1RW2A

Three-dimensional structure of ku80 ctd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
MHHHHHHKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent DNA helicase II, 80 kDa subunit
publication title Solution structure of the C-terminal domain of Ku80 suggests important sites for protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2003-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 1rw2A00
3ISMC 1RW2A 1Q2ZA
chains in the Genus database with same CATH superfamily
4UWHA 3UT7A 1U3DA 2OVFA 3K9IA 2Y3AA 3JXIA 2WXNA 5ARFA 4DX1A 1Z6TA 1HZ4A 5EYLA 3CV0A 5JA4D 3D9IA 1HO8A 5JHAA 2V5FA 2DYRE 4GZ6A 5CMYA 1IXVA 3SFXA 1PY1A 3E33A 4HQDA 4J6IA 4PS3A 5D66A 2GRQB 3R7QA 5AQAA 1Y6IA 3E32A 2BUGA 1E8WA 1TNOA 4F53A 3PE4A 1H6KA 2V8SE 3L6AA 4D10C 2WXLA 3UIOC 4XI0A 1HE8A 1N52A 2WXGA 3C98A 3KSQA 4HOSA 4CEMA 4LNUD 3TWRA 4ACLA 4UQXA 3KEZA 1SVXA 3AS8A 3L22A 3UM2A 5B3SE 3ZIMA 4A3VA 1EYHA 3QK0A 2XHEA 3VLFA 5AQ9A 1ZU2A 3PZ2A 1HFAA 4W9RA 2XQ0A 3ZYQA 2XEEA 3B13A 3LS8A 4HOTA 4OYSA 4JXTA 2XS8A 2NXPA 3PZ4A 5LFAA 2WM9A 4GTPA 2FF4A 3CK8A 3FTXA 3S7FA 1FPPA 4TXRA 2WXQA 4AXHA 4I2WA 2EILE 5CECB 4HI9A 4G25A 4DPRA 2Y69E 3FUNA 3SFYA 4JEUA 2IONA 3S7DA 3SHFA 2WQ7A 2R17C 3SF4A 3ZYMA 4E6HA 3T5XA 3MV3B 2MRIA 1IHGA 2QFCA 4I43A 4AEZC 2I9CA 4YDEA 2XRZA 4B0ZA 2EIJE 3APFA 4GTRA 3FUJA 2WQ6A 4HORA 4BSXA 5G2NA 3I3NA 3ZKJA 3EDTB 5FINA 4ILHB 2P9UG 4ZFHA 3TWWA 1OWNA 1OCOE 3TG4A 4LEUA 2IOSA 4J7WA 5BPPA 2VGYA 3CHQA 4A1GA 5CMWA 2PL2A 3UQ3A 2JABA 1MQSA 3RU0A 5FT9A 3I4RB 1Z3YA 5HI7A 4V3IA 5BNWA 3NBNB 4U0ZA 2QYUA 4EZLA 3QJZA 4UI9K 3B7RL 1S64A 4NRHB 2GW1A 3CSFA 3JYSA 4ANVA 3W9GA 2HYZA 4I9EA 4RSYA 4BSZB 3B95A 3HYMB 3ZXSA 1OCRE 3RO2A 3HXFA 3AJIA 1KLXA 5EKQD 5FTPA 3ASNE 3E4BA 3MX3A 4GAAA 1TNZA 2B6CA 3G2UA 4APOA 3FUEA 4O1OA 2IY0C 4L23A 5FQ6A 2ETBA 5FZSA 3FUDA 1TJFA 3J5PA 1QZ2A 3NZUA 5ENSD 5AN8A 1UW4B 3E34A 3ML9A 4GTOA 1H2UA 1OWMA 3FTZA 4A55A 3ZGQA 4GA1A 3RIBA 2AJAA 4JHKA 3PNTB 1BU9A 4BT9A 3Q15A 3CHOA 2KBXA 1E7UA 3B7UX 3LXUX 4J0UA 5JJ6A 4C9BB 3CHSA 3LY7A 4TRQA 3ASHA 3B7BA 4F7AA 3FDHA 4BX8A 1UOHA 4LNGA 4UWKA 4GCOA 3CQCB 4QQIA 4AV7A 3FWVA 3Q78A 1OY3D 3SI5A 4TUUA 2XENA 4XIFA 3GYZA 4KZCA 3VTXA 4BERA 1SZAA 1HU3A 3R9MA 2KZTA 3U9WA 2X6HA 5EX3A 5LP0A 2R02A 4DX6D 1DCQA 4HOUA 2RD0A 5AYWD 4AVXA 5FQ4A 5DBKA 2P58C 2R2LA 1TN6A 4X8QA 4LUNU 3Q79A 2DBAA 3E30A 2J9QA 4WNGA 4WWOA 2FULA 5BXOA 4JA9A 1TR4A 1MYOA 4R7LA 2CHWA 3E37A 1IKND 1SQMA 4AP2A 1NA0A 1BPOA 3CVNA 3PUJA 1INZA 3FH8A 3Q7AA 3APDA 1JCQA 2AVPA 3C3RA 2RFAA 3SBTB 4EBAA 2OEVA 4FULA 2VTBA 3F6QA 4GMLA 4UWGA 3AG3E 1K1BA 2ONDA 3FH7A 2WXOA 3AG1E 5CCLA 3LKUA 1OWLA 3LVQE 1B89A 4JL0A 2HE0A 3SNXA 4M7CA 3HXDA 1NP7A 1MX2A 4YNDA 3LY9A 3ESKA 3Q9NC 4UI9C 5CRUA 4GYYA 1H6OA 4ANWA 5CRVA 5BV0A 1JPLA 5ITZF 2H6HA 4OAVB 3FU0A 3CVXA 3ISMC 2HR2A 2AW6A 1N4RA 4L7TA 2IU1A 5FQ8A 4RLYA 3UINC 4N2SA 4N2QA 1HG2A 4ABNA 4XI9A 5CEAA 1S70B 2NYJA 3CVPA 4KVOA 2DWZA 3HXCA 5ENPD 4HRNA 1UN8A 3BU8A 2I2OA 2WXFA 2I1JA 5A7DB 3CVVA 1E90A 5EILA 4WNEA 1Q2ZA 5LX8A 4XEIG 1SZ9A 3CVWA 4KBQA 3ASGA 5ENOD 4UQZA 3IHVA 1OWPA 4K5AB 2QYJA 4GTQA 2L6JA 4HS2A 5CBNA 2H6FA 2GRRB 4APFA 3NB2A 3DSTA 3V2XA 3UMVA 1IHBA 4F1SA 4XX5A 3SD5A 3TJPA 4KMOA 5ANRA 1WG0A 1P5QA 2F37A 4OVVA 4J8FA 5HRYA 4KZ0A 3EIQC 3ZFWA 1N0QA 3PRZA 4HXIA 2A4ZA 4CDNA 2MOWA 1TEZA 2VGEA 3LJNA 3FTUA 1NA3A 3EIJA 2CHZA 5BXUA 4ATGA 2VJ8A 5ARGA 2X6FA 3UI2A 4K0RA 4WNDA 1XGWA 2P9LG 4UWFA 3SFZA 3DEOA 2HM8A 1RZ4A 1QBQA 2R03A 3UPVA 3CHMA 3L17A 2JEKA 4JC8A 4C0EA 1JCRA 5CERB 3G2WA 1H19A 3PZDA 2P2CP 4WNFA 2LO6A 2PQRA 3ZHEA 1E7VA 3HVEB 3UX4A 2ZU6B 2KCLA 3QWPA 1SA5A 2AXZA 5FQ7A 3DSVA 2VSYA 3FUFA 3R7RA 4U8HA 1WDYA 4RVBA 2P9SG 3C3OA 4GTMA 4GB9A 2VQ2A 2YINA 4YDYA 1IQUA 2MHKA 4BY6A 3ESLA 4H7XA 1W3BA 1DVPA 2C2LA 3L16A 1QYMA 2YNQA 4I1OB 2X6IA 3HRAA 1N54A 3SY2A 4DRXE 5KJNA 3CEQA 3FH5A 1TJCA 5EYPF 2WMOA 3TGOA 3RK6A 2UY1B 3SO8A 3QWVA 4BTAA 4BT8A 5C1DA 1OUVA 1TNBA 3MJWA 4U0SA 3DSSA 1G3NB 1H2TC 2GRNB 4WWNA 3NQPA 4U8VD 2Y4TA 5JJTA 3CK7A 3EU5A 2VGXB 4A3TA 2PNNA 1MZCA 5CEDB 2J4BA 2M63A 3CHPA 3EHMA 4JEHA 2X38A 4AY6A 3V30A 3CVYA 3G2TA 3CLJA 4NQ0A 3RRMB 3FUKA 4UUCA 3HXEA 4PDXA 1V55E 5D2MC 4LRZA 4A63B 3TAXA 3ZXPA 2QC9A 5A23A 3LDZA 1O1TA 5HQ8A 2WXPA 4HRMB 4U07A 3BQOA 5AARA 5AAOA 2F8YA 4KT6B 4BTBA 4UI9J 4BX9A 3DSUA 4ANUA 4Y6WA 1LTXA 3DSXA 2ZGDA 2I1KA 3C5RA 4N39A 1DNPA 3J5QB 1WM5A 1KZPA 4GTVA 2R05A 5LOZA 3QC1A 4CGVA 4B8AA 2XGOA 1JUQA 3WXXA 3AG2E 1N0RA 5FIOA 4B93B 4M3OA 4HOQA 4HRLA 4N5CA 2NSZA 2XPZA 5AIJA 5BV1A 2B0OE 3Q75A 1K8KG 2XZTG 4I1AA 3JUIA 4G1TA 4EECA 4JPSA 3L9TA 3FTVA 3Q47B 1UJKA 5KNHD 3X2QE 4BWRA 5AQBA 3URZA 5ENTD 4GZCA 4WWPA 5AENA 1N4QA 1HH8A 3DPYA 2CG2A 2C0LA 4KXKB 3Q5MA 3AU4A 3CK9A 3Q9UC 3IHYA 3NOCD 5C2YA 2YHEA 3UM3A 4DLQA 1YMPA 1H6PA 3UIPC 3DSWA 3QKYA 1BLXB 3QDNA 2IFUA 3BEEA 2KCVA 3SGHA 4LSZE 1K1AA 3Q49B 3ZNGA 3CR3A 4AY5A 3OTNA 4GPKA 3U64A 2XGMA 5KJMA 4TXPA 4K5BA 4GYOA 3HVEA 2Y0BG 1N94A 1JCSA 4CDRA 4TXQA 1A17A 3G2SA 2R5SA 3FP3A 1D9SA 2KM4A 3BUAA 2AXUA 2ETAA 2FEZA 3NF1A 1FCHA 4K5CA 4CRWA 5CBOA 1BD8A 2RKKA 1RW2A 2J07A 3FU5A 3WG7E 4GPMA 2WXRA 2UWJG 4H7YA 4ILIA 2QY7A 4HLLA 5CHEE 2DZNA 1DCEA 3ZW3A 4JZYA 5LCWC 3UT8A 2WMNA 1YYHA 1MX4A 3GZ2A 2WXJA 2IQCA 4Q94A 3RRUA 1HF8A 5D0OD 3PEVB 3TG5A 1HG5A 3SBSA 1S0PA 4HLEA 3IEGA 3CSTA 2J49A 5B1BE 3B7SA 3D9LA 3GZSA 1HS6A 1OXJA 3KEAA 4N3CA 3TWTA 5EIDA 3PE3A 3ZU7B 3CKBA 3N71A 2IO3C 2BKKB 4F6RD 4OVUA 4HB5A 4CT0A 3ONLA 4DLOA 4PS8A 3S7BA 2QZAA 4AJWA 2XS1A 5ANLA 3UTMA 4FLBA 2OOEA 5ENQD 4MKTA 3QOUA 1XNFA 3I5PA 2XPIA 2XEVA 4C48B 4O60A 3EHRA 1LD8A 5AJDA 2GRPB 3MCXA 4FU3A 2YHCA 4EPZA 5JJ7A 2CFZA 4O6FA 4J8EA 4GZ3A 1HXIA 3FTWA 1NI1A 1K3ZD 2IO2C 1KT0A 2NC9A 4EBAG 5KWDA 1D8EA 3MEKA 4GMJA 1KZOA 3U66A 2V5QC 4BFRA 3AS5A 4E85A 5DIZA 2V4HC 4G8LA 1UN9A 1TN7A 5FZRA 3AU5A 4Q69A 3DRAA 5IY5E 1FVFA 3VLDA 5HKPA 3GW4A 4FHKA 1H2VC 3TL5A 2CFUA 1GW6A 2LSVA 4BESA 4A1SA 4TV3A 3HG0D 4PUCA 2P9PG 1EPUA 3ASDA 3Q4AB 3FULA 3L54A 3ULYA 2KC7A 4AOFA 1QNFA 2WPVA 3JQ1A 3FUIA 4NURA 3OXFA 3EU9A 3PUKA 4JHJA 4MLPA 3CKCA 3W9FA 1V54E 3LEWA 3L13A 4YDWA 2H6IA 4DX5D 3CVQA 4UQYA 3RSEG 2PM7A 2L6BA 4UWLA 1KPSB 3ZN3A 2CHXA 2WVIA 2ILRA 3AAAC 3TWSA 1MJ0A 3HXBA 2EQXA 3T8KA 3LY8A 3IXEA 3KS2A 2LXMA 5G04C 3D9NA 5BUZA 3ZRHA 4FADA 3CVUA 5M72A 2J09A 2L9BA 1SW6A 3P2BA 2MYOA 3NAWA 4B8CB 4GYWA 3ZVVA 4GTTA 4G26A 5ENRD 3ONKA 4FA6A 2I6HA 3BG1B 4RQIA 3KAEA 4LNBA 3CHRA 1ZBPA 3FEYA 2GROB 3SQVA 1MX6A 3ULQA 4G23A 1PAQA 3PS6A 4DI4A 3D9OA 4CT4A 2E0IA 3QWWA 2GGFA 2IF4A 3DXMG 1FT1A 2YQ8A 4L2LA 3FFLA 1U3CA 2LXLA 3CGHA 1N4PA 3DEPA 3QAQA 1OT8A 3TWVA 1WAO1 2XZDG 2WXHA 2V0PA 2F0YA 3FU3A 5G55A 2X3MA 1OWOA 4N3BA 2Q7FA 4I6JA 2J4DA 2LSUA 3VTYA 4LG6A 3KD7A 5G05C 1O5MA 5LCWJ 2PM6A 2CG3A 3TWUA 1D8DA 1S63A 2XGSA 3D9JA 3ZEFA 4GA2A 3TXMA 2FO7A 4URKA 1ZB1A 1QQEA 4BEPA 1IYGA 2BKGA 5CCMA 3TWXA 4Z68A 1MHQA 4B94A 1HX8A 4HBDA 2X6JA 3RKVA 2HO1A 2XCBA 3LVRE 3D3MA 3JUEA 1UG3A 4CCAA 2KZTB 5T8IA 4MRUA 2DZOA 4FLHA 3S2AA 3UM0A 4PH4B 4C0MA 1NFIE 3NZSA 3T5VA 3EUVA 2Y4UA 3CIAA 3UUXA 2KXPC 4ILGA 3NOGD 4QFVA 5AJLA 2X6KA 1PC2A 3G2VA 2XPYA 4HNAD 2LAIA 1Z5SC 3ZYLA 2BF0X 3MYVA 1O1RA 1FT2A 1Z3XA 4U96D 3CVLA 2AXVA 5FJYA 1TYQG 3RO3A 2XRYA 5KNGA 1E8XA 2P9NG 4K03A 3JXJA 1NL4A 4FP7A 3RAUA 2VTBB 3D9PA 4CYMD 3V2OA 4GCNA 2VYIA 4FJYA 5BT1A 3RJVA 2LUHA 1NZNA 4CZ2D 5BW8C 5E76A 3MKQB 4G8KA 2WQHA 2BTDA 3C72A 4WUYA 1JWFA 2VSXE 4N3AA 1U2VG 2L0IA 1TNUA 1E8YA 3UKUG 3U3WA 3FUMA 4HI8A 3JCKC 4I17A 4RG9A 4PS7A 3SZ7A 3DPDA 3IV0A 1ELRA 3PEUB 4I6GA 3ABKE 2IOLA 3I4GA 2F8XK 1OCZE 1YA0A 4DJAA 3OXLA 3PZ1A 3EHQA 3DXKG 1LF8A 3FUHA 4U95D 4U0UA 3D9MA 4OAUC 2DVWA 4RG6A 3R9AB 3UM1A 4F3VA 4KVMA 4IULA 3BG0B 4I9CA 3L08A 5EX0A 3D9HA 4BETA 2A5UA 3VLEA 1N9AA 2EIKE 5EN5D 4HVBA 5KBAA 2FI7A 1WY6A 2BEDA 4U04A 3T9KA 3ZPJA 3ML8A 2ZIRA 4JD2G 3PVLA 3DBSA 5G04J 2E2EA 2RFMA 2LNIA 4GU5A 4I2ZA 5KJLA 2WXIA 3Q73A 4IN3B 3ABLE 3PNLB 2IJGX 4JW1A 2JLBA 3IBEA 3MZLB 1A5EA 4EZJA 4XZ4A 3IKOB 2OEWA 1OCCE 4TUMA 4MS6A 3D9KA 4L2YA 5D0QD 4AIFA 4ANXA 2PQNA 1EF1C 3MKRA 4N5QA 4FHJA 4WAFA 3U4TA 2PZIA 5JHBA 3ASFA 4DX7D 3QNKA 4NACA 2FO1E 4FJZA 4KYOB 4P29A 4DX2A 5FZQA 2ETCA 3ZUVB 4ZHBA 1X5BA 3LJ3A 2UY1A 3ZYKA 2ZISA 4YVOA 5G05J 4JB8P 4ACKA 2LAHA 3O48A 4CDMA 3V79K 2XCCA 2ZXWE 3ZHEB 3FTYA 4J8DA 2GRMA 4YDOA 3DWLG 3FEXA 2ZGGA 2VGXA 2DCPA 2L0TB 5KJKA 2H6GA 2KCKA 5B1AE 4GA0A 1N4SA 3EJNA 1LD7A 4G2VA 1TN8A 4JVSA 4J8SA 2OCCE 3PH0C 3KSLA 4GMRA 4JA7A 1AWCB 4Y6CA 4I6EA 5T3RA 3HIZA 5JMND 5J08A 3JQ0A 3QARA 2R59A 3TXNA 5A6CA 2OVBA 4GZ5A 2IEJA 3OAWA 3C3QA 3FU6A 5FWQA 3UKRG 4U8YD 3GZ1A 5HS0A 3Q7FA 4B89A 2EINE 2P9KG 5EDSA 3LCAA 3ULEG 3CQGB 2WXKA 2J08A 2J8SD 4G11A 3HDXA 2RG8A 3APCA 1ELKA 4XKBA 3RRNB 3MKQA 5KCMA 2VSOE 3ASOE 4IYPA 4MBGA 1JWGA 3LYAA 1SA4A 1H0AA 3V31A 4U63A 4AM9A 2XEHA 4L9PA 3QB2A 5T4YA 3AS4A 4DI3A 4NIKA 4U7EB 2EIME 3EHNA 3FHEA 1TNYA 3UT4A 2DIWA 1BI8B 4F1PA 4EZKA 2P9IG 2DYSE 5E75A 2OV8A 3T8MA 4DK5A 4CGWA 1X81A 4O1PA 3PREA 3S7JA 3MV2B 2C0MA 1ELWA 1E8ZA 4EHMA 5EIBE 3LPZA 2Y1LE 4IRUA 1BI7B 2VSNA 1UJJA 2A5EA 4FC8A 5AQ7A 4XKCA 1DC2A 3MGBA 1O1SA 1KT1A 4I1MA 4JHRA 1EDUA 3AG4E 2FBNA 5J90A 3PZ3A 4DUIA 3P1UA 3FTSA 1IQRA 3ENEA 1N95A 4GZDA 3B7TA 1L5JA 1VDYA 4G24A 3MA5A 4GTSA 3FY4A 2V4LA 4EQFA 4ME2A 3UXGA 3HHMA 1AP7A 2WB2A 2AWIA 4XE0A 5H7PA 3OXGA 1FVHA 4HFGA 2GRLA 4J8YA 1E96B 2WXMA 4ATZD 3L82A 3PDNA 2KATA 4LERA 1N11A 1Y8MA 1YCSB 4L1BA 4YVQC 3ABME 5ENNA 3O4ZA 4LCTA 3TWQA 4Q96A
chains in the Genus database with same CATH topology
3ISMC 1RW2A 1Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISM C;  1RW2 A;  1Q2Z A; 
#chains in the Genus database with same CATH topology
 4UWH A;  3UT7 A;  1U3D A;  2OVF A;  3K9I A;  2Y3A A;  3JXI A;  2WXN A;  5ARF A;  4DX1 A;  1Z6T A;  1HZ4 A;  5EYL A;  3CV0 A;  5JA4 D;  3D9I A;  1HO8 A;  5JHA A;  2V5F A;  2DYR E;  4GZ6 A;  5CMY A;  1IXV A;  3SFX A;  1PY1 A;  3E33 A;  4HQD A;  4J6I A;  4PS3 A;  5D66 A;  2GRQ B;  3R7Q A;  5AQA A;  1Y6I A;  3E32 A;  2BUG A;  1E8W A;  1TNO A;  4F53 A;  3PE4 A;  1H6K A;  2V8S E;  3L6A A;  4D10 C;  2WXL A;  3UIO C;  4XI0 A;  1HE8 A;  1N52 A;  2WXG A;  3C98 A;  3KSQ A;  4HOS A;  4CEM A;  4LNU D;  3TWR A;  4ACL A;  4UQX A;  3KEZ A;  1SVX A;  3AS8 A;  3L22 A;  3UM2 A;  5B3S E;  3ZIM A;  4A3V A;  1EYH A;  3QK0 A;  2XHE A;  3VLF A;  5AQ9 A;  1ZU2 A;  3PZ2 A;  1HFA A;  4W9R A;  2XQ0 A;  3ZYQ A;  2XEE A;  3B13 A;  3LS8 A;  4HOT A;  4OYS A;  4JXT A;  2XS8 A;  2NXP A;  3PZ4 A;  5LFA A;  2WM9 A;  4GTP A;  2FF4 A;  3CK8 A;  3FTX A;  3S7F A;  1FPP A;  4TXR A;  2WXQ A;  4AXH A;  4I2W A;  2EIL E;  5CEC B;  4HI9 A;  4G25 A;  4DPR A;  2Y69 E;  3FUN A;  3SFY A;  4JEU A;  2ION A;  3S7D A;  3SHF A;  2WQ7 A;  2R17 C;  3SF4 A;  3ZYM A;  4E6H A;  3T5X A;  3MV3 B;  2MRI A;  1IHG A;  2QFC A;  4I43 A;  4AEZ C;  2I9C A;  4YDE A;  2XRZ A;  4B0Z A;  2EIJ E;  3APF A;  4GTR A;  3FUJ A;  2WQ6 A;  4HOR A;  4BSX A;  5G2N A;  3I3N A;  3ZKJ A;  3EDT B;  5FIN A;  4ILH B;  2P9U G;  4ZFH A;  3TWW A;  1OWN A;  1OCO E;  3TG4 A;  4LEU A;  2IOS A;  4J7W A;  5BPP A;  2VGY A;  3CHQ A;  4A1G A;  5CMW A;  2PL2 A;  3UQ3 A;  2JAB A;  1MQS A;  3RU0 A;  5FT9 A;  3I4R B;  1Z3Y A;  5HI7 A;  4V3I A;  5BNW A;  3NBN B;  4U0Z A;  2QYU A;  4EZL A;  3QJZ A;  4UI9 K;  3B7R L;  1S64 A;  4NRH B;  2GW1 A;  3CSF A;  3JYS A;  4ANV A;  3W9G A;  2HYZ A;  4I9E A;  4RSY A;  4BSZ B;  3B95 A;  3HYM B;  3ZXS A;  1OCR E;  3RO2 A;  3HXF A;  3AJI A;  1KLX A;  5EKQ D;  5FTP A;  3ASN E;  3E4B A;  3MX3 A;  4GAA A;  1TNZ A;  2B6C A;  3G2U A;  4APO A;  3FUE A;  4O1O A;  2IY0 C;  4L23 A;  5FQ6 A;  2ETB A;  5FZS A;  3FUD A;  1TJF A;  3J5P A;  1QZ2 A;  3NZU A;  5ENS D;  5AN8 A;  1UW4 B;  3E34 A;  3ML9 A;  4GTO A;  1H2U A;  1OWM A;  3FTZ A;  4A55 A;  3ZGQ A;  4GA1 A;  3RIB A;  2AJA A;  4JHK A;  3PNT B;  1BU9 A;  4BT9 A;  3Q15 A;  3CHO A;  2KBX A;  1E7U A;  3B7U X;  3LXU X;  4J0U A;  5JJ6 A;  4C9B B;  3CHS A;  3LY7 A;  4TRQ A;  3ASH A;  3B7B A;  4F7A A;  3FDH A;  4BX8 A;  1UOH A;  4LNG A;  4UWK A;  4GCO A;  3CQC B;  4QQI A;  4AV7 A;  3FWV A;  3Q78 A;  1OY3 D;  3SI5 A;  4TUU A;  2XEN A;  4XIF A;  3GYZ A;  4KZC A;  3VTX A;  4BER A;  1SZA A;  1HU3 A;  3R9M A;  2KZT A;  3U9W A;  2X6H A;  5EX3 A;  5LP0 A;  2R02 A;  4DX6 D;  1DCQ A;  4HOU A;  2RD0 A;  5AYW D;  4AVX A;  5FQ4 A;  5DBK A;  2P58 C;  2R2L A;  1TN6 A;  4X8Q A;  4LUN U;  3Q79 A;  2DBA A;  3E30 A;  2J9Q A;  4WNG A;  4WWO A;  2FUL A;  5BXO A;  4JA9 A;  1TR4 A;  1MYO A;  4R7L A;  2CHW A;  3E37 A;  1IKN D;  1SQM A;  4AP2 A;  1NA0 A;  1BPO A;  3CVN A;  3PUJ A;  1INZ A;  3FH8 A;  3Q7A A;  3APD A;  1JCQ A;  2AVP A;  3C3R A;  2RFA A;  3SBT B;  4EBA A;  2OEV A;  4FUL A;  2VTB A;  3F6Q A;  4GML A;  4UWG A;  3AG3 E;  1K1B A;  2OND A;  3FH7 A;  2WXO A;  3AG1 E;  5CCL A;  3LKU A;  1OWL A;  3LVQ E;  1B89 A;  4JL0 A;  2HE0 A;  3SNX A;  4M7C A;  3HXD A;  1NP7 A;  1MX2 A;  4YND A;  3LY9 A;  3ESK A;  3Q9N C;  4UI9 C;  5CRU A;  4GYY A;  1H6O A;  4ANW A;  5CRV A;  5BV0 A;  1JPL A;  5ITZ F;  2H6H A;  4OAV B;  3FU0 A;  3CVX A;  3ISM C;  2HR2 A;  2AW6 A;  1N4R A;  4L7T A;  2IU1 A;  5FQ8 A;  4RLY A;  3UIN C;  4N2S A;  4N2Q A;  1HG2 A;  4ABN A;  4XI9 A;  5CEA A;  1S70 B;  2NYJ A;  3CVP A;  4KVO A;  2DWZ A;  3HXC A;  5ENP D;  4HRN A;  1UN8 A;  3BU8 A;  2I2O A;  2WXF A;  2I1J A;  5A7D B;  3CVV A;  1E90 A;  5EIL A;  4WNE A;  1Q2Z A;  5LX8 A;  4XEI G;  1SZ9 A;  3CVW A;  4KBQ A;  3ASG A;  5ENO D;  4UQZ A;  3IHV A;  1OWP A;  4K5A B;  2QYJ A;  4GTQ A;  2L6J A;  4HS2 A;  5CBN A;  2H6F A;  2GRR B;  4APF A;  3NB2 A;  3DST A;  3V2X A;  3UMV A;  1IHB A;  4F1S A;  4XX5 A;  3SD5 A;  3TJP A;  4KMO A;  5ANR A;  1WG0 A;  1P5Q A;  2F37 A;  4OVV A;  4J8F A;  5HRY A;  4KZ0 A;  3EIQ C;  3ZFW A;  1N0Q A;  3PRZ A;  4HXI A;  2A4Z A;  4CDN A;  2MOW A;  1TEZ A;  2VGE A;  3LJN A;  3FTU A;  1NA3 A;  3EIJ A;  2CHZ A;  5BXU A;  4ATG A;  2VJ8 A;  5ARG A;  2X6F A;  3UI2 A;  4K0R A;  4WND A;  1XGW A;  2P9L G;  4UWF A;  3SFZ A;  3DEO A;  2HM8 A;  1RZ4 A;  1QBQ A;  2R03 A;  3UPV A;  3CHM A;  3L17 A;  2JEK A;  4JC8 A;  4C0E A;  1JCR A;  5CER B;  3G2W A;  1H19 A;  3PZD A;  2P2C P;  4WNF A;  2LO6 A;  2PQR A;  3ZHE A;  1E7V A;  3HVE B;  3UX4 A;  2ZU6 B;  2KCL A;  3QWP A;  1SA5 A;  2AXZ A;  5FQ7 A;  3DSV A;  2VSY A;  3FUF A;  3R7R A;  4U8H A;  1WDY A;  4RVB A;  2P9S G;  3C3O A;  4GTM A;  4GB9 A;  2VQ2 A;  2YIN A;  4YDY A;  1IQU A;  2MHK A;  4BY6 A;  3ESL A;  4H7X A;  1W3B A;  1DVP A;  2C2L A;  3L16 A;  1QYM A;  2YNQ A;  4I1O B;  2X6I A;  3HRA A;  1N54 A;  3SY2 A;  4DRX E;  5KJN A;  3CEQ A;  3FH5 A;  1TJC A;  5EYP F;  2WMO A;  3TGO A;  3RK6 A;  2UY1 B;  3SO8 A;  3QWV A;  4BTA A;  4BT8 A;  5C1D A;  1OUV A;  1TNB A;  3MJW A;  4U0S A;  3DSS A;  1G3N B;  1H2T C;  2GRN B;  4WWN A;  3NQP A;  4U8V D;  2Y4T A;  5JJT A;  3CK7 A;  3EU5 A;  2VGX B;  4A3T A;  2PNN A;  1MZC A;  5CED B;  2J4B A;  2M63 A;  3CHP A;  3EHM A;  4JEH A;  2X38 A;  4AY6 A;  3V30 A;  3CVY A;  3G2T A;  3CLJ A;  4NQ0 A;  3RRM B;  3FUK A;  4UUC A;  3HXE A;  4PDX A;  1V55 E;  5D2M C;  4LRZ A;  4A63 B;  3TAX A;  3ZXP A;  2QC9 A;  5A23 A;  3LDZ A;  1O1T A;  5HQ8 A;  2WXP A;  4HRM B;  4U07 A;  3BQO A;  5AAR A;  5AAO A;  2F8Y A;  4KT6 B;  4BTB A;  4UI9 J;  4BX9 A;  3DSU A;  4ANU A;  4Y6W A;  1LTX A;  3DSX A;  2ZGD A;  2I1K A;  3C5R A;  4N39 A;  1DNP A;  3J5Q B;  1WM5 A;  1KZP A;  4GTV A;  2R05 A;  5LOZ A;  3QC1 A;  4CGV A;  4B8A A;  2XGO A;  1JUQ A;  3WXX A;  3AG2 E;  1N0R A;  5FIO A;  4B93 B;  4M3O A;  4HOQ A;  4HRL A;  4N5C A;  2NSZ A;  2XPZ A;  5AIJ A;  5BV1 A;  2B0O E;  3Q75 A;  1K8K G;  2XZT G;  4I1A A;  3JUI A;  4G1T A;  4EEC A;  4JPS A;  3L9T A;  3FTV A;  3Q47 B;  1UJK A;  5KNH D;  3X2Q E;  4BWR A;  5AQB A;  3URZ A;  5ENT D;  4GZC A;  4WWP A;  5AEN A;  1N4Q A;  1HH8 A;  3DPY A;  2CG2 A;  2C0L A;  4KXK B;  3Q5M A;  3AU4 A;  3CK9 A;  3Q9U C;  3IHY A;  3NOC D;  5C2Y A;  2YHE A;  3UM3 A;  4DLQ A;  1YMP A;  1H6P A;  3UIP C;  3DSW A;  3QKY A;  1BLX B;  3QDN A;  2IFU A;  3BEE A;  2KCV A;  3SGH A;  4LSZ E;  1K1A A;  3Q49 B;  3ZNG A;  3CR3 A;  4AY5 A;  3OTN A;  4GPK A;  3U64 A;  2XGM A;  5KJM A;  4TXP A;  4K5B A;  4GYO A;  3HVE A;  2Y0B G;  1N94 A;  1JCS A;  4CDR A;  4TXQ A;  1A17 A;  3G2S A;  2R5S A;  3FP3 A;  1D9S A;  2KM4 A;  3BUA A;  2AXU A;  2ETA A;  2FEZ A;  3NF1 A;  1FCH A;  4K5C A;  4CRW A;  5CBO A;  1BD8 A;  2RKK A;  1RW2 A;  2J07 A;  3FU5 A;  3WG7 E;  4GPM A;  2WXR A;  2UWJ G;  4H7Y A;  4ILI A;  2QY7 A;  4HLL A;  5CHE E;  2DZN A;  1DCE A;  3ZW3 A;  4JZY A;  5LCW C;  3UT8 A;  2WMN A;  1YYH A;  1MX4 A;  3GZ2 A;  2WXJ A;  2IQC A;  4Q94 A;  3RRU A;  1HF8 A;  5D0O D;  3PEV B;  3TG5 A;  1HG5 A;  3SBS A;  1S0P A;  4HLE A;  3IEG A;  3CST A;  2J49 A;  5B1B E;  3B7S A;  3D9L A;  3GZS A;  1HS6 A;  1OXJ A;  3KEA A;  4N3C A;  3TWT A;  5EID A;  3PE3 A;  3ZU7 B;  3CKB A;  3N71 A;  2IO3 C;  2BKK B;  4F6R D;  4OVU A;  4HB5 A;  4CT0 A;  3ONL A;  4DLO A;  4PS8 A;  3S7B A;  2QZA A;  4AJW A;  2XS1 A;  5ANL A;  3UTM A;  4FLB A;  2OOE A;  5ENQ D;  4MKT A;  3QOU A;  1XNF A;  3I5P A;  2XPI A;  2XEV A;  4C48 B;  4O60 A;  3EHR A;  1LD8 A;  5AJD A;  2GRP B;  3MCX A;  4FU3 A;  2YHC A;  4EPZ A;  5JJ7 A;  2CFZ A;  4O6F A;  4J8E A;  4GZ3 A;  1HXI A;  3FTW A;  1NI1 A;  1K3Z D;  2IO2 C;  1KT0 A;  2NC9 A;  4EBA G;  5KWD A;  1D8E A;  3MEK A;  4GMJ A;  1KZO A;  3U66 A;  2V5Q C;  4BFR A;  3AS5 A;  4E85 A;  5DIZ A;  2V4H C;  4G8L A;  1UN9 A;  1TN7 A;  5FZR A;  3AU5 A;  4Q69 A;  3DRA A;  5IY5 E;  1FVF A;  3VLD A;  5HKP A;  3GW4 A;  4FHK A;  1H2V C;  3TL5 A;  2CFU A;  1GW6 A;  2LSV A;  4BES A;  4A1S A;  4TV3 A;  3HG0 D;  4PUC A;  2P9P G;  1EPU A;  3ASD A;  3Q4A B;  3FUL A;  3L54 A;  3ULY A;  2KC7 A;  4AOF A;  1QNF A;  2WPV A;  3JQ1 A;  3FUI A;  4NUR A;  3OXF A;  3EU9 A;  3PUK A;  4JHJ A;  4MLP A;  3CKC A;  3W9F A;  1V54 E;  3LEW A;  3L13 A;  4YDW A;  2H6I A;  4DX5 D;  3CVQ A;  4UQY A;  3RSE G;  2PM7 A;  2L6B A;  4UWL A;  1KPS B;  3ZN3 A;  2CHX A;  2WVI A;  2ILR A;  3AAA C;  3TWS A;  1MJ0 A;  3HXB A;  2EQX A;  3T8K A;  3LY8 A;  3IXE A;  3KS2 A;  2LXM A;  5G04 C;  3D9N A;  5BUZ A;  3ZRH A;  4FAD A;  3CVU A;  5M72 A;  2J09 A;  2L9B A;  1SW6 A;  3P2B A;  2MYO A;  3NAW A;  4B8C B;  4GYW A;  3ZVV A;  4GTT A;  4G26 A;  5ENR D;  3ONK A;  4FA6 A;  2I6H A;  3BG1 B;  4RQI A;  3KAE A;  4LNB A;  3CHR A;  1ZBP A;  3FEY A;  2GRO B;  3SQV A;  1MX6 A;  3ULQ A;  4G23 A;  1PAQ A;  3PS6 A;  4DI4 A;  3D9O A;  4CT4 A;  2E0I A;  3QWW A;  2GGF A;  2IF4 A;  3DXM G;  1FT1 A;  2YQ8 A;  4L2L A;  3FFL A;  1U3C A;  2LXL A;  3CGH A;  1N4P A;  3DEP A;  3QAQ A;  1OT8 A;  3TWV A;  1WAO 1;  2XZD G;  2WXH A;  2V0P A;  2F0Y A;  3FU3 A;  5G55 A;  2X3M A;  1OWO A;  4N3B A;  2Q7F A;  4I6J A;  2J4D A;  2LSU A;  3VTY A;  4LG6 A;  3KD7 A;  5G05 C;  1O5M A;  5LCW J;  2PM6 A;  2CG3 A;  3TWU A;  1D8D A;  1S63 A;  2XGS A;  3D9J A;  3ZEF A;  4GA2 A;  3TXM A;  2FO7 A;  4URK A;  1ZB1 A;  1QQE A;  4BEP A;  1IYG A;  2BKG A;  5CCM A;  3TWX A;  4Z68 A;  1MHQ A;  4B94 A;  1HX8 A;  4HBD A;  2X6J A;  3RKV A;  2HO1 A;  2XCB A;  3LVR E;  3D3M A;  3JUE A;  1UG3 A;  4CCA A;  2KZT B;  5T8I A;  4MRU A;  2DZO A;  4FLH A;  3S2A A;  3UM0 A;  4PH4 B;  4C0M A;  1NFI E;  3NZS A;  3T5V A;  3EUV A;  2Y4U A;  3CIA A;  3UUX A;  2KXP C;  4ILG A;  3NOG D;  4QFV A;  5AJL A;  2X6K A;  1PC2 A;  3G2V A;  2XPY A;  4HNA D;  2LAI A;  1Z5S C;  3ZYL A;  2BF0 X;  3MYV A;  1O1R A;  1FT2 A;  1Z3X A;  4U96 D;  3CVL A;  2AXV A;  5FJY A;  1TYQ G;  3RO3 A;  2XRY A;  5KNG A;  1E8X A;  2P9N G;  4K03 A;  3JXJ A;  1NL4 A;  4FP7 A;  3RAU A;  2VTB B;  3D9P A;  4CYM D;  3V2O A;  4GCN A;  2VYI A;  4FJY A;  5BT1 A;  3RJV A;  2LUH A;  1NZN A;  4CZ2 D;  5BW8 C;  5E76 A;  3MKQ B;  4G8K A;  2WQH A;  2BTD A;  3C72 A;  4WUY A;  1JWF A;  2VSX E;  4N3A A;  1U2V G;  2L0I A;  1TNU A;  1E8Y A;  3UKU G;  3U3W A;  3FUM A;  4HI8 A;  3JCK C;  4I17 A;  4RG9 A;  4PS7 A;  3SZ7 A;  3DPD A;  3IV0 A;  1ELR A;  3PEU B;  4I6G A;  3ABK E;  2IOL A;  3I4G A;  2F8X K;  1OCZ E;  1YA0 A;  4DJA A;  3OXL A;  3PZ1 A;  3EHQ A;  3DXK G;  1LF8 A;  3FUH A;  4U95 D;  4U0U A;  3D9M A;  4OAU C;  2DVW A;  4RG6 A;  3R9A B;  3UM1 A;  4F3V A;  4KVM A;  4IUL A;  3BG0 B;  4I9C A;  3L08 A;  5EX0 A;  3D9H A;  4BET A;  2A5U A;  3VLE A;  1N9A A;  2EIK E;  5EN5 D;  4HVB A;  5KBA A;  2FI7 A;  1WY6 A;  2BED A;  4U04 A;  3T9K A;  3ZPJ A;  3ML8 A;  2ZIR A;  4JD2 G;  3PVL A;  3DBS A;  5G04 J;  2E2E A;  2RFM A;  2LNI A;  4GU5 A;  4I2Z A;  5KJL A;  2WXI A;  3Q73 A;  4IN3 B;  3ABL E;  3PNL B;  2IJG X;  4JW1 A;  2JLB A;  3IBE A;  3MZL B;  1A5E A;  4EZJ A;  4XZ4 A;  3IKO B;  2OEW A;  1OCC E;  4TUM A;  4MS6 A;  3D9K A;  4L2Y A;  5D0Q D;  4AIF A;  4ANX A;  2PQN A;  1EF1 C;  3MKR A;  4N5Q A;  4FHJ A;  4WAF A;  3U4T A;  2PZI A;  5JHB A;  3ASF A;  4DX7 D;  3QNK A;  4NAC A;  2FO1 E;  4FJZ A;  4KYO B;  4P29 A;  4DX2 A;  5FZQ A;  2ETC A;  3ZUV B;  4ZHB A;  1X5B A;  3LJ3 A;  2UY1 A;  3ZYK A;  2ZIS A;  4YVO A;  5G05 J;  4JB8 P;  4ACK A;  2LAH A;  3O48 A;  4CDM A;  3V79 K;  2XCC A;  2ZXW E;  3ZHE B;  3FTY A;  4J8D A;  2GRM A;  4YDO A;  3DWL G;  3FEX A;  2ZGG A;  2VGX A;  2DCP A;  2L0T B;  5KJK A;  2H6G A;  2KCK A;  5B1A E;  4GA0 A;  1N4S A;  3EJN A;  1LD7 A;  4G2V A;  1TN8 A;  4JVS A;  4J8S A;  2OCC E;  3PH0 C;  3KSL A;  4GMR A;  4JA7 A;  1AWC B;  4Y6C A;  4I6E A;  5T3R A;  3HIZ A;  5JMN D;  5J08 A;  3JQ0 A;  3QAR A;  2R59 A;  3TXN A;  5A6C A;  2OVB A;  4GZ5 A;  2IEJ A;  3OAW A;  3C3Q A;  3FU6 A;  5FWQ A;  3UKR G;  4U8Y D;  3GZ1 A;  5HS0 A;  3Q7F A;  4B89 A;  2EIN E;  2P9K G;  5EDS A;  3LCA A;  3ULE G;  3CQG B;  2WXK A;  2J08 A;  2J8S D;  4G11 A;  3HDX A;  2RG8 A;  3APC A;  1ELK A;  4XKB A;  3RRN B;  3MKQ A;  5KCM A;  2VSO E;  3ASO E;  4IYP A;  4MBG A;  1JWG A;  3LYA A;  1SA4 A;  1H0A A;  3V31 A;  4U63 A;  4AM9 A;  2XEH A;  4L9P A;  3QB2 A;  5T4Y A;  3AS4 A;  4DI3 A;  4NIK A;  4U7E B;  2EIM E;  3EHN A;  3FHE A;  1TNY A;  3UT4 A;  2DIW A;  1BI8 B;  4F1P A;  4EZK A;  2P9I G;  2DYS E;  5E75 A;  2OV8 A;  3T8M A;  4DK5 A;  4CGW A;  1X81 A;  4O1P A;  3PRE A;  3S7J A;  3MV2 B;  2C0M A;  1ELW A;  1E8Z A;  4EHM A;  5EIB E;  3LPZ A;  2Y1L E;  4IRU A;  1BI7 B;  2VSN A;  1UJJ A;  2A5E A;  4FC8 A;  5AQ7 A;  4XKC A;  1DC2 A;  3MGB A;  1O1S A;  1KT1 A;  4I1M A;  4JHR A;  1EDU A;  3AG4 E;  2FBN A;  5J90 A;  3PZ3 A;  4DUI A;  3P1U A;  3FTS A;  1IQR A;  3ENE A;  1N95 A;  4GZD A;  3B7T A;  1L5J A;  1VDY A;  4G24 A;  3MA5 A;  4GTS A;  3FY4 A;  2V4L A;  4EQF A;  4ME2 A;  3UXG A;  3HHM A;  1AP7 A;  2WB2 A;  2AWI A;  4XE0 A;  5H7P A;  3OXG A;  1FVH A;  4HFG A;  2GRL A;  4J8Y A;  1E96 B;  2WXM A;  4ATZ D;  3L82 A;  3PDN A;  2KAT A;  4LER A;  1N11 A;  1Y8M A;  1YCS B;  4L1B A;  4YVQ C;  3ABM E;  5ENN A;  3O4Z A;  4LCT A;  3TWQ A;  4Q96 A; 
#chains in the Genus database with same CATH homology
 3ISM C;  1RW2 A;  1Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...