1RWLA

Extracellular domain of mycobacterium tuberculosis pknd
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
258
structure length
254
Chain Sequence
GQTVLPFTGIDFRLSPSGVAVDSAGNVYVTSEGMYGRVVKLAGTTVLPFNGLYQPQGLAVDGAGTVYVTDFNNRVVTLAAGSNNQTVLPFDGLNYPEGLAVDTQGAVYVADRGNNRVVKLAAGSKTQTVLPFTGLNDPDGVAVDNSGNVYVTDTDNNRVVKLEAESNNQVVLPFTDITAPWGIAVDEAGTVYVTEHNTNQVVKLLAGSTTSTVLPFTGLNTPLAVAVDSDRTVYVADRGNDRVVKLTSLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sensor Domain of the Mycobacterium tuberculosis Receptor Ser/Thr Protein Kinase, PknD, forms a Highly Symmetric beta Propeller.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase pknD
total genus 43
structure length 254
sequence length 258
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01436 NHL NHL repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1rwlA00
1CVMA 3U0SA 4GN8A 3SRGA 1N7DA 5FWWA 3IAXA 1E1AA 2IARA 1PJXA 2DSOA 1CRUA 2IAUA 3I1CA 3SOBB 2FP9A 3SREA 1NPEA 2GVXA 4HHOA 3LI5A 4O5TA 2QE8A 1POOA 2OJHA 2G8SA 5EX7A 5GX3A 2GVVA 2V91A 2VAQA 2POOA 1CRZA 1C9UA 3AMRA 3V65B 3BYCA 2IAWA 3KGGA 4GNAA 1CQ1A 2GHSA 2HQSA 1QLGA 3TC9A 2IATA 3LI3A 5GX2A 3LI4A 3HRPA 5GX4A 4IYGA 1C5KA 3V64C 5D9BA 2P4OA 5D9CA 2FPCA 1RWIA 4O5SA 1H6LA 1RWLA 3P5BL 4GNCA 2IASA 2DG1A 2IAXA 4HW6A 3S2KA 1Q7FA 4HHQA 3A9HA 4R40A 2IAVA 3KYAA 1QBIA 2IAOA 2GVUA 2IAQA 3Q6KA 3Q6PA 3E5ZA 4JMLA 2GVWA 3DASA 3SOQA 3S8ZA 2FPBA 4GN9A 3O4PA 3G4EA 4GNBA 3S8VA 5GTQA 3FW0A 3A9GA 5D9DA 4PWZA 3Q6TA 3S94A 2DG0A 2W8BB 2FP8A 2IAPA 1IJQA 4A0PA 5GX5A 2W8BA 4GN7A 3DR2A 3FVZA 3AMSA 3V1SA 3SOVA 3G4HA 2ISMA 4DG6A 3WW9A 3HLIA 4Q1UA 2IVZA 4IMBA 4ZLRA 3HLHA 3WWAA 1V04A 5GX1A
chains in the Genus database with same CATH superfamily
1N6EA 3K3AA 1EUUA 3SRGA 2HTVA 5FWWA 3IAXA 3TI5A 1NMAN 4SLIA 5FZNA 1PJXA 2ZW9A 4XHBA 4KS4A 4YW5A 2HT7A 2VW1A 3GVLA 1EUTA 2QWDA 4L7CA 4YZ1A 3SREA 2AEPA 4XMBA 2F12A 1WCQA 1NNCA 1NCDN 4O5TA 2QE8A 3K37A 1V0EA 4D52B 3O9KA 2BATA 5EX7A 4I00A 3CL2A 1W8NA 1IVEA 3SANA 3D11A 4WEGA 1CRZA 3NSSA 3V65B 4CPLA 4CHBA 2IAWA 2VW0A 3KGGA 1IUBA 1CQ1A 4ZGCA 4QN7A 1NSBA 1S1DA 1INWA 1N1TA 4XJWA 4XE9A 3WDZA 4FOQA 2AEQA 3HRPA 4YY8A 5GX4A 3VNHA 1W0OA 5EO8A 2ZZKA 5D9CA 2FPCA 2WOZA 4O5SA 4GZSA 4MWUA 1RWLA 5F9TA 2DG1A 4CH9A 1EURA 4WEFA 2CMLA 4YW4A 4HW6A 4B7QA 2Z32A 3A9HA 5FNSA 4L7BA 4WA4A 1QBIA 2IAOA 2QWKA 2ZWAA 4XYXA 3E5ZA 1SNTA 2QWAA 1L7HA 3O4PA 4CPMA 4BBWA 3B69A 4XJUA 5GTQA 3D12A 5D9DA 4HZVA 4IFJA 1W0PA 2W8BB 2YA4A 4A0PA 5NN9A 2F11A 1V3CA 1X2RA 3ALWA 4AGTA 2QWJA 2C4LA 1W1XA 2W5NA 3AMSA 2C4AA 1S0JA 4DG6A 4NN9A 3HLIA 1W8OA 1MS4A 1NN2A 3ZGCA 2IVZA 4IMBA 1S18A 4ASCA 4UOUA 4KS2A 2VVZA 2H2NA 4FPFA 1MZ6A 1XOEA 1VCUA 2IARA 2DYHA 2HTYA 1INFA 4FPCA 4QN5A 4NC5A 2YDTA 2DSOA 1Z4ZA 5JYYA 1NMBN 1IVCA 1INYA 3LI5A 2W5OA 1N1YA 1MS1A 4XJQA 2SILA 3ZGDA 3ADEA 2G8SA 3T1EA 2BERA 3SLIA 4FZHA 4CPNA 5GX3A 1Z4XA 2V91A 4HZWA 2POOA 3AMRA 4FPYA 1NCBN 1F8CA 3BYCA 1A4GA 2A75A 2GHSA 4MWJA 3CL0A 2HQSA 3GVKA 2AGSA 1SO7A 1INVA 2IATA 3K38A 4GZQA 2F26A 3TIAA 1VCJA 2YA7A 4MC7A 5GX2A 4JF7A 4XILA 4KS3A 4Q6KA 5B2DA 6NN9A 1N1SA 3TI8A 4FPEA 1NNBA 3JU4A 1Z4YA 4K1HA 3L6VA 5D9BA 2F29A 4MZAA 4YZ3A 2YA8A 1RWIA 4H52A 4M4VA 1IVGA 4MJVA 4AHAA 1H6LA 4IFNX 4WA3A 4GNCA 3H73A 5H47A 3TI4A 4GZOA 4C1YA 3S2KA 1V0ZA 2HT8A 4GB1A 4R40A 2IAVA 4MWQA 3KYAA 3A71A 4GZTA 4B7NA 1INHA 1INGA 2QWBA 4MWVA 4YW1A 3PJQA 4FP2A 4B7JA 2F13A 4XIOA 1V0FA 3SOQA 1MS9A 4GNBA 3TICA 5HUNA 5EO7A 3A9GA 4CPYA 1B9VA 1XOGA 2F25A 3Q6TA 3S94A 4FPLA 1DILA 4YZ4A 4XJRA 2XN4A 2QWIA 2W8BA 1N6DA 4GN7A 2VW2A 1OFZA 4X49A 3FVZA 3G4HA 3WW9A 1N6FA 1A14N 4YZ2A 2ZB5A 3HLHA 4M3MA 4FOVA 1ZGKA 2VSMA 5FZJA 1CVMA 4GN8A 1N7DA 7NN9A 3CYEA 1IVDA 1E1AA 1W21A 2VK7A 4YW3A 1NNAA 4D52A 3TI3A 4GDJA 2X9MA 4B7MA 2W20A 5HUMA 1Z50A 3NO0A 2IAUA 4IN4A 3I1CA 4K3YA 2FP9A 3O9JA 4YW2A 1NCCN 4HHOA 3W09A 4L7DA 4QN6A 4XHXA 2YA5A 4FQ4A 4HZZA 2OJHA 4QNPA 4QN3A 4MX0A 2VK5A 2B8HA 4IFLX 4GDIA 1C9UA 1NCAN 4ZY3A 1V3BA 1BJIA 3WN7A 2BF6A 2QWHA 1WCSA 2HTWA 4H53A 3UC1A 3H72A 1QLGA 3TC9A 1SLIA 2AH2A 2H2UA 5CGJA 3LI3A 1E8TA 2FHRA 4HIZA 4K1IA 2VSKA 1IUCA 3VNGA 2ZB6A 1A4QA 2W38A 4GZPA 4IYGA 3NN9A 2HU4A 4D52C 4GEZA 4K1KA 3K36A 3SALA 2QWFA 4IQKA 4XMIA 5B2CA 2SLIA 1MS5A 5M1ZA 4FPGA 2YA6A 1NSDA 1DIMA 4AGIA 3TI6A 4XIKA 1Q7FA 2SIMA 4FPOB 1V2IA 5FNQA 4FJ6A 1B9SA 5HUGA 4MWWA 2IAQA 4XMAA 3Q6PA 3DASA 3S8ZA 4GN9A 1IVFA 2F24A 1W20A 1INXA 3BEQA 1F8BA 1USRA 1X2JA 3FW0A 3K39A 1F8DA 4PWZA 1NMCA 3OPZA 2DG0A 4XOGA 4M4NA 4GZWA 2F27A 2IAPA 2VK6A 4FOWA 4MJUA 1N1VA 4HZYA 4B7RA 1ZI0A 4YZ5A 2HTUA 4WA5A 4FVKA 1SUUA 1USXA 4FP3A 1S0IA 5FNTA 2QWGA 3SILA 4GZXA 2YDPA 2VPJA 2VWDA 1V04A 4DGRA 3U0SA 2F10A 2HTQA 4N1BA 4MWRA 4HZXA 4G3NA 1V3DA 2QWEA 1CRUA 3ALXA 2XZKA 1K32A 1EUSA 3SOBB 1NPEA 2GVXA 3INBA 1WP5A 4C1YB 1MR5A 4X4AA 1POOA 2HU0A 4M4UA 4FPJA 2GVVA 2VAQA 3B7EA 3A72A 5F72C 4XJAA 2QWCA 4GNAA 1L7GA 5FNUA 1V3EA 4CPOA 1Z4WA 1E8UA 1MS0A 4MZEA 4UF7A 5HUKA 4J9TA 4MWLA 2RKCA 4FPKA 1U6DX 3LI4A 4QN4A 4D8SA 1C5KA 5HX0A 3V64C 3II7A 2P4OA 3CKZA 1MS3A 3P5BL 2IASA 4KS5A 2XCYA 4XJZA 2F28A 2IAXA 1B9TA 5FNRA 1KITA 4HHQA 5GX1A 4X6KA 4AH4A 2F0ZA 2HT5A 1L7FA 2FLUX 3H6JA 1E8VA 2GVUA 4KS1A 1SLLA 3Q6KA 4JMLA 4XJ9A 2GVWA 4CSDA 1MS8A 2FPBA 3G4EA 2HTRA 3S8VA 4MWXA 1Z4VA 2JKBA 3GVJA 4CPZA 2FP8A 4FPHA 4GJTA 1IJQA 1MWEA 4FOYA 5GX5A 1MZ5A 4X47A 3TIBA 3DR2A 4XJ8A 1F8EA 3V1SA 3SOVA 2ISMA 4NCSA 4D4UA 3H71A 4Q1UA 4K1JA 2XZIA 4ZLRA 1NSCA 2XZJA 1IVBA 3WWAA 4MWYA 2BZDA
chains in the Genus database with same CATH topology
1CVMA 3U0SA 4GN8A 3SRGA 1N7DA 5FWWA 3IAXA 1E1AA 2IARA 1PJXA 2DSOA 1CRUA 2IAUA 3I1CA 3SOBB 2FP9A 3SREA 1NPEA 2GVXA 4HHOA 3LI5A 4O5TA 2QE8A 1POOA 2OJHA 2G8SA 5EX7A 5GX3A 2GVVA 2V91A 2VAQA 2POOA 1CRZA 1C9UA 3AMRA 3V65B 3BYCA 2IAWA 3KGGA 4GNAA 1CQ1A 2GHSA 2HQSA 1QLGA 3TC9A 2IATA 3LI3A 5GX2A 3LI4A 3HRPA 5GX4A 4IYGA 1C5KA 3V64C 5D9BA 2P4OA 5D9CA 2FPCA 1RWIA 4O5SA 1H6LA 1RWLA 3P5BL 4GNCA 2IASA 2DG1A 2IAXA 4HW6A 3S2KA 1Q7FA 4HHQA 3A9HA 4R40A 2IAVA 3KYAA 1QBIA 2IAOA 2GVUA 2IAQA 3Q6KA 3Q6PA 3E5ZA 4JMLA 2GVWA 3DASA 3SOQA 3S8ZA 2FPBA 4GN9A 3O4PA 3G4EA 4GNBA 3S8VA 5GTQA 3FW0A 3A9GA 5D9DA 4PWZA 3Q6TA 3S94A 2DG0A 2W8BB 2FP8A 2IAPA 1IJQA 4A0PA 5GX5A 2W8BA 4GN7A 3DR2A 3FVZA 3AMSA 3V1SA 3SOVA 3G4HA 2ISMA 4DG6A 3WW9A 3HLIA 4Q1UA 2IVZA 4IMBA 4ZLRA 3HLHA 3WWAA 1V04A 5GX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CVM A;  3U0S A;  4GN8 A;  3SRG A;  1N7D A;  5FWW A;  3IAX A;  1E1A A;  2IAR A;  1PJX A;  2DSO A;  1CRU A;  2IAU A;  3I1C A;  3SOB B;  2FP9 A;  3SRE A;  1NPE A;  2GVX A;  4HHO A;  3LI5 A;  4O5T A;  2QE8 A;  1POO A;  2OJH A;  2G8S A;  5EX7 A;  5GX3 A;  2GVV A;  2V91 A;  2VAQ A;  2POO A;  1CRZ A;  1C9U A;  3AMR A;  3V65 B;  3BYC A;  2IAW A;  3KGG A;  4GNA A;  1CQ1 A;  2GHS A;  2HQS A;  1QLG A;  3TC9 A;  2IAT A;  3LI3 A;  5GX2 A;  3LI4 A;  3HRP A;  5GX4 A;  4IYG A;  1C5K A;  3V64 C;  5D9B A;  2P4O A;  5D9C A;  2FPC A;  1RWI A;  4O5S A;  1H6L A;  1RWL A;  3P5B L;  4GNC A;  2IAS A;  2DG1 A;  2IAX A;  4HW6 A;  3S2K A;  1Q7F A;  4HHQ A;  3A9H A;  4R40 A;  2IAV A;  3KYA A;  1QBI A;  2IAO A;  2GVU A;  2IAQ A;  3Q6K A;  3Q6P A;  3E5Z A;  4JML A;  2GVW A;  3DAS A;  3SOQ A;  3S8Z A;  2FPB A;  4GN9 A;  3O4P A;  3G4E A;  4GNB A;  3S8V A;  5GTQ A;  3FW0 A;  3A9G A;  5D9D A;  4PWZ A;  3Q6T A;  3S94 A;  2DG0 A;  2W8B B;  2FP8 A;  2IAP A;  1IJQ A;  4A0P A;  5GX5 A;  2W8B A;  4GN7 A;  3DR2 A;  3FVZ A;  3AMS A;  3V1S A;  3SOV A;  3G4H A;  2ISM A;  4DG6 A;  3WW9 A;  3HLI A;  4Q1U A;  2IVZ A;  4IMB A;  4ZLR A;  3HLH A;  3WWA A;  1V04 A;  5GX1 A; 
#chains in the Genus database with same CATH topology
 1N6E A;  3K3A A;  1EUU A;  3SRG A;  2HTV A;  5FWW A;  3IAX A;  3TI5 A;  1NMA N;  4SLI A;  5FZN A;  1PJX A;  2ZW9 A;  4XHB A;  4KS4 A;  4YW5 A;  2HT7 A;  2VW1 A;  3GVL A;  1EUT A;  2QWD A;  4L7C A;  4YZ1 A;  3SRE A;  2AEP A;  4XMB A;  2F12 A;  1WCQ A;  1NNC A;  1NCD N;  4O5T A;  2QE8 A;  3K37 A;  1V0E A;  4D52 B;  3O9K A;  2BAT A;  5EX7 A;  4I00 A;  3CL2 A;  1W8N A;  1IVE A;  3SAN A;  3D11 A;  4WEG A;  1CRZ A;  3NSS A;  3V65 B;  4CPL A;  4CHB A;  2IAW A;  2VW0 A;  3KGG A;  1IUB A;  1CQ1 A;  4ZGC A;  4QN7 A;  1NSB A;  1S1D A;  1INW A;  1N1T A;  4XJW A;  4XE9 A;  3WDZ A;  4FOQ A;  2AEQ A;  3HRP A;  4YY8 A;  5GX4 A;  3VNH A;  1W0O A;  5EO8 A;  2ZZK A;  5D9C A;  2FPC A;  2WOZ A;  4O5S A;  4GZS A;  4MWU A;  1RWL A;  5F9T A;  2DG1 A;  4CH9 A;  1EUR A;  4WEF A;  2CML A;  4YW4 A;  4HW6 A;  4B7Q A;  2Z32 A;  3A9H A;  5FNS A;  4L7B A;  4WA4 A;  1QBI A;  2IAO A;  2QWK A;  2ZWA A;  4XYX A;  3E5Z A;  1SNT A;  2QWA A;  1L7H A;  3O4P A;  4CPM A;  4BBW A;  3B69 A;  4XJU A;  5GTQ A;  3D12 A;  5D9D A;  4HZV A;  4IFJ A;  1W0P A;  2W8B B;  2YA4 A;  4A0P A;  5NN9 A;  2F11 A;  1V3C A;  1X2R A;  3ALW A;  4AGT A;  2QWJ A;  2C4L A;  1W1X A;  2W5N A;  3AMS A;  2C4A A;  1S0J A;  4DG6 A;  4NN9 A;  3HLI A;  1W8O A;  1MS4 A;  1NN2 A;  3ZGC A;  2IVZ A;  4IMB A;  1S18 A;  4ASC A;  4UOU A;  4KS2 A;  2VVZ A;  2H2N A;  4FPF A;  1MZ6 A;  1XOE A;  1VCU A;  2IAR A;  2DYH A;  2HTY A;  1INF A;  4FPC A;  4QN5 A;  4NC5 A;  2YDT A;  2DSO A;  1Z4Z A;  5JYY A;  1NMB N;  1IVC A;  1INY A;  3LI5 A;  2W5O A;  1N1Y A;  1MS1 A;  4XJQ A;  2SIL A;  3ZGD A;  3ADE A;  2G8S A;  3T1E A;  2BER A;  3SLI A;  4FZH A;  4CPN A;  5GX3 A;  1Z4X A;  2V91 A;  4HZW A;  2POO A;  3AMR A;  4FPY A;  1NCB N;  1F8C A;  3BYC A;  1A4G A;  2A75 A;  2GHS A;  4MWJ A;  3CL0 A;  2HQS A;  3GVK A;  2AGS A;  1SO7 A;  1INV A;  2IAT A;  3K38 A;  4GZQ A;  2F26 A;  3TIA A;  1VCJ A;  2YA7 A;  4MC7 A;  5GX2 A;  4JF7 A;  4XIL A;  4KS3 A;  4Q6K A;  5B2D A;  6NN9 A;  1N1S A;  3TI8 A;  4FPE A;  1NNB A;  3JU4 A;  1Z4Y A;  4K1H A;  3L6V A;  5D9B A;  2F29 A;  4MZA A;  4YZ3 A;  2YA8 A;  1RWI A;  4H52 A;  4M4V A;  1IVG A;  4MJV A;  4AHA A;  1H6L A;  4IFN X;  4WA3 A;  4GNC A;  3H73 A;  5H47 A;  3TI4 A;  4GZO A;  4C1Y A;  3S2K A;  1V0Z A;  2HT8 A;  4GB1 A;  4R40 A;  2IAV A;  4MWQ A;  3KYA A;  3A71 A;  4GZT A;  4B7N A;  1INH A;  1ING A;  2QWB A;  4MWV A;  4YW1 A;  3PJQ A;  4FP2 A;  4B7J A;  2F13 A;  4XIO A;  1V0F A;  3SOQ A;  1MS9 A;  4GNB A;  3TIC A;  5HUN A;  5EO7 A;  3A9G A;  4CPY A;  1B9V A;  1XOG A;  2F25 A;  3Q6T A;  3S94 A;  4FPL A;  1DIL A;  4YZ4 A;  4XJR A;  2XN4 A;  2QWI A;  2W8B A;  1N6D A;  4GN7 A;  2VW2 A;  1OFZ A;  4X49 A;  3FVZ A;  3G4H A;  3WW9 A;  1N6F A;  1A14 N;  4YZ2 A;  2ZB5 A;  3HLH A;  4M3M A;  4FOV A;  1ZGK A;  2VSM A;  5FZJ A;  1CVM A;  4GN8 A;  1N7D A;  7NN9 A;  3CYE A;  1IVD A;  1E1A A;  1W21 A;  2VK7 A;  4YW3 A;  1NNA A;  4D52 A;  3TI3 A;  4GDJ A;  2X9M A;  4B7M A;  2W20 A;  5HUM A;  1Z50 A;  3NO0 A;  2IAU A;  4IN4 A;  3I1C A;  4K3Y A;  2FP9 A;  3O9J A;  4YW2 A;  1NCC N;  4HHO A;  3W09 A;  4L7D A;  4QN6 A;  4XHX A;  2YA5 A;  4FQ4 A;  4HZZ A;  2OJH A;  4QNP A;  4QN3 A;  4MX0 A;  2VK5 A;  2B8H A;  4IFL X;  4GDI A;  1C9U A;  1NCA N;  4ZY3 A;  1V3B A;  1BJI A;  3WN7 A;  2BF6 A;  2QWH A;  1WCS A;  2HTW A;  4H53 A;  3UC1 A;  3H72 A;  1QLG A;  3TC9 A;  1SLI A;  2AH2 A;  2H2U A;  5CGJ A;  3LI3 A;  1E8T A;  2FHR A;  4HIZ A;  4K1I A;  2VSK A;  1IUC A;  3VNG A;  2ZB6 A;  1A4Q A;  2W38 A;  4GZP A;  4IYG A;  3NN9 A;  2HU4 A;  4D52 C;  4GEZ A;  4K1K A;  3K36 A;  3SAL A;  2QWF A;  4IQK A;  4XMI A;  5B2C A;  2SLI A;  1MS5 A;  5M1Z A;  4FPG A;  2YA6 A;  1NSD A;  1DIM A;  4AGI A;  3TI6 A;  4XIK A;  1Q7F A;  2SIM A;  4FPO B;  1V2I A;  5FNQ A;  4FJ6 A;  1B9S A;  5HUG A;  4MWW A;  2IAQ A;  4XMA A;  3Q6P A;  3DAS A;  3S8Z A;  4GN9 A;  1IVF A;  2F24 A;  1W20 A;  1INX A;  3BEQ A;  1F8B A;  1USR A;  1X2J A;  3FW0 A;  3K39 A;  1F8D A;  4PWZ A;  1NMC A;  3OPZ A;  2DG0 A;  4XOG A;  4M4N A;  4GZW A;  2F27 A;  2IAP A;  2VK6 A;  4FOW A;  4MJU A;  1N1V A;  4HZY A;  4B7R A;  1ZI0 A;  4YZ5 A;  2HTU A;  4WA5 A;  4FVK A;  1SUU A;  1USX A;  4FP3 A;  1S0I A;  5FNT A;  2QWG A;  3SIL A;  4GZX A;  2YDP A;  2VPJ A;  2VWD A;  1V04 A;  4DGR A;  3U0S A;  2F10 A;  2HTQ A;  4N1B A;  4MWR A;  4HZX A;  4G3N A;  1V3D A;  2QWE A;  1CRU A;  3ALX A;  2XZK A;  1K32 A;  1EUS A;  3SOB B;  1NPE A;  2GVX A;  3INB A;  1WP5 A;  4C1Y B;  1MR5 A;  4X4A A;  1POO A;  2HU0 A;  4M4U A;  4FPJ A;  2GVV A;  2VAQ A;  3B7E A;  3A72 A;  5F72 C;  4XJA A;  2QWC A;  4GNA A;  1L7G A;  5FNU A;  1V3E A;  4CPO A;  1Z4W A;  1E8U A;  1MS0 A;  4MZE A;  4UF7 A;  5HUK A;  4J9T A;  4MWL A;  2RKC A;  4FPK A;  1U6D X;  3LI4 A;  4QN4 A;  4D8S A;  1C5K A;  5HX0 A;  3V64 C;  3II7 A;  2P4O A;  3CKZ A;  1MS3 A;  3P5B L;  2IAS A;  4KS5 A;  2XCY A;  4XJZ A;  2F28 A;  2IAX A;  1B9T A;  5FNR A;  1KIT A;  4HHQ A;  5GX1 A;  4X6K A;  4AH4 A;  2F0Z A;  2HT5 A;  1L7F A;  2FLU X;  3H6J A;  1E8V A;  2GVU A;  4KS1 A;  1SLL A;  3Q6K A;  4JML A;  4XJ9 A;  2GVW A;  4CSD A;  1MS8 A;  2FPB A;  3G4E A;  2HTR A;  3S8V A;  4MWX A;  1Z4V A;  2JKB A;  3GVJ A;  4CPZ A;  2FP8 A;  4FPH A;  4GJT A;  1IJQ A;  1MWE A;  4FOY A;  5GX5 A;  1MZ5 A;  4X47 A;  3TIB A;  3DR2 A;  4XJ8 A;  1F8E A;  3V1S A;  3SOV A;  2ISM A;  4NCS A;  4D4U A;  3H71 A;  4Q1U A;  4K1J A;  2XZI A;  4ZLR A;  1NSC A;  2XZJ A;  1IVB A;  3WWA A;  4MWY A;  2BZD A; 
#chains in the Genus database with same CATH homology
 1CVM A;  3U0S A;  4GN8 A;  3SRG A;  1N7D A;  5FWW A;  3IAX A;  1E1A A;  2IAR A;  1PJX A;  2DSO A;  1CRU A;  2IAU A;  3I1C A;  3SOB B;  2FP9 A;  3SRE A;  1NPE A;  2GVX A;  4HHO A;  3LI5 A;  4O5T A;  2QE8 A;  1POO A;  2OJH A;  2G8S A;  5EX7 A;  5GX3 A;  2GVV A;  2V91 A;  2VAQ A;  2POO A;  1CRZ A;  1C9U A;  3AMR A;  3V65 B;  3BYC A;  2IAW A;  3KGG A;  4GNA A;  1CQ1 A;  2GHS A;  2HQS A;  1QLG A;  3TC9 A;  2IAT A;  3LI3 A;  5GX2 A;  3LI4 A;  3HRP A;  5GX4 A;  4IYG A;  1C5K A;  3V64 C;  5D9B A;  2P4O A;  5D9C A;  2FPC A;  1RWI A;  4O5S A;  1H6L A;  1RWL A;  3P5B L;  4GNC A;  2IAS A;  2DG1 A;  2IAX A;  4HW6 A;  3S2K A;  1Q7F A;  4HHQ A;  3A9H A;  4R40 A;  2IAV A;  3KYA A;  1QBI A;  2IAO A;  2GVU A;  2IAQ A;  3Q6K A;  3Q6P A;  3E5Z A;  4JML A;  2GVW A;  3DAS A;  3SOQ A;  3S8Z A;  2FPB A;  4GN9 A;  3O4P A;  3G4E A;  4GNB A;  3S8V A;  5GTQ A;  3FW0 A;  3A9G A;  5D9D A;  4PWZ A;  3Q6T A;  3S94 A;  2DG0 A;  2W8B B;  2FP8 A;  2IAP A;  1IJQ A;  4A0P A;  5GX5 A;  2W8B A;  4GN7 A;  3DR2 A;  3FVZ A;  3AMS A;  3V1S A;  3SOV A;  3G4H A;  2ISM A;  4DG6 A;  3WW9 A;  3HLI A;  4Q1U A;  2IVZ A;  4IMB A;  4ZLR A;  3HLH A;  3WWA A;  1V04 A;  5GX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...