA 4YTQA 1R2TA 2YOCA 2PGRA 5CC3A 4F0MA 1E70M 1DJQA 4W5ZA 1XBZA 4AD1A 2HRWA 3U9IA 1FVPA 5JCMA 1ZMCA 3H24A 3CAVA 3MP4A 3MWAA 1YPFA 1W1PA 2YPIA 3L0NA 5LIWX 2Y63A 1XSKA 2CIPA 3CQ0A 3NQ7A 1HJSA 3G8EA 3KCOA 3QFAA 1OG6A 1O66A 3KBNA 2DDXA 2FZDA 2PDBA 3VD5A 1GRAA 1W17A 4PRTA 4ACYA 1DIKA 4J4KA 3RITA 4Q7NA 3CK5A 1LG1A 1ZJAA 1NHSA 3GNDA 1O68A 3WLLA 1S2CA 3E12A 2YVGA 4BQ5A 8A3HA 3GC5A 5DMMA 4US5D 1AMYA 3BQ6A 2Z28A 3W29A 1ZAJA 3MI2A 3BSGA 1RALA 4RE3A 4UTUA 4X61A 3B8VA 3VM5A 3ZLHA 3PBWA 3USBA 1OFDA 3QN3A 1K7EA 3EXSA 1EEPA 4U31A 5D09A 2OU4A 4O53A 2W5FA 3MMDA 4KKXA 3W1LA 1EA9C 4L1GA 1SSDA 3IIOA 1F4HA 5AHIA 4X22A 2Z7KA 4AVOA 1F74A 3MI3A 3VOJA 3W1QA 1VP5A 1DHKA 4MZYA 3NPXA 5TNVA 1B3VA 3LHUA 4KWVA 2ISSA 4OOZA 5E5CA 1QK0A 3IV3A 4C7DA 3ECQA 1UD3A 3BO9A 5H8UA 2FKPA 2W92A 4DNHA 4D72A 3DZ1A 4LVBA