1RWKA

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwkA00
1RHJA 1GQFA 2H65A 3D6MA 3E4CA 4QU9A 4QUAA 5I9BA 2C2KA 2HBZA 2QLFA 2XYPA 4EJFA 4PRYA 3GJQA 3SIRA 4AWAA 2CDRA 3D6FA 1RHKA 1I4OA 1NW9B 3DEJA 1SC4A 4HQRA 4PS1A 4EHNA 3K7EA 4JJ7A 2QLBA 3R5JA 2QL7A 1F9EA 3EDQA 4PS0A 1NMSA 3UO8B 4EHFA 3P4UA 1PYOA 4HQ0A 2XZTA 4N6OA 4AWBA 1QTNA 3H11B 4D3ZA 5JFTA 1SHJA 3V6MA 1I4EB 3DEKA 1SC3A 4NOMA 4EHHA 2C2OA 4FEAA 4HVAA 3EDRA 2CNOA 3QNWA 3ITNA 3UOAB 5LUBA 4NBKA 2XYHA 2QL5A 4D3XA 5IABA 4ZVQA 4QUDA 3KJQA 4EHKA 5IBPA 1SHLA 3IBFA 1RWWA 2C2MA 2J32A 4DCPA 3R5KA 4QUEA 2K7ZA 1NMQA 1K86A 5IC4A 1JXQA 3V55A 1KMCA 2FQQA 1RWKA 3R7SA 2FP3A 4ZVPA 1I3OA 1GFWA 4FDLA 5IAJA 3DEIA 4QU8A 4NOLA 3R6GA 4I1RA 3H0EA 1RWNA 4QUIA 2H51A 1RWMA 2HBQA 3V6LA 2NN3C 3KJNA 5IARA 1BMQA 5IASA 4IYRA 2Y0BA 2QLJA 2H4WA 2H48A 4QU0A 5IBRA 4D3YA 2XZDA 2CJXA 4EHLA 4QUJA 4QTYA 2CNKA 2CNNA 3GJRA 2AR9A 4JR0A 1SC1A 1K88A 2QL9A 5LU9A 3PD0A 4JJ8A 4ZVOA 4EHDA 2C2ZA 1RWVA 1F1JA 1RWXA 3PCXA 3P45A 1RHQA 1RE1A 2DKOA 2P2CA 4NOJA 4JQZA 5IC6A 3NKFA 3H13A 4FGUA 4LSZA 3V3KA 5K20A 4JR2A 3V4OA 4QUGA 1I51A 4AW9A 3R6LA 2FUNB 2J31A 3PD1A 4N6GA 5IAGA 3V4LA 1IBCA 1RHMA 1RHUA 4JB8A 1QDUA 4NBLA 3H1PA 4N7MA 4QULA 3D6HA 5IAKA 5IAEA 3NS7A 5LUAA 2J30A 4ZVUA 2C1EA 3IBCA 1PAUA 4NOKA 4ZVTA 2HBYA 5LU8A 3RJMA 2HBRA 3R7NA 4DCOA 4N7JA 5IANA 4JQYA 4QU5A 5H0IA 4JR1A 2CNLA 2H4YA 4M9RA 1QX3A 1RWOA 2CJYA 2H5IA 4IEFB 4ZVRA 4N5DA 4QTXA 3H11A 4ZVSA 4PRZA 3S8EA 1NMEA 1ICEA 4FXOA 1RWPA 3NR2A 3OD5A 1M72A 2XYGA 1CP3A 4N6NA 4JJEA 4EHAA 2H54A 5I9TA 1CVRA 2Y1LA 1RHRA 2WDPA 3S70A 4DCJA 5IBCA 4NBNA 3R7BA 3BIJA 2J33A 3KJFA 4QUBA 3GJTA 4I1PA 3DEHA 4QUHA 3SIPA 2H5JA 3GJSA
chains in the Genus database with same CATH superfamily
2HWXA 1DJPA 3GLHE 3E48A 1J20A 1NXVA 1L7PA 3GGCA 4YRJA 1Y4ZA 3DP7A 3L0ZA 4QUAA 5JDIA 4QLOA 2JBAA 2WUEA 1BE1A 2GZ1A 2YIMA 2Z98A 5K03A 4DA8A 3R7WB 5UKDA 4ENPA 4CF7A 1JYEA 1KAQA 4FZJA 1A2KC 2NGRA 2WK1A 3FCOA 4KCGA 2V7UA 5E7JA 3WICA 1FNSA 3DEJA 2RH8A 2OWEA 2WU0A 3WSVA 4DF3A 4DADA 4Q3BA 3RROA 1S9HA 2E4WA 1S0UA 2CFCA 1JDUA 4ROTA 2R87A 2JH3A 1ZITA 4JLMA 5EZ5A 1P2DA 3VTKA 1D2RA 4M7RA 5FF9A 4A8TA 3KUCA 1CQJB 1G8HA 4HDRA 4R3WA 3I32A 4D98A 1L4MA 1LWOA 4AKSA 3N3BC 1R6TA 3QX7A 5CM2Z 3M1AA 2NZVG 5H82A 2Q4EA 1I3NA 1IN7A 2LBPA 3KKZA 1ZGHA 3O0DA 4N0DA 3QF4B 4V03A 3AO0B 4G0MA 3EXIA 1I80A 3KU1A 1HRKA 3U81A 1QP0A 2O8EB 2X42A 4WZAB 3KQSA 3TW4A 1O6ZA 3CJTA 4X8LA 3BXOA 2FI1A 4PF1A 3OQVA 4I4TA 4CI9A 2XYVA 2WFZA 5JSHA 3SDZA 5E3HA 4ESHA 2K2QB 1EG7A 4X1KA 2PHZA 4JKYA 4RWEA 5ICEA 5B1SA 3UV3A 1W35A 3NCHA 2J6BA 1E2FA 2GEFA 1KJ9A 2M98A 3AZOA 4FYIA 4FT4A 4RXMA 3U16A 4OHYA 4TMKA 1WEHA 4TVKA 1A9XB 1JGTA 4FWBA 3JQFA 2AR9A 2GUWA 1MRZA 4G1FA 4NCIA 3MTGA 1CHNA 2X2PA 5AKGA 2INGX 4WESB 1JKJB 1Z35A 2GAIA 2RIRA 2X5JO 2BVNA 3BFPA 3RAJA 4E46A 3AC0A 2RI1A 3SE7A 3DLHA 1DAHA 1QFZA 2J3LA 2HIHA 1I6KA 4YIKA 3V80A 2ZIAA 2VQDA 1ZGBA 3ORHA 3QTBA 4N65A 4OQLA 2QSJA 1ISFA 5FA5A 1YZNA 4DTCA 3JAWA 3F5MA 2C78A 2ABWA 4HKTA 4G1UC 3HLKA 3MJTA 2EZ8A 2Q45A 2WJPA 4IWYA 4ZEVA 5KNBD 1JB1A 2C2BA 2BKXA 2IY8A 3PGXA 5HFNA 4D8UA 4GEGA 2Q2NA 4NMXB 2HRDA 2XA1A 5KNCH 3GJ0A 5D5HA 1SGWA 1JHXA 3GVHA 4NBVA 4R3NA 3HKBA 5A71A 4GW3A 1O57A 3ZDZB 4OKSA 3O8QB 3QOYA 1AV7A 4QULA 1CUJA 4WJKB 4CMJA 1WXEA 2AC4A 3AQIA 1CUFA 5C35A 1W5EA 4NX2A 3TDNA 4JJGA 5EUCA 4HEHA 1QF9A 1RIFA 4HH1A 1UEIA 4DM3A 1OCEA 1EM8A 3HKCB 3QEMB 4ZAGA 3JYPA 4OHXA 3DYIA 3NVDA 2G77B 1O97D 2VYVD 3FDXA 1A7AA 3OZIA 1D6MA 2QD3A 3PDCA 4JLUA 1GQQA 2FW8A 2OR3A 2PSDA 2CNWD 4AJ4A 1W36B 4PPGA 1W36C 4QEKA 3LDGA 3S68A 3NPMA 1U1GA 1MC4A 2CXSA 3HRKA 1WCIB 4X6XA 2X2FA 5FO0A 3F4KA 4IIHA 4DV3B 3OF5A 3EPHA 3MMNA 4HH4A 3DTYA 2LUOA 3S6JA 3UJ9A 3C15C 1GG5A 2DR0A 1RHJA 3HN6A 2FSGA 4FGJA 4ZU1X 4AY5A 2XE4A 4YJHB 3OEHA 1C30A 5EP4A 1T4CB 1C7ZA 1XD2A 3E4CA 2L42A 2CMFA 3TSOA 4YH1A 1YKSA 3QVOA 2P6PA 2IV3A 4R0MA 5JTTA 1E3JA 1MF7A 3ZE7A 1M34E 4UZSA 1ZD1A 3DDZX 3FYTA 4IJWA 4FJ0A 1QAQA 4A27A 1C3LA 3T4PA 2NXCA 4P9NA 5FL3A 1IAVA 3A1TA 5FEUA 1QTNA 1YFKA 2Q5LA 2C0PA 1U3FA 2I03A 1WB9A 1P1IA 4BJHB 3ZE0B 1SCBA 5HIKA 5IH3A 2P3LA 2R00C 2JVJA 3BCHA 3D0OA 3O8DA 5E3JA 1MVNA 1J56A 1XAJA 2C2OA 2VF4X 3FLBA 5EN4A 3YASA 5C1OA 1Y5IA 2Q50A 3PA8A 2REBA 5B5SA 3MUEA 4HAZA 1TGYA 3K94A 4TN1A 4REMA 4N40A 4QXRA 3I5YA 3FUCA 4LZWA 2G70A 3UJ8A 5AP9A 1SQGA 2BEJA 2LWIA 2OCKA 2RMKA 5ISMA 4JC4A 1L1QA 1I3OA 1KDVA 3U9SA 4BJ3A 3X43A 2OHOA 3GCGA 1BDBA 1J0DA 2HA2A 2WV7A 3CGGA 1T9BA 3SX4A 1CIVA 1QK4A 2WWIA 2Q3CA 5JMOA 2F2TA 5AOBA 5F3DA 3M4ZA 4FUQA 4HX2A 1MNAA 4MUYA 4OFBA 4ZOLF 5AKLA 2EL7A 4UARA 1PTKA 1QJCA 2XE6A 2PX8A 1Z7EA 2ZBPA 1PZMA 4FFMA 1GQSA 4GT1A 1SZCA 2IZ1A 16PKA 1U0JA 2YV2A 4XVQA 5KDLA 3ZC3A 4Q1BA 1CJVC 1BXRA 1YFJA 5T4EA 4GMFA 4BTEA 5I5GA 1AHPA 2BR5A 2GYUA 4W82A 4KBFA 5KAMA 1PZHA 1DDOA 1FMLA 3JAKB 5FX2A 4FN4A 4Z4CA 1MG5A 1JNYA 2E82A 1GRNA 3IPLA 1UOEA 3Q7SA 4YALA 4WOJA 1R12A 2XSZA 3ZBTA 2GEVA 2OLJA 3KL2A 4KXUA 5AVSA 1VQ1A 2GZMA 5IXYA 3C4QA 4MP6A 3Q3CA 2JAQA 3B20A 3GRUA 4QDOA 1GVHA 3VNAA 3FZYA 1HE8B 1WABA 3MFQA 3UVEA 3AR8A 4HNUA 2QGFA 4HXFB 4Q1DA 1JSXA 1AQUA 1L4LA 2XCIA 5DGDA 2W98A 3S40A 3V8EA 1UBCA 2DWQA 3JWPA 4ER6A 3NH9A 5BR8B 2R1TA 4DDWA 4LXIA 1XFDA 1F6DA 1L8OA 5AKZA 5A3VA 1L7BA 3O0TA 2R96A 2ONCA 4IUYA 2G4LA 5FBZA 2VHTA 4LXGA 2V7EA 3K0CC 1QH1B 2QRHA 3PHIA 2G1JA 4DYHA 5EINA 2WNSA 1Z9BA 1U9JA 4KR6A 1NBAA 1WVIA 2OLEA 1GCUA 4OXXA 3RJ5A 4AJEA 4EB0A 3DDOA 1IEXA 1RYEA 3ZJVA 3S70A 2V9ZA 3I45A 4NBRA 4EB8A 3Q9SA 2GPBA 3N0VA 4LJSA 3T3IA 3GJ8A 3K70B 2QQ0A 4IY1A 1ZNYA 4IIDA 4TLLB 1IH8A 3SLRA 2UUAB 4JVMA 5DTRA 3AFIA 3E84A 3FTPA 1T5LA 1QB8A 2BFFB 3F97A 4LA4A 4CM1A 5KVAA 4MVJH 5L4SA 5DM70 3ROEA 3U39A 1Z5UA 3DDHA 1Z75A 3EF3A 3L3BA 5EGNA 1XDBA 1SPBS 5EPOA 1XMOB 5FUWA 2ZTLA 4RELA 5B7NA 3W4JA 1RP1A 3R09A 3UGKA 3WE7A 1L7RA 1GSHA 3EDOA 2J5QA 1RJ9B 3N53A 2PWAA 4FFBB 4IFIA 1FYEA 4LRSB 1X13A 5C9ZA 3NT4A 4YJ3A 1N2CE 4WADA 2JHPA 1SURA 3V4SA 4N3AA 2OL4A 1RCFA 4BQQA 1BDHA 4I1YA 4CU2A 3GVPA 3KB6A 3U4GA 2WOOA 2VTVA 1Z82A 1IM2A 2GK3A 3ET5A 2ZRJA 4OH7A 1TTPB 1FFXB 2X40A 3EGXB 1FBNA 4DWVA 2VCYA 3C3YA 4X64B 2XYQA 2FMKA 2AOWA 2XSZD 2W2LA 1SQ6A 5BUZA 4AUKA 1U5BA 5CP8A 1VPWA 3IAM6 1FLVA 1OTHA 5COAA 5F3WB 1BN7A 2J3EA 3USCS 1L4KA 2VP9A 2P9YA 4I1RA 1JQ5A 2C2HA 4QFMA 2V7GA 1WQ4A 1RTTA 4NK5A 4YAEA 1SD5A 4YA6A 3ZDRA 4AX4A 3AXSA 1BG6A 4R31A 3SYMA 4F2PA 1M1XB 5J2TA 1JDBB 1RQPA 2HCJB 5T8KC 4NYMQ 5LWHA 1KYTA 2D06A 2MR6A 3O3CA 2SKDA 3GGSA 3PFHA 2VNHA 4QASA 5D3QA 5ER6A 1TVEA 5EMJA 4ZVKA 3TZCA 5K0ZA 2DLNA 2YRXA 1QTQA 1RKUA 1IL0A 1S02A 2A57A 2IXDA 2GXSA 2HRQA 3KT0A 2O8CB 1IB6A 2EYQA 1EX7A 4WASA 4R8RA 1MQ9A 1SCNE 5KU7A 3Q1KA 2ZJ6A 1Z2PX 4PLPA 1SG9A 3C3EA 5K8TA 1BE6A 3FGPA 4F3YA 1UJMA 5EYPB 3OPQA 3MWGA 1LSJA 4IHAA 4DIDA 5LQMA 2NTJA 1GTL1 2EX4A 3CRQA 2ZRMA 1XQVA 4GI1A 4GQIA 4R9VA 4BEBA 2VF5X 1NNSA 1NVDA 2NSDA 3TLYA 2VPTA 2N46A 2PMFA 5IAGA 3W4KA 3PXUA 1I4LD 4YCMA 2F55A 1S8NA 4KLZA 3F4BA 5A9RA 1EVKA 3F7TA 3OEYA 4CLRB 1G98A 3L9XA 4AJ9A 3VOTA 3QHAA 1Q2XA 3ZNOA 3VKHA 3ON5A 4H17A 4HDCA 1PZGA 2FPXA 3CJQA 4MV1A 1L9KA 3QPDA 5SZIA 1F2TA 4YP5A 2B5VA 2IBSA 5DGTA 1GKKA 4Z3DA 1N6PA 2V3CC 1CQIA 1CVLA 3TCXB 4P54A 3TW8A 1NI4A 1C3EA 3P27A 3QKTA 4DQUA 4O2AF 3AM3A 1GNRA 4ES6A 5EKDA 1AQNA 5E4FA 3EGIA 3DT6A 3OOEA 4GXTA 5KJ1A 3U3JA 1QG2A 1XXHB 4IXMA 5CAEA 1KMIY 3NBKA 1V11B 3D8RA 3FM9A 3TRFA 2FMXA 1GILA 5DBGA 4B6SA 2H4JA 2QUZA 3IV6A 2A7XA 4RHFA 3VO8A 1MZPA 2AJTA 4MRSA 4H1HA 4AYXA 3WLTA 1D6SA 4GSLA 1JFRA 5BSEA 3LLVA 2P5TB 5F23A 3RF7A 1YHNA 2F1OA 3LDAA 5JCXA 2XCQA 3JQPA 5AKYA 1OWLA 1IDN1 3O91A 3QOWA 4WHMA 3EVDA 3G0IA 2OBBA 1LNSA 4OBBA 3LBIA 4PO3X 5JJKA 5AKEA 2XDQB 5THKA 3I6BA 1O95D 2EKLA 3OFVA 2VYVA 4DA9A 2EWWA 2VJPA 5DYIA 1X1QA 4OOFA 1A9TA 5DXJA 3MS7A 1SUCA 1WETA 1IN1A 1P19A 2HU5A 4PG5A 1XRJA 1H6CA 4TQUS 4LZJA 1GZ5A 4LDAA 3IULA 3PNYA 1GZ4A 2CNOA 3CNQS 3QA9A 3QF7A 2OXFA 3H1BA 3RW9A 3HJFA 4Y67A 2NV6A 3P2OA 3PR3A 3AFHA 3KL4A 1JEQB 3R44A 3VTAA 4MR7B 3UHAA 5IDQA 1CZNA 1RPJA 3KB2A 4RGQA 3ZPXA 3ZTTA 2YOFA 1S01A 1WNFA 5M29A 1EFUA 1X86B 1DO8A 5ELMA 1I0ZA 1MEEA 3UC5A 3C6YA 2ERCA 1EEXB 3DTNA 1CK4A 4BKQA 2RB4A 4PN7A 1A9QA 1H1LB 4D80A 3M82A 2BGNA 3BM5A 3R9WA 1PTJC 1TT5A 3F1KA 1G5IA 4G01B 5AOVA 4L5IA 5A05A 4D0RA 3L6UA 5FPKA 2A9JA 2G6TA 2X2EA 3KKKA 3H3FA 1CRQA 2ZB3A 2AS0A 1NAHA 3GPCA 3R76A 1WL8A 3NEAA 4EG7A 5CDUA 2XRYA 2JCGA 1E6MA 3OLXA 2WBLC 4IIBA 3T5TA 3H5OA 1SUAA 3BXPA 4CIVA 4V0QA 5JXIA 5FNVA 2QM7A 4G67A 4BLPA 4C6SA 2GVNA 1GN9A 4LCEA 4Y98A 4ESOA 1H2ZA 4AF7A 2FN3A 1IBMB 1KBQA 4DLRA 4ZANA 1YOBA 1QJ4A 3E1GA 3N59A 3P45A 5AHRA 5IJXA 2DLCX 1TT7A 4N0QA 2IZ7A 3DZHA 2L69A 4WWHA 2WHPB 1EUQA 2BMAA 4IH4A 4AXBA 4HADA 2Q28A 2EFJA 1W0KA 4JN6B 4MR9A 1Q11A 4WTOA 3T61A 2Z8YM 5AVTA 2YVAA 1FNNA 3PD1A 2P2DA 5C18A 4FFLA 5AXAA 3QXJA 3DHNA 3KYBA 3QIAA 3AJAA 4BX3A 4DA6A 2BD0A 4M88A 4ZRNA 3LXRA 4WNAB 1TTQB 4AO6A 4GH5A 1SHUX 1FP4B 2O4UX 2AFIA 3LYAA 3LFHA 1ULUA 1RZVA 4P4UA 1TUGA 5CJPA 4Y2GA 2CJYA 3RUPA 5EWJB 2GJKA 3ST7A 5KCZA 4OLAA 1WE2A 3ILXA 2A58A 1DG3A 4IO0A 3IDQA 1OBVA 4TLDA 5IFKA 3GLVA 3QE2A 4OGLA 1B23P 1U1CA 4M1EA 3OKCA 4C6TB 4QO7A 2DPHA 4B9EA 4TTPA 4ZJYA 2XWPA 3OE7A 3T3EA 3K05A 4IRMA 1GKLA 3E1SA 1XA0A 4OQFA 5C3MA 1AQIA 3LY9A 1P9NA 2PTHA 4O0MA 3V8PA 2XMBA 3FG9A 1OU0A 4WKOA 1A5AB 3HLYA 4QELA 2IJGX 3BICA 5KYWB 4FFSA 3VNVA 2H3EA 3GRYA 2ZE5A 1MBZA 1MH9A 2EWMA 2X1LA 2XUQA 3TWOA 1CUWA 2ZVPX 3QI7A 4YY3B 1DRUA 3D3EA 4JB0A 4U39A 4ZQGA 4PZ9A 4RLFA 4DNQA 3WXBA 4CQLA 4MXDA 5GONB 2VCHA 1UMBA 3H9GA 4BO4A 3LPAA 5G0UA 4PS1A 1RI5A 5CA0F 1PS8A 4MGZR 2QU7A 4TLAA 4D8TA 2HI0A 5CMLA 3MK31 3KZNA 5CA0B 2A9PA 5KEIA 1ULHA 4BB0A 3IBGA 3IOBA 4NYJQ 1O0CA 1PQYA 4W6QA 1ZN7A 4V02A 1P0CA 2NO6A 4QDZA 1MAVA 2YCLA 2X8BA 1A4XA 1LI5A 2IYNA 4UHKA 2IDJA 3FSJX 3JZFA 2XIQA 3WO1A 1J24A 5KTMA 1G63A 1JG7A 1HETA 3Q2IA 2QLNA 5DLYA 3R8CA 2BTEA 2ZQZA 3ZVNA 2C54A 4J03A 4KAAA 2QRPA 5C5CA 1WXDA 3OMXA 4UD6A 5CTAA 1HI9A 3AY3A 3T7SA 3WQBA 4BKMA 3TKLA 5CVTA 3H3JA 3PBKA 3DKRA 4RKQA 3Q7IA 4A0GA 2EJBA 1KAGA 4Q4AA 4TGLA 4D9IA 4NPHA 4EKYA 1LWNA 3LL7A 2VDOB 4G4GA 3P9ZA 1BHJA 2WP8J 3IUNA 4H31A 4QU8A 4UVDA 2D7CA 2JCYA 2Q6VA 3NALA 4FYPA 2B2NA 3M34A 3MBIA 3PSHA 4JYBA 2FY8A 2QRKA 4XFDA 4A2WA 3PUZA 3S2UA 5B6JA 4AQYB 4RJIA 2I33A 5DHFA 5ICGA 3AXTA 2XYRA 2HD4A 2AZ4A 4G5HA 1PJTA 2QMYA 4XB2A 1QAMA 3QEJA 3K5WA 3TNDA 1P31A 3OCXA 1E64A 1C7FA 3NVMB 4PZ0A 4EUKA 3A2NA 1YR6A 2CUZA 5K3CA 1GPAA 1BRTA 2O0HA 3IEIA 1JHUA 2C2XA 2EKBA 3L8ZA 3KZCA 1JR3D 4JIMA 4P4GA 4B43A 2BGIA 1Y5MA 4M1QA 1EWRA 3TD2A 1ZJZA 2DMRA 2E48A 1DEAA 3JQCA 4UE3S 2D7DA 1YZHA 1D5CA 3GY0A 1I01A 3VPFA 2EHDA 3V2UA 2QW8A 4I19A 1HKHA 4XKJA 4RVDA 1AQYA 3ZXIA 3LOQA 3WV5A 4RLQA 2IIPA 1AF4A 4L07A 3OX4A 3L5KA 3PV0A 4EA7A 3ZJUA 1B2LA 2H1RA 4JP8A 1AGNA 1P5FA 5MN4A 2WPNA 3N0RA 2X0EA 3FVTA 2CK3D 3EXG2 3LU1A 1H8ED 3QBDA 4J0EA 1ZM2A 3QU5A 4MUAA 2P79A 2AYYA 4YUAA 5IT5A 4W5RA 1GEEA 1BS2A 4O4JA 2WY2D 1RM3A 1IDOA 3IOEA 4YAJA 4P1ZA 3LBNA 1R8QA 3GLFB 4LQ4A 4MRVA 1A1VA 1RRPA 2V59A 4JI3B 1XVTA 2AFHB 4IEFB 4CFZA 4JYCA 4ENSA 5ES4B 3U44B 5EY5B 2OC9A 5E1MA 4IGFA 2GRJA 2PJZA 2W4QA 4P3OA 4E2ZA 1T1EA 3BHMA 2VQ3A 1NZFA 3GWZA 5EUQB 1Q95A 1Z34A 3ZHCA 1D07A 1L1RA 1X7XB 2HAEA 4O4HF 4P3XA 3KPYA 5CW1A 5ELLA 1W5TA 1OHHA 4XR9A 2ZZKA 5TMBA 5JROA 2D59A 2OV3A 4E07A 3ENVA 1YS6A 3P9NA 2IXFA 3T41A 3JAMA 2UVQA 4JWKA 5EJ7A 2DTEA 2QJFA 3L2OB 3P96A 4IZHA 2B5OA 5JPDA 2Q46A 1CULC 4H1VA 2Z58A 4IZOA 4RE5A 5EMKA 2FLWA 3E6AA 3P1JA 4I2VA 5TPWA 3WGZA 1G0NA 1ESCA 2ECOA 2AT1A 5IVKA 4G1EB 4LC0A 4Q6WA 1MH1A 4PLTA 3GUVA 2BEVA 4DC0A 1U0RA 3B3QA 2EQAA 3BL6A 4Q12A 4RJKA 1XDUA 2JI7A 2Q9CA 5G0TA 2JGLA 5AVZA 1QFSA 2Q41A 3Q3EA 3TZBA 3HS3A 3I12A 4IV8A 1T9GR 1V5GA 1U2RA 2CXPA 1VYVA 4NMMA 5C31A 3SSOA 4MQ6A 2PD6A 3KUXA 3VKFA 1M2GA 2DBYA 2JFFA 2BYTA 4TWIA 4RDIA 3UK0A 2QEQA 1ACMA 3USES 1GD1O 3FUXA 4IDPA 4WCFC 4C1NA 2RHRA 4DXDA 4F86A 3ZGZA 6LDHA 2AFVA 2WWWA 1GNVA 1VYTA 2P3SA 2ZIVB 3UJ6A 3H04A 1OPXA 2KMLA 4REQB 3A37A 4U9HS 1X0XA 2ZP1A 4M83A 3RLIA 4NZYA 5IBPA 4ZARA 5TV2A 5K4GA 4LISA 1UAGA 3A6ZA 2QZPA 2IYRA 3R5KA 4I55B 4LHSA 3FLAA 3ESZA 3IQGX 4ZDJA 2QUAA 1ZVVA 2GEKA 2ACKA 3GEBA 2HDHA 4Y2RA 3C14C 2VUUA 1Z39A 2F8MA 3OU6A 3AJRA 4P7JA 1MA3A 1MORA 1UXOA 2G72A 2HFKA 3GHYA 2VC2B 1ENPA 2DUNA 5LQJA 3D7LA 1I1OA 1YL5A 1WHTB 1WUTA 3FPFA 2OUIA 2ZUBA 4ZMBA 3NHYA 5BYAA 3BEDA 3IQEA 4TKMA 2XUKA 3PFWO 5TSDA 1RMQA 1EZZA 1L5OA 1JQEA 1NFQA 2ZW9A 3Q3GE 3X1XA 4EY7A 5GTDA 3LKVA 4MYHA 3AVVA 1LTHR 1DCTA 1EWYA 1SOAA 1J0AA 5JWHA 4DEVA 3U80A 3QU2A 4ED9A 1GUAA 3M7IA 4AYTA 4C0XA 1J2EA 1PG0A 1QE3A 3EAGA 3C43A 3DEFA 3RH0A 3FUTA 4EYSA 4TMYA 4XLLA 1J2TA 2CE7A 1NXTA 1X0VA 4EITA 2O2DA 3GJXC 1KAHA 3RBZA 4XTCS 5H9VA 1Y34E 2ZDQA 2MSDB 4YYEA 3T8YA 1SCUB 5GINE 3T1YB 2CXQA 3K5HA 1OJ7A 2EW2A 1XO1A 3REQA 5T6BA 2QRMA 2YVKA 4DWOA 1RM5A 1WZEA 3QKUA 4N9QA 4RCYA 2ORVA 1YZ3A 3V1TC 4KEAA 2RONA 3AFNA 3N8HA 3A9UA 3BL5A 2I7XA 2R8EA 3CZ9A 4V0LA 5DI9A 3QVGA 1FNMA 1XI2A 5JD5A 3OIFA 2HQBA 3DLIA 3LHFA 4MRMB 1N8KA 3NO4A 4ZP1A 2O59A 5D8DA 3TKAA 2WJ3A 2QUJA 4OHFA 2B78A 2WAOA 5KJEA 4DKJA 2J87A 1SBQA 3CCBA 3IAEA 4KUGA 4F6RB 5J4KA 1F2UA 2JGRA 3OLQA 5EQDA 1QCYA 3EZ7A 5TEWA 4DR5B 1FX1A 5EIHA 2YQ4A 5HSGA 1GPDG 1NXXA 2JIZA 1QYVA 2O6LA 1G3MA 4JUAA 3NHLA 4E14A 1O9BA 1C9NA 2IF0A 3ABQB 3AK4A 1MN6A 5I9TA 5SV2A 3GFOA 3ZY4A 2ZYUX 4V2UA 4OHWA 3VPGA 4ZGWA 3R3WA 1Q74A 3CTMA 1CTQA 2XQKA 4R98A 1K6MA 3C5CA 2XGMA 3ZY2A 1PL0A 1DARA 2QX7A 2QXUA 3GMDA 3OPYA 3K6KA 5A9SB 1A8QA 4JKOA 5IBQA 3GH1A 2DE0X 3HY4A 4Q3OA 3L1VA 1K2WA 3V1KA 3HCDA 4NYJR 3W3AH 3WGJA 3ZOKA 2R8RA 1A9PA 4D7AA 4BRWA 2FR0A 4EARA 3H2ZA 2ZYRA 4C2UA 2FP4B 4OI2A 3ZS8A 5IT0A 2KPOA 3FHJA 3GT4A 5LZ7A 2P1ZA 3CZ4A 4ZREA 3PSAA 2FQYA 4X1YB 2QMQA 3PEFA 1KOJA 4GOJA 1VMKA 2I7VA 3VX3A 3STVA 3L0PA 3L5OA 5PNTA 2I9KA 3X1KA 2F9MA 1E0DA 3U7HB 3N2EA 4UBMA 2P91A 1M67A 3PT9A 5J2UA 4D3XA 1GU1A 2W93A 1G8GA 3L4EA 4AICA 4Z9FA 1P4HA 1L7OA 1KP9A 2O7SA 3LA6A 4MARA 4DIEA 4KW7A 4PYNA 2ZJAA 3KDSE 5HTOA 4P3YA 2JBAB 4GPZA 3HMQA 3LO8A 4DXHA 4M1YA 4L9WA 4YAGA 4QRHA 3FPSA 4LNAA 4O02B 2VSFA 2K7ZA 4WESA 4QFDA 1MNQA 3L0BA 2AJ8A 4G5SA 3SJAA 2QXTA 2IC5A 1M8KA 1P39A 3DUFB 4UUBA 3V8BA 3W2GA 3UHFA 1QNFA 3KPJA 3TMYA 2ZSBA 1OFVA 1EJBA 2AVDA 2ADFA 3MT0A 4KFRA 3AEKA 3OP4A 1EAMA 5I48A 1U2EA 3O8CA 4MI9A 1OPRA 1DCKA 4WN9A 3T4EA 1KVQA 1F0KA 2HLDA 1TADA 3UWOA 5E4JA 3WL4A 5C5EA 5IXSA 3KO8A 1QRTA 4H6WA 2DOKA 1Z4LA 1SNYA 4G4SP 5TE9A 1HPLA 1CZHA 2WA1A 3U40A 1CR1A 3WL6A 1E5LA 4EW2A 1V45E 3UK6A 3THOA 3WK5A 3OEEA 1PG2A 5CH8A 3LBAA 4UVHA 4F3RA 1KU0A 1XEXA 4ZJPA 4NG4A 1VMDA 2R1UA 2CLDX 3HCRA 1AY0A 1L5MA 1DQRA 1VE7A 5DHTA 1XN1A 5ALPA 3PNKA 3TOXA 1VHJA 4D92A 2DQYA 2H16A 3HKCA 3PCXA 3NLLA 1V5WA 1HGXA 4A9AA 5LQUA 5I3CA 4EY4A 1Z2CA 2Q5OA 3DKKA 4RFVA 4ZO4A 5C3UA 3IP8A 1SBYA 4ZQEA 5JT1A 3GV0A 2GZDA 3O1HB 4HXEB 3OFKA 4FLFA 2X6QA 3VKWA 4JU9A 4YRMA 4RTLA 3BZWA 3TNJA 1K3TA 3PJGA 1A7JA 2GCOA 4JQSA 4RHYA 1CCWA 1TPZA 1AUPA 3QZUA 2PGNA 3FSGA 3V46A 3U1TA 5B1HA 2FPSA 3MOGA 3M5PA 3WWZA 3WJAA 3WFZA 5L95A 1IM5A 1HC7A 1I2CA 3BK7A 3CMCO 5H8WA 4IVNA 4KI7A 5P8WA 1OZAA 1Z62A 2ZM6B 4BC1A 4BFYA 1F7UA 1JVNA 3GL9A 3Q8KA 1FPMA 2E49A 2J3MA 4LVUA 5ALOA 5FFNA 3H75A 3L79A 2XRFA 5EG5A 1S8FA 1JJAA 1AE1A 1O95C 2JLUA 1KY3A 1ML4A 3QY9A 1QBGA 5F78A 4KQ9A 4OB6A 9ABPA 1L5WA 5K0EA 2LV8A 5KCMA 3FFXA 1E1QD 1PR4A 4PC3A 1HDGO 3OUUA 4MJ7A 4TZKA 4OHPA 4GP7A 3TCKA 1WVMA 3LK6A 121PA 4I9GA 4XYEA 4RF5A 2JVKA 2W2XA 3W2EA 5KNLA 1G21A 1B6RA 1OE0A 4RZIA 3DE0X 4CLXA 3A3NA 3I58A 1YR1A 3PNLA 4WNCA 5A6SA 4K8RB 5TPZD 1YBVA 3I8SA 4QPDA 3SC4A 1JMVA 1GZDA 4BKPA 3GOHA 2DTDA 5TGTA 4F2DA 2C61A 3LQYA 2XBLA 3IT2A 4B7AA 4ZAFA 4B33A 3X44A 4YMHA 1UINA 1Z0SA 3DOEA 1NR7A 1YO6A 1HNNA 3NYIA 1U7XA 2XCOA 1TMOA 2ZVDA 4K1XA 4LQCA 5AM3A 1Y80A 4NYIR 3PC2A 1C3OA 4YCBA 2RFLA 4P31A 1HLGA 1HY3A 4OH1A 4BRZA 4DR6B 1H0HA 1N9GA 1MUUA 2RGWA 3MGBA 4QXAA 5A4KA 2XZOA 1N3LA 3U4CA 2X0NA 3E9EA 3HYTA 4D46A 2YV1A 5B58C 3U19A 1EK0A 5F1OA 2O8NA 2FSVC 1KEZA 1D03A 3O75A 1XTTA 2AN5A 1IXZA 3IEXA 3WYEA 2I9PA 2QRVA 1GPLA 1QG4A 3FCSB 2GN0A 2XY4A 3SR0A 4MVCA 3QMPA 4ZYYA 1C30B 2X22A 1UKYA 4ILKA 2FJ0A 3WLLA 1T1GA 2YHIA 2MWMA 2X7XA 5BNFA 1KFJB 4YT8A 5HBRA 1RXEA 5BO5A 4RTOA 1CP2A 4ER0A 3PVCA 3UWMA 4NCHA 3A4MA 2FOXA 1O54A 4ER3A 2OV2A 4UCXA 2AK3A 2PGAA 2XNSA 3AP1A 3HB0A 2NYRA 2WKQA 5I9NA 1C1DA 1YUNA 4DQDA 1O08A 3JAKA 2UYQA 3H2HA 4B2PA 4MYRA 5DSZA 3LWZA 3SBEA 3SCZA 4AP5A 4FXPA 1Y4AE 2P9TA 4RK7A 2XW6A 2X8LA 2R4QA 1SVOA 3ZE8A 1VIDA 2PH7A 1C9JA 1A5SB 1RE0A 1YIAA 4HNAA 2H48A 4FS8A 1E0AA 3QEMA 3V34A 5I01A 2ZIGA 5IJ9A 3G17A 5K09A 2MYUA 3ZLBA 1UUFA 2BI4A 3DVRX 3MRSA 4YJFB 3ZUGA 4AKGA 4NZZA 3Q4GA 1YV9A 1ADCA 1F0NA 3NKVA 1OY1A 1AKVA 4DV2B 2C0CA 3OFNA 1JBQA 4H1UA 1PWYE 1ADYA 3QMWA 5BURA 3AR7A 5REQA 3UK2A 4NOJA 4Y1RA 5CPFA 2H17A 2Z6QA 2R86A 5CT9A 5LQAA 5JAUA 1KO4A 1Z5NA 4FI3F 3WRXC 2O3SA 2C8JA 1VE9A 3PX2A 3ABSB 4AMBA 2LIPA 1R5OA 4JR2A 4JA2A 1PTJA 4OJTA 3K2QA 3M6XA 1VIMA 4JGGA 4Q47A 5EIFA 2ECFA 2P68A 1GLGA 3CEMA 1DMRA 2MCFA 5JS2A 3B7PA 4L3OA 2CYAA 1R0RE 4DSZA 1E98A 3VR6A 4BWVA 4BLWA 1ULTA 4X65B 3WKAA 1Z22A 3WDSA 3ZHTA 3DP9A 3WGUA 4HI0E 1VCOA 5SZJA 1R66A 4RPCA 5IZCA 2WM9B 4F4JA 1NPYA 2I5PO 3JZAA 1RQGA 4OHMA 3RS2A 1GU0A 2YS6A 4F45A 5C46F 1UQRA 1SXJA 1Y3CE 4YMLA 1IMJA 5F2KA 5JVDF 2FRXA 1LQTA 1RRKA 4PYIA 4TS3A 2UZ0A 1K8YB 3JWIA 4G8JA 2BOVA 1JW9B 1TZBA 1M1NA 3ZHUA 3DR5A 2EIHA 3ANYB 5CVEA 4MHOA 4EHAA 4BGDA 5M3BA 4E4YA 1NN1A 4W8HA 2YOGA 4CEHB 1D2AA 3QIVA 3HJBA 1F8YA 3KJZA 4PZDA 5DH9A 3HYRA 5I7AA 3WRVA 4DJ5X 2ACWA 3BSSA 3U1BA 1X7GA 3UMRA 2HB6A 1E18A 2R1TB 2D4HA 1QV7A 2GBLA 2BGWA 5KWJA 2QY9A 4TXHA 2H2FA 3G2PA 1K5GA 2L0XA 2BPOA 3PQ7A 4BNTA 4C5BA 4BVKA 4BO9A 2BH9A 2SCUB 1XK6A 1RYZA 2J0EA 4LQDA 4UHBA 4BNGA 1NVUQ 2PO7A 2QWXA 5I6DA 4JOQA 1IHOA 1L4UA 4JENA 1QIFA 3KIPA 1Y7IA 5FORA 2X2OA 4M8IA 2FLKA 2WF5A 3SR4A 2JJ1D 4BMSA 5KB3A 5L7TA 4HPXB 5JIBA 2WSYB 4QOFA 3UAYA 4S2EA 3W5CA 1FVHA 1R6AA 1SG0A 2HCTA 3B1FA 3K0HA 3CNEA 3F9RA 3QBTA 4I6EA 4ZPJA 2YDYA 3CLSD 3TTWA 4B6RA 1DU4A 2BFFA 4G1BA 4Q9IA 1HBJA 5JMPA 1KO1A 4EF6A 4CMAA 2ZRKA 1GFSA 1GPJA 5D5PA 3J81A 4YCSA 4U7GA 3DEYX 3KAJA 2RCNA 3KKEA 4H4DA 3RS0A 4HFNA 2BEUA 2W6ZA 4XE5A 3OBIA 4C0LA 5D6OA 3ICWA 1MC8A 3WGQA 5CB4A 5JNSA 4L78A 4A6XA 2YWCA 4ZVNA 2FR8C 1IVNA 2ZDGA 4IQ8A 2EF1A 3H0EA 3NBQA 4X5OA 5FLEX 1MTOA 3MINA 2VK1A 2ZU6A 5H02A 3BZBA 5HXAA 1JWAB 3HWWA 4YI3A 1XZQA 5TEVA 5KJCA 3FHTA 1BMQA 2RB5A 5EHGA 2AV6A 4MQFB 1HWYA 2QTNA 3C6MA 4YI5A 3MB5A 2GRAA 2VSXA 3DC7A 1NQTA 2WIBA 2GUGA 4GZMA 2D0DA 5DF1A 3ICCA 1N5JA 4IRUB 5LU9A 1WG8A 4LZNA 4X7RA 2V1XA 3BBPA 1NLMA 4BQNA 3KNZA 4YRZA 2AJLI 3OHPA 4ZOLA 4JT8A 5LN1A 2GSWA 3OQPA 4CT0A 3M5WA 4YHHB 4A23A 1NJFA 3AL3A 4L1KA 1IBSA 5DU2A 2NU7A 2GI4A 3H1GA 1JKFA 2QTBA 3PFCA 4H35A 5J43A 4K26A 3D3WA 3MINB 3PUWA 2QE6A 4LWZA 1QHGA 5CM8B 3SVTA 1NE2A 2EERA 3ER9A 1P81A 2P2SA 5KOHA 1T1IA 4DGSA 1UZMA 3MF4A 4NABA 2ZAIA 2D00A 3G8AA 5U1PA 4BB6A 3HCPA 4GPBA 1DWUA 3IA7A 3NS7A 5DTEA 2A4KA 1CE8B 2QN2A 2VRCD 1ZC4A 1X7ZA 4TRRA 4V0RA 3UK1A 4BN0A 4CIXA 2GZHA 4W99A 2HBRA 5LIRA 5CM9C 4OLBA 2QTVB 4M9ZA 5EFZA 2CJFA 4G0UA 3VJRA 4FYXA 4QDXA 4UMEA 1LTQA 2HO5A 5EIAA 5FUVA 2O23A 1OH7A 1SIWA 3AR6A 3OD5A 4QATA 1AQLA 2Q1UA 4HGYA 3RSCA 4E5UA 1ZL0A 3IE1A 3RYCA 2R68A 4J3FA 1RHRA 2CBXA 2LDBA 4HG2A 4LPKA 1RR6A 1PLJA 1DG9A 4EUFA 3AUTA 4X0EA 3WYGA 1BD3A 5JCJD 1AK2A 4C3ZA 2NTEA 4X66B 3KOYA 3V7UA 1CWUA 1U0TA 5LP6A 4B83A 5JQGF 3RVNA 3FIUA 1U5BB 2W6CX 3TL3A 1KJNA 2ERYA 5CFZA 3L6BA 3U7QB 2WJ4A 1U0EA 3ESXA 2VP5A 2C2KA 1JZTA 4PYKA 1F5NA 4HH3C 3VZDA 3PGKA 5BRAA 2GBCA 3S7TA 2PYIA 2DERA 2H0QA 3QJGA 4BRUA 1O97C 2PL3A 1UC4B 4JLDA 2PD3A 2V7QA 3PL1A 4AFNA 5B30A 2A9OA 5FBVB 2ZYWX 2JJ1A 2O52A 3GJ7A 4UCWA 1DC8A 2C57A 2FMHA 4BXOB 2Z6VA 4FP9A 2Q7XA 3L0CA 4FFDA 1XSEA 1D8TA 2BKAA 4CR7A 4DABA 2JAXA 4NU8X 5G2OA 1X7HA 3IEVA 4K9PA 5CPBA 1DIRA 2RAVA 3NDIA 4AN1A 1WUJS 4IF6A 4Q7QA 3N7AA 4TKUA 3E0XA 5LOVF 4S1TA 4X7BA 4UAGA 5F3RA 5A7FA 4OXKA 1UWVA 3A1SA 2XKJE 4Z7OB 5C37A 4ZALA 1H22A 3QJ5A 4N01A 2IOHA 3CLKA 5K4HA 2H1FA 3X2EA 4EYOA 2ZIUB 2ZJZA 3RLFA 1NQVA 1ZCBA 3CLTD 5L45A 4MQBA 1NJGA 2ZSKA 4DIOA 1SUWA 4EBBA 2O9JA 4KVFA 1C4WA 3ZDYB 5HKBA 5DFAA 2H51A 4JCOA 4ON9A 1BFUA 1FP2A 3AY7A 1N5KA 3DE3X 4WD3A 3U4IA 2VSOA 5AJXA 4DPLA 3M2TA 2ZSAA 1DPFA 1PKEA 2CDCA 1J70A 2VZ0A 2W58A 3LDFA 4QNMA 3PEWA 4C0JA 2EBHX 5SYNA 4OK6A 1GZHB 4YCNA 4XWYA 5KZMB 4QBHA 1Y8RB 4Y0VA 4EP1A 4LJLA 3FPGA 1YA8A 2Z2YA 2ENWA 5HR5A 5B55A 2YWEA 3BJIC 2ZE6A 4LXXA 4S05A 1W25A 5JVDA 2FMFA 4FT2A 2IHVA 3L82B 3VR5D 2Y0EA 3DPIA 2BRUC 5CEFA 4A8PA 2NXWA 1YA6A 1U2DC 3AHIA 1EQUA 4LMPA 1LVGA 1LI7A 2P69A 1DJOA 1AZSC 2XF8A 3DULA 3GUUA 2BFNA 3UMCA 5MDHA 1GGFA 2WG0A 1P6XA 3B9RA 5SYMA 3I4FA 4EA8A 4LK3A 3GLIA 3NBZC 2FPOA 3MIIA 3TR0A 2HWUA 1VTKA 1XZIA 2RHJA 4OP1A 5AQ1A 2GKGA 4DNXA 2YN0A 2RCYA 3N8NA 3R0VA 2HHAA 4GVPA 3GOQA 3FCCA 5AI6A 4B3GA 1CJUC 1MX9A 3TEJA 3P32A 5DHSA 1TYCA 3DV2A 3LDUA 5KYVA 1RZRA 1N0UA 4BGEA 1F9AA 1C1XB 4JI6B 3TLBA 1QX3A 2VJLA 3JYNA 1BROA 3FDIA 1XD8A 3EOBI 3KSBC 3F71A 4M0KA 4PRZA 1UMBB 1ZUIA 3PDJA 2X0FA 1U3DA 2WHPA 2YWRA 3X1WA 5B3JC 3RRNA 1N4AA 1NOIA 3ZYCA 3TQIA 2WM8A 4DCGA 3HU5A 5IHPA 1P4GA 4BY9E 1TQDA 2DUJA 1XZKA 3EA4A 4PFSA 3QPBA 2WF9A 5A0TA 3T3MB 2PMBA 3KLPX 3VDMA 1KFEB 1XU7A 2WD8A 2X6RA 5AM1A 2G9QA 3ULKA 3H84A 2XUIA 2JAUA 2GJSA 3WNBA 3H6KA 4IEEA 4LWQA 4KP7A 2WINI 2G4VA 3DJFA 1H1LA 4E2YA 1NF8A 1KJWA 3ONEA 1J8DA 3FRHA 4AS3A 3TQHA 1DKNA 1ZD4A 3CSUA 3I0ZA 2VHUA 3K73O 1Q20A 3WK9A 1FFDA 2QPOA 1GNPA 4YAWA 5TQ2A 1A88A 1FRQA 3CT6A 1E1RD 1Z0UA 3Q7EA 4II7A 2DPXA 4J7XA 4R2IA 2P27A 2RK6A 3CU5A 4NIMA 2BKUA 4KKVA 2DH5A 1WMAA 1ZBDA 3M9LA 4Y2SA 3DMTC 4RHXA 5FTMA 3OZCA 5I8WA 1SQ5A 4OXNA 1ORTA 5H59A 3TUZC 4R7ZA 2PUEA 1Y4UA 2HA0A 3KP1A 1T36A 2WJHA 3AUFA 2PSSA 1W75A 2N42A 1KMMA 1TVCA 3DOFA 1Z6TA 3DYVA 4HYEA 3ORSA 4WLNA 1R0XA 3TZLA 3ECSA 4BO1A 1AXGA 2Z0MA 3LZDA 4DCPA 4JQCA 5JZBA 4TS9A 5AJWA 2QAIA 2R6ZA 2XVZA 4D82A 1SUIA 2C3YA 4BNDB 1KEWA 4JEIA 5ADWA 2DQKA 1ZGZA 2ZCUA 3LC0A 1N6LA 1XTZA 3QXSA 4Q3LA 4R69A 2JLWA 2DULA 1N32B 4OA5A 3RYFA 4BPBA 4NEGA 1Z5VA 3NNNA 4AECA 1P73A 5HCUA 4AMYA 3CGWA 1YMQA 3FUUA 4AG6A 5B7GA 2P5YA 5K0FA 1PK7A 1PNOA 1RVDA 3GUYA 2KLBA 3COVA 2WMNB 1E1QA 4HNGA 3U9TA 1H69A 1HDEA 4Q21A 4OREX 4V1CA 2HU2A 1PJ4A 4GGMX 3URMA 1ITZA 1GPNA 1PRYA 1PCXA 3QGMA 1HL7A 4WCVA 2QGNA 3UQYS 4BO3A 3E3OA 4NNJA 3EYWA 4AQ7A 1P7CA 2OKCA 4MR8A 4RM3A 4UE2A 3D7NA 1P1FA 4PPYA 1T9AA 5FUBA 1RI1A 3N2GA 4Q4AB 2A0KA 3K16A 3WZLA 3OP1A 4JBHA 4Z7JA 1W7AA 1E1CA 4OL9A 5CVVA 3CG4A 4HNSA 5KX5A 1I1QB 2E37A 4XEHA 5L3ZA 2W43A 4U02A 3RUDA 3MW8A 2OGUA 4PICA 2G7MC 4NF2A 3G6WA 4QXQA 3WADA 3DL7A 3LRXA 3ZWOA 3OG9A 2JANA 3VO2A 1U94A 4MIOA 2C29D 3AHHA 4NV0A 4TRJA 1RHMA 2BBTA 3VR2A 4V1CB 2VG8A 3DZFA 4LGMA 4PQGA 4YUWA 1P9LA 2O7RA 2RGCA 2QYSA 3FAKA 4FDAA 4HTFB 4IJQA 5BQOA 1EHIA 1XRQA 4U3JB 4XUGB 5BSWA 2W2TA 3VZCA 5FFFA 5CX1B 4QARA 4URWR 3CHYA 4N8EA 5FL7A 5CA0A 3WYDA 1OWNA 3BMNA 2V58A 2ZIXA 2NXEA 5B4VA 1QGDA 2W6IA 3IS3A 3FRJA 4FMDB 3TVYA 1FNDA 1MGOA 4YT2A 4MGIR 4MW9A 5J58A 1KI3A 2GHRA 3GPIA 1HOXA 3PKJA 1CUGA 1LZKA 4LS3A 4YXWA 4BQEA 2A9KA 1B8NA 1G4AE 3WMXA 4OTZA 1DQYA 4FCWA 4XM0A 4U2FA 1FVFA 2WMDA 3GGPA 3UOWA 4CM9D 4L6AA 1DAFA 1MW8X 4HTFA 1AK1A 2Y9PB 4LJ8A 4UBOA 4GKKB 13PKA 2FSUA 1TM4E 5AJVB 1P2FA 1T3GA 3GRFA 1GU7A 2C83A 3OKAA 3GLQA 4FQ5A 4HQNA 3NYRA 4MS3A 4OXIA 4EO9A 1N75A 1G8FA 4N8DA 1DKMA 2I78A 2IITA 4J0DA 4CHTA 5HZGA 1WDLA 2NVBA 4UQPA 2NAPA 3A1WA 1G5HA 1XT6A 1B16A 1VE5A 3CMMA 3G5LA 3L8DA 3PXBA 3KEMA 4PRYA 5T8KA 3G9QA 5JFOA 2D74A 2HW8A 3CS3A 4Q7KA 3K0FA 3TJMA 1LPSA 5AD1A 4KQFA 3EVAA 1BFDA 4S1OA 3WGOA 2FMUA 1SC9A 3AR2A 1B0PA 3L84A 4K9KA 1R4MB 4J0FA 3DL2A 5BN1A 4NFYA 4F71A 3IBSA 1E6KA 4L8YA 2C4MA 1HQCA 1NW8A 2IHYA 1UC8A 3KAQA 3DDSA 4IS2A 4IKPA 3RYHB 4ASUD 1VL5A 2BFWA 3WYCA 4LBZA 5MGBA 1KO7A 2EP5A 3OPYI 4GM0A 4KIUA 3QG5A 2GARA 2QHXA 1ATZA 3IPXA 1CYDA 4AJPA 3G2HA 3LRTA 4NFSA 1THZA 3V55A 3VR3D 4GZLA 4E1AA 1A5TA 1JG3A 2GNAA 4ZDIA 2PV7A 4HB2A 1PGJA 4LZPA 4QBGB 3UUWA 4GPIB 1FSZA 5H16A 1BJKA 1UKZA 3BK1A 3EWNA 3N8DA 2WABA 4RD3A 1CR6A 1YBMA 1SCUA 4HOYA 5FJIA 3GBVA 4N3NA 3TTTA 2J41A 1NVEA 3IMKA 3IODA 3JQ6A 1UPBA 2ZKIA 3E3NA 3IIIA 3B12A 4RZUA 3W1WA 4PLFA 5A4DA 1EM6A 5K05A 3C0KA 1KPHA 2P41A 3R4VA 3JRNA 5AQEA 6AT1A 3LZCA 1K0UA 1JWLA 3B3GA 2ZITA 2FSIA 1IWOA 1Z0AA 3THRA 1I4DD 2QMZA 5C53B 1NP3A 2CNKA 2O5RA 2Q99A 3KJGA 3K5PA 4GMGA 2Q5QA 4A15A 3IAXA 4ZRDA 1LPMA 1T2UA 2GTIA 3KE8A 3TO5A 3OZ7A 4WBSA 4ATNA 1K6EA 1DWPA 2C3PA 2D13A 1Y81A 2WUGA 4R41A 5G1PA 1KY2A 3RSQA 5AVYA 5IT9A 2BZ1A 3T9EA 1Z68A 4G09A 2HEGA 3OY2A 2IF2A 3JQRA 4ZKEA 5T3YA 4BNZA 5C8ZA 3ZV3A 3ZHOA 3KG2A 3V3KA 4F97A 4ENTA 2QN6A 2X23A 4MV0A 2HPHA 4WE3A 5B7PA 5HZHA 5IJWA 5JC1A 2HA4A 4M99A 4LCJA 5EZYB 5AXBA 3SQDA 3CVYA 2UYCA 4O2AB 3Q3HA 1J6UA 2JGDB 2GETA 4G5GA 2BSAA 1CR4A 2Q29A 1L8AA 1HNWB 4KIGA 2IH2A 1K98A 3E8XA 1E3EA 1U2QA 1PJRA 3P2IA 4I5EA 4EKGA 4Z53A 2JJYA 5DNCA 3FYUC 4XH9B 3CKKA 3FZEA 1S3SA 4GX5A 4MQ4A 2ZRNA 3WGIA 2JLXA 2J08A 2OO3A 2H5IA 4BNWA 1UWKA 4WGGA 4YLGA 4F06A 2MIIA 3TG8A 4US1R 4Y3UA 1FS6A 1OVMA 3WTCA 1PEDA 1RJDA 3A0UA 1Q3TA 3GEMA 2C9DA 2AMFA 1TRHA 2JA1A 2V6IA 1TGVA 1PZXA 4GBJA 2ZJ0A 2CLSA 1QG0A 4N6NA 5FJJA 3REQB 3UFXA 4DNFA 2VBFA 4RK0A 3MJFA 5CLJA 1WY7A 2X0IA 3OWXA 1QYXA 2HUNA 2YWHA 1AKYA 1P1JA 5LMNB 1S4QA 2GWRA 3H1EA 4X7MA 4RHUA 3TBHA 3WIVA 3R75A 1ZHFA 3QVUA 5LBTA 2P2YA 2XTMA 3PX3A 3K1AA 2B7CA 1RT9A 1L4EA 2Q9UA 1QPZA 1NP6A 2R84A 2RGRA 4Z4FA 4MYSA 3BXXA 3EGCA 3B9QA 1O89A 2HK7A 2Q9BA 3IPCA 3JQGB 1I4OA 2PUGA 2ZWPA 2JRCA 2XGOA 4U2BA 4WNIA 3L07A 2ES4A 2J45A 3SZGA 5LKAA 2ZANA 2LZ0A 3ZHZA 1BE8A 2HA5A 1EBBA 4ZMSA 4G97A 1M1YA 1SVIA 2A3NA 4CCAA 4QGSA 4UPEA 2XMRA 2WAYA 4GBED 5I7SA 1ZMXA 2ZAMA 1A7KA 1HYBA 1AQ6A 1JU4A 3OPYB 3M1YA 3Q41A 3LTNC 3QFRA 1VJ5A 5BXQC 1E4OA 2NVWA 1XNRB 5LZ4A 1VE6A 4P81A 2XWJI 4Q03A 1VP9A 3A7DA 3R7WA 1U0FA 3RABA 1NLYA 2ZT8A 4MW1A 2C31A 3U6KA 1XKQA 3HSKA 1P0PA 2O7QA 2WKSA 3AVQA 5DXAA 4JY7A 2DT5A 3ZY6A 4AZWA 4ZGGA 3E9YA 3R7SA 4W6ZA 3KJIA 4GMHA 1OAAA 1YZKA 4ZHSA 3EAFA 4JIGA 1EE9A 2NZUG 4BWFB 3VDXA 1AGXA 1TU3A 4P3PA 4FJ2A 4LGYA 3UAZA 5G02A 4MLZA 4IDQA 3JU3A 1BGWA 1TUIA 4RZ3A 1BCSA 1FNBA 2VEOA 3KX2A 5K99A 3PPYA 5TY0A 3UHOA 4LZZA 1QTRA 3IUQA 2QUBA 1EUDA 2RAUA 3DHEA 1AXEA 1C14A 1QKJA 3IB3A 4QTTB 5DLDA 1XZJA 5HVNA 1H4SA 2F4VB 5HK8A 3UT5B 3WB1A 5DTMA 5A04A 4A0QA 1RLUA 4MUEA 3LY7A 4DM7A 2CL0X 4JBIA 4LTMA 5TT1A 5CITA 1X7WA 2E85A 1GPWB 1E9EA 2DSTA 2DFKB 4KWTA 4HUQB 1CUYA 4RD4A 5A62A 3UTCA 2F8SA 2JF0A 1C7JA 2X19A 2MMCA 4L28A 2IP4A 3VR2D 5ILOA 4TZ0A 4NS1A 2HTEA 3ZDXB 2QRLA 3X1MA 4BO8A 4BVHA 2PFGA 2A94A 2IP1A 1TEZA 3S2EA 3KZOA 1WJGA 3DFUA 2G88A 4E33A 3SX0A 3ECCA 2WHQA 1YRWA 3KQTA 3VRHA 1JE0A 3MGKA 4C4ZA 3ZWWA 1AMUA 2LKDA 3QQ5A 2CL7X 1PVVA 2OFPA 4U7PB 2IV7A 3REFA 5LZ2A 1XYYA 2PXCA 4UD2A 3KFLA 4CF3A 1S1CA 1HYHA 4XX1A 3CN7A 1W2GA 5LCXA 3NEPX 4A0SA 1YQDA 2BIFA 3EC1A 1A8IA 2Y6UA 4JP5A 2QTTA 1NBMD 1Z5PA 1GVNB 3JAWB 4QNNA 3OT1B 1ES9A 3FHLA 3F90A 2WFLB 4EVQA 4LX0A 2JEZA 2XF2A 3JY6A 3NT5A 4HDRB 5ICCA 1NJ1A 4FKBA 4PAQA 4J76A 2OAEA 1YULA 5F5XA 4U1RA 1ZJ4A 3MXTA 2JG3A 3NTXA 1UK8A 3ZCUA 2UVDA 3KU4A 3HM2A 4C4OA 1WV1A 2O54A 1H9BA 1PJLA 1MPXA 4K86A 2C8VA 4D8YA 5BSFA 2AN1A 2NZYA 3DLAA 3TH5A 5A3RA 2Z56A 3IKJA 1H6AA 3QW2A 4O4LF 1ZCJA 3R9XB 1ECLA 3GDHA 1PLKA 2EEZA 3LJKA 4RDCA 5CIQA 3T3GA 3E70C 3V32A 2AOTB 2VYND 4LHVA 1OBHA 1ZA2A 5BT9A 1QGZA 5KDOA 1Q1EA 1Y42X 2WFLA 3K2BA 3O8OB 4OB8A 2GN4A 3WWCA 1OC4A 5TQ0B 3EVBA 4JJ7A 2FGKA 1EH5A 3C70A 4K1LA 5BUCA 4AO7A 2W2PA 3I05A 3AM4A 2A1TS 2ILVA 1OWPA 2PS9A 3DMTA 2G76A 3DMHA 4B32A 1IBKB 4RHTA 1ZUD1 2X13A 3H18A 1ZN9A 3EDRA 3E15A 3QU4A 4TKZA 4PVCA 1JQDA 3UUEA 1RW4A 1SXHA 1HTTA 1Z2EA 2P9ZA 4ZZIA 4OO3A 2WWTA 5F64A 3WRXA 3OLVA 2V9PA 4DVGA 1ZNZA 4GI2A 4A2CA 4MRRA 1PSZA 4RBNA 3I64A 4YJFA 1UR5A 1EXVA 1W4CA 4AMZA 3F2VA 4C08A 3Q8LA 5FBHA 2BMFA 3RTAA 1EFRA 5ALGA 3U9LA 1XQ1A 2OZLB 3NDPA 5JSZB 2X58A 2XA2A 1U1FA 3BMOA 3EGOA 3NT2A 1CC1S 5B53A 5BYJA 4BHTA 2FFJA 2BDEA 4IDHA 3B6KA 3O38A 4S1VA 5T6MA 5CCEA 3FKSA 1S2LA 1JFFA 1YRQA 4LGCA 5HQ3A 3NDRA 4N49A 2A0WA 3D6JA 1ETUA 4LMBA 3UN1A 5TRTA 3CH5A 1M34A 5D84A 4RTRA 4XCXA 4W9MC 5COQA 1AT1A 4FPXA 4JELA 3LOUA 1KDTA 4RV4A 4MWOA 3DOJA 4YWHA 1QM5A 2B3DA 3AUSA 4Q1EA 3I42A 3ZHVA 1PSDA 2OZLA 1B0AA 1RWXA 2R7NA 3GN2A 3TQRA 5KUTA 1SXQA 4UVEA 3ETCA 3EZNA 3NKFA 1E3TA 3GLUA 3Q9UA 5BUSA 1CF4A 1XEWY 3G5UA 5F7JA 3F6CA 1XV5A 1QK5A 2QTCA 3HNOA 4GLOA 5DGCA 4AW9A 3C3AA 2J31A 1WZNA 2FSSA 2OORC 3EH1A 3GO4A 4HDNB 3WGLA 3ZWPA 4EEZA 2VPPA 1GADO 2ZK7A 2OY0A 5FTLA 2X5XA 4J29A 3F9CA 3VR5H 1PR0A 2QW0X 3B1WA 1NT4A 4BMVA 1OAKA 3ZWNA 4ZDKA 4G07A 1FFCA 4KO2S 5TNXA 4YRAA 1ZOSA 1R37A 4W7HA 1LD3A 2PPVA 5CEJA 4JR1A 5CCBA 1PN3A 2JFOA 4OYRA 1UT8A 2CD7A 3SG0A 3T34A 2O4CA 4ZVSA 4JI7B 1P8JA 4HMQA 4UC0A 4PLYA 1J33A 4UHHA 4YMGA 3A6JA 1JT9A 3F1LA 2ZVQX 4KXVA 5H4GA 5C4GB 1WY5A 4NCNA 4RZSA 3E22B 2FUG6 1PT7A 1QIIA 3SK0A 1BEZA 1A96A 2E1PA 1GZ3A 2LVBA 3IIEA 1HEUA 1KHHA 1TEVA 2R1VA 3AY0A 3VC2A 4DYDA 2Z6AA 1ZVJA 2JFNA 4OGFA 4X3OA 2FPIB 2YWFA 2OCBA 4M9UA 2XQIA 2ZIWB 1LF5A 1R74A 4P82A 4BX0A 3BT7A 4K6CA 5C5IA 1YR7A 2VJDA 3CWZA 3RC1A 4L9RA 3FTEA 1TIBA 1T5SA 1OFTA 1QVVA 3FCYA 3HE3A 3KVYA 3NBAA 3NB0A 4NCXA 1RKBA 4XD7A 5HPYB 1Q0TA 2RK4A 1HH4A 4HK4A 3PE6A 4KOAA 5IEJA 3JARB 3RBVA 3G68A 4JV5B 3I28A 1DIAA 4OMCA 4PSCA 4YDHB 4BKOA 3HFSA 2NP7A 1YQ9A 4B0OA 3NHRA 2ZYDA 5AUPB 4W4TA 4KU4A 5B37A 2FPRA 1L8QA 1IHUA 1L4NA 3PUHA 4ZCIA 3KZMA 3SEAA 4KUHA 3UAXA 3VBEA 3UT0A 5BSKA 1CKEA 1UPUA 3RR2A 5J2TB 4K88A 2OAQ1 1JEJA 2OV4A 3ITNA 1USKA 2FX5A 4GC5A 4G86A 4MQFA 4NDNE 1Z7BA 1BIFA 4HO1X 4NULA 4TXJA 5JV5A 4MKFA 3B6ZA 1EA7A 5ARDA 5EHQA 4LSGA 3SKXA 3AHJA 4CDNA 4WFQA 5B2FA 2W83A 2O48X 1ZW6A 2VWQA 4EZIA 1NXOA 2ZT7A 3W7BA 4H0NA 2I7DA 3I9FA 4HAWA 1UF9A 4YGYA 5NLLA 1V5FA 3ZTWA 1R4NB 4QHSA 4DG5A 1Q84A 3F74A 2E18A 3OKPA 3I2IA 1CG6A 1DEXA 3FX2A 3UAOA 3HCWA 3LP8A 3P9CA 4CM9A 3G89A 3JV7A 3VZSA 4C0AC 1R9NA 2RGDA 1AKMA 1MOQA 1VCIA 1DHRA 5DE3A 2B35A 1Z26A 3ZVRA 3CT4A 3SEQA 1Q16A 3S1LA 1GRCA 5AMXA 3W78A 3HUFA 4MUFA 4DLYA 4F1JA 1TLFA 2DT8A 5E8RA 2EJVA 2B1JA 1FBTA 4CKYA 1H2HA 2Q5IA 1P7YA 5DM0A 2QS9A 1I0LA 4ARZA 3JZMA 4NAHA 4CMIB 1O0BA 4FYJA 1A4UA 1LI4A 1M1UA 4OV6B 4CCYB 5CXQA 4D26A 3DXYA 3FFAA 3H5VA 4PHTA 4GPEA 5FLKA 1D0SA 2G9UA 3CEHA 3WDLA 4ABTA 1W46A 3VR0A 2Z1MA 1CQIB 2Q7OE 1QVWA 3MAGA 3AFOA 3RFCA 5CA1A 5JSQA 4IL5A 3JD2A 1N34B 4IVQA 3WLEA 4BN4A 3Q9LA 4LI0A 2WSBA 1U7HA 1GGJA 1SELA 2QNRA 3UJDA 1DJLA 1D2HA 3ZDQA 4FOLA 4MUBA 4MKXA 3GMTA 5AW8A 1T3ZA 1SR8A 2CDBA 3K2EA 1E9CA 3SYTA 2H1HA 4KSYA 1GG8A 1YR8A 2BFOA 5TF0A 4QC2A 2O20A 1UT5A 5T5QA 5G40A 2NUBA 2D8MA 1ZH8A 3A1UA 4ABYA 1FTWA 4B3BA 2A2ZA 4ETNA 3AUYA 3GD5A 4ZOAA 3KVVA 5DGIA 3IVXA 3RGWS 5A4AA 2FA9A 2ZTUA 4BFCA 1CY7A 3OF3A 2NACA 3V4RA 1GJRA 1REQA 3ZGOA 4F8EA 3ZGYA 1ADGA 3AUJB 3HY3A 1GOTA 3FTQA 4IS3A 4KX3A 4LRYA 1DC5A 3OIDA 2VF7A 1Y9ZA 2IH4A 1NATA 3TQCA 3R1IA 4PXYA 3QE9Y 1I3CA 2NVUA 3NHPA 3AJEA 3NETA 3WWOA 4CKWB 1W6UA 4P4NA 3D4LA 3SHFA 2FZGA 5GZ6A 7ADHA 3OTGA 4GX0A 4MUMA 3JQAA 3ZZNA 2R2AA 2PK3A 3BE5A 3NUZA 4X1OA 1SJ9A 2BEUB 1KP2A 5AHKA 2WQ6A 4YPVA 2I2CA 1ODKA 5E6SA 3ZNQA 3C39A 5B36A 2ZJ5A 1YNSA 3GMIA 2PLRA 1DIGA 2AMJA 2FKNA 2PPLA 4D74A 3GJQA 4FX2A 4C7OB 2PBRA 3I92A 3G1UA 4F6LA 3OBBA 1SC4A 1DAIA 4OSEA 1YS4A 4CWAA 1ZXXA 2WAAA 3D0KA 2ZXUA 1U1EA 1FXWA 5MN5A 1PYOA 1PJ2A 4OU4A 4GRIA 2ZSUA 5LA6F 5T64A 2RKBA 4EG3A 3OUZA 4HEA6 5DASA 3R20A 4HVAA 4AJHA 1J1UA 2PBLA 5KAPA 4NJEB 3AETA 4M1TA 4NAVA 4RIIA 3BDVA 2L18A 2W5UA 4WKGA 3TSYA 2P4SA 1T15A 4JXJA 5IXJA 2C2MA 3EVGA 9ATCA 2I2WA 2NU7B 3U31A 4XR4A 3O74A 3SY8A 3VZRA 4DMLA 1RTKA 5BVHB 1LY1A 5ECYA 4D4IA 3AY6A 1PKXA 3C6XA 4BP9A 1YGYA 2X5NA 3A9VA 3P9KA 4DCCA 1LCIA 1CZRA 4H1WA 4HDSA 4NOLA 5AK5A 3GAZA 4KK4A 3VOBA 3DG9A 2YINC 5F1KA 4RPGA 4GBMA 1K8ZB 1NL3A 2ZBEA 3I2KA 2D1SA 1FTSA 1DRVA 1I1HA 1JVSA 2FEKA 3KJNA 1Z0DA 1TXGA 3MSXA 2VQ6A 4PLHA 4UHJA 1PL7A 1SM4A 1ZJYA 2QVCA 3B52X 4Q4HB 4MVWA 4D4MA 3C7CB 8ATCA 1QFYA 2XXAA 3A26A 2CSUA 1SXJD 3IRVA 4PG4A 1W85B 2D1YA 4QDUA 1E79A 3DBIA 4TWRA 4FGLA 1TUBA 4D9HA 5M34A 1EGMB 1JJVA 2TMGA 1OXVA 3V5NA 4J0HA 2O3QA 3LGSA 2BMJA 4L50A 4V3BA 3SC2A 3B48A 4EL5A 3CNNA 1L6RA 3K9FC 1E3SA 1VGVA 4YIHA 2NPFA 4OD0A 4BQIA 5JXGA 2WNIA 3HJAA 2AFRA 1JALA 1L7NA 2A88A 2WT4A 4DRYA 2X86A 3R6LA 3AU8A 4REOA 4IGEA 2QORA 2QMOA 3QLTA 4F8JA 2QD2A 4HS9A 4R8VA 4TTJA 2OB2A 1EB8A 2ZRGA 4M46A 1KQPA 4W1QA 5C1BA 3BORA 4UXIA 2R11A 3VC3A 2VSNA 4PIPA 2E0IA 1JXOA 4EAAA 2OBXA 4L15A 4DBZA 4V1CI 2PZMA 4P2BA 5KYWA 3SZLA 1V1RB 3O03A 3QYPA 5CA1F 1C9MA 3V3TA 5AM2A 1RQXA 3HA7A 3MJHA 3W04A 3M49A 1TK9A 3MAJA 3TECE 1ENZA 3WR5A 3ETGA 5JDCA 4KGVA 3UM9A 2ZT5A 2XCTB 2OV6A 4DJTA 2UXDB 1TNDA 2XKBA 3DGFC 1W1UA 5GJBA 1J1IA 4Y9UA 1RPZA 1XZ8A 2YMMA 1O7JA 4UUQA 1Y7LA 2YZKA 3AF5A 5HILA 4I99A 5CNIA 3CCCA 4DN6A 2ZREA 1ACJA 4MCJA 3TK1A 4GPAA 5FWDA 3QLUA 3C8HA 3EZ6A 1KL7A 4B6GA 4MR7A 2JHFA 1QV6A 2ZJBA 1K5PA 3EUWA 4B6QA 1F2VA 4LVCA 4OKIA 3CW9A 3LXMA 3N5CA 3RVLA 4WZZA 4BMCA 4UJ3A 3KYJB 4QGGA 2O57A 1I36A 1JNXX 3GRAA 4AIIA 5FWXB 2N1MA 1DBPA 4P92A 4ZTUB 3NBXX 3PNMA 1F14A 4B3HA 1KSJA 4KQGA 1S7CA 2RG7A 4O25A 1NW4A 4NKRA 1JH8A 2JIZD 2Z8XA 4Y2QA 2BTQB 1E3IA 2H9YA 4ND5A 5ALNA 4B17A 1I1NA 1U1IA 3MWYW 3VGPA 4RF2A 1MV8A 2W6JA 2KQUA 2PKQP 3PGA1 3CF6R 2ZR9A 4CM6A 2W6OA 5E9WA 2I4OA 2XT9A 2RBGA 4K03A 1KYVA 4RV9A 4DQLA 3S99A 1O5IA 2FW7A 4I1IA 4ZKDA 5L7WA 2BBSA 4UOQA 1EGQA 4B79A 4B8WA 3ZHSA 3R77A 5EMHA 3KHKA 5H4HA 221PA 1B3RA 2Q4OA 2E6KA 2Z4SA 1UAYA 2W9XA 3OQIB 2IYVA 2R66A 4OQZA 4A0RA 4AMUA 3N8GA 1T3SA 5E9QA 1EVLA 5B12A 1SOWA 1WOMA 2YWDA 2HXSA 2YCBA 1KI7A 1S2OA 1TMKA 1JAIA 1ZONA 4GAEA 4KWCA 5DLEA 5B3AA 3W6OA 3LPCA 2OXRA 4G89A 2FRDC 4HMPA 1L4BA 4KQWA 5JCJA 3PE4A 2MOKA 4C7XA 4IIUA 4B71A 2FG6C 1VL1A 4PZLA 1ZO8A 1E1MA 1WSDA 4YBZA 2GDJA 2UZ3A 5D5QA 2WVGA 3ZV4A 3EY9A 2JLCA 3BD7A 4KLAA 4YJ2B 2OBFA 4KXLA 4RU1A 4CKCB 2GBPA 1DQZA 1Y0BA 1TCUA 2XZDA 3ZD9A 4MUGA 4DMUB 3ZOZA 3WMFA 5EE1A 4DV6B 4DREA 2BFEA 3A4VA 4BUZA 4J6FA 3BF8A 2CSXA 1BU8A 3F78A 1NVTA 3SR3A 1P5HA 4IOMA 4U3JA 2HRCA 4KAJA 5DBOA 5DMHA 4W9NC 4MVYA 1IE3A 4PHHA 3DBHA 1JLKA 2PJDA 4QL3A 3S1AB 4BTLA 1IJFA 1K9SA 1HTBA 4JQZA 5HUHA 3PYXA 4C3OB 2GLTA 4LNUB 3BKWA 3GCZA 1X19A 3EZGA 1GP2A 3NP9A 2GN8A 1NNEA 3NAQA 1TLTA 1H2YA 3AUXA 4UEOA 1Y3AA 3KDPA 1R0SA 5LYYA 1NBEA 3VDRA 1J0XO 4ZK2A 3PNVA 1N6NA 4ZOCA 3P9YA 1JJ7A 1ZD2P 1KS9A 1TUEA 1M3SA 2J0VA 4F7WA 2OHFA 3CVUA 4LSMA 4BVFA 1M73E 3EFHA 1B00A 4AUNA 4ZZ3A 2I6UA 2ZSDA 1O6BA 3GFBA 4OA8A 1UOOA 1PWEA 2VTEA 4F5DA 4MB0A 4FX5A 5CHEA 5K45A 2GHQA 3OOJA 1B15A 3CPEA 4J2OA 2GXAA 1NMXA 2QTFA 4RA6B 4RVUA 2O1SA 3Q8MA 1VLMA 4KN8A 1G4HA 3K0FB 2DFLA 4BGIA 2W0MA 2HKIA 2QIPA 2VJMB 4LF4B 4TTIA 1Y5NA 4H7HA 3LL4A 5IDYA 3DXFA 3HI6A 3QXHA 1TZ2A 3GGJA 2O0JA 1KXZA 1PNTA 5L6LB 3FJYA 4NBTA 1JFSA 1Z8HA 4IF4A 2P67A 3V33A 2LXNA 2VL7A 4E2FA 4FQ8A 4EJSB 4PCUA 1LDEA 4P0PB 2QMUA 3V42A 1E3LA 4Q7EA 1RRMA 4TKVB 4IMIB 4BU1A 4CTOA 4ER5A 3RC9A 1X7DA 1I7LA 1QH8A 3AHEA 1GPYA 5KC8A 3F7NA 1RC0A 1YHZA 4L4UA 1GITA 5EE9A 1TB4A 2H59A 4P5EA 1JAZA 1K9VF 2WJZB 4EB6A 4BPRA 5L51A 1Y1PA 2QVBA 1DFGA 2XUPA 1QVRA 3CRMA 1PYGA 2J59A 4AWBA 3OECA 2GLUA 1A0OA 2VUTA 1UT6A 4GR5A 4RMNA 3TZHA 2RGAA 2YWXA 1J9EA 1ZD9A 3EA5A 1NRWA 2BE7A 1KVSA 3GA5A 3LAWA 3LFTA 3VVBA 1B8VA 2JZCA 4KIFA 3EQ8A 5AM0A 3AL2A 621PA 5FKJA 1KFCB 5HG0A 4LXYA 2I2FA 3R5FA 5EWLB 2EL9A 2ONKA 1CIJA 2TYSB 4CL8A 4F5WA 5EA2A 3LQ2A 1O6GA 1PR9A 3K8ZA 4G0OA 2BEVB 4R8LA 4CM3A 5KC9A 2BHRA 2JK0A 3K9HA 3PJRA 1HL3A 2GK6A 5KX5F 3C3KA 3LVFO 3PC8A 3OQOA 4OJYA 2RAPA 1Z06A 3BHIA 3PRYA 2B34A 2R5WA 2CBGA 1BH6A 1XTSA 1M0EA 3IALA 2Y1CA 2O1EA 2PH5A 1O77A 4OQQA 3T1OA 2PLNA 2H18A 1Y1KE 1N7IA 3UXMA 1APBA 3M6FA 3V8VA 2WC1A 4P32A 2F59A 4KN9S 4YRCA 5EFOA 4AG3A 3H1TA 2O06A 1PR3A 2VVTA 4HWSA 4J0IA 3HCOA 1EFVB 4Q19A 5B3JA 3VYUB 4D6YA 5F35A 2YXEA 4XWGA 3LLSA 1SG6A 3FOFC 1YQGA 4N18A 4I9HA 3HHPA 4WBXC 2Q1WA 3QVGB 4MRMA 1JHZA 3WHIA 1H1DA 2YYAA 2F9LA 1RQLA 1BQEA 1RYHA 3P7MA 4QBFA 1YTUA 5L3SB 1P7PA 2UKDA 4RZHA 3RSGA 3N1UA 1W59A 2VHJA 3BIWA 2J4DA 5JY1A 1ZIXA 4FGUA 3LH5A 5A5FA 3N2KA 1L5ZA 4W1RA 4X7PA 2A7QA 3TSCA 5JQGA 5KSZA 5I51A 3H9QA 4CLOA 1QHHA 5LDHA 1JX6A 2XZPA 4KRGA 4EFDA 1C7QA 2QSUA 3K9NA 2I4TA 2OBLA 3N0WA 3NVAA 3OH8A 1T5IA 3RE1A 1YB7A 1RVV1 4DUGA 5JNLA 4C30A 1EFTA 1NG1A 3T0GA 4LDNA 4L9AA 2FK7A 4JDUA 2J30A 3ESBA 1GFIA 1EU1A 3EVFA 3H05A 1BDJA 1LQUA 3TTXA 3IAM1 3Q72A 4QO8A 1V5IA 2W6NA 1E2PA 4HWPA 2OMEA 3P9IA 2O2GA 4UUOA 4EFKA 4FTWA 4LHEA 2IU6A 2BDTA 4J7CA 1FJ2A 3D4BA 3WLAA 3MYYA 1R4MA 2QLMA 3VHQA 3DMYA 1JVBA 2G04A 3PVSA 4CV2A 2GHIA 4M1WA 5EJ9A 3BXHA 3BSFA 3Q88A 1Y9JA 3ZJYA 3LX5A 1JPNA 1OXKB 2WZCA 2HNAA 3ZYZA 4BUJA 5KQRA 1NBWB 4K46A 3RD5A 4OHZA 3W6NA 2DKNA 4IXDA 3OJLA 4LX8A 1E2BA 4D3FA 2QNIA 3FWYA 1OF1A 3D1JA 4ALIA 1KP3A 4FOSA 4QDJA 3GJSA 5K8IA 2IYXA 2QSZA 2BKVA 2OB1A 4BNKA 3VNUA 1GR0A 2FCRA 4ZQBA 3WDKA 3T7DA 2Q3HA 2J9XB 3A2LA 4E5DA 3TLXA 2XODA 4PAWA 4AKHA 3NHMA 4OXRA 3EMVA 3Q15C 5THQA 1TI7A 3D6FA 1S9DA 3CVJA 4JVLA 1HUQA 3C1TA 3CSSA 4OI4A 3RREA 1ZINA 1ZI6A 2UZ4A 1BVHA 3PCRB 4LV6A 3BMQB 1GLVA 1T4DA 2JFWA 4KE8A 4NDAA 4DR2B 2FW6A 1GXSA 2GPNA 3D7MA 3N07A 3JALA 5FUQA 1ZK3A 4G81A 2CV2A 1K7SN 2QQGA 4P7GA 2ZUEA 3SWWA 1D4ZA 2JAWA 3ZTYA 1E8MA 3BKXA 3HG7A 4R1LA 4NBKA 4W7SA 1RI4A 4D8WA 1DINA 1YHYA 4Y2TA 1ENOA 3I30X 3OU2A 1DBRA 3MOIA 4YO8A 2JLQA 3ZE2B 2C5FA 1XEWX 5KYTA 1IY0A 1E2GA 4N39A 4U63A 3ND5A 5DHPA 3AESA 5IC4A 3KOWA 2WP0A 3M70A 1JDTA 2AG0A 4RJLA 3TNYA 5LJLA 1RWKA 3LE8A 2GTPA 3ADOA 4HZUB 3AVPA 5TPZA 4FDLA 3SYNA 1G7SA 4LJ6A 5HS4A 3IMCA 3L43A 1WA5A 4XYBA 4YTEA 1UXGA 1WKBA 3TS1A 5BWLA 3NHBA 3QKSA 2G5CA 4DDKA 1OLOA 4A7PA 3MELA 3WL3A 1V7PC 3IPAA 2PGIA 1OHHD 4C0QC 1NONA 2PUJA 3W3AD 4OBEA 2IDKA 3BDAA 4KN6A 2YW2A 5PGMA 1E2JA 1Q0RA 2IGBA 3QF4A 4BLOA 4F6RA 5CFRA 3CFYA 3H5LA 4G1CA 1FF9A 1US8A 2QUHA 4R40A 4EJSC 1T5BA 2B1IA 2ODTX 1YA4A 4NNOA 1AF7A 5DBFA 3WGYA 3S2FA 2PE5A 4QYWA 4WY2A 3LRPA 1XTKA 4HEA1 1FU7A 4M89A 4IHJF 2PUDA 2DPMA 3DAGA 2H08A 4BV8A 1N2ZA 3DEAA 4WXPA 3UJPA 1NTRA 3AMVA 2HX1A 2DH6A 3P0EA 5AI8A 3P5SA 3F9IA 3LUJA 4Z49A 2AX4A 3JR7A 3BQMB 3SICE 1ZAYA 3PFFA 3UK7A 3LLCA 5CLLA 5JNRA 3NJ4A 1W1WA 3GVCA 4X95A 4HFMA 2JJ8A 5BN4B 4D42A 1FE8A 2OT3B 4MPPA 2HADA 3GFVA 3SHWA 3KQMA 3E5MA 5KYYB 3ID6C 3QVSA 4MV3A 2CHGA 3BEOA 2RHGB 2YY6A 1BMTA 1JR3A 3N0XA 1TK2A 3C6KA 4E5VA 4P3KA 1TTHA 3C1UA 5AFSA 3CISA 2HYIC 4RCVA 2NXNA 3IVMA 5FYDA 4D4HA 1Y6RA 5ESWA 1U28A 3F5QA 3WK7A 3VKVA 3UHJA 2CCKA 1LA2A 2G0AA 4BO6A 2HNBA 2XT0A 3O90A 3OTHA 3OQMA 1ZM9A 4YDSA 5FLYA 4IGKA 1E5VA 2WHYA 1KY4A 1P2GA 3UB4A 4DMGA 3ZI4A 4EMTA 3P9QA 2RHHA 1JQJC 2A8YA 5DM1A 2ZIEA 3HDGA 1C1HA 3GYBA 3K6RA 2H11A 4Y18A 4XSGA 3DUFA 3CWCA 3U13A 2ZRPA 3RASA 3WRWA 2EQ5A 2CEAA 2E4YA 2XMZA 4AWAA 1MO2A 4ZHQA 2WSMA 4BMPB 1EINA 2DF8A 1PFWA 2ZSIA 2ZRAA 2B4YA 3KXLA 3NGLA 4OHOA 4L5JA 1OI2A 1U3VA 2JFUA 1CZKA 2ZI7A 2OK7A 5ITWA 2HK6A 2RGNA 4CTMA 3PNQA 4GYYA 1CNEA 3VNRA 3VYVA 1VPLA 2QLLA 1ZM7A 2VHXA 2PSJA 1NSTA 1D2GA 1YCHA 1SD1A 2IYSA 2JHAA 2Z2IA 4HWRA 4I4NA 4P8RA 4TTSA 4H59A 5EOVA 1NIJA 2HTFA 3O8LA 3DB1A 8GPBA 4KYTA 1FXSA 1FXUA 2C7RA 1KI4A 4DY6A 4O5AA 4BIMA 4D6XA 1KKUA 1TAQA 4AY2A 1KFBB 5B6PA 1KK3A 1OX5A 3V9AA 2CF6A 4XWAA 1ISMA 3WLQA 1N2CB 2D1FA 3VMMA 4DGQA 3CR3C 4KXFB 4S3MA 1MABA 4FU0A 2X9NA 5D7NA 3RIEA 3H83A 1P8AA 1ZIOA 2P6OA 4B7ZA 4FSHA 2AG6A 4BL5A 4DLSA 1NUTA 1WDKA 1HT1E 4EGQA 5DNYB 1GL3A 3VI4B 4A1FA 2JLYA 2PV0A 4PZYA 2YYYA 4H4EA 3FLMA 3L93A 2VH2A 5KOJA 2E5WA 2VS1A 4UEQA 1FRVA 3ZD8A 1WMDA 1U0SY 2AJDA 2QD4A 3GZNB 3NHFA 4FFNA 2OLKA 4OQMA 5C8YA 1Z3CA 4MWTA 5AVXA 1ZR4A 1N2CA 3CUYA 4BNMA 4I6GA 3GLGA 1XDSA 5DX1A 5DTJA 1L5QA 3NRBA 4G0XA 5KO2A 1F3LA 5GIPE 2VBGA 2O2JA 3IDFA 3MT8A 4TRMA 4X94A 5CR9A 1JQ3A 1USIA 1RHQA 2C99A 4GRDA 5IS2A 1EFLA 1DBIA 2FRDA 2JFQA 3HU1A 1R8XA 1CUAA 3AHGA 5AK6A 5EXPA 4OGWA 1FJHA 2DPLA 5SY4A 3RK1A 4D3DA 1L3BA 1TEHA 3V4OA 1SU8A 1XJCA 2QTMA 3B6MA 4GZ5A 4OFWA 3UMFA 1FP7A 1DBQA 2O14A 4J1SA 2NV0A 4LHXA 5IAEA 5BMOA 2DKFA 2I1LA 4CRWB 1I24A 3HA5A 4KXMA 1UM9B 2AW5A 3CN9A 5HF8A 1ZNXA 5K3BA 4DMMA 1E6UA 3E3MA 1NLZA 3NXKA 5G4KB 1JDPA 1C3OB 1FSSA 2G4CA 5TMDA 1DI0A 1K2VN 5EHZA 3IB6A 3EB9A 3SXPA 4PO1A 2ZPAA 3P0JA 4M60A 3VHXB 2BZ0A 3QUQA 2OQ2A 2J3DA 4A6EA 1IPEA 4DPMA 4IIJA 1XHEA 4HSEA 5GPBA 3GXBA 1LDYA 2J5RA 4M9XA 5KI6A 2M9MA 3DZDA 1OGYA 3OCCA 4QYXA 2ZULA 4TQGA 2WU4A 3N05A 3NRCA 5D1NA 5IBCA 1RKXA 1U7TA 3G8YA 3I8OA 2PUCA 1A9ZA 4LF8B 3C5HA 1YKGA 3OO1A 4DCSA 3PGLA 1H9CA 1UFVA 1W34A 1R2QA 1Q6YA 1IN5A 3CUTA 5KKAA 3W5SA 1FUIA 2OK8A 2CF5A 3CKYA 4RFSB 5I4CA 1H0KA 7MDHA 2MSEB 4K9RA 4XUEA 5LSAA 3G0GA 1OH6A 3PX7A 3B1JA 5LBIA 2OE2A 1B1AA 2CCGA 3W77A 2YJTD 2ZUFA 1C4XA 2QP3A 2M6KA 1Q19A 1XZFA 4AZ3A 2HC9A 4QDKA 3FZQA 4BLQA 2GM3A 3RVJA 2HJVA 3D8NA 4ZV9A 5FLXA 3OCWA 2ZI9A 1JIKA 2QG4A 4WLEA 4HGOA 2ZXFA 4MEJA