1RW2A

Three-dimensional structure of ku80 ctd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
b'MHHHHHHKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent DNA helicase II, 80 kDa subunit
publication title Solution structure of the C-terminal domain of Ku80 suggests important sites for protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 1rw2A00
3ISMC 1RW2A 1Q2ZA
chains in the Genus database with same CATH superfamily
3Q9NC 5AJDA 4CGWA 5EYLA 4GMLA 1EPUA 2P9NG 4TUUA 3EHMA 3ZU7B 2V0PA 1N95A 2OV8A 4U8HA 2VQ2A 1H0AA 1AWCB 3MKQB 3B7SA 3GW4A 1INZA 3EDTB 2ZGDA 3UM2A 3LY8A 2XGSA 1V54E 4ILGA 3ZYLA 1NA3A 4U8VD 2WXPA 3CVXA 3OXLA 1Z3XA 1IHBA 4GTQA 4GAAA 3G2TA 4GTRA 4JC8A 2BF0X 3CIAA 4QQIA 2B6CA 2WQ6A 5G55A 5KNHD 3MEKA 1YA0A 2R59A 3TG5A 3PZ3A 1TNYA 3ZYKA 4FA6A 5BW8C 2CG2A 1BLXB 3V31A 5J08A 4XIFA 3RK6A 2WQ7A 5EKQD 4J7WA 5BPPA 5EN5D 2FF4A 4N3BA 2LXLA 2CHZA 1JUQA 4AY5A 3C98A 3I3NA 2IO2C 4ABNA 2R03A 3FU6A 1VDYA 3UM0A 3VLDA 1IKND 2VSYA 3VLFA 4RLYA 2XCBA 3QB2A 1O5MA 5D0QD 1FPPA 2AJAA 2KCVA 4F3VA 3D9JA 3NAWA 3UKRG 1OWOA 3L22A 4ACLA 5DIZA 2IF4A 5G05C 1S63A 3PZ4A 5CCMA 3D9LA 4AXHA 3RRMB 4L7TA 3QARA 4CCAA 2L0TB 3ZKJA 3FEYA 1OWLA 5CBNA 3TXNA 2UY1A 1S70B 3JUIA 2XEVA 2KATA 3MV2B 2NXPA 5CECB 3LVRE 1OT8A 3AG2E 4GA1A 1H2TC 1AP7A 3MX3A 4BFRA 4GA0A 4GYYA 3S7DA 4GB9A 1HH8A 4AV7A 4UQXA 1D8DA 3V30A 1FVFA 2IJGX 4WWNA 3J5PA 4HQDA 2EIJE 5A6CA 5ITZF 2Y1LE 4DX2A 4O1OA 4K5BA 2V4LA 2BUGA 4I6EA 1K1BA 4G8KA 2AW6A 3L9TA 3CVLA 2WXLA 2VTBB 2XPYA 2ONDA 3CSTA 1E8WA 5LCWC 3FUKA 3QOUA 4XEIG 3CQCB 3D9KA 4U07A 4AM9A 4KZCA 4AIFA 3UKUG 4E85A 3SI5A 4EZLA 2J4BA 2XGMA 3FTYA 1TN6A 4YVQC 1UJJA 2P9PG 2XQ0A 3CVNA 4LUNU 2NC9A 3FH8A 3B95A 3NF1A 2QYJA 2X6IA 3UI2A 3HYMB 2NSZA 4JHJA 2P9LG 4GA2A 5B1BE 3SD5A 4KVMA 1V55E 3NZSA 3UXGA 3V2OA 5FINA 3HG0D 3LS8A 3SHFA 3APCA 2DYRE 1MHQA 3CVUA 2KZTB 2IQCA 5JHBA 3PDNA 1Z6TA 2BKGA 3NZUA 4IULA 3S7JA 3CK8A 4TXRA 3V2XA 5J90A 3JCKC 3ESLA 1TNBA 3CQGB 4PS8A 2FO7A 4JA7A 4RQIA 1KPSB 4B93B 1BPOA 3FHEA 1ELKA 3EJNA 4U0ZA 1Y8MA 2GRMA 5FQ7A 3MCXA 4JA9A 4ANWA 2H6IA 2XZDG 5CEAA 4C0EA 4DUIA 4PS7A 1IYGA 3IHYA 3ZGQA 4GU5A 3QK0A 2KM4A 3P2BA 1FCHA 1U2VG 1Y6IA 4X8QA 3UUXA 4O1PA 3UT4A 2LAHA 3JYSA 5LFAA 5BT1A 2P9SG 2Y0BG 4U8YD 2ZU6B 3Q75A 1N52A 3IHVA 4O6FA 3RKVA 4BWRA 4U95D 1JWGA 3DSXA 2VGXB 3X2QE 4ILHB 3QKYA 1JCQA 3Q49B 2X6JA 2JEKA 4HORA 3PZDA 3FU0A 2VYIA 3ZNGA 3ISMC 1H6OA 3ZEFA 3AU5A 3R7RA 3LY7A 2J49A 5KJNA 5CEDB 4U0SA 1QYMA 1QNFA 2WXIA 1DCQA 1K1AA 5FTPA 4ZHBA 1UOHA 3LY9A 2WXHA 5AQ9A 1X5BA 3APDA 4N2SA 1YYHA 3D3MA 2ZXWE 3LJ3A 3ML8A 3TG4A 3C5RA 3AJIA 4G23A 4AP2A 3VTYA 2EILE 2AXZA 4IN3B 4B8CB 2OEVA 3I4RB 2HR2A 4LERA 3ASFA 3CVQA 2XEHA 3EIQC 3L6AA 1O1RA 1OCOE 2LUHA 5C1DA 4N5CA 5AJLA 3FWVA 1E8ZA 1JCRA 2OVBA 3WG7E 3CR3A 5HS0A 5T4YA 4JEHA 3HVEB 4MBGA 3LEWA 1WM5A 4BESA 3DPYA 4GZ6A 3B7BA 2J4DA 2GRQB 3BUAA 4TUMA 3R7QA 2WXGA 3O4ZA 4G25A 3CVPA 1QBQA 3DWLG 3FEXA 2DZNA 5FWQA 3C3RA 1SA4A 4HRLA 2XRYA 3MGBA 1WG0A 3QWWA 4BTAA 2A5UA 2IOSA 4Y6WA 1DCEA 4BERA 1E8XA 4DX7D 1LD8A 3RRNB 3UINC 5E76A 3HHMA 3HXFA 4MKTA 4I2WA 3HXDA 2X3MA 4XE0A 5CERB 5T8IA 3TWQA 1B89A 3SFZA 3K9IA 1E90A 3PREA 3D9HA 3SBSA 5JA4D 1PAQA 4APFA 5B1AE 3D9NA 3FTXA 4RSYA 3ONLA 4HI9A 3J5QB 4GTOA 5C2YA 3URZA 4F1SA 3CGHA 3OAWA 3QC1A 4GYOA 2PM7A 3PEUB 4PUCA 1EDUA 1PY1A 3EU5A 5BV0A 3DSUA 2HE0A 2IONA 5KNGA 5HKPA 4Q69A 1UJKA 5JJ7A 4KYOB 4F53A 2HM8A 3DSWA 1WY6A 4EBAG 4HLLA 2A5EA 4O60A 3TWVA 2P58C 2IOLA 4CZ2D 2YQ8A 1KZPA 3HXBA 3DSSA 3QWVA 3L16A 1N0RA 4I6GA 4HFGA 3TWWA 3Q15A 4KXKB 1MX6A 2J07A 1NA0A 5FZQA 3T5XA 3ZIMA 2ETBA 2EINE 4UWLA 3AG4E 3LYAA 1N11A 5ENTD 3JUEA 3SGHA 1H2UA 3CEQA 4BX8A 2XHEA 3CHMA 3MV3B 3FUNA 4EZJA 3EIJA 1KT0A 3ASHA 2CHXA 5LOZA 5D0OD 2KCLA 4GTVA 4PH4B 3CHRA 3GYZA 2DCPA 2RFMA 2R02A 4GPMA 4MRUA 3PZ2A 3D9MA 2FEZA 3T9KA 4F1PA 1OUVA 4KVOA 4B0ZA 3UPVA 2I6HA 4YVOA 3UM3A 2CFUA 3ASGA 4TXQA 4CT0A 3EHRA 4EPZA 1JPLA 3T5VA 5HI7A 4YDWA 1A5EA 3FUJA 1D9SA 3UIOC 5FJYA 3FUIA 3QDNA 2KBXA 3DEPA 2GRPB 3QNKA 5HQ8A 4EBAA 1TJCA 2F37A 3SQVA 4YDYA 3TWXA 3FUEA 5LX8A 5BNWA 5FQ4A 3KAEA 2IO3C 1DNPA 2XENA 2KC7A 3AS5A 2Y69E 3I4GA 4JB8P 4AEZC 4G8LA 4EECA 3E33A 5G04C 4I6JA 3FUFA 1ELRA 3NBNB 3IKOB 5ARGA 4A3VA 3JXIA 5G04J 1E7UA 2YNQA 2KCKA 4LNUD 4Q94A 2NYJA 2XZTG 1HZ4A 4NIKA 3RO2A 4I43A 2P2CP 3IV0A 2R5SA 4TV3A 4TXPA 4N39A 2GRNB 1HU3A 4ILIA 4XZ4A 5LP0A 5ANLA 2FULA 4NQ0A 5JJ6A 3B7TA 3SZ7A 3CVVA 4WWPA 3E34A 3G2WA 3W9FA 4K03A 5B3SE 3E30A 4J8YA 1D8EA 2J09A 3G2UA 4A1SA 5EX3A 2ILRA 2PM6A 3AS8A 4H7XA 3B13A 3ESKA 4UWKA 4JPSA 3FH5A 4J8DA 4XI9A 3DPDA 1O1SA 5EYPF 2L0IA 2QZAA 4GCNA 4Y6CA 3PH0C 3ZW3A 3BU8A 2I2OA 1IXVA 4U7EB 4CGVA 3TWRA 4NURA 4CDRA 5EX0A 3UM1A 2VSXE 1N4RA 2PL2A 3PE3A 4DI4A 3PZ1A 3FTWA 5KJMA 3V79K 2ZIRA 4P29A 1ELWA 3TAXA 3CSFA 2XPZA 2AXVA 4U63A 1E8YA 4OYSA 3PEVB 4B89A 4GTTA 3GZ2A 4HOSA 1TYQG 3IBEA 3C72A 1ZB1A 3EHNA 3Q7FA 3JQ1A 3DSTA 1OY3D 3ASDA 4I9CA 4UWFA 2RKKA 3TXMA 3ZUVB 2ZISA 4PDXA 2A4ZA 3FP3A 2AVPA 2YHCA 3PNTB 4GZDA 5AAOA 3DXKG 2AWIA 4HOQA 1PC2A 5ANRA 2Y3AA 5H7PA 3Q7AA 1KLXA 5BXOA 1N4QA 2YHEA 1WDYA 5ENRD 3NB2A 2QC9A 4JEUA 4XKCA 1N94A 3FTUA 1UG3A 4AVXA 2VTBA 3IEGA 5CRUA 3SF4A 3ZHEA 5FIOA 3B7UX 4FJYA 3DEOA 4LRZA 2V4HC 4BTBA 4L9PA 3U9WA 3PS6A 1OXJA 4I1OB 3E4BA 4A3TA 3ZVVA 1UW4B 1Z5SC 2WXNA 2WXOA 1W3BA 4KT6B 1WAO1 4R7LA 5CBOA 3ZFWA 4RG9A 3RIBA 3KS2A 5IY5E 5JHAA 4I17A 5FZSA 5AQ7A 1HG2A 3FTSA 2CHWA 3PE4A 5HRYA 4GPKA 5FT9A 4FJZA 4HLEA 1L5JA 1A17A 1TNOA 2GRRB 1OWMA 1UN9A 3AG3E 4L2LA 2J8SD 4B94A 4FU3A 2WXMA 1FT1A 3MJWA 2V8SE 2AXUA 4ATZD 2I1JA 4J6IA 3HXCA 3HXEA 1P5QA 1X81A 2FI7A 2WM9A 1SW6A 2KZTA 5FZRA 4YDOA 4ANXA 2WXJA 4N2QA 2YINA 2M63A 2F0YA 1MX2A 2MOWA 3ENEA 4Q96A 4ME2A 2PQRA 4U96D 3I5PA 4U04A 3LJNA 3D9OA 4J8FA 2PQNA 1TJFA 4RG6A 4NACA 2B0OE 3AG1E 1N54A 3L08A 3BQOA 1IQUA 4G26A 4APOA 1HG5A 3VTXA 2VGYA 3JXJA 3T8KA 1OCCE 3O48A 2I1KA 4I1MA 3CHSA 1NI1A 3RJVA 3QJZA 4G1TA 2L9BA 4UQYA 1OWPA 5BV1A 2VGEA 2ZGGA 5E75A 4WNFA 1MZCA 1N9AA 1E7VA 3TJPA 1EYHA 3FH7A 4K5AB 4QFVA 4EHMA 4A1GA 3DBSA 4I1AA 3RAUA 1HS6A 3CVWA 4CDMA 4HOUA 5D2MC 2F8XK 4GTPA 4L1BA 2QYUA 1OCRE 2H6GA 3ZXSA 4A55A 3ONKA 2WPVA 4EQFA 4LNGA 4D10C 1OCZE 1LF8A 2P9UG 3CVYA 4K0RA 3B7RL 5AARA 1Q2ZA 4J0UA 2R05A 2EIME 4CEMA 3PVLA 4DLQA 3DXMG 4BSZB 1FVHA 3LXUX 4TRQA 4JW1A 3Q73A 3R9AB 1OWNA 2LSVA 3ABME 4HBDA 4BX9A 2VGXA 2UY1B 1HFAA 4WAFA 4F6RD 2V5QC 4WNDA 4C0MA 3FULA 3PNLB 3TWUA 1TNUA 2MRIA 3D9PA 5D66A 4LEUA 5ENNA 3MKRA 4N3AA 1TN8A 3ZN3A 4I2ZA 1HO8A 2J9QA 3C3OA 3PUKA 3CK7A 1N0QA 2OEWA 2WB2A 2DIWA 5FQ6A 2FBNA 4FLHA 2WMNA 4HI8A 4MS6A 4C9BB 4FHKA 5G2NA 4HRNA 4LNBA 4G2VA 4MLPA 4DPRA 4OVVA 4DLOA 1GW6A 1N4PA 2I9CA 2PNNA 2WMOA 4HNAD 5FQ8A 1FT2A 3CHPA 2JABA 2LAIA 1BI7B 5AIJA 3U66A 2ETCA 4AOFA 3AAAC 5JJTA 2Y4UA 4DI3A 3G2SA 2C0MA 1XNFA 4OVUA 1NL4A 3GZSA 3U4TA 1S64A 5A7DB 2LSUA 2RD0A 4WWOA 5CRVA 3S2AA 2XGOA 1DC2A 3SO8A 2WXQA 2GGFA 4M3OA 1ZU2A 3Q5MA 1U3CA 3FY4A 3HVEA 3FU5A 1YMPA 4KMOA 4JXTA 4CYMD 3UT8A 5A23A 3AU4A 4FC8A 2PZIA 4G11A 3PRZA 3JQ0A 3TWSA 5CCLA 3G2VA 2RFAA 3E37A 5BUZA 2UWJG 3SBTB 2IEJA 2LNIA 4M7CA 2P9KG 2IFUA 2H6FA 2X38A 1TNZA 3NOGD 4JHKA 4CDNA 2WXFA 2GROB 4GZ5A 2F8YA 2VSOE 4HOTA 5CMYA 3ULQA 3ZPJA 5G05J 4UQZA 3Q78A 3FTVA 2GW1A 4XX5A 1SA5A 2P9IG 3Q9UC 4JVSA 3C3QA 4JD2G 3MKQA 3GZ1A 3VLEA 5AN8A 3KSQA 3ZYQA 4JHRA 4FLBA 3OTNA 1G3NB 4L23A 3CHQA 2Y4TA 2XRZA 2XPIA 4C48B 5KCMA 4BT9A 4K5CA 1LTXA 3BG0B 3MA5A 4UWHA 3R9MA 4PS3A 4KBQA 4HS2A 4HB5A 3E32A 4J8SA 2HO1A 1K8KG 1SVXA 3F6QA 4UUCA 3MZLB 3BG1B 4NRHB 3ZHEB 3APFA 4W9RA 3NQPA 1QQEA 4DX5D 4URKA 3HDXA 5KJKA 4F7AA 3WXXA 3DRAA 5EIDA 5LCWJ 4GMRA 3CKCA 3W9GA 3UQ3A 2VSNA 3FUMA 1NFIE 2CG3A 2X6KA 4ACKA 4HVBA 3UMVA 2BTDA 3QWPA 3CKBA 4GTMA 1U3DA 3LKUA 1S0PA 4OAVB 3ML9A 2C2LA 3UTMA 4WUYA 3BEEA 1SZAA 5ENQD 4ANVA 3P1UA 3RO3A 1ZBPA 4HRMB 3UT7A 3Q47B 4LCTA 2ETAA 1JCSA 3LDZA 1Z3YA 4DK5A 2XS1A 4KZ0A 2FO1E 3LVQE 3U64A 4BT8A 1JWFA 2WXKA 5ARFA 2HYZA 2OVFA 2QY7A 3OXFA 1HE8A 4DRXE 4GTSA 4RVBA 1MYOA 3L17A 1IQRA 3PUJA 2C0LA 3L13A 2Q7FA 1KT1A 1HX8A 3Q79A 1N4SA 4UWGA 4GZ3A 1IHGA 1HXIA 1RZ4A 2J08A 4I9EA 5EDSA 4LSZE 4GCOA 2X6FA 4OAUC 3CLJA 3LCAA 4IYPA 1MX4A 4IRUA 1TR4A 4BSXA 4L2YA 3TGOA 4ZFHA 3ABKE 3FUHA 1HF8A 2QFCA 5CHEE 4YDEA 4XI0A 2XS8A 4ATGA 4UI9C 3FUDA 3EHQA 5CMWA 3UX4A 3AS4A 4BEPA 1H2VC 4UI9J 2OOEA 2DWZA 4G24A 3KD7A 4CT4A 3FFLA 4EZKA 3TL5A 3HIZA 3L82A 1H19A 3RRUA 2XCCA 5AENA 3IXEA 3RU0A 4LG6A 2LXMA 3HRAA 2WVIA 3LPZA 4A63B 2WXRA 3KEZA 3ULEG 3ABLE 3QAQA 4V3IA 3SY2A 4FADA 2BKKB 2XEEA 2L6BA 2DZOA 2V5FA 3UIPC 1BU9A 5KJLA 2X6HA 2DYSE 2E2EA 2EIKE 4GYWA 1H6PA 1O1TA 3OXGA 5ENPD 5ENOD 3TWTA 1KZOA 1MJ0A 2IY0C 3D9IA 4CRWA 4UI9K 1TEZA 3EU9A 3S7FA 3ZXPA 1MQSA 4GZCA 2E0IA 1YCSB 1XGWA 4YNDA 2JLBA 3ZYMA 2RG8A 3MYVA 1RW2A 5DBKA 2DBAA 1EF1C 4BETA 2R2LA 2R17C 2VJ8A 2EQXA 3SFXA 3CV0A 3S7BA 3ASNE 4ANUA 5BXUA 2IU1A 3CK9A 3FDHA 5AYWD 2WQHA 3N71A 2MYOA 3ZRHA 1QZ2A 1TN7A 4JZYA 1K3ZD 1H6KA 3CHOA 5KBAA 3KEAA 4U0UA 2MHKA 4WNEA 3SNXA 2H6HA 2GRLA 3DSVA 3FU3A 4N3CA 4B8AA 4WNGA 5M72A 3L54A 5EILA 5ENSD 3RSEG 2L6JA 4HXIA 4AY6A 4E6HA 2BEDA 5JMND 3NOCD 3Q4AB 3U3WA 4BY6A 1SQMA 4DX6D 3EUVA 4FP7A 2OCCE 3FTZA 4JL0A 4J8EA 4XKBA 4FHJA 2DVWA 4H7YA 4Z68A 1UN8A 5AQAA 4AJWA 1NP7A 1LD7A 2LO6A 4DJAA 4FULA 2CFZA 5EIBE 3ULYA 4DX1A 3SFYA 5KWDA 5T3RA 1E96B 3KSLA 4N5QA 3ASOE 5AQBA 1BD8A 1BI8B 2KXPC 4GMJA 1NZNA 1SZ9A 1DVPA 3T8MA
chains in the Genus database with same CATH topology
3ISMC 1RW2A 1Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISM C;  1RW2 A;  1Q2Z A; 
#chains in the Genus database with same CATH topology
 3Q9N C;  5AJD A;  4CGW A;  5EYL A;  4GML A;  1EPU A;  2P9N G;  4TUU A;  3EHM A;  3ZU7 B;  2V0P A;  1N95 A;  2OV8 A;  4U8H A;  2VQ2 A;  1H0A A;  1AWC B;  3MKQ B;  3B7S A;  3GW4 A;  1INZ A;  3EDT B;  2ZGD A;  3UM2 A;  3LY8 A;  2XGS A;  1V54 E;  4ILG A;  3ZYL A;  1NA3 A;  4U8V D;  2WXP A;  3CVX A;  3OXL A;  1Z3X A;  1IHB A;  4GTQ A;  4GAA A;  3G2T A;  4GTR A;  4JC8 A;  2BF0 X;  3CIA A;  4QQI A;  2B6C A;  2WQ6 A;  5G55 A;  5KNH D;  3MEK A;  1YA0 A;  2R59 A;  3TG5 A;  3PZ3 A;  1TNY A;  3ZYK A;  4FA6 A;  5BW8 C;  2CG2 A;  1BLX B;  3V31 A;  5J08 A;  4XIF A;  3RK6 A;  2WQ7 A;  5EKQ D;  4J7W A;  5BPP A;  5EN5 D;  2FF4 A;  4N3B A;  2LXL A;  2CHZ A;  1JUQ A;  4AY5 A;  3C98 A;  3I3N A;  2IO2 C;  4ABN A;  2R03 A;  3FU6 A;  1VDY A;  3UM0 A;  3VLD A;  1IKN D;  2VSY A;  3VLF A;  4RLY A;  2XCB A;  3QB2 A;  1O5M A;  5D0Q D;  1FPP A;  2AJA A;  2KCV A;  4F3V A;  3D9J A;  3NAW A;  3UKR G;  1OWO A;  3L22 A;  4ACL A;  5DIZ A;  2IF4 A;  5G05 C;  1S63 A;  3PZ4 A;  5CCM A;  3D9L A;  4AXH A;  3RRM B;  4L7T A;  3QAR A;  4CCA A;  2L0T B;  3ZKJ A;  3FEY A;  1OWL A;  5CBN A;  3TXN A;  2UY1 A;  1S70 B;  3JUI A;  2XEV A;  2KAT A;  3MV2 B;  2NXP A;  5CEC B;  3LVR E;  1OT8 A;  3AG2 E;  4GA1 A;  1H2T C;  1AP7 A;  3MX3 A;  4BFR A;  4GA0 A;  4GYY A;  3S7D A;  4GB9 A;  1HH8 A;  4AV7 A;  4UQX A;  1D8D A;  3V30 A;  1FVF A;  2IJG X;  4WWN A;  3J5P A;  4HQD A;  2EIJ E;  5A6C A;  5ITZ F;  2Y1L E;  4DX2 A;  4O1O A;  4K5B A;  2V4L A;  2BUG A;  4I6E A;  1K1B A;  4G8K A;  2AW6 A;  3L9T A;  3CVL A;  2WXL A;  2VTB B;  2XPY A;  2OND A;  3CST A;  1E8W A;  5LCW C;  3FUK A;  3QOU A;  4XEI G;  3CQC B;  3D9K A;  4U07 A;  4AM9 A;  4KZC A;  4AIF A;  3UKU G;  4E85 A;  3SI5 A;  4EZL A;  2J4B A;  2XGM A;  3FTY A;  1TN6 A;  4YVQ C;  1UJJ A;  2P9P G;  2XQ0 A;  3CVN A;  4LUN U;  2NC9 A;  3FH8 A;  3B95 A;  3NF1 A;  2QYJ A;  2X6I A;  3UI2 A;  3HYM B;  2NSZ A;  4JHJ A;  2P9L G;  4GA2 A;  5B1B E;  3SD5 A;  4KVM A;  1V55 E;  3NZS A;  3UXG A;  3V2O A;  5FIN A;  3HG0 D;  3LS8 A;  3SHF A;  3APC A;  2DYR E;  1MHQ A;  3CVU A;  2KZT B;  2IQC A;  5JHB A;  3PDN A;  1Z6T A;  2BKG A;  3NZU A;  4IUL A;  3S7J A;  3CK8 A;  4TXR A;  3V2X A;  5J90 A;  3JCK C;  3ESL A;  1TNB A;  3CQG B;  4PS8 A;  2FO7 A;  4JA7 A;  4RQI A;  1KPS B;  4B93 B;  1BPO A;  3FHE A;  1ELK A;  3EJN A;  4U0Z A;  1Y8M A;  2GRM A;  5FQ7 A;  3MCX A;  4JA9 A;  4ANW A;  2H6I A;  2XZD G;  5CEA A;  4C0E A;  4DUI A;  4PS7 A;  1IYG A;  3IHY A;  3ZGQ A;  4GU5 A;  3QK0 A;  2KM4 A;  3P2B A;  1FCH A;  1U2V G;  1Y6I A;  4X8Q A;  3UUX A;  4O1P A;  3UT4 A;  2LAH A;  3JYS A;  5LFA A;  5BT1 A;  2P9S G;  2Y0B G;  4U8Y D;  2ZU6 B;  3Q75 A;  1N52 A;  3IHV A;  4O6F A;  3RKV A;  4BWR A;  4U95 D;  1JWG A;  3DSX A;  2VGX B;  3X2Q E;  4ILH B;  3QKY A;  1JCQ A;  3Q49 B;  2X6J A;  2JEK A;  4HOR A;  3PZD A;  3FU0 A;  2VYI A;  3ZNG A;  3ISM C;  1H6O A;  3ZEF A;  3AU5 A;  3R7R A;  3LY7 A;  2J49 A;  5KJN A;  5CED B;  4U0S A;  1QYM A;  1QNF A;  2WXI A;  1DCQ A;  1K1A A;  5FTP A;  4ZHB A;  1UOH A;  3LY9 A;  2WXH A;  5AQ9 A;  1X5B A;  3APD A;  4N2S A;  1YYH A;  3D3M A;  2ZXW E;  3LJ3 A;  3ML8 A;  3TG4 A;  3C5R A;  3AJI A;  4G23 A;  4AP2 A;  3VTY A;  2EIL E;  2AXZ A;  4IN3 B;  4B8C B;  2OEV A;  3I4R B;  2HR2 A;  4LER A;  3ASF A;  3CVQ A;  2XEH A;  3EIQ C;  3L6A A;  1O1R A;  1OCO E;  2LUH A;  5C1D A;  4N5C A;  5AJL A;  3FWV A;  1E8Z A;  1JCR A;  2OVB A;  3WG7 E;  3CR3 A;  5HS0 A;  5T4Y A;  4JEH A;  3HVE B;  4MBG A;  3LEW A;  1WM5 A;  4BES A;  3DPY A;  4GZ6 A;  3B7B A;  2J4D A;  2GRQ B;  3BUA A;  4TUM A;  3R7Q A;  2WXG A;  3O4Z A;  4G25 A;  3CVP A;  1QBQ A;  3DWL G;  3FEX A;  2DZN A;  5FWQ A;  3C3R A;  1SA4 A;  4HRL A;  2XRY A;  3MGB A;  1WG0 A;  3QWW A;  4BTA A;  2A5U A;  2IOS A;  4Y6W A;  1DCE A;  4BER A;  1E8X A;  4DX7 D;  1LD8 A;  3RRN B;  3UIN C;  5E76 A;  3HHM A;  3HXF A;  4MKT A;  4I2W A;  3HXD A;  2X3M A;  4XE0 A;  5CER B;  5T8I A;  3TWQ A;  1B89 A;  3SFZ A;  3K9I A;  1E90 A;  3PRE A;  3D9H A;  3SBS A;  5JA4 D;  1PAQ A;  4APF A;  5B1A E;  3D9N A;  3FTX A;  4RSY A;  3ONL A;  4HI9 A;  3J5Q B;  4GTO A;  5C2Y A;  3URZ A;  4F1S A;  3CGH A;  3OAW A;  3QC1 A;  4GYO A;  2PM7 A;  3PEU B;  4PUC A;  1EDU A;  1PY1 A;  3EU5 A;  5BV0 A;  3DSU A;  2HE0 A;  2ION A;  5KNG A;  5HKP A;  4Q69 A;  1UJK A;  5JJ7 A;  4KYO B;  4F53 A;  2HM8 A;  3DSW A;  1WY6 A;  4EBA G;  4HLL A;  2A5E A;  4O60 A;  3TWV A;  2P58 C;  2IOL A;  4CZ2 D;  2YQ8 A;  1KZP A;  3HXB A;  3DSS A;  3QWV A;  3L16 A;  1N0R A;  4I6G A;  4HFG A;  3TWW A;  3Q15 A;  4KXK B;  1MX6 A;  2J07 A;  1NA0 A;  5FZQ A;  3T5X A;  3ZIM A;  2ETB A;  2EIN E;  4UWL A;  3AG4 E;  3LYA A;  1N11 A;  5ENT D;  3JUE A;  3SGH A;  1H2U A;  3CEQ A;  4BX8 A;  2XHE A;  3CHM A;  3MV3 B;  3FUN A;  4EZJ A;  3EIJ A;  1KT0 A;  3ASH A;  2CHX A;  5LOZ A;  5D0O D;  2KCL A;  4GTV A;  4PH4 B;  3CHR A;  3GYZ A;  2DCP A;  2RFM A;  2R02 A;  4GPM A;  4MRU A;  3PZ2 A;  3D9M A;  2FEZ A;  3T9K A;  4F1P A;  1OUV A;  4KVO A;  4B0Z A;  3UPV A;  2I6H A;  4YVO A;  3UM3 A;  2CFU A;  3ASG A;  4TXQ A;  4CT0 A;  3EHR A;  4EPZ A;  1JPL A;  3T5V A;  5HI7 A;  4YDW A;  1A5E A;  3FUJ A;  1D9S A;  3UIO C;  5FJY A;  3FUI A;  3QDN A;  2KBX A;  3DEP A;  2GRP B;  3QNK A;  5HQ8 A;  4EBA A;  1TJC A;  2F37 A;  3SQV A;  4YDY A;  3TWX A;  3FUE A;  5LX8 A;  5BNW A;  5FQ4 A;  3KAE A;  2IO3 C;  1DNP A;  2XEN A;  2KC7 A;  3AS5 A;  2Y69 E;  3I4G A;  4JB8 P;  4AEZ C;  4G8L A;  4EEC A;  3E33 A;  5G04 C;  4I6J A;  3FUF A;  1ELR A;  3NBN B;  3IKO B;  5ARG A;  4A3V A;  3JXI A;  5G04 J;  1E7U A;  2YNQ A;  2KCK A;  4LNU D;  4Q94 A;  2NYJ A;  2XZT G;  1HZ4 A;  4NIK A;  3RO2 A;  4I43 A;  2P2C P;  3IV0 A;  2R5S A;  4TV3 A;  4TXP A;  4N39 A;  2GRN B;  1HU3 A;  4ILI A;  4XZ4 A;  5LP0 A;  5ANL A;  2FUL A;  4NQ0 A;  5JJ6 A;  3B7T A;  3SZ7 A;  3CVV A;  4WWP A;  3E34 A;  3G2W A;  3W9F A;  4K03 A;  5B3S E;  3E30 A;  4J8Y A;  1D8E A;  2J09 A;  3G2U A;  4A1S A;  5EX3 A;  2ILR A;  2PM6 A;  3AS8 A;  4H7X A;  3B13 A;  3ESK A;  4UWK A;  4JPS A;  3FH5 A;  4J8D A;  4XI9 A;  3DPD A;  1O1S A;  5EYP F;  2L0I A;  2QZA A;  4GCN A;  4Y6C A;  3PH0 C;  3ZW3 A;  3BU8 A;  2I2O A;  1IXV A;  4U7E B;  4CGV A;  3TWR A;  4NUR A;  4CDR A;  5EX0 A;  3UM1 A;  2VSX E;  1N4R A;  2PL2 A;  3PE3 A;  4DI4 A;  3PZ1 A;  3FTW A;  5KJM A;  3V79 K;  2ZIR A;  4P29 A;  1ELW A;  3TAX A;  3CSF A;  2XPZ A;  2AXV A;  4U63 A;  1E8Y A;  4OYS A;  3PEV B;  4B89 A;  4GTT A;  3GZ2 A;  4HOS A;  1TYQ G;  3IBE A;  3C72 A;  1ZB1 A;  3EHN A;  3Q7F A;  3JQ1 A;  3DST A;  1OY3 D;  3ASD A;  4I9C A;  4UWF A;  2RKK A;  3TXM A;  3ZUV B;  2ZIS A;  4PDX A;  2A4Z A;  3FP3 A;  2AVP A;  2YHC A;  3PNT B;  4GZD A;  5AAO A;  3DXK G;  2AWI A;  4HOQ A;  1PC2 A;  5ANR A;  2Y3A A;  5H7P A;  3Q7A A;  1KLX A;  5BXO A;  1N4Q A;  2YHE A;  1WDY A;  5ENR D;  3NB2 A;  2QC9 A;  4JEU A;  4XKC A;  1N94 A;  3FTU A;  1UG3 A;  4AVX A;  2VTB A;  3IEG A;  5CRU A;  3SF4 A;  3ZHE A;  5FIO A;  3B7U X;  4FJY A;  3DEO A;  4LRZ A;  2V4H C;  4BTB A;  4L9P A;  3U9W A;  3PS6 A;  1OXJ A;  4I1O B;  3E4B A;  4A3T A;  3ZVV A;  1UW4 B;  1Z5S C;  2WXN A;  2WXO A;  1W3B A;  4KT6 B;  1WAO 1;  4R7L A;  5CBO A;  3ZFW A;  4RG9 A;  3RIB A;  3KS2 A;  5IY5 E;  5JHA A;  4I17 A;  5FZS A;  5AQ7 A;  1HG2 A;  3FTS A;  2CHW A;  3PE4 A;  5HRY A;  4GPK A;  5FT9 A;  4FJZ A;  4HLE A;  1L5J A;  1A17 A;  1TNO A;  2GRR B;  1OWM A;  1UN9 A;  3AG3 E;  4L2L A;  2J8S D;  4B94 A;  4FU3 A;  2WXM A;  1FT1 A;  3MJW A;  2V8S E;  2AXU A;  4ATZ D;  2I1J A;  4J6I A;  3HXC A;  3HXE A;  1P5Q A;  1X81 A;  2FI7 A;  2WM9 A;  1SW6 A;  2KZT A;  5FZR A;  4YDO A;  4ANX A;  2WXJ A;  4N2Q A;  2YIN A;  2M63 A;  2F0Y A;  1MX2 A;  2MOW A;  3ENE A;  4Q96 A;  4ME2 A;  2PQR A;  4U96 D;  3I5P A;  4U04 A;  3LJN A;  3D9O A;  4J8F A;  2PQN A;  1TJF A;  4RG6 A;  4NAC A;  2B0O E;  3AG1 E;  1N54 A;  3L08 A;  3BQO A;  1IQU A;  4G26 A;  4APO A;  1HG5 A;  3VTX A;  2VGY A;  3JXJ A;  3T8K A;  1OCC E;  3O48 A;  2I1K A;  4I1M A;  3CHS A;  1NI1 A;  3RJV A;  3QJZ A;  4G1T A;  2L9B A;  4UQY A;  1OWP A;  5BV1 A;  2VGE A;  2ZGG A;  5E75 A;  4WNF A;  1MZC A;  1N9A A;  1E7V A;  3TJP A;  1EYH A;  3FH7 A;  4K5A B;  4QFV A;  4EHM A;  4A1G A;  3DBS A;  4I1A A;  3RAU A;  1HS6 A;  3CVW A;  4CDM A;  4HOU A;  5D2M C;  2F8X K;  4GTP A;  4L1B A;  2QYU A;  1OCR E;  2H6G A;  3ZXS A;  4A55 A;  3ONK A;  2WPV A;  4EQF A;  4LNG A;  4D10 C;  1OCZ E;  1LF8 A;  2P9U G;  3CVY A;  4K0R A;  3B7R L;  5AAR A;  1Q2Z A;  4J0U A;  2R05 A;  2EIM E;  4CEM A;  3PVL A;  4DLQ A;  3DXM G;  4BSZ B;  1FVH A;  3LXU X;  4TRQ A;  4JW1 A;  3Q73 A;  3R9A B;  1OWN A;  2LSV A;  3ABM E;  4HBD A;  4BX9 A;  2VGX A;  2UY1 B;  1HFA A;  4WAF A;  4F6R D;  2V5Q C;  4WND A;  4C0M A;  3FUL A;  3PNL B;  3TWU A;  1TNU A;  2MRI A;  3D9P A;  5D66 A;  4LEU A;  5ENN A;  3MKR A;  4N3A A;  1TN8 A;  3ZN3 A;  4I2Z A;  1HO8 A;  2J9Q A;  3C3O A;  3PUK A;  3CK7 A;  1N0Q A;  2OEW A;  2WB2 A;  2DIW A;  5FQ6 A;  2FBN A;  4FLH A;  2WMN A;  4HI8 A;  4MS6 A;  4C9B B;  4FHK A;  5G2N A;  4HRN A;  4LNB A;  4G2V A;  4MLP A;  4DPR A;  4OVV A;  4DLO A;  1GW6 A;  1N4P A;  2I9C A;  2PNN A;  2WMO A;  4HNA D;  5FQ8 A;  1FT2 A;  3CHP A;  2JAB A;  2LAI A;  1BI7 B;  5AIJ A;  3U66 A;  2ETC A;  4AOF A;  3AAA C;  5JJT A;  2Y4U A;  4DI3 A;  3G2S A;  2C0M A;  1XNF A;  4OVU A;  1NL4 A;  3GZS A;  3U4T A;  1S64 A;  5A7D B;  2LSU A;  2RD0 A;  4WWO A;  5CRV A;  3S2A A;  2XGO A;  1DC2 A;  3SO8 A;  2WXQ A;  2GGF A;  4M3O A;  1ZU2 A;  3Q5M A;  1U3C A;  3FY4 A;  3HVE A;  3FU5 A;  1YMP A;  4KMO A;  4JXT A;  4CYM D;  3UT8 A;  5A23 A;  3AU4 A;  4FC8 A;  2PZI A;  4G11 A;  3PRZ A;  3JQ0 A;  3TWS A;  5CCL A;  3G2V A;  2RFA A;  3E37 A;  5BUZ A;  2UWJ G;  3SBT B;  2IEJ A;  2LNI A;  4M7C A;  2P9K G;  2IFU A;  2H6F A;  2X38 A;  1TNZ A;  3NOG D;  4JHK A;  4CDN A;  2WXF A;  2GRO B;  4GZ5 A;  2F8Y A;  2VSO E;  4HOT A;  5CMY A;  3ULQ A;  3ZPJ A;  5G05 J;  4UQZ A;  3Q78 A;  3FTV A;  2GW1 A;  4XX5 A;  1SA5 A;  2P9I G;  3Q9U C;  4JVS A;  3C3Q A;  4JD2 G;  3MKQ A;  3GZ1 A;  3VLE A;  5AN8 A;  3KSQ A;  3ZYQ A;  4JHR A;  4FLB A;  3OTN A;  1G3N B;  4L23 A;  3CHQ A;  2Y4T A;  2XRZ A;  2XPI A;  4C48 B;  5KCM A;  4BT9 A;  4K5C A;  1LTX A;  3BG0 B;  3MA5 A;  4UWH A;  3R9M A;  4PS3 A;  4KBQ A;  4HS2 A;  4HB5 A;  3E32 A;  4J8S A;  2HO1 A;  1K8K G;  1SVX A;  3F6Q A;  4UUC A;  3MZL B;  3BG1 B;  4NRH B;  3ZHE B;  3APF A;  4W9R A;  3NQP A;  1QQE A;  4DX5 D;  4URK A;  3HDX A;  5KJK A;  4F7A A;  3WXX A;  3DRA A;  5EID A;  5LCW J;  4GMR A;  3CKC A;  3W9G A;  3UQ3 A;  2VSN A;  3FUM A;  1NFI E;  2CG3 A;  2X6K A;  4ACK A;  4HVB A;  3UMV A;  2BTD A;  3QWP A;  3CKB A;  4GTM A;  1U3D A;  3LKU A;  1S0P A;  4OAV B;  3ML9 A;  2C2L A;  3UTM A;  4WUY A;  3BEE A;  1SZA A;  5ENQ D;  4ANV A;  3P1U A;  3RO3 A;  1ZBP A;  4HRM B;  3UT7 A;  3Q47 B;  4LCT A;  2ETA A;  1JCS A;  3LDZ A;  1Z3Y A;  4DK5 A;  2XS1 A;  4KZ0 A;  2FO1 E;  3LVQ E;  3U64 A;  4BT8 A;  1JWF A;  2WXK A;  5ARF A;  2HYZ A;  2OVF A;  2QY7 A;  3OXF A;  1HE8 A;  4DRX E;  4GTS A;  4RVB A;  1MYO A;  3L17 A;  1IQR A;  3PUJ A;  2C0L A;  3L13 A;  2Q7F A;  1KT1 A;  1HX8 A;  3Q79 A;  1N4S A;  4UWG A;  4GZ3 A;  1IHG A;  1HXI A;  1RZ4 A;  2J08 A;  4I9E A;  5EDS A;  4LSZ E;  4GCO A;  2X6F A;  4OAU C;  3CLJ A;  3LCA A;  4IYP A;  1MX4 A;  4IRU A;  1TR4 A;  4BSX A;  4L2Y A;  3TGO A;  4ZFH A;  3ABK E;  3FUH A;  1HF8 A;  2QFC A;  5CHE E;  4YDE A;  4XI0 A;  2XS8 A;  4ATG A;  4UI9 C;  3FUD A;  3EHQ A;  5CMW A;  3UX4 A;  3AS4 A;  4BEP A;  1H2V C;  4UI9 J;  2OOE A;  2DWZ A;  4G24 A;  3KD7 A;  4CT4 A;  3FFL A;  4EZK A;  3TL5 A;  3HIZ A;  3L82 A;  1H19 A;  3RRU A;  2XCC A;  5AEN A;  3IXE A;  3RU0 A;  4LG6 A;  2LXM A;  3HRA A;  2WVI A;  3LPZ A;  4A63 B;  2WXR A;  3KEZ A;  3ULE G;  3ABL E;  3QAQ A;  4V3I A;  3SY2 A;  4FAD A;  2BKK B;  2XEE A;  2L6B A;  2DZO A;  2V5F A;  3UIP C;  1BU9 A;  5KJL A;  2X6H A;  2DYS E;  2E2E A;  2EIK E;  4GYW A;  1H6P A;  1O1T A;  3OXG A;  5ENP D;  5ENO D;  3TWT A;  1KZO A;  1MJ0 A;  2IY0 C;  3D9I A;  4CRW A;  4UI9 K;  1TEZ A;  3EU9 A;  3S7F A;  3ZXP A;  1MQS A;  4GZC A;  2E0I A;  1YCS B;  1XGW A;  4YND A;  2JLB A;  3ZYM A;  2RG8 A;  3MYV A;  1RW2 A;  5DBK A;  2DBA A;  1EF1 C;  4BET A;  2R2L A;  2R17 C;  2VJ8 A;  2EQX A;  3SFX A;  3CV0 A;  3S7B A;  3ASN E;  4ANU A;  5BXU A;  2IU1 A;  3CK9 A;  3FDH A;  5AYW D;  2WQH A;  3N71 A;  2MYO A;  3ZRH A;  1QZ2 A;  1TN7 A;  4JZY A;  1K3Z D;  1H6K A;  3CHO A;  5KBA A;  3KEA A;  4U0U A;  2MHK A;  4WNE A;  3SNX A;  2H6H A;  2GRL A;  3DSV A;  3FU3 A;  4N3C A;  4B8A A;  4WNG A;  5M72 A;  3L54 A;  5EIL A;  5ENS D;  3RSE G;  2L6J A;  4HXI A;  4AY6 A;  4E6H A;  2BED A;  5JMN D;  3NOC D;  3Q4A B;  3U3W A;  4BY6 A;  1SQM A;  4DX6 D;  3EUV A;  4FP7 A;  2OCC E;  3FTZ A;  4JL0 A;  4J8E A;  4XKB A;  4FHJ A;  2DVW A;  4H7Y A;  4Z68 A;  1UN8 A;  5AQA A;  4AJW A;  1NP7 A;  1LD7 A;  2LO6 A;  4DJA A;  4FUL A;  2CFZ A;  5EIB E;  3ULY A;  4DX1 A;  3SFY A;  5KWD A;  5T3R A;  1E96 B;  3KSL A;  4N5Q A;  3ASO E;  5AQB A;  1BD8 A;  1BI8 B;  2KXP C;  4GMJ A;  1NZN A;  1SZ9 A;  1DVP A;  3T8M A; 
#chains in the Genus database with same CATH homology
 3ISM C;  1RW2 A;  1Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...