1RWMB

Crystal structure of human caspase-1 in complex with 4-oxo-3-[2-(5-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-thiophen-2-yl)-acetylamino]-pentanoic acid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwmB00
2CJXB 1NMEB 3EDRB 4DCJB 2H5JB 2C2MB 1RWMB 2Y1LB 1RWVB 2Y0BB 5IC6B 3R7SB 3D6FB 1I3OB 1PYOB 2H51B 1SC4B 3R6GB 1RWXB 3R5JB 3EDQB 2HBQB 3SIPB 2HBRB 2XZDB 2CNKB 4ZVSB 3GJRB 1QDUB 1RWPB 1RE1B 2CNLB 4ZVRB 2FQQB 2HBZB 3NS7B 4JB8B 3QNWB 3GJQB 1F9EB 2HBYB 2XYGB 5K20B 2QLFB 2XZTB 2CDRB 4ZVQB 3KJQB 3P45B 3R7NB 1RHKB 2XYPB 2QLBB 2QL9B 2H48B 1PAUB 1I51B 1SC1B 3GJTB 1RWOB 1RHRB 2QLJB 2C2OB 2XYHB 2C1EB 1SC3B 2H4WB 1RWNB 4ZVOB 2P2CB 1IBCB 2H54B 2H5IB 1RHMB 1RWWB 1GFWB 4DCOB 3D6HB 3KJFB 4ZVUB 5IC4B 3R6LB 1RWKB 3P4UB 3GJSB 3KJNB 2CNOB 2H65B 2H4YB 3R7BB 2DKOB 1QTNB 2QL7B 1BMQB 3IBFB 3RJMB 4LSZB 2C2KB 1ICEB 2CJYB 3D6MB 2QL5B 1RHJB 4ZVTB 4DCPB 1RHQB 1RHUB 2CNNB 3IBCB 2C2ZB 4ZVPB
chains in the Genus database with same CATH superfamily
4WIQA 5J2MB 4DCJB 1KR4A 4LF2A 1N0VC 4RR5A 3H5SA 4GVLA 5H9EJ 2FJEB 4J9NA 3LP0B 2B9XA 4P2XA 3RBDA 2RRBA 5KFYA 3QJPA 2HNDA 3AT1B 2N7YA 4JV5F 4DV4F 2LDIA 2ATLA 4UTGA 1TAQA 4IG0B 4WWSA 4ZOSA 2BOPA 5EWEA 1YJNS 4NZ6A 4UY85 3DLEA 2EWHA 2YNHB 1Z2LA 4Q45A 2LECA 2DPJA 2H5IB 3LW5C 4MK8A 5HMXA 3R5AA 1B64A 4TN2A 1S4EA 4P9SA 2SXLA 2CAJA 2QMWA 3CJQA 3MM7A 5C24B 1HYSA 5KFNA 2OAUA 4DQSA 4GO5X 4UY8T 5ETNA 3D28A 4YB6A 2RDIA 1P6TA 1EKRA 1U25A 3VVUA 5DDRC 2R7XA 4D3GA 2CJKA 1PYOB 1N34F 2B9EA 3KK1A 4DQIA 4ZJOA 2CJ9A 3R3TA 3ZTOA 3CD7A 3FMBA 4J9UE 2R4FA 2XMAA 3TR5A 4P7VA 1Z2ZA 2YNGA 4EZ6A 3UNYA 2GIQA 2BDPA 2F5GA 2VJVA 4O0IA 2XZTB 5CAAA 3KHRA 2V2ZA 2VG7B 4CH7A 3T1HJ 3K5MA 1H7XA 1FRLA 1BD6A 2H48B 3IR5B 2Q3PA 1SKRA 1A0OB 2CQ2A 2X7IA 2M8DB 2BE9B 4WYLA 3IXQA 1L3UA 1HNZF 7AT1B 1U6ZA 1XN9A 1YK9A 3H59A 4RWXA 2VJUA 1RT1A 3IWLA 1LKZA 3MR5A 2HEKA 5LSOA 3VGUA 1ROFA 1S1UA 2VQFF 3SFUA 4RU9A 3H20A 2VZ9A 3E51A 3UI3A 1RXOB 2XGQA 1N5TA 1P1LA 4ZVTB 5KG2A 4USWA 1Q16B 2BJ1A 4IG0A 3JS9A 1SPBP 4DL0C 4EZ9A 3UWTA 2RQ4A 5BR8F 2CPXA 2MLXA 2YNHA 3ZFVA 3A12A 2UV8G 2HQIA 2F63A 4U7CA 3DLLQ 3PYEA 1AUSL 1PBAA 3DRRA 4R5PA 3QBCA 1FFGB 5C24A 1SBRA 2W8KA 2WBRA 2ZITA 1TK0A 3GG0A 2UXBJ 5EGYA 3QGIA 4ED6A 1RA7A 1UCNA 4OYBA 3CWJA 4FYXB 1KLMA 4W98A 2H5EA 2QMXA 4PUOB 2L9NA 1Y5IB 1I6JA 3V6HA 1RAJA 1S0VA 5DGAA 3FZBA 1T9XA 5DG7A 2DNPA 2OIHA 5KFMA 2JC1A 3RR8A 4OHXA 3Q86A 2YWKA 4NX9A 3GLJA 3EDRB 5E3CA 2KKHA 5D78A 3R27A 3CCLS 1WG1A 1AXQA 1YSJA 3GTYX 2D1CA 1TKZB 1FESA 4YUDA 1SKWA 2DNKA 3RAXA 2KU7A 5D0RA 2CVEA 4RZRA 2LDYA 3E3XA 3MCSA 1W25A 1FA0A 3HD2A 9ATCB 5M2RA 5F8HA 1G7CB 3TUZC 3MM8B 2CQ0A 2HMIB 3D2WA 5DETA 2XGPA 5CZVA 2BR0A 3MUVP 2XMVA 2P8IA 1WNEA 1S9EA 3IP0A 1AZSB 2LVWA 1RWWB 2ZH3A 4DR1J 3L7OA 5LSRA 4EEYA 2L08A 3EX7B 4IRKA 1Q7YT 5IXUA 1EZZB 2RQKA 3MOJB 1FJGJ 2B5JB 4Y34A 2QL7B 1Z4UA 4USVA 1TL7A 5JJBA 1PJ7A 4ZVPB 4DV0J 4M5KA 3EUNA 5F0WA 1JLBB 1T02A 2DH7A 1RWVB 2RT3A 2YX4A 4PG7A 3M6WA 1SVDA 4DR2J 5HROB 4I2QB 5EDWA 3RU0A 3TX0A 1U6BA 4IR9A 1PGZA 3RRHA 2B3TB 1S1VB 1T9YA 2HHUA 4RW8B 4UOGA 3G87A 1M5VC 1WG4A 2V6AA 3SYZA 1TZ0A 3HHNB 2C2EA 5CXTA 4KTQA 4KV8B 1FWPA 3NMAA 5KFAA 3AD7C 1HARA 2FJWA 1X5PA 2KXHA 1UWBB 4WF9Q 4NLVA 4K4VA 3J7YU 3KHHA 3JSBA 1LW2B 1VQOS 1IKXB 2KHDA 1VLOA 3RGIA 1WOOA 1ITPA 3DHWC 4CO5A 1K8AT 3FNNA 1O0PA 1LXNA 4W92B 4C48A 1NMEB 1WDDA 2J7UA 4DI6A 1Y4ZB 5ETTA 1BLUA 1XNQF 2J7WA 2P9GA 4WTYA 4YS2A 1M5HA 5KT5A 1AZSA 2XNQA 2C42A 5DZ6A 4BCAA 2R2RA 4OI3A 5CABA 5KFKA 5B0CA 2IDLA 3LQVA 3MEKA 2V4QA 4JI0F 2WSCC 3MURP 3JYTA 3G8QA 1VLYA 3OL6A 4AE5A 1U45A 1NAQA 1H3DA 4DPUA 2OEMA 3M2UA 4QZVB 1SC3B 3MPDA 2I1RA 1D0EA 3AY0A 1JIHA 4USKA 5HROA 4I2QA 3KXDA 4NXMF 1TL1B 4FN5A 2UVWA 2FGOA 2ZC3A 1S79A 2F1FA 1BMQB 3J81j 3D66A 1TKDA 3IN5A 1JNRB 2GVDB 5HVFA 4B17A 4A8QA 2CG4A 8AT1B 2E1PA 2P6SA 2V5HG 4NLDA 4DQQA 4JI5F 3HX9A 1SJ4P 4ZITA 1Y7PA 4OJ3A 2HK3A 4R25A 2RKIA 4Y3CA 3MXHP 2OGUA 4B9MA 3S1TA 1LW2A 1IKXA 3S7RA 2HURA 2XTJP 1R0BG 4ZLNA 4YB1P 4E98A 4DSKA 3MF5A 1S5ZA 4KQZA 2XLJA 2F3JA 1JJ2R 4WXOA 3EJMA 5D0EA 3MD3A 2JC0A 4JI4F 3NNAA 1WF1A 4HEA9 4WE1B 5IT4A 2OPRA 3PYFA 3QO9B 2IA6A 3NGDA 1HHQA 4CLPA 2AJ2A 4N76A 4CNZA 4RNOA 2RDDA 3FSIA 3B82A 2W2NP 4L75A 4A8MP 1KVJA 4DOZA 3SCKE 3PYDA 1C1BA 3M8QB 1C2PA 3CC4S 1RTJB 1SQFA 2ZVIA 2CFXA 4QYZJ 4ZDNA 1X7VA 1FXDA 4ED4A 3NAHA 2VG5A 2Y1LB 5KFHA 1BXNA 3BBFA 2AJ1A 2UUCF 3DLKB 4BS2A 4ZIWA 3EDQB 1ACMB 4OFZA 3H2UB 3VQSA 3HPOA 1OIAA 4OZLA 3DDNA 1TL1A 5DGBA 3EM1A 2RB7A 1X4GA 3ET6B 2MHNA 2NREA 3W65A 2FB0A 1FJCA 3QJJA 2IFXA 2QL9B 1NK0A 2LFVA 4A8YA 1RTZA 1S6PB 1YX2A 2ZH4A 3BSNA 3CCMS 2YQ3A 1SKUB 3O44A 2QRRA 3GILA 1TP7A 3MCNA 1X0FA 1Q0NA 4TU9A 4AQYF 5DDQC 1UW9A 1U1KA 1HA1A 2DNRA 3H98A 2CZ9A 1DRZA 4OZ5A 1FERA 5KFBA 1CQNA 4L74A 1NRKA 1G2EA 1KP6A 2FJVA 3G2XA 2HK2A 4DR5F 1S1XB 1LWEA 4QIWD 5BJRA 1FRXA 4O3PA 2KFNA 4FKYA 5ITHA 5IV4A 4GKKF 3NBPB 1UL3A 1ZPWX 3IA0A 3SCJE 4OI0A 2DITA 2NLWA 1S1TB 3CULA 3I9V9 4HI2A 3NS6A 4ZPTR 3M8QA 2KYZA 2X1BA 1NM2A 3W5YA 2WK4A 2HFUA 2HG4A 3CEDA 2X1FA 2GV1A 3DOLB 5B09A 1ZA2B 1YLXA 2VA2A 3QIPA 3P6YC 4I7FB 3Q8PB 4ALZA 4Y6IA 3DLKA 3C2PA 5IT0A 2GMJA 3K17A 1QVFR 3J80U 2BQ3A 2XMUA 5EWFA 1SJRA 2MB0B 3BPDA 1K0VA 1K1SA 3M2RB 1QLNA 1DLOA 2HNZB 4DL2A 3HHDA 4TNOA 3LAKA 1KC8T 4OJHA 1VC6A 3CMES 1SCJB 1T7PA 1H7WA 1NKEA 1E6VB 3GCWP 3CJ2A 3TUJC 1LW0B 2AGQA 2DH9A 3MMBA 3R6GB 2CJAA 1M1GA 4YFUA 4LF5J 4GMKA 1VGYA 2CQ4A 4DFMA 2E5JA 1L3VA 4PQAA 3LANA 3I9ZA 2G0CA 4WTOB 1C4CA 1URNA 2HBZB 3M8RA 4DL5A 1GAOA 4OI2A 1RTHA 1HQ2A 2HVHA 2M70A 2MKIA 4PRFA 4ERDA 4NLYA 4F25A 2VBYA 2E5IA 2EC0A 3C6TB 3ETOA 1RHKB 2RSQA 1T9TA 3KYLA 1IQTA 5EX3A 3HZGA 1YBUA 5CD4H 2J0SD 2GX8A 1JLGA 1ZOTA 4ZPVR 1IKWA 2P2CB 5CCMA 1SI9A 5E33A 3TZWA 1TQLA 5FDLA 4QR0A 3VAJA 1OQ6A 4LR9A 3T1HF 2JH3A 2YWWA 4USTA 1IUJA 1RACB 4JI3J 3P49B 2FHJA 1LEOA 5GMEA 2CPEA 3MM6A 2AWZA 2A6MA 4OYXA 4Q2MA 3UDCA 4B9UA 3ZTPA 1F2GA 3K7RA 1YIJS 1MW7A 6AT1B 2A2CA 1CC7A 1F2HA 2Y3YA 1YBTA 5LMNJ 1URRA 2E7WA 3MFHA 4PQUB 4B02A 3MM5A 1UMJA 4IH7A 4C8MA 4QWAA 2VKZG 2FTRA 4IO1A 1UA1A 4WK1A 1F9EB 5B0BA 4YB7A 5K20B 5A8RA 2VV5A 2HNZA 1RQ0A 3B8HA 1HFEL 3DMJA 3U7JA 1WC1A 2FHKA 4Y28C 5ADZA 1GX5A 3B4MA 1RCOB 2XWYA 3P96A 1E6VA 3DNCA 1WOSA 1F1BB 2OUGA 2IHR1 3TA0A 3I31A 4C0HA 1IBLJ 4DV5J 1CJKB 1GMVA 3CIMA 1CC8A 4LVOP 2NCKL 3AA9A 1RWKB 3EGNA 1LWCA 2Q43A 3J7A1 1IQZA 4ZLLA 3NRBA 4ZK7M 5IFMA 1MNEA 2UXBF 4O44A 1HWUA 2HHPA 2MKCA 1TAUA 4ZMMA 3C6TA 3G86A 2B7BB 2HVZA 3ZXWA 2Y0BB 1DTTA 3DGVA 2BE2B 4KY3A 4I4BA 2HWIA 3KDOA 1OMSA 3P5BP 2WBMA 2CPZA 4NCBA 4AFFA 4M63A 2CDQA 2J9DE 3PKMA 2XI2A 3TJ9A 3I4HX 1MMDA 2XMWA 4K4YA 3R5DA 4ZP9A 3D7SB 1MU2B 4ILLA 2VDHA 3NCQA 5HATA 3AJ1A 4NOHA 3NCRA 4QCLA 2LCWA 1FKPB 2GJIA 4DR6J 3A3NB 5AT1B 2BZ2A 3IFEA 1WI8A 2H54B 2JEJA 3ZTSA 1UP1A 1SJ1A 3BBBA 3FQLA 2YKMB 2QGFB 3R1HA 3PW0A 1HW8A 2BMBA 4EI2A 1UVLA 4E2FB 2CQ1A 3HFZB 3K5OA 4F67A 1YTYA 4GC7A 1XK8A 2BANA 3DM2A 2YVSA 3VAMA 4DR1F 3BR9A 3M8SA 1VC5A 4FPIA 3SIPB 1CJKA 1JJHA 1RT4B 1M5PC 2B8QA 3M9NB 2P9EA 1VQ6S 4P7TA 1RE1B 1YKWA 3N01A 4EO6A 4FYDA 3OR1A 5B7WA 2VG6B 4ZN3A 3W62A 3GFHA 4DV1J 4IRCA 3I96A 4JI8F 3CD5A 2G9OA 3G6YA 4MAKA 2YWEA 3LWMA 4WJBA 1UPPA 4KKOB 1H2UX 2HWHA 4JOUA 3QLHB 4DR2F 2V4RA 4ED0A 1NJWA 1HI1A 3MAAB 2DNHA 3BN4A 4HH1A 1NDCA 2CQIA 3MR3A 2JLGA 3MOZA 2R7WA 3VAHA 2KT2A 2Y0SD 3OTEA 2V8HA 3QMQA 5K8NA 4ED2A 3RBZA 3CO9A 1VRTB 3CO0P 1QE1B 2C2KB 2HZCA 1WORA 1HWKA 3DU6A 1RT6B 3PW5A 4KPYA 3KK2A 4DL7A 3KK3B 1T9WA 4QW9A 5DZ7A 1MU2A 3HMJG 2L9DA 3CJ3A 5I42B 1RWMB 1VK3A 3RAMA 2XG8A 5GADU 1R0AA 3HZEA 4CLTA 2HFNA 2JX2A 4B3TJ 3W9IA 2AJ0A 3CDAA 1JNZB 2X3GA 2YKMA 3CCES 1RWUA 3WC0A 2DK2A 4FXWA 2F4VJ 1P9QC 4FF3A 1VBZA 2CPFA 1G4CA 1NKCA 2HZAA 2JSXA 3IG1B 3C15A 4PXCA 3O2IA 1FTRA 5J2PA 1X31C 2OTJS 1D8ZA 2YWHA 3OSNA 2BQRA 5E41A 4ECVA 3MHYA 3BM7A 4H4KC 2JEIA 5GMKa 2MGZB 1W7WA 1CJVB 2KVIA 2JFDA 4ICLB 4EFAC 4K7QA 5JMNA 1QD1A 3QZ7A 4RW6B 4OX6A 2VG6A 3OTCA 3KG4A 1KQGB 4DQRA 4C8LA 2J5AA 3B6BA 3VAIA 4I1TA 3JTOA 1N0UA 1KN6A 4M5DB 4KKOA 1NDLA 1VIXA 1QUPA 3MPWA 4LF8F 1VQYA 3B54A 3PHEA 2CUYA 1R8AA 5DJBA 3RB4A 1D9AA 1S72S 4KHPJ 4PR6A 1TKXA 3MAAA 2A3JA 2AYBA 4Y2AA 2W9BB 4RBVA 1TUWA 2FYXA 2ZE2A 3SXLA 4U96A 4ID5A 2PEBA 3BDPA 1KONA 1SV5B 1WHYA 2RH3A 3E01A 1QE1A 2IY5B 2ADCA 5DO2A 1EX8A 2RIJA 1U26A 2BW2A 3OUYB 3QGPA 3CCQS 2AKWB 1IN0A 3OQ2A 3OHAA 4WCEQ 3AD9C 2CQPA 2RRAA 4Y2KA 3O3LA 4HHJA 3IRXB 4KR0B 4XPEA 1T05B 1YWXA 4AL5A 3C66A 1JLQB 3HCXA 3BJYA 2FGCA 1XTZA 4X4NA 2H1YA 3IBFB 3IG1A 1RHUB 1U1LA 1PYTA 1AFJA 2OLWA 1K73T 1N48A 3UCGA 1IR2A 1NZ8A 1MWYA 2XMKA 4NEZA 2MGZA 2DRBA 4KGZB 4JI6J 2JOQA 2Z56B 4KSEB 2RE1A 3A1YG 3TANA 2BACA 4C97A 1WHWA 3O5TB 1VQPS 3CJ4A 2VASA 3AOBA 3QAUA 3M6UA 4MYUA 4F0MA 5C7PA 5KFTA 3PXGa 3M30A 1XNRJ 1TKTA 3PHTA 1GTHA 4WIIA 2MLYA 2CRLA 1VOMA 4I6WA 1CLFA 4X4QA 1JMTA 3MMAA 3PR5B 2JLEA 2LEAA 4UUXA 2M52A 3JQJA 4AUKA 3I82A 2E9RX 6FD1A 3W5XA 3PEHA 2YKPA 2WW4A 1XIQA 1BWVA 3T3FA 5AXNA 4WXWA 2YKOA 3ZC4A 1ICEB 4ZHRA 3OUYA 2KN4A 3TI0A 4CNYA 3CJSA 4WBFA 2A1BA 3M9OB 4ES3A 1NSQA 1KFSA 2OMOA 1IKVA 3OV7A 4O4GB 3HT3A 4RW7B 3CSKA 3Q8UA 5C2CA 4F36A 1WUUA 2FZGB 3D1OA 3ISND 2N3OA 3DRPB 4F7VA 2XZDB 3KLIA 2W9CB 1HNWF 2UUBJ 1S9GA 2OHDA 1JLQA 2YH1A 1VQ7S 1FDBA 4QIGA 4JB8B 3P5TL 2ZH5A 2IMOA 5HSPA 1ULRA 4RW9B 1A7GE 4EK2A 2FVSA 3SQGB 4CLUA 3MEDB 1S49A 3UN5A 2HLUA 4AL7A 2HIYA 2FUG9 5KG6A 3TA1A 4RUCA 3QT6A 4UOHA 3G8TA 4I56A 5T7LB 1JB0C 4C9DA 5LSLA 4DU7A 1Q95G 3KJFB 2XO7A 1I1GA 3BEGB 1X4BA 5A8KB 4C2MA 1D09B 3CC2S 3ISNC 1IJFB 5K9FA 7FD1A 4X4RA 3MUTP 1V9OA 2VFTA 2V8DA 2NXEA 4KB7A 3EMTA 1NLKL 2ZM6J 2GJ2A 1N32J 1RT7B 2PDAA 2FHJD 2LQ5A 5HO4A 1GMWA 2KRBA 4WKRA 1RTDB 4Y00A 3TNVA 1FNMA 2MY8A 4ED5A 1N88A 1FXLA 1FD2A 1JLAA 3OBIA 2IYIA 2FZKB 3FBCA 2PO4A 3QWUA 4MIAA 5F8LA 1IJEB 3JSMB 3N5BA 1GXTA 2E29A 3IMQJ 4K5SA 4C3KA 5HQ8A 1MROA 1OO0B 4CYUA 3WQPA 4E8UA 1REVB 3DLGA 2QIFA 2CYYA 1S6QB 5L1LA 4LF5F 1X9MA 1I51B 2B4UA 2DR5A 5F8NA 1X4CA 2ZHBA 3UO0A 5EX0A 2KJVA 4QIVA 4CLZA 3CJRA 4LR8A 4KT0C 2D7SA 2YKAA 4KPCA 4RNMA 4C0OC 3PY8A 4RX6A 3R7BB 3S8SA 4PCQA 4MFBB 1TUGB 1IKYA 2QL5B 1WDTA 2EK1A 3IBCB 2J6TA 1S1WB 3IAS9 4TU7A 3VZHA 2YBVA 1NK8A 3SQGA 3DRSB 2DNOA 2W7OA 2MQNA 3BV8A 1C1CA 4YHHJ 5GAGU 1OYDA 1YITS 1U1MA 2DY1A 4ELUA 2UUWA 2FVPA 1QDUB 4JI3F 3MR7A 1NK6A 2JEFA 5HBMA 2BRLA 3M9MB 1F60B 4CP5A 4X62F 5JVGQ 2V8PA 5HQMA 2XO6A 3QT7A 1OPZA 3PW4A 3BGLA 4YP3A 3KUGA 1RT7A 3ILJA 4JI7J 4ZLJA 3G9CA 5LMNF 1U2FA 4B3SF 3ICLA 3KTQA 5HMWA 3JQMA 1RKJA 4FZVA 4JV5J 1IWAA 2D41A 5K5MA 3J7YI 4BHQA 2ASJA 2KYXA 2RUGA 3PO5A 4KH0B 4F50A 3AXMA 1PBUA 4A47A 3GIJA 5KOXA 3IRWP 2GIFA 2CADA 1S6QA 1KOOA 2AZ1A 1IBLF 4DV5F 2BXJA 1WHVA 1SC6A 2MZ1A 2KFYA 2HS4A 4AD6A 2XY5A 4Q2LA 3L09A 2X1AA 2FD2A 4H4OB 1DHMA 3GU0A 4I2PB 1CPZA 2K06A 1Q79A 2DGTA 1RSCA 1F5BA 2VU5A 3PNIA 2MQMA 5L9XA 3PX4A 4HDHA 2HS0A 3PDNA 4MKAA 1DBDA 4X2BA 3SFGA 4A8KA 4IDKB 3LP1B 4QPXA 5H1SV 3NEKA 1S1WA 3ILLA 5J2NA 4NLGA 5F8IA 3UDLA 1N34J 2QLBB 1X9SA 1RT2A 3GJTB 3AQPA 2R7OA 2R9LA 2FVCA 1HNIA 4RPFA 4Q0BB 4DSIA 4LQ9A 2FPHX 4JV0A 3G82B 4Z7YA 5LXYA 3TYTA 4NRTA 1X4EA 3HP6A 3CPWR 1XJWB 2LEPA 4J9OA 1ZTTA 4WFZA 1NCLA 3VAFA 1JXEA 2NZCA 1R3NA 1FX4A 1KQSR 1XMOF 4Z37A 4DR6F 2E44A 2DCUB 3ITHB 1JLFA 5H9FK 4IG3B 4LSLB 1LWXA 3VGSA 3GMGA 1EB0A 4KFBB 4IH5A 4DS5A 1C4AA 4QWBA 2F8HA 3G6VA 3OFHA 4NWBA 4WZMA 2ZFHA 2EFOA 2DXDA 3JB9k 1S9FA 4OHVA 4HVZA 1YBAA 3HKZD 2ZHOA 4G6VB 4KRWA 3BSAA 4GRSA 5E3QA 1TV6B 2XYPB 5C42B 5FJ4A 4N41A 4DR7J 1NSPA 4K4TA 4DHVA 1QY7A 5E0OA 1OJ4A 2G0IA 5J2QB 2XLKA 1T0TV 3F44A 3M6XA 2IAJB 1CJTB 3W2WA 3MEGB 5AJ3J 3UR3C 1KQFB 2W4PA 1VBKA 3QAEA 2G2ZA 1AW0A 2AF6A 3PJXA 2BUNA 4BC7A 2CNNB 2R7QA 2DNGA 1HMVA 2NXNA 3QRPA 2KVQE 4EGLA 4Q0BA 4L72B 5GAHU 1FT8A 2KZZA 3KLHB 4M5LA 5CYQB 4NCGA 3RTVA 4L3NA 1NEEA 1ZYQA 4QYZK 1WEXA 1ZM2A 3DFEA 3LH2S 4B9TA 3KNAA 3UVJB 5A6WA 5FD1A 4A46A 1KSPA 1CQMA 4C11B 5KFIA 1ZZNA 3G6XA 4IG3A 4Z7CA 4B3TF 4R0JA 4FNIA 4Q43A 4AL6A 3RR7A 2QLJB 2ZZMA 3RYLA 1RDRA 2KM8C 4KFBA 1SH2A 2QO3A 1Q5YA 4DCOB 2OMLA 4FVCA 4KGMA 3D0IE 2COLA 3BGRB 2NPFA 2E1AA 2BX6A 4OLOA 2Z30B 4IR1A 3K89A 1NNDA 2YNFB 4KIAA 3A3PB 2W7PA 1VBYA 3I0SA 4O3NA 2OEJA 3O8WA 2A2DA 3DU5A 2RHSB 1DTQB 2ROGA 1H72C 2WONA 2E5GA 2RHQB 5KFLA 4TQSA 5J2QA 1N56A 3W66A 4LF6F 1D9FA 2DYAA 4ECSA 3NMRA 4K0KF 4I68A 1FJ7A 3TRGA 2IAJA 1NJYA 4YY3F 1FEEA 1QVGR 2OD4A 3HHLA 1IR1A 1PYSB 1N6QB 3MUMP 5HK4A 2ZZNA 1P27B 1FRJA 2J0WA 3HVTB 2F9DA 2ZWPA 1JKHA 1MG7A 3ZZZA 2LU2A 3DDKA 3C6UB 3O6QA 2V0NA 3QJLA 1TTHB 2PMZD 1GH8A 1RLDA 2O67A 3HK2A 4WFNQ 3JSYA 5CYQA 5KFUA 3HVAA 4YQWA 5HJYA 5J1NA 2AW0A 3ETMA 1X9WA 2KI2A 4CLSA 2RILA 1HI0P 2Z57B 4YOEA 2WB4A 5IWAJ 3HLUA 2HWTA 4PYAA 3I6PA 2C2NA 3UVJA 2Q79A 1U8SA 3PG9A 3I56S 1CS4A 4WZQA 3GIIA 3EVWA 2QG9B 1EP4B 5D4OA 3MAHA 4D3HA 1Q8IA 3V5RA 1W26A 3M8PA 2RRNA 5G0RA 5K14B 1N5VA 4RW4B 3ENVA 5A8WA 1XMBA 5IQQA 4FBUA 4OZ3A 4DXLA 2HS3A 1HKAA 1TUVA 5DQIA 3TEGA 1BHNA 2MZJA 2AJFE 1U24A 3HJVA 2IC3B 1K9MT 2UUAF 1Y5NB 2RU9A 4ZA1A 1YRUA 4FXDA 2PC6A 1JLCB 2P6TA 2XYHB 2HZVA 2DR6A 2ZOFA 3UN3A 1N5YA 3HVRA 4JI0J 1NZAA 1HNVB 4F4XA 2VQEJ 1HNXJ 2V9WA 1XNRF 2IRXA 2JEGA 2DHGA 2FY1A 1RTIA 4X4SA 3QGHA 4N47A 3D6MB 1PG5B 2KTQA 4DCPB 1M1HA 3C6UA 1RAGB 5F8JA 4TY8B 5B0DA 1RU1A 1U8WA 4U9RA 3ULHA 2KRRA 2FVRA 3V4IB 3ENWA 1GMWD 4L6V3 3T5HA 4K4SA 3CJTA 3M2VB 2BJ3A 1EKSA 1K44A 3EPGA 2HQCA 3KJQB 4MTPA 2GO8A 4IFYB 3TX8A 3ONQA 1UVMA 1WSRA 3UW1A 1J5EF 1JXLA 1CVJA 5J1EB 2ZKUA 5T41A 1V5IB 2Z2MA 2UUBF 3SSSA 2AU0A 1Q8BA 2KXFA 3PRBA 1M0SA 5K14A 1FCAA 3I0RA 4Z2XA 2OSRA 1KKHA 2PA8D 4L76A 3OL8A 2GHWA 2ZEJA 5LJ3Y 3T5JA 5CA5A 2BM1A 3NAIA 4OYIA 2DRDA 1HD1A 4NE9C 4MJKA 2IC3A 4M5NA 3ADAC 2J7KA 1BQNB 2WVFA 4G1QB 3NKYA 4QR2A 2DNLA 2MKYA 2JL9A 3FJ2A 4ZVEA 1HNVA 2MJNA 3M8ZA 1WC4A 1Q53A 2F8EX 3POTA 1PILA 2ZM6F 1N32F 3PRVA 3OR2A 4JI2F 4EBDA 2FLNA 2D74B 4OYOA 1VQLS 5GVQA 2UUCJ 3MMCA 2MXYA 4O4RA 2YH0A 3PO4A 4E0DA 3KJVA 3FUYA 4C8NA 2CQBA 2HQ3A 3EGWB 4RJVA 3GZ7A 2W01A 4TYBA 1EETB 1TVRA 2HRUA 3M2VA 2VBXA 2PN6A 3U02A 1JLEA 3WZ0A 3JTNA 2HNYB 3DRYA 2PI5A 2LQBA 1RHJB 2JNJA 4IFYA 3VGVA 2IM0A 2CJQA 3LPEA 3EE3A 4C8YA 3FSXA 3SBMA 3WDOA 2B0GA 4I0WA 4KE5A 2MZTA 3BGOP 1VS3A 1S97A 2B6AB 1Y00A 1UVNA 2EW9A 1PAEX 3FFIA 2QEXS 3A4TA 1VJWA 4P74A 4K5RA 2EKNA 2NXJA 1WTFA 4NLUA 1B99A 1WI6A 3RBXA 1PC5A 3T9NA 4MT1A 4YHHF 5F8MA 4AXIA 5FLXU 2K1RB 2VFRA 2MHEA 1SC1B 3TZXA 5CD4A 4GKKJ 5BYRA 3Q83A 4U67Q 3WIVA 1N5QA 4N8OA 2CQHA 3W5ZA 2LU1A 4DL6A 2VFVA 5HP1B 1T94A 2CWXA 2R8IA 2BKOA 1HIYA 1VHIA 1JXVA 2JVOA 1NPRA 4DR4F 1IBKF 3OSPA 4JI7F 1S59A 3MPVA 4GVBB 1NUEA 2LP4A 3GR1A 3K5NA 4QIEA 3MR6A 1XBWA 2BA9A 1XMQJ 1TFYA 3V81A 1KS2A 4WPAA 2BJEA 5GADI 2G1DA 4OZNA 4EBEA 5IM0B 3LGNA 4KHRA 5A0YA 4ILMA 1NH7A 1SJFA 2QYGA 4ZVSB 4CH0S 4ZPCA 4M94A 3KLEA 4F4YA 1FVQA 1FXRA 4XPCA 1JX4A 4LFAF 4F3OA 5M2PA 3QT8A 3NGSA 2C2DA 4WKYA 5F41A 3R1LA 1NB2A 4HACA 4OHZA 2R42A 2AGPA 4N5SA 2XSJB 1HBMB 4KO0B 2QA4S 3AB2B 4ZVOB 2UUTA 1RT5A 2VFUA 3S01A 4K59A 1FDAA 4KGKA 3DOKB 3UR0A 2YPYA 3T1YF 2CA9A 5KFWA 4BBYA 3MPYA 2EBGA 4HKQA 2HAIA 2AHOB 2HHHF 4RNFA 1FEHA 2IRYA 4LT6A 2K1RA 1HPZB 1Q5VA 1RT3B 3OT9A 1VQ5S 4V19J 2AYEA 1DFDA 1TR0A 5J2MA 1MMLA 5HP1A 7FDRA 3J7Z5 3DRXA 3BGFA 2GA7A 2YX1A 2ZBIA 1D3WA 1VYAA 2IPOB 1RGVA 3LP0A 4OYPA 8ATCB 4Q8EA 4CQ1A 2XI3A 4ZCIA 2X51A 4H4MB 4JP8A 5HL7Q 1AUDA 1ZZFA 1RHRB 3QQCD 2HAFA 4DV2F 5DS7A 2H4WB 3C3LA 3GYGA 3J7ZT 2KO1A 2K7KA 3BQ0A 2M9KA 4LSNB 1FRMA 1O8BA 4OI1A 3WC2A 3C19A 4ECUA 3B78A 2DD8S 2ZKTA 2Y9HA 4J37A 2CNOB 4QIFA 4DV6F 1FE4A 2W1BA 5ETOA 3FBBA 2PFDA 2WCXA 2ILYA 4DR7F 2HRYA 5KG0A 2K3IA 1J2VA 1FWKA 4FP9A 2XSJA 3UDVA 1HBMA 4KO0A 4JV1A 1HL6A 2AIRB 4MYTA 4L3KA 3MFIA 2OI2A 5DM7Q 5AJ3F 3RG6A 1KBRA 4QW8A 2MSSA 5AXMA 4LMZA 3F0NA 1YI2S 2DHAA 3DOKA 3K5PA 1U48A 3GJQB 3FEXB 3Q24A 3HHLD 2R8KA 1LK7A 2BQUA 3ZZ0A 2ZUGA 2QN6B 2LKZA 3OVBA 4N77A 1RWNB 4EYHB 4DUYJ 3JAMY 2VG7A 3RUBL 1U1NA 1T9UA 1S48A 3N79A 3PRDA 3AJ2A 2ZHAA 2VHGA 1KTVA 3CJ0A 2LQJA 5A2QY 1ZTWA 2N3LA 4P10A 4LSZB 3UE2A 4HHHA 3LUYA 1U1RA 2WVBA 2LXUA 1VJQA 4CLFA 3HHLC 4DL3A 3UFCX 4H4MA 1SL1A 4Y65A 1TL3B 3TVZA 2BJ8A 5HVHA 4DG1B 3H40A 4X4VA 1RADB 2FJAB 4NPOA 1WKLA 4LREA 4B9SA 2ZD1B 1LWFB 2R2TA 2QE5A 2OPQB 4NI2B 4NYZA 3J80Y 2HBYB 4CTAB 4C3LA 4BWMA 3UCZP 1C0UB 4AXJA 1SJQA 1P9YA 4ED7A 2EC2A 4NRUA 3RBEA 5IOLA 1T03B 2C1EB 3IS9B 2I5JB 4I6AA 1DQ9A 4NLPA 3QRRA 4CM0A 2KH9A 4ANEA 1KDNA 3GFZA 2NS1B 4MKBA 4JI8J 4DX6A 1RZMA 3MTJA 3AODA 3A8EA 4UOFA 4WP9A 2PI4A 3W2VB 1R8CA 1G3OA 4PUOA 2D9PA 1ZAWA 3HM9A 3CVKA 4YN3B 3MMJA 3KMSA 5IWAF 3H5YA 2NSCA 3TP2A 2Z2ZA 2FLLA 4ED8A 1SH3A 2WVCA 1KRPA 2FIUA 4PXDA 1WJ9A 3VHQA 4IQXA 2DGOA 2GAGC 6FDRA 1B0TA 5CHCB 1TKZA 2DGXA 4B3OB 3GG1A 4QOTA 1VQSA 3I5AA 1R8PA 1U4BA 1I94F 3KLFB 4R0EA 1RWOB 3O1LA 1RBLA 4X65J 1S12A 2OPSB 3OXGA 1X0PA 2AT1B 3OFGA 3EWGA 5HLFB 4ZS6A 3CE8A 3SV3A 1X5TA 1KHWA 2O1PA 3MM8A 3SSRA 2HMIA 4KYZA 1J27A 3PV8A 3ZZPA 4NI2A 3CCJS 2Y1RI 2ZUAA 1QTMA 4O0NA 2LXFA 1Z1ZA 3TA2A 4BWJA 1P8GA 1FKOB 2R7VA 1FKAF 4CTAA 4G65A 2FLPA 3F41A 3M8YA 2O66A 2HQGA 4USUA 2ZH8A 3NOCA 2V34A 3CGIA 4RBTA 4TLQA 2I0XA 1GK8A 1UZDA 2ZVSA 3TVKA 2B5JA 4DN0A 3IS9A 3BN7A 2VQEF 1HNXF 4HI1A 2CPDA 2VIHA 2EFQA 5GAGI 2IJNA 2LEBA 4J9MA 5KT4A 4LFBJ 1JLBA 1XWLA 2PEHA 3GJRB 4CT8A 2FC9A 2ERRA 1RUSA 2WSEC 1S77D 3HFKA 4WYWA 1BY9A 3M32B 2MQLA 4LF8J 3TAMB 2RDJA 4K4UA 5H9FJ 2QSFA 4LIRA 3W2VA 2AV5A 3Q23A 3THPA 2AX0A 3DOMB 3SV4A 1WSVA 2B9WA 2Y8WA 4EUVA 1S1VA 4OZ2A 3US5A 1QJHA 1UKUA 4RW8A 2NUHA 5ETRA 3KFWX 2GQ2A 3TAQA 5EUHA 2XQCA 1ZM4A 2ZC4A 2MKKA 2CQ3A 4KV8A 3PJ9A 5KFGA 3D4JA 3H2VE 2EEYA 3HT0A 3IBWA 1UWBA 2E9TA 5KFJA 1NBEB 4HYKA 5D8HB 4OLPA 5IC6B 3A8KA 2JRSA 1HBUB 1T3OA 4ANCA 5T14A 2HHQA 3OLBA 3FGVA 3DCAA 2XNRA 1WC3A 1YQHA 2RUSA 2O01C 4PYDA 3Q8QB 4CH1A 2W25A 4HR2A 1IR0A 1KWMA 3T6JA 4HL9A 1BC6A 1KEKA 1Q82T 4R8UB 3QYYA 1ZA1B 4J7CA 2ZBRA 3GONA 4UW2A 3E8OA 3D67A 4P52A 1PIEA 4C6AA 4LVNP 2R7TA 1LV5A 2ZH1A 2PT0A 3AOAA 3NP5A 2VC1A 3SDEB 4L73A 4UF4A 4XDCA 5KFDA 1FJEB 1FK9B 1T95A 2XHCA 3Q89A 4RO0A 3BKTA 4IYQA 5LXRA 3PM9A 4USHA 3KHGA 2XMMA 1J5OB 3NS5A 4F2SA 2FZCB 4GKJF 1UPMB 5E7OB 2W2OP 2CPIA 1HBOB 2BW7A 2W7AA 2WOMB 2AJ4A 4DPXA 2FJBB 1H73A 2GVDA 2KHCA 3SQOP 4MKVA 1C0TB 5E2QA 2VPWB 4F0HA 1VK8A 3K59A 3M6VA 3LP2B 1Q81T 3KMQA 2BYCA 4QQBA 2M2BA 3M7VA 1B70B 2QSWA 1HNWJ 3NL0A 3K8VA 2OEKA 1SL2A 1N36J 2DVIA 1F5CA 1U0HB 4WE1A 2ZH7A 1GT8A 3QO9A 1HQUB 3M1VB 4M5GA 3JAMU 4KBIA 3NGTA 4KGXB 3RJMB 2ZNZA 4K50A 1N5SA 5C25B 1FNXH 1HR0J 4OX7A 3MAQA 3U1MA 2W4DA 4PABA 2Q66A 5A2QU 2XM3A 2HHXA 4ECQA 3ZO7A 3U27A 1RTJA 4DX8H 4ID8A 5I3UB 1VQNS 5GAHI 1KFDA 1WEZA 2AD9A 1XR5A 3BO4A 2MYFA 2ZH6A 2KB2A 2J0QD 1SUQB 3SDEA 1R8BA 1RWPB 2QMUB 2R2SA 1ZPVA 4ENOA 2ILZA 4WFYA 3FRZA 4DWIA 3C16B 3GWCA 3V6DB 1XMQF 1WEYA 4QPTA 4ZP6A 4B08A 2EPIA 4F3QA 4DSFA 2E7VA 3ENQA 2B4VA 1YJRA 1HBOA 2HVDA 4YMEA 3N9UC 3ET6A 2EBEA 4ED1A 4IO9Q 3VWSA 1RYRA 2PSZA 4LFCJ 1JQGA 3PW2A 4ZVGA 4B3RJ 2OD6A 1WC5A 1S6PA 3HFVA 4A48A 2I2YA 1FNOA 4WP8A 2NQPA 3DGPB 1VQMS 4JUZA 1KLNA 1S57A 3CJKB 3K0JA 1H38A 1XEZA 3NGKA 3HDSA 1QSLA 2DNMA 5F3ZA 2HNDB 3LO3A 3R7SB 2IM3A 2PE8A 2IVFB 3FVYA 5D77A 4PEOA 4DLGA 3EXYA 3CDUA 2J6UA 3K58A 1FFWB 2FLOA 1S1XA 1ZS6A 2DGSA 3BKUA 2RVJA 3PVXA 4LBPA 3DLEB 1V3ZA 1B7FA 1K47A 3NBPA 5D0GA 2CQDA 4Q5VA 4NCAA 2VBWA 1AA1B 3I5BA 4OYMA 1S1TA 3F56A 2C2RA 3CDEA 3LPYA 2BRKA 1YHQS 2GHVC 3G71S 2DR8A 3V6KA 2NR0A 3CC7S 4QJVA 2QYCA 1FRKA 2WSFC 2M88A 3NLCA 3BQ2A 5DG8A 5HQLA 4X62J 3DOLA 2P5VA 1R27B 3HI9A 4X4UA 4I7FA 5DDPC 3KK1B 4MK9A 2EK6A 3NWRA 4NLRA 4DUTA 1RHQB 4CLLA 1R6VA 3AB4B 1UVJA 4B3SJ 4ZLPA 1UTAA 4HLBA 4QU6A 3N4WA 1SJ3P 1KTQA 2ROPA 2YNGB 4C8OA 2ROEA 5F9NA 3CF5Q 5D6GA 4F26A 3M2RA 1S10A 4LR7A 1RK8A 4P72A 4DPYA 1X5SA 1EARA 2VPXB 3AA8A 3G8SA 1L3SA 2HQFA 1LW0A 1BUXA 4EWTA 2LXIA 3DGPA 2N7CA 4LRCA 4F02A 2W2MP 3CJKA 4A4JA 1B0PA 1RT1B 2HGNA 4TLRA 3W9JA 1SH0A 4M95A 4LIWA 4C8KA 2FC8A 2GNKA 1S1UB 1Q8LA 3BYPA 3NCPA 2JDJA 2BV3A 5IV3A 2QTWA 3VGTA 3UNGC 2CKWA 3DLHA 3GSDA 5B0AA 4P73A 4U7UD 3J81Y 2M3DA 4TQRA 2W8LA 3IR7B 2ZWOA 3K2YA 2H4YB 3Q8YA 3AXKA 3TW0A 4F0KA 2HYIB 5CCLA 5GAEI 3T6BA 4XAKA 3H90A 4DUYF 1MLAA 1QAIA 3DRRB 1S99A 3M4XA 4R5PB 3NWGA 4FPRA 1UZHA 3L9ZA 2IM1A 4ZN1A 1XQIA 5CH7B 1X60A 3J7AN 3EZ5A 2VFSA 4TU8A 1XMOJ 3UPFA 1NJIT 1YDLA 2CWKA 1DQAA 5E3RA 5CYJA 2IA0A 5KFPA 5L9NA 3BGUA 1KLMB 4PQUA 3W1YC 1OY6A 4OV1A 2O5DA 2ZNYA 2GMHA 3CCZA 1IBMJ 3OVAA 2RF2B 2OKQA 4ECXA 4ZJQA 5L1IA 1X5OA 1FVSA 2QA4G 2UVRA 1VC0A 4C7QA 2QT7A 3FMWA 2K7JA 2DGUA 2QZ8A 3MM9B 2UZAA 2APOA 2J8SA 5KT2A 3QIDA 1NH8A 4WU2A 2IVMA 4QR1A 1BWEA 2XBPA 3K8WA 1EJ7L 3GP9A 5HAOA 4DUZJ 3CNQP 4X4OA 3LOUA 3BYRA 4I64A 1S6UA 1HD0A 1H98A 2BE2A 1NK9A 1EQMA 1S0OA 3R5CA 3X1LB 2KDOA 5KFOA 2KT5A 5L8RC 1S9EB 3V2UC 3D1QA 4NYOA 3R7NB 1B0VA 1NHKL 3CCSS 1F0XA 4CO1A 4Y2MA 2IYGA 2ZH9A 3SCLE 4PPZA 5M2UA 4X64J 2R8GA 5HI7A 2KG1A 1XR6A 2XWXA 3SMZA 1Q8KA 4IQMA 1TL7B 3CDWA 3MZIA 2RQCA 3HSGA 3WIUA 2NSBA 1KD1T 5DQHA 1TU0B 2DNYA 2ZOGA 1FKPA 1GXUA 4O3QA 1G1XA 3A8IA 5LJ5Y 3DLJA 2V50A 1F9HA 4NA2A 4Q44A 3TZYA 2QJ3A 4X65F 3NXZA 4ECRA 4C8ZA 2EFNA 2H5JB 3MCMA 4DSLA 1F3VA 3Q0AA 1Y11A 3GYNA 4HHUA 2RF2A 2ZDPA 4DPWA 3AH6A 2DBBA 3R2DJ 2K2PA 4K2XA 2XMJA 2UU9J 3DHXA 2G2YA 3BS9A 3QPIA 4C0BA 1ZBTA 1GMUA 1HHSA 4NEYA 3WX4A 1TMMA 3MM9A 2HFSA 3TUIC 1RT4A 2UP1A 4KGVB 5L38A 3PX6A 1YJ9S 3OVSA 4LF6J 2NZ4A 4FNHA 4K0KJ 4P2SA 4CI0B 1FX2A 5K8MA 3L7UA 1UETA 3OTBA 4LFBF 1U09A 4RU2A 2CQGA 4YY3J 2XEXA 1TELA 4KAIA 2AZ3A 1BE4A 4ZPBA 4OHYA 3QLHA 4DV3F 5U47A 3SSQA 2DKOB 1NDKA 4RLEA 4ZPDA 2OJ3A 3IC1A 1TFWA 3VZIA 1LNQA 4CO2A 2ALZA 3N6NA 5IS2A 4YEAA 3G4SS 4ZPWR 1R43A 4F8RA 3RAQA 1VRTA 4OI6A 4S0MA 3TARA 4ZCLA 1RT6A 1NHVA 3CD6S 3JYTB 3HHKA 3KK3A 4ZVHA 5I42A 4OJ1A 2DO4A 4OX9F 2IRUA 4PG4A 4DR3J 1EQ0A 3M2UB 1TMJA 5ETMA 1VRUB 1Y0HA 2MQOA 5KOWA 1R8HA 4UOCA 1VIOA 2L41A 2O3DA 5KFZA 4I69A 2EFVA 2MY7A 2IDEA 1A6LA 1RHMB 2DIUA 4WK3A 2I38A 5ETKA 3IO1A 3H7HB 1F9FA 3CIZA 2XC9A 4C3MA 2UUAJ 1LFPA 1TL4A 3GSIA 3FKBA 1FTCA 2RKIB 4F2RA 1CJVA 1WD6A 2NUUG 1R6YA 4ICLA 4MMOA 3FBFA 3PIOQ 4LQ3A 3ZZRA 3BZQA 2OSQA 4P75A 4W4MA 4RW6A 2P9CA 1I3OB 3QFHA 4ZJLA 2V2VA 1IM6A 3T9ZA 4M5DA 2M0GB 2HHTA 4XK8C 2OPRB 1VQ4S 1AFIA 2EFPA 4RNNA 3MEEB 3CCVS 4A8SA 1DY3A 4F4WA 2W9BA 2OP5A 2J9EA 2VBZA 2F40A 1EIYB 2MZQA 4DQPA 1C1BB 4OL8A 1NPPA 2V69A 3CTRA 4CM2A 1SV5A 2B43A 2U2FA 1REGX 4ZPAA 2F65A 4DF4A 5K8OA 4GC6A 1FDDA 2DGVA 1X4FA 2M8HA 4RL1A 4ECTA 2VG5B 4YR2A 4DF8A 4CLKA 3KJNB 4J9PA 3ZTQA 2E1CA 3IRXA 1J5EJ 3FEZA 1VRUA 1UJ4A 1T05A 1N33F 2PMHA 3J81U 1U6FA 4DV7F 1X8DA 1IM4A 3ISZA 3N5FA 1KVKA 2HFZA 2F4FA 3IM9A 1T3NA 1N36F 2M4MA 1KHVA 2GAHC 2HW3A 4H4KA 5HMYA 3R97A 4XIUA 3W63A 2IJRA 1B4SA 5KFXA 4CO3A 1MWQA 2B4PA 1Q7LB 3ZZOA 4HTIA 4DMZA 1WKJA 4PG6A 5EN1A 1U2CA 2MDAA 5I3PA 1HR0F 3MTKA 1YG0A 3OXLA 3FRYA 3FC9A 2CJBA 4DZ6A 2J8AA 1WHXA 5HJXA 1S0NA 1Q78A 2F7VA 2Y1IA 2CZVC 5L1KA 4EMDA 1YVFA 3EXCX 1VISA 2AX1A 3HVWA 5F3TA 2GZOA 3DYAB 4JI2J 2VKRA 3MWBA 1LWEB 3T5LA 1FD8A 3MEEA 5FIIA 3M8WA 1GX6A 2LA4A 2BM0A 2XZWA 4PG5A 4EYIB 4PZVA 1H2TZ 1YJTA 1WTBA 1QSSA 4LFCF 1QUVA 1DQ8A 4J90A 2C28A 1M1KT 4B3RF 3NGRA 5AE3A 1W2IA 1WELA 2D3UA 2FHOB 4PPDA 1UA0A 1MN7A 4OX8A 3KUEA 2DT9A 4O4GA 4F3MA 3QIPB 4RW7A 3HSDA 5D4NA 4OYZA 4V19X 2DR9A 2WAQD 3I32A 3GB0A 4ZVQB 2LLZA 3DRPA 3LGMA 4USIA 2V63A 2W9CA 3ZZUA 2V68A 2YX7A 2B8PA 1S7HA 4ELVA 3WBZA 1LFWA 2RQMA 3W8PA 2VH7A 4HH0A 4URQU 4JV2A 4RW9A 1DLOB 2EXUA 5DM6Q 3FBEA 5IC4B 1U0SA 3MEDA 1YRTA 5HANA 3ILOA 4UQGA 5KFQA 2XS5A 2DHSA 1T11A 4LF1A 1WOPA 2GW8A 2AYMA 1O6XA 2MQQA 2YY3A 4M1KA 1GEHA 2RS8A 3MMBB 5T7LA 2C2ZB 5A8KA 1OQ3A 5SUHA 3UN2A 1SQEA 3PX0A 3SCIE 2MQPA 3DDIA 4LF7F 3TO8A 3D6FB 1G6BA 2HHWA 5AE1A 5BXIA 1RTHB 2BJ9A 4DR4J 4B9VA 2I8EA 4PXEA 2RD5C 1IBKJ 2Z58B 2F8MA 3DYAA 1AYEA 3R2CJ 1WC0A 1RTDA 2GIRA 1JLGB 2W9AA 1IKWB 4Y0FA 3ZNUA 4DEZA 4A8OA 2G0JA 5FDLB 4NLTA 2PIIA 2XCPA 1VBXA 4RUHA 3GV5B 1UEVA 3JSMA 1R7IA 4ED3A 2QLWA 5KG5A 1NDPA 1REVA 3MM6B 2BKPA 4LFAJ 4UT4A 1NKBA 2I9SA 2WZ1A 4NZ7A 4LJMA 5KT3A 5DQGA 3G6ES 2POKA 3W64A 4H54A 3MM5B 3G96A 5KFEA 2MJUA 3TQ1A 1U1OA 3LWLA 2V8VA 4MFBA 3WHIA 1N54B 4HDGA 5E5NA 5A8RB 4UZCA 3T1YJ 2GMLA 1L5UA 4P2MA 1RYSA 1HHTP 3DMJB 3DRSA 2GQQA 1L3KA 1VQ8S 2HHHJ 3N6MA 2GHPA 1E6YB 3QNWB 3SEOA 3ILIA 2BVZA 2PGCA 4DFJA 1CJUB 2UXDJ 3KNGA 1QAXA 5SZTA 2HFOA 4NA3A 5KFSA 1LWCB 4PKDB 1HWIA 2PA3A 4BLGA 4DX5A 2E7XA 3A8JA 4O44B 1GFWB 3CUNA 2DNQA 4ZVUB 3R6LB 3BR8A 1VHFA 4FF1A 1DTTB 2XY7A 2BBEA 4OV6A 1IBMF 3DKDA 4DV2J 2QX0A 2X1GA 4PWDB 2VOOA 3HKWA 4JYAJ 1UEUA 1GNKA 1RKIA 2DEJA 1RI7A 4X84A 2A10A 4DV6J 3GQCA 3KLVA 3W8GA 5C2GA 4I6YA 5EWGA 3D0GE 1NU4A 3ZTRA 4IH6A 3T1AA 4RUBA 1AT1B 4ZCMA 2R2UA 3M05A 1GTEA 4H4OA 2CDRB 4I2PA 4OYWA 4RNHA 1OSDA 4ECWA 1HW9A 4C98A 4DUZF 4ILRA 4N7TA 1FRIA 1PJ5A 2XHWA 2YXLA 4IDKA 4TVAB 3LP1A 5K8PA 4N8NA 1IBCB 2GC8A 5HN0A 3OL9A 3CCRS 3A3OB 4LRDA 3LGHA 1PKUA 3IR6B 2BANB 1GQEA 3DM2B 3Q2SC 1E6YA 4PWWA 3G82A 1UEKA 3SI8A 4HT5A 1CJUA 3PEJA 2C3PA 3HSJA 3KKFA 4X64F 4QWCA 1HWJA 3UDEA 4CT9A 1O51A 2WTFA 5A76A 4XTTA 5FLXY 1RAEB 3OR1B 4ZP8A 1OS5A 3Q8SB 3TVYA 4J9LA 3ITHA 3PR4A 4LSLA 1VMBA 2HHSA 4U95A 2ZOMA 3W9HA 2M7SA 2E66A 3L7PA 4J9VA 5DLFA 4K4XA 1R31A 4ZVFA 1VRQC 2GFFA 2MKSA 2MEWA 4PWDA 4P2FA 3HSZA 2VB6A 2XULA 3TEHB 2UU9F 1DARA 3D3CJ 2DRAA 3BSOA 4CIOA 1QAYA 3AOCA 3EPIA 2R8JA 3KK2B 3P8BB 2XS7A 2JHEA 1TV6A 4A8XA 5C42A 5C5JA 3DN9A 1NPKA 1F3FA 3H2LA 2FVQA 3MR2A 1R0AB 2HPUA 2QFIA 1JJ4A 2DGQA 2JWNA 1OY8A 1R89A 3RZAA 3BPSP 1CJTA 3MEGA 2R7UA 2E5HA 5D0HA 1PO6A 2Z2LA 1U49A 3QGGA 2DEIA 2A6OA 1WKKA 4J5OA 3C15B 2WB1D 3D6TB 1NSAA 4GO7X 5J2PB 3PACA 4DZDA 3ENAA 3OTDA 1W2BR 4LUBA 4ZVRB 2V94A 3NS7B 3KLHA 5LMUJ 3FCWA 2QLFB 2J76E 3OHBA 1FJGF 1EHWA 2Q6BA 4X66J 4OQJA 3K57A 2DPIA 2VPZB 4DV0F 3MD1A 3EVOA 1S7IA 4OIXA 2VDIA 1AROP 2EVZA 3EZUA 3IWNC 2R8HA 2L48A 5HMZA 4DR3F 3RRKA 4C11A 2G2OA 2KM8B 1NJZA 4BDPA 2X3DA 2NXCA 2YKNB 2GO9A 4ES2A 1LXJA 2MZSA 1S6OA 3H0PA 4F04B 4CWBA 1H2VZ 1TKXB 1I94J 3C8YA 2C22A 1U47A 4LF9J 5DDOC 1P1TA 4LF4J 2JLFA 2EG2A 4FDFA 3BGRA 4X4TA 1DAXA 2ZE2B 1T8EA 5F0UA 2EKYA 4USJC 3N6LA 4ID5B 5L1JA 3AJDA 3GV8B 3C46A 2JZ5A 1RAFB 3E01B 4TY9A 2IBOA 2YNFA 2KL8A 3R5JB 1F6TA 1K0TA 1Q86T 4LRBA 1RISA 2I6WA 3D9BA 4YDXA 1NK5A 1ELOA 3VCDA 1DTQA 3FCVA 2FQQB 1RU2A 9RUBA 5E3PA 1HLWA 3FCHA 3CD0A 2E9ZA 3HULA 2UVUA 5D3GB 3OTOJ 3H4DA 2GVZB 5KG7A 1N6QA 2CG8A 3BH6B 3HVTA 2DHXA 4M8LA 3D0HE 1Y9OA 2V2QA 5G4DA 4KHMA 4J9KA 2W4CA 3GJSB 1UW4A 2H65B 2VICA 2AQ4A 1F5AA 4EBCA 3ZZTA 3MCOA 1VQKS 1R0CB 1SL0A 4DU8A 3VF0B 3R8YA 2DB1A 3D54A 2FJDB 2C2MB 1S0MA 3PYGA 1TL5A 2UXCJ 2H51B 1ZM9A 1Y3JA 4DFPA 2J9CA 3FQKA 3M30B 1TKTB 2B7CB 1V5VA 5KTQA 3KDNA 3ZZYA 5JUMA 2DR7A 3MMAB 4NXNJ 2YKNA 1PCAA 1EP4A 2N4DA 1BQXA 1M5KC 4N56A 3N28A 2ZJPQ 2VD3A 1X4HA 1WG5A 3KG1A 4KC5A 3GPAA 2OELA 3GR0A 4RW4A 1Y5LB 3P3DA 8RUCA 3F73A 2GQCA 4PAAA 1LQ9A 1RBAA 1VFJA 4UQTA 3HXMA 3CMQA 2ZH2A 2ASDA 1UAWA 2VUGA 3AHPA 2C2OB 1CBKA 1DJ0A 4ZHRB 1HQEB 4IRDA 2B56A 2K8GA 2VL1A 3GFXA 3D6HB 5H9EK 2V2KA 5IT9Y 2PMWA 2G13A 3FK4A 4A8FA 2J9DA 4J9RA 1SIWB 1JLCA 1IKVB 3QWPA 4KH1B 1NJXA 2AGOA 3BKFA 4FBTA 1WF2A 4WFXA 2ZJQQ 2AEMA 2NXUA 5D3GA 1RB0A 4IUFA 3KLIB 2GVZA 2NYIA 1S9GB 4JBCA 1M90T 4NLQA 4IOBA 1H0HB 3VQTA 4XO0A 4OI4A 4TY8A 2WVEA 1VR6A 5CQGA 1JK9B 1SKSA 2XS2A 1PJ6A 1Y10A 3THTA 3TZZA 3JQKA 4QYRA 5JXSA 4GKJJ 1OYEA 4UUWA 2WW8A 3V4IA 5MLCV 3PFOA 3TQEA 3GV7B 4MK7A 3HO1A 2VONA 4C4WA 4QWDA 2LYVA 3H42A 3RB6A 4MIWA 4A8WA 2F9JA 2OFGX 1JWWA 1WF0A 4NL5A 1Y3KA 5IQ6A 5EHHA 3GYXB 4NMXA 2DCLA 4URGA 2KG0A 2BJDA 5J1EA 4J91A 3A13A 4WU3A 3GE9A 1TK5A 2RNEA 2JVRA 3TAPA 3LF0A 1NK4A 1K1QA 2G4BA 1KNZA 4DBQA 3BH7B 1QSYA 1JLAB 4DPTA 2BEFA 1XERA 2CPJA 4OZJA 3FSYA 1RLCL 1AB8A 3OLAA 1MROB 1HQEA 3L3CA 4PWUA 4CYUB 2MPUA 1SIZA 3DLGB 2R7RA 1BQNA 2C3YA 1RAHB 4G1QA 1RABB 4DLEA 4B3MJ 3HHEA 4OMFG 4O3RA 5KG3A 3PCOB 4CLYA 1DURA 4OZ1A 3L4BC 2VODA 4MH8A 2MKHA 3OJSA 3IM8A 4DX7A 2LA6A 4ECZA 3MI7X 1ZH5A 1IKYB 2HLTA 1D1UA 3D3BJ 3PTWA 1RAIB 3PKYA 2OTLS 2MLZA 4NA1A 3UD5A 1OWXA 2XB2D 1C1CB 3U1LA 4UZBA 1N8RT 4FYYB 2YQ0A 2E5LJ 1HWLA 3BB5A 5CYMB 5LT5A 3MDFA 2V4JB 4Y2IA 1EETA 1WACA 2HKEA 2HVEA 3I5CA 1APSA 2HNYA 2W2QP 3CCUS 3GFYA 1OPIA 4MIBA 4EO8A 5HBMB 2AP6A 5B0GA 1Q1KA 5D15A 3JTPA 4P71A 3BO3A 2XCAA 4ZIVA 1MSWD 2J0XA 2CPHA 1A9NB 3Q22A 2B6AA 3W60A 5KFCA 5RUBA 2AMCB 4NLXA 2QA2A 3BBCA 4DSJA 2YKQA 5BYQA 5I4MA 4ECYA 2A0FB 2DJWA 2IM2A 5KT6A 2VOPA 1EAYC 5DG9A 3NG8A 2L3MA 3RB0A 1YGYA 2HVIA 3NOGA 5E3AA 2VC0A 3OFEA 3DXSX 4M5HA 3R5GA 1U1PA 1T9VA 2OH2A 1YJUA 2AEFA 2UXDF 2EG1A 4FS1A 1VQ9S 1SB6A 1ZAXA 3EYZA 4LBHA 4I67A 2D69A 4PXBA 1UWAA 4F4KA 3KWMA 4CZCA 4FYWB 4GVBA 4JI1J 5J2NB 2H3EB 3AD8C 1RT2B 4RWWA 4K4ZA 2PD1A 5KG4A 3RW7A 2CNLB 1HNIB 3L95X 2B9YA 3VTIA 2ZZTA 2QLXA 4M5JA 4JYAF 4ZP7A 5CYMA 3NGUA 3B4DA 2V4JA 2YWFA 3P45B 5IM0A 3CXCR 3R9LA 3CW2C 2CZ4A 4IOAQ 3KLGB 3OXFA 2NPIA 2HSEB 3U1NA 4X4PA 2WRMA 3AAWB 5AXKA 2EI5A 3GIMA 2GGPB 2MKJA 2DNNA 3KUHA 1YJWS 2WVDA 1BQMB 1JLFB 2DO0A 4Q8FA 2IBKA 5GMDA 3D68A 1CG2A 1I5OB 1YZ7A 5KFFA 3DI6B 4O3OA 4ZKAA 4CO0A 5LM7E 3E2EA 4DV4J 3FDSA 2R3VA 2MTLA 4QWEA 2C3OA 4TXSA 5D4PA 2N4CA 2HBRB 1RAOA 1U02A 4HTJA 4USMA 2C3UA 1HPZA 1MMNA 3R5BA 2RU3A 5ETLA 1RT3A 2IMWP 4ES1A 2IJFA 4URSA 3LA0A 3CDBA 1L3TA 1NO8A 3PZPA 2W24A 2Z4PA 3W2WB 3H8YA 4FYVB 2LQ9A 4TKTA 3BQ1A 3H4BA 2FHMA 3VR1A 3IAM9 3T19A 5L46A 1KVIA 2YQ1A 1HMVB 1HBNB 1FRHA 1YZ6A 2L9WA 2ATCB 3UCUP 5KG1A 2D3ZA 4ELTA 3DXBA 2CJYB 2QA1A 5IT9U 4LSNA 4NCGB 3I87A 2ALYB 1OY9A 3I4PA 3KLGA 3MGJA 1V6HA 2CPYA 3KOAA 2RS2A 2W2PP 2HQDA 1FI4A 3QSYB 2GGPA 2GS8A 5CZXA 5J1PA 2DGWA 1GXLA 1BQMA 3ZNJ1 1HNZJ 1V3SA 5LOQA 1H74A 4ETZA 4CCHA 1FWLA 5KAKA 4P6QA 3KG0A 3OPKA 3WX8A 2LQ8A 4B9NA 3N0VA 2VQFJ 2R7SA 3DI6A 4OYAA 2BKNA 5AE2A 3GCXP 2Y1JA 4MKYA 2OPPB 2JFKA 2UV8A 4U7UK 1LOUA 4PG8A 2KFZA 1X4AA 3I0SB 5BR8J 4J9SA 4FS2A 5LMUF 4Y2CA 5KFRA 2WONB 4ETXA 4ER8A 4FVMA 2HGMA 1N4LA 4X66F 2H9ZA 1H6KX 2XSFA 2YNIB 2FDNA 2D9OA 4DV1F 3I55S 3HHLB 2HGLA 1RWXB 1JKHB 3HD1A 2N82B 3OL7A 5LL6d 1HBNA 4LF9F 4HT7A 1TL3A 4CDIA 4LF4F 4DS4A 2VA3A 2ZJRQ 4ZCKA 4DG1A 2B4OA 1UJ5A 2XLIA 2DH8A 3VAKA 2ZD1A 1LWFA 5AXLA 3VVTA 1PAUB 2OPQA 1V3RA 1RJJA 2YWGA 4U8YA 2HRTA 2QC3A 2ACMA 2DXFA 1WC6A 4DFKA 4LRAA 2VF3A 2AYGA 3QRQA 2HFVA 4TYAA 2MSTA 1MWZA 1C0UA 1CS4B 4G1PA 3C14B 2ASYA 2KT3A 3K5LA 1XR7A 5KFVA 3IGNA 1T03A 4IFVB 3OTOF 4WP3A 2I5JA 2F4VF 4WFBQ 3M8PB 3AFGA 4RUAA 2QFJA 5G0RB 4DPOA 3V6JA 2RJZA 5A8WB 1B7YB 4YR0A 2OPPA 3VV2B 1SC4B 2ZDOA 3AQOA 2RAQA 3HJFA 4DV3J 4G1IA 4M5IA 1IXKA 2HBQB 3EICA 2QV6A 3DLBA 2DY9A 4LBIA 1X4DA 4F4ZA 3RRGA 1NXIA 5KT7A 3UD4P 1YJVA 3OD2A 2UXCF 1N5YB 2YNIA 1IWGA 1S4FA 3OJUA 1VCTA 2D3O1 1RBOB 5MAOA 3EZOA 1RTIB 3H25A 4NXNF 2Y8YA 3Q8RB 4OX9J 4B3OA 3CMAS 4KJIA 2CIMA 1YRXA 4KHPF 3TOQA 1SXLA 3KLFA 1TK8A 2YTCA 1FHTA 3OW2R 4B9LA 3OFFA 5ETSA 2OPSA 1LK5A 4DN9A 3TJAA 1PSDA 5HLFA 2ADBA 2FJXA 1SQGA 4XDDA 1FE0A 1ZM3A 2BE7D 3H5UA 2BJ7A 1D8YA 4RKUC 4QU7A 2ABYA 2V67A 1U1QA 4O3SA 1FKOA 3PJWA 3FEYB 1PC4A 4M5MA 2CNKB 2Q6CA 3C14A 4YDDB 1RAAB 1IVZA 3IWXA 5L39A 2ZBCA 1UFLA 4IFVA 3BDEA 2XMTA 5ETQA 1B3TA 2Z0GA 3ELHA 4OHWA 5DLGA 4CLWA 3I0RB 1M5OC 2ZBPA 4CO4A 3T41A 4IKAA 2DHHA 3BREA 1NK7A 4NLSA 3M32A 2MZRA 3QZ8A 2D3OR 3TAMA 2HHVA 1FDNA 1CULB 4NASA 1XNQJ 4JI6F 3DOMA 3PFEA 5B08A 2AJQA 1NSKL 3JXOA 3EGZA 3W61A 4F4AA 4K4WA 4NLOA 4IOCQ 2Z8QA 4DJBA 1D9DA 3MECB 2CQCA 5F9LA 4RBUA 4YR3A 3QSIA 3POTB 3CCWA 4V1Ak 3LALA 1KQKA 3TWZA 3OR2B 2RMLA 5GAEU 2UVVA 3D5MA 1U7LA 3PW7A 2OFHX 1N33J 3NNHA 3MMCB 4DV7J 2AEJA 3BF4A 3PIPQ 1HBUA 2ASLA 4NXMJ 3KJVB 1DZ5A 5IZHA 4FXVA 1YJ7A 1N52B 4FF2A 3NNCA 1FF2A 3THVA 3CCTA 1TVRB 3BO2A 4DSEA 2YPZA 2WHOA 1JLEB 2DISA 3QATA 4JI5J 4O23A 4WFAQ 4AYBD 3BSCA 4R8UA 1CSJA 4U8VA 2V8GA 4B3MF 5THWA 3P4UB 1Q4RA 3GIRA 3MPUB 3TUPA 2HIQA 2C3MA 3D1HA 4CRJA 1NB7A 4YB5A 3CT9A 2U1AA 5HVGA 3FFIB 3LTOA 2DTJA 1M5SA 4K2JA 1FK9A 4JI4J 4U6PA 3CJ8A 1J5OA 1VDHA 3V4MA 2IVYA 1CULA 1UVIA 4ANDA 3UQSA 2KZMA 3W3SA 3X3UA 2A18A 1ZAVA 2GJFA 1NHUA 3GIKA 2E5LF 1JJCB 3NY0A 1RA6A 3LAMA 2JJ4D 2ZBQA 5JVHQ 2V9KA 2WOMA 4ATNA 5I3QA 2VPYB 5F8GA 2XYGB 3Q8VA 2OO4A 4OJGA 4ITSA 1C0TA 2DNZA 2KXNB 3MECA 1BGXT 3FZ2A 3H5XA 1ZETA 1OSCA 1MN9A 5ETVA 1FFSB 2DIVA 2CVIA 3Q2TC 4Q7AA 5B0FA 3HF5A 4OZ0A 3T5KA 3LP2A 4NYPA 3TJ8A 2G1HA 4NZ0A 2M5YA 2MMYA 4W90B 2Q1LA 1QTNB 3V81B 5ETPA 4G3IA 5BYSA 2CXEA 4QBUA 2ACYA 2GCFA 3RW6A 1U0HA 3W7BA 5D4LA 1UJ6A 5A0YB 2CJXB 1QAJA 1U2RA 1HQUA 3M1VA 2E1MC 3DC2A 2BOAA 3KLEB 4DL4A 4FF4A 2MQ8A 3JSRA 3RB3A 4FKXA 1UVKA 4AT1B 3CB4A 3KHLA 5C25A 3UD3P 1HI8A 2BABA 2Z2YB 2XY6A 1UFWA 1QM9A 4K8RA 4HACB 1XC9A 1KOHA 4NMLA 3IGVA 4AQYJ 5I3UA 1UFKA 2FY8A 2PFFB 3MM7B 5A6PA 1HYSB 5B0EA 3S6EA 4LF7J 1S76D 2DXEA 1O5JA 1RT5B 1SUQA 5DRKA 2KJWA 2EFGA 1VI7A 3CJ5A 2K3KA 4JI1F 1RCXB 2LMIA 4BC9A 3EGVA 3C16A 4J9QA 3SZ2A 4LRFA 3V6DA 4DR5J 2IIHA 2E1RA 1RP5A 4DDFA 3VALA 3QFWA 4NLWA 2B51A 2NYHA 1FO1A 1WWHA 3QT5A 4EU0A 3EVMA 1CEZA 3VAGA 2J6SA
chains in the Genus database with same CATH topology
2CJXB 1NMEB 3EDRB 4DCJB 2H5JB 2C2MB 1RWMB 2Y1LB 1RWVB 2Y0BB 5IC6B 3R7SB 3D6FB 1I3OB 1PYOB 2H51B 1SC4B 3R6GB 1RWXB 3R5JB 3EDQB 2HBQB 3SIPB 2HBRB 2XZDB 2CNKB 4ZVSB 3GJRB 1QDUB 1RWPB 1RE1B 2CNLB 4ZVRB 2FQQB 2HBZB 3NS7B 4JB8B 3QNWB 3GJQB 1F9EB 2HBYB 2XYGB 5K20B 2QLFB 2XZTB 2CDRB 4ZVQB 3KJQB 3P45B 3R7NB 1RHKB 2XYPB 2QLBB 2QL9B 2H48B 1PAUB 1I51B 1SC1B 3GJTB 1RWOB 1RHRB 2QLJB 2C2OB 2XYHB 2C1EB 1SC3B 2H4WB 1RWNB 4ZVOB 2P2CB 1IBCB 2H54B 2H5IB 1RHMB 1RWWB 1GFWB 4DCOB 3D6HB 3KJFB 4ZVUB 5IC4B 3R6LB 1RWKB 3P4UB 3GJSB 3KJNB 2CNOB 2H65B 2H4YB 3R7BB 2DKOB 1QTNB 2QL7B 1BMQB 3IBFB 3RJMB 4LSZB 2C2KB 1ICEB 2CJYB 3D6MB 2QL5B 1RHJB 4ZVTB 4DCPB 1RHQB 1RHUB 2CNNB 3IBCB 2C2ZB 4ZVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  1NME B;  3EDR B;  4DCJ B;  2H5J B;  2C2M B;  1RWM B;  2Y1L B;  1RWV B;  2Y0B B;  5IC6 B;  3R7S B;  3D6F B;  1I3O B;  1PYO B;  2H51 B;  1SC4 B;  3R6G B;  1RWX B;  3R5J B;  3EDQ B;  2HBQ B;  3SIP B;  2HBR B;  2XZD B;  2CNK B;  4ZVS B;  3GJR B;  1QDU B;  1RWP B;  1RE1 B;  2CNL B;  4ZVR B;  2FQQ B;  2HBZ B;  3NS7 B;  4JB8 B;  3QNW B;  3GJQ B;  1F9E B;  2HBY B;  2XYG B;  5K20 B;  2QLF B;  2XZT B;  2CDR B;  4ZVQ B;  3KJQ B;  3P45 B;  3R7N B;  1RHK B;  2XYP B;  2QLB B;  2QL9 B;  2H48 B;  1PAU B;  1I51 B;  1SC1 B;  3GJT B;  1RWO B;  1RHR B;  2QLJ B;  2C2O B;  2XYH B;  2C1E B;  1SC3 B;  2H4W B;  1RWN B;  4ZVO B;  2P2C B;  1IBC B;  2H54 B;  2H5I B;  1RHM B;  1RWW B;  1GFW B;  4DCO B;  3D6H B;  3KJF B;  4ZVU B;  5IC4 B;  3R6L B;  1RWK B;  3P4U B;  3GJS B;  3KJN B;  2CNO B;  2H65 B;  2H4Y B;  3R7B B;  2DKO B;  1QTN B;  2QL7 B;  1BMQ B;  3IBF B;  3RJM B;  4LSZ B;  2C2K B;  1ICE B;  2CJY B;  3D6M B;  2QL5 B;  1RHJ B;  4ZVT B;  4DCP B;  1RHQ B;  1RHU B;  2CNN B;  3IBC B;  2C2Z B;  4ZVP B; 
#chains in the Genus database with same CATH topology
 4WIQ A;  5J2M B;  4DCJ B;  1KR4 A;  4LF2 A;  1N0V C;  4RR5 A;  3H5S A;  4GVL A;  5H9E J;  2FJE B;  4J9N A;  3LP0 B;  2B9X A;  4P2X A;  3RBD A;  2RRB A;  5KFY A;  3QJP A;  2HND A;  3AT1 B;  2N7Y A;  4JV5 F;  4DV4 F;  2LDI A;  2ATL A;  4UTG A;  1TAQ A;  4IG0 B;  4WWS A;  4ZOS A;  2BOP A;  5EWE A;  1YJN S;  4NZ6 A;  4UY8 5;  3DLE A;  2EWH A;  2YNH B;  1Z2L A;  4Q45 A;  2LEC A;  2DPJ A;  2H5I B;  3LW5 C;  4MK8 A;  5HMX A;  3R5A A;  1B64 A;  4TN2 A;  1S4E A;  4P9S A;  2SXL A;  2CAJ A;  2QMW A;  3CJQ A;  3MM7 A;  5C24 B;  1HYS A;  5KFN A;  2OAU A;  4DQS A;  4GO5 X;  4UY8 T;  5ETN A;  3D28 A;  4YB6 A;  2RDI A;  1P6T A;  1EKR A;  1U25 A;  3VVU A;  5DDR C;  2R7X A;  4D3G A;  2CJK A;  1PYO B;  1N34 F;  2B9E A;  3KK1 A;  4DQI A;  4ZJO A;  2CJ9 A;  3R3T A;  3ZTO A;  3CD7 A;  3FMB A;  4J9U E;  2R4F A;  2XMA A;  3TR5 A;  4P7V A;  1Z2Z A;  2YNG A;  4EZ6 A;  3UNY A;  2GIQ A;  2BDP A;  2F5G A;  2VJV A;  4O0I A;  2XZT B;  5CAA A;  3KHR A;  2V2Z A;  2VG7 B;  4CH7 A;  3T1H J;  3K5M A;  1H7X A;  1FRL A;  1BD6 A;  2H48 B;  3IR5 B;  2Q3P A;  1SKR A;  1A0O B;  2CQ2 A;  2X7I A;  2M8D B;  2BE9 B;  4WYL A;  3IXQ A;  1L3U A;  1HNZ F;  7AT1 B;  1U6Z A;  1XN9 A;  1YK9 A;  3H59 A;  4RWX A;  2VJU A;  1RT1 A;  3IWL A;  1LKZ A;  3MR5 A;  2HEK A;  5LSO A;  3VGU A;  1ROF A;  1S1U A;  2VQF F;  3SFU A;  4RU9 A;  3H20 A;  2VZ9 A;  3E51 A;  3UI3 A;  1RXO B;  2XGQ A;  1N5T A;  1P1L A;  4ZVT B;  5KG2 A;  4USW A;  1Q16 B;  2BJ1 A;  4IG0 A;  3JS9 A;  1SPB P;  4DL0 C;  4EZ9 A;  3UWT A;  2RQ4 A;  5BR8 F;  2CPX A;  2MLX A;  2YNH A;  3ZFV A;  3A12 A;  2UV8 G;  2HQI A;  2F63 A;  4U7C A;  3DLL Q;  3PYE A;  1AUS L;  1PBA A;  3DRR A;  4R5P A;  3QBC A;  1FFG B;  5C24 A;  1SBR A;  2W8K A;  2WBR A;  2ZIT A;  1TK0 A;  3GG0 A;  2UXB J;  5EGY A;  3QGI A;  4ED6 A;  1RA7 A;  1UCN A;  4OYB A;  3CWJ A;  4FYX B;  1KLM A;  4W98 A;  2H5E A;  2QMX A;  4PUO B;  2L9N A;  1Y5I B;  1I6J A;  3V6H A;  1RAJ A;  1S0V A;  5DGA A;  3FZB A;  1T9X A;  5DG7 A;  2DNP A;  2OIH A;  5KFM A;  2JC1 A;  3RR8 A;  4OHX A;  3Q86 A;  2YWK A;  4NX9 A;  3GLJ A;  3EDR B;  5E3C A;  2KKH A;  5D78 A;  3R27 A;  3CCL S;  1WG1 A;  1AXQ A;  1YSJ A;  3GTY X;  2D1C A;  1TKZ B;  1FES A;  4YUD A;  1SKW A;  2DNK A;  3RAX A;  2KU7 A;  5D0R A;  2CVE A;  4RZR A;  2LDY A;  3E3X A;  3MCS A;  1W25 A;  1FA0 A;  3HD2 A;  9ATC B;  5M2R A;  5F8H A;  1G7C B;  3TUZ C;  3MM8 B;  2CQ0 A;  2HMI B;  3D2W A;  5DET A;  2XGP A;  5CZV A;  2BR0 A;  3MUV P;  2XMV A;  2P8I A;  1WNE A;  1S9E A;  3IP0 A;  1AZS B;  2LVW A;  1RWW B;  2ZH3 A;  4DR1 J;  3L7O A;  5LSR A;  4EEY A;  2L08 A;  3EX7 B;  4IRK A;  1Q7Y T;  5IXU A;  1EZZ B;  2RQK A;  3MOJ B;  1FJG J;  2B5J B;  4Y34 A;  2QL7 B;  1Z4U A;  4USV A;  1TL7 A;  5JJB A;  1PJ7 A;  4ZVP B;  4DV0 J;  4M5K A;  3EUN A;  5F0W A;  1JLB B;  1T02 A;  2DH7 A;  1RWV B;  2RT3 A;  2YX4 A;  4PG7 A;  3M6W A;  1SVD A;  4DR2 J;  5HRO B;  4I2Q B;  5EDW A;  3RU0 A;  3TX0 A;  1U6B A;  4IR9 A;  1PGZ A;  3RRH A;  2B3T B;  1S1V B;  1T9Y A;  2HHU A;  4RW8 B;  4UOG A;  3G87 A;  1M5V C;  1WG4 A;  2V6A A;  3SYZ A;  1TZ0 A;  3HHN B;  2C2E A;  5CXT A;  4KTQ A;  4KV8 B;  1FWP A;  3NMA A;  5KFA A;  3AD7 C;  1HAR A;  2FJW A;  1X5P A;  2KXH A;  1UWB B;  4WF9 Q;  4NLV A;  4K4V A;  3J7Y U;  3KHH A;  3JSB A;  1LW2 B;  1VQO S;  1IKX B;  2KHD A;  1VLO A;  3RGI A;  1WOO A;  1ITP A;  3DHW C;  4CO5 A;  1K8A T;  3FNN A;  1O0P A;  1LXN A;  4W92 B;  4C48 A;  1NME B;  1WDD A;  2J7U A;  4DI6 A;  1Y4Z B;  5ETT A;  1BLU A;  1XNQ F;  2J7W A;  2P9G A;  4WTY A;  4YS2 A;  1M5H A;  5KT5 A;  1AZS A;  2XNQ A;  2C42 A;  5DZ6 A;  4BCA A;  2R2R A;  4OI3 A;  5CAB A;  5KFK A;  5B0C A;  2IDL A;  3LQV A;  3MEK A;  2V4Q A;  4JI0 F;  2WSC C;  3MUR P;  3JYT A;  3G8Q A;  1VLY A;  3OL6 A;  4AE5 A;  1U45 A;  1NAQ A;  1H3D A;  4DPU A;  2OEM A;  3M2U A;  4QZV B;  1SC3 B;  3MPD A;  2I1R A;  1D0E A;  3AY0 A;  1JIH A;  4USK A;  5HRO A;  4I2Q A;  3KXD A;  4NXM F;  1TL1 B;  4FN5 A;  2UVW A;  2FGO A;  2ZC3 A;  1S79 A;  2F1F A;  1BMQ B;  3J81 j;  3D66 A;  1TKD A;  3IN5 A;  1JNR B;  2GVD B;  5HVF A;  4B17 A;  4A8Q A;  2CG4 A;  8AT1 B;  2E1P A;  2P6S A;  2V5H G;  4NLD A;  4DQQ A;  4JI5 F;  3HX9 A;  1SJ4 P;  4ZIT A;  1Y7P A;  4OJ3 A;  2HK3 A;  4R25 A;  2RKI A;  4Y3C A;  3MXH P;  2OGU A;  4B9M A;  3S1T A;  1LW2 A;  1IKX A;  3S7R A;  2HUR A;  2XTJ P;  1R0B G;  4ZLN A;  4YB1 P;  4E98 A;  4DSK A;  3MF5 A;  1S5Z A;  4KQZ A;  2XLJ A;  2F3J A;  1JJ2 R;  4WXO A;  3EJM A;  5D0E A;  3MD3 A;  2JC0 A;  4JI4 F;  3NNA A;  1WF1 A;  4HEA 9;  4WE1 B;  5IT4 A;  2OPR A;  3PYF A;  3QO9 B;  2IA6 A;  3NGD A;  1HHQ A;  4CLP A;  2AJ2 A;  4N76 A;  4CNZ A;  4RNO A;  2RDD A;  3FSI A;  3B82 A;  2W2N P;  4L75 A;  4A8M P;  1KVJ A;  4DOZ A;  3SCK E;  3PYD A;  1C1B A;  3M8Q B;  1C2P A;  3CC4 S;  1RTJ B;  1SQF A;  2ZVI A;  2CFX A;  4QYZ J;  4ZDN A;  1X7V A;  1FXD A;  4ED4 A;  3NAH A;  2VG5 A;  2Y1L B;  5KFH A;  1BXN A;  3BBF A;  2AJ1 A;  2UUC F;  3DLK B;  4BS2 A;  4ZIW A;  3EDQ B;  1ACM B;  4OFZ A;  3H2U B;  3VQS A;  3HPO A;  1OIA A;  4OZL A;  3DDN A;  1TL1 A;  5DGB A;  3EM1 A;  2RB7 A;  1X4G A;  3ET6 B;  2MHN A;  2NRE A;  3W65 A;  2FB0 A;  1FJC A;  3QJJ A;  2IFX A;  2QL9 B;  1NK0 A;  2LFV A;  4A8Y A;  1RTZ A;  1S6P B;  1YX2 A;  2ZH4 A;  3BSN A;  3CCM S;  2YQ3 A;  1SKU B;  3O44 A;  2QRR A;  3GIL A;  1TP7 A;  3MCN A;  1X0F A;  1Q0N A;  4TU9 A;  4AQY F;  5DDQ C;  1UW9 A;  1U1K A;  1HA1 A;  2DNR A;  3H98 A;  2CZ9 A;  1DRZ A;  4OZ5 A;  1FER A;  5KFB A;  1CQN A;  4L74 A;  1NRK A;  1G2E A;  1KP6 A;  2FJV A;  3G2X A;  2HK2 A;  4DR5 F;  1S1X B;  1LWE A;  4QIW D;  5BJR A;  1FRX A;  4O3P A;  2KFN A;  4FKY A;  5ITH A;  5IV4 A;  4GKK F;  3NBP B;  1UL3 A;  1ZPW X;  3IA0 A;  3SCJ E;  4OI0 A;  2DIT A;  2NLW A;  1S1T B;  3CUL A;  3I9V 9;  4HI2 A;  3NS6 A;  4ZPT R;  3M8Q A;  2KYZ A;  2X1B A;  1NM2 A;  3W5Y A;  2WK4 A;  2HFU A;  2HG4 A;  3CED A;  2X1F A;  2GV1 A;  3DOL B;  5B09 A;  1ZA2 B;  1YLX A;  2VA2 A;  3QIP A;  3P6Y C;  4I7F B;  3Q8P B;  4ALZ A;  4Y6I A;  3DLK A;  3C2P A;  5IT0 A;  2GMJ A;  3K17 A;  1QVF R;  3J80 U;  2BQ3 A;  2XMU A;  5EWF A;  1SJR A;  2MB0 B;  3BPD A;  1K0V A;  1K1S A;  3M2R B;  1QLN A;  1DLO A;  2HNZ B;  4DL2 A;  3HHD A;  4TNO A;  3LAK A;  1KC8 T;  4OJH A;  1VC6 A;  3CME S;  1SCJ B;  1T7P A;  1H7W A;  1NKE A;  1E6V B;  3GCW P;  3CJ2 A;  3TUJ C;  1LW0 B;  2AGQ A;  2DH9 A;  3MMB A;  3R6G B;  2CJA A;  1M1G A;  4YFU A;  4LF5 J;  4GMK A;  1VGY A;  2CQ4 A;  4DFM A;  2E5J A;  1L3V A;  4PQA A;  3LAN A;  3I9Z A;  2G0C A;  4WTO B;  1C4C A;  1URN A;  2HBZ B;  3M8R A;  4DL5 A;  1GAO A;  4OI2 A;  1RTH A;  1HQ2 A;  2HVH A;  2M70 A;  2MKI A;  4PRF A;  4ERD A;  4NLY A;  4F25 A;  2VBY A;  2E5I A;  2EC0 A;  3C6T B;  3ETO A;  1RHK B;  2RSQ A;  1T9T A;  3KYL A;  1IQT A;  5EX3 A;  3HZG A;  1YBU A;  5CD4 H;  2J0S D;  2GX8 A;  1JLG A;  1ZOT A;  4ZPV R;  1IKW A;  2P2C B;  5CCM A;  1SI9 A;  5E33 A;  3TZW A;  1TQL A;  5FDL A;  4QR0 A;  3VAJ A;  1OQ6 A;  4LR9 A;  3T1H F;  2JH3 A;  2YWW A;  4UST A;  1IUJ A;  1RAC B;  4JI3 J;  3P49 B;  2FHJ A;  1LEO A;  5GME A;  2CPE A;  3MM6 A;  2AWZ A;  2A6M A;  4OYX A;  4Q2M A;  3UDC A;  4B9U A;  3ZTP A;  1F2G A;  3K7R A;  1YIJ S;  1MW7 A;  6AT1 B;  2A2C A;  1CC7 A;  1F2H A;  2Y3Y A;  1YBT A;  5LMN J;  1URR A;  2E7W A;  3MFH A;  4PQU B;  4B02 A;  3MM5 A;  1UMJ A;  4IH7 A;  4C8M A;  4QWA A;  2VKZ G;  2FTR A;  4IO1 A;  1UA1 A;  4WK1 A;  1F9E B;  5B0B A;  4YB7 A;  5K20 B;  5A8R A;  2VV5 A;  2HNZ A;  1RQ0 A;  3B8H A;  1HFE L;  3DMJ A;  3U7J A;  1WC1 A;  2FHK A;  4Y28 C;  5ADZ A;  1GX5 A;  3B4M A;  1RCO B;  2XWY A;  3P96 A;  1E6V A;  3DNC A;  1WOS A;  1F1B B;  2OUG A;  2IHR 1;  3TA0 A;  3I31 A;  4C0H A;  1IBL J;  4DV5 J;  1CJK B;  1GMV A;  3CIM A;  1CC8 A;  4LVO P;  2NCK L;  3AA9 A;  1RWK B;  3EGN A;  1LWC A;  2Q43 A;  3J7A 1;  1IQZ A;  4ZLL A;  3NRB A;  4ZK7 M;  5IFM A;  1MNE A;  2UXB F;  4O44 A;  1HWU A;  2HHP A;  2MKC A;  1TAU A;  4ZMM A;  3C6T A;  3G86 A;  2B7B B;  2HVZ A;  3ZXW A;  2Y0B B;  1DTT A;  3DGV A;  2BE2 B;  4KY3 A;  4I4B A;  2HWI A;  3KDO A;  1OMS A;  3P5B P;  2WBM A;  2CPZ A;  4NCB A;  4AFF A;  4M63 A;  2CDQ A;  2J9D E;  3PKM A;  2XI2 A;  3TJ9 A;  3I4H X;  1MMD A;  2XMW A;  4K4Y A;  3R5D A;  4ZP9 A;  3D7S B;  1MU2 B;  4ILL A;  2VDH A;  3NCQ A;  5HAT A;  3AJ1 A;  4NOH A;  3NCR A;  4QCL A;  2LCW A;  1FKP B;  2GJI A;  4DR6 J;  3A3N B;  5AT1 B;  2BZ2 A;  3IFE A;  1WI8 A;  2H54 B;  2JEJ A;  3ZTS A;  1UP1 A;  1SJ1 A;  3BBB A;  3FQL A;  2YKM B;  2QGF B;  3R1H A;  3PW0 A;  1HW8 A;  2BMB A;  4EI2 A;  1UVL A;  4E2F B;  2CQ1 A;  3HFZ B;  3K5O A;  4F67 A;  1YTY A;  4GC7 A;  1XK8 A;  2BAN A;  3DM2 A;  2YVS A;  3VAM A;  4DR1 F;  3BR9 A;  3M8S A;  1VC5 A;  4FPI A;  3SIP B;  1CJK A;  1JJH A;  1RT4 B;  1M5P C;  2B8Q A;  3M9N B;  2P9E A;  1VQ6 S;  4P7T A;  1RE1 B;  1YKW A;  3N01 A;  4EO6 A;  4FYD A;  3OR1 A;  5B7W A;  2VG6 B;  4ZN3 A;  3W62 A;  3GFH A;  4DV1 J;  4IRC A;  3I96 A;  4JI8 F;  3CD5 A;  2G9O A;  3G6Y A;  4MAK A;  2YWE A;  3LWM A;  4WJB A;  1UPP A;  4KKO B;  1H2U X;  2HWH A;  4JOU A;  3QLH B;  4DR2 F;  2V4R A;  4ED0 A;  1NJW A;  1HI1 A;  3MAA B;  2DNH A;  3BN4 A;  4HH1 A;  1NDC A;  2CQI A;  3MR3 A;  2JLG A;  3MOZ A;  2R7W A;  3VAH A;  2KT2 A;  2Y0S D;  3OTE A;  2V8H A;  3QMQ A;  5K8N A;  4ED2 A;  3RBZ A;  3CO9 A;  1VRT B;  3CO0 P;  1QE1 B;  2C2K B;  2HZC A;  1WOR A;  1HWK A;  3DU6 A;  1RT6 B;  3PW5 A;  4KPY A;  3KK2 A;  4DL7 A;  3KK3 B;  1T9W A;  4QW9 A;  5DZ7 A;  1MU2 A;  3HMJ G;  2L9D A;  3CJ3 A;  5I42 B;  1RWM B;  1VK3 A;  3RAM A;  2XG8 A;  5GAD U;  1R0A A;  3HZE A;  4CLT A;  2HFN A;  2JX2 A;  4B3T J;  3W9I A;  2AJ0 A;  3CDA A;  1JNZ B;  2X3G A;  2YKM A;  3CCE S;  1RWU A;  3WC0 A;  2DK2 A;  4FXW A;  2F4V J;  1P9Q C;  4FF3 A;  1VBZ A;  2CPF A;  1G4C A;  1NKC A;  2HZA A;  2JSX A;  3IG1 B;  3C15 A;  4PXC A;  3O2I A;  1FTR A;  5J2P A;  1X31 C;  2OTJ S;  1D8Z A;  2YWH A;  3OSN A;  2BQR A;  5E41 A;  4ECV A;  3MHY A;  3BM7 A;  4H4K C;  2JEI A;  5GMK a;  2MGZ B;  1W7W A;  1CJV B;  2KVI A;  2JFD A;  4ICL B;  4EFA C;  4K7Q A;  5JMN A;  1QD1 A;  3QZ7 A;  4RW6 B;  4OX6 A;  2VG6 A;  3OTC A;  3KG4 A;  1KQG B;  4DQR A;  4C8L A;  2J5A A;  3B6B A;  3VAI A;  4I1T A;  3JTO A;  1N0U A;  1KN6 A;  4M5D B;  4KKO A;  1NDL A;  1VIX A;  1QUP A;  3MPW A;  4LF8 F;  1VQY A;  3B54 A;  3PHE A;  2CUY A;  1R8A A;  5DJB A;  3RB4 A;  1D9A A;  1S72 S;  4KHP J;  4PR6 A;  1TKX A;  3MAA A;  2A3J A;  2AYB A;  4Y2A A;  2W9B B;  4RBV A;  1TUW A;  2FYX A;  2ZE2 A;  3SXL A;  4U96 A;  4ID5 A;  2PEB A;  3BDP A;  1KON A;  1SV5 B;  1WHY A;  2RH3 A;  3E01 A;  1QE1 A;  2IY5 B;  2ADC A;  5DO2 A;  1EX8 A;  2RIJ A;  1U26 A;  2BW2 A;  3OUY B;  3QGP A;  3CCQ S;  2AKW B;  1IN0 A;  3OQ2 A;  3OHA A;  4WCE Q;  3AD9 C;  2CQP A;  2RRA A;  4Y2K A;  3O3L A;  4HHJ A;  3IRX B;  4KR0 B;  4XPE A;  1T05 B;  1YWX A;  4AL5 A;  3C66 A;  1JLQ B;  3HCX A;  3BJY A;  2FGC A;  1XTZ A;  4X4N A;  2H1Y A;  3IBF B;  3IG1 A;  1RHU B;  1U1L A;  1PYT A;  1AFJ A;  2OLW A;  1K73 T;  1N48 A;  3UCG A;  1IR2 A;  1NZ8 A;  1MWY A;  2XMK A;  4NEZ A;  2MGZ A;  2DRB A;  4KGZ B;  4JI6 J;  2JOQ A;  2Z56 B;  4KSE B;  2RE1 A;  3A1Y G;  3TAN A;  2BAC A;  4C97 A;  1WHW A;  3O5T B;  1VQP S;  3CJ4 A;  2VAS A;  3AOB A;  3QAU A;  3M6U A;  4MYU A;  4F0M A;  5C7P A;  5KFT A;  3PXG a;  3M30 A;  1XNR J;  1TKT A;  3PHT A;  1GTH A;  4WII A;  2MLY A;  2CRL A;  1VOM A;  4I6W A;  1CLF A;  4X4Q A;  1JMT A;  3MMA A;  3PR5 B;  2JLE A;  2LEA A;  4UUX A;  2M52 A;  3JQJ A;  4AUK A;  3I82 A;  2E9R X;  6FD1 A;  3W5X A;  3PEH A;  2YKP A;  2WW4 A;  1XIQ A;  1BWV A;  3T3F A;  5AXN A;  4WXW A;  2YKO A;  3ZC4 A;  1ICE B;  4ZHR A;  3OUY A;  2KN4 A;  3TI0 A;  4CNY A;  3CJS A;  4WBF A;  2A1B A;  3M9O B;  4ES3 A;  1NSQ A;  1KFS A;  2OMO A;  1IKV A;  3OV7 A;  4O4G B;  3HT3 A;  4RW7 B;  3CSK A;  3Q8U A;  5C2C A;  4F36 A;  1WUU A;  2FZG B;  3D1O A;  3ISN D;  2N3O A;  3DRP B;  4F7V A;  2XZD B;  3KLI A;  2W9C B;  1HNW F;  2UUB J;  1S9G A;  2OHD A;  1JLQ A;  2YH1 A;  1VQ7 S;  1FDB A;  4QIG A;  4JB8 B;  3P5T L;  2ZH5 A;  2IMO A;  5HSP A;  1ULR A;  4RW9 B;  1A7G E;  4EK2 A;  2FVS A;  3SQG B;  4CLU A;  3MED B;  1S49 A;  3UN5 A;  2HLU A;  4AL7 A;  2HIY A;  2FUG 9;  5KG6 A;  3TA1 A;  4RUC A;  3QT6 A;  4UOH A;  3G8T A;  4I56 A;  5T7L B;  1JB0 C;  4C9D A;  5LSL A;  4DU7 A;  1Q95 G;  3KJF B;  2XO7 A;  1I1G A;  3BEG B;  1X4B A;  5A8K B;  4C2M A;  1D09 B;  3CC2 S;  3ISN C;  1IJF B;  5K9F A;  7FD1 A;  4X4R A;  3MUT P;  1V9O A;  2VFT A;  2V8D A;  2NXE A;  4KB7 A;  3EMT A;  1NLK L;  2ZM6 J;  2GJ2 A;  1N32 J;  1RT7 B;  2PDA A;  2FHJ D;  2LQ5 A;  5HO4 A;  1GMW A;  2KRB A;  4WKR A;  1RTD B;  4Y00 A;  3TNV A;  1FNM A;  2MY8 A;  4ED5 A;  1N88 A;  1FXL A;  1FD2 A;  1JLA A;  3OBI A;  2IYI A;  2FZK B;  3FBC A;  2PO4 A;  3QWU A;  4MIA A;  5F8L A;  1IJE B;  3JSM B;  3N5B A;  1GXT A;  2E29 A;  3IMQ J;  4K5S A;  4C3K A;  5HQ8 A;  1MRO A;  1OO0 B;  4CYU A;  3WQP A;  4E8U A;  1REV B;  3DLG A;  2QIF A;  2CYY A;  1S6Q B;  5L1L A;  4LF5 F;  1X9M A;  1I51 B;  2B4U A;  2DR5 A;  5F8N A;  1X4C A;  2ZHB A;  3UO0 A;  5EX0 A;  2KJV A;  4QIV A;  4CLZ A;  3CJR A;  4LR8 A;  4KT0 C;  2D7S A;  2YKA A;  4KPC A;  4RNM A;  4C0O C;  3PY8 A;  4RX6 A;  3R7B B;  3S8S A;  4PCQ A;  4MFB B;  1TUG B;  1IKY A;  2QL5 B;  1WDT A;  2EK1 A;  3IBC B;  2J6T A;  1S1W B;  3IAS 9;  4TU7 A;  3VZH A;  2YBV A;  1NK8 A;  3SQG A;  3DRS B;  2DNO A;  2W7O A;  2MQN A;  3BV8 A;  1C1C A;  4YHH J;  5GAG U;  1OYD A;  1YIT S;  1U1M A;  2DY1 A;  4ELU A;  2UUW A;  2FVP A;  1QDU B;  4JI3 F;  3MR7 A;  1NK6 A;  2JEF A;  5HBM A;  2BRL A;  3M9M B;  1F60 B;  4CP5 A;  4X62 F;  5JVG Q;  2V8P A;  5HQM A;  2XO6 A;  3QT7 A;  1OPZ A;  3PW4 A;  3BGL A;  4YP3 A;  3KUG A;  1RT7 A;  3ILJ A;  4JI7 J;  4ZLJ A;  3G9C A;  5LMN F;  1U2F A;  4B3S F;  3ICL A;  3KTQ A;  5HMW A;  3JQM A;  1RKJ A;  4FZV A;  4JV5 J;  1IWA A;  2D41 A;  5K5M A;  3J7Y I;  4BHQ A;  2ASJ A;  2KYX A;  2RUG A;  3PO5 A;  4KH0 B;  4F50 A;  3AXM A;  1PBU A;  4A47 A;  3GIJ A;  5KOX A;  3IRW P;  2GIF A;  2CAD A;  1S6Q A;  1KOO A;  2AZ1 A;  1IBL F;  4DV5 F;  2BXJ A;  1WHV A;  1SC6 A;  2MZ1 A;  2KFY A;  2HS4 A;  4AD6 A;  2XY5 A;  4Q2L A;  3L09 A;  2X1A A;  2FD2 A;  4H4O B;  1DHM A;  3GU0 A;  4I2P B;  1CPZ A;  2K06 A;  1Q79 A;  2DGT A;  1RSC A;  1F5B A;  2VU5 A;  3PNI A;  2MQM A;  5L9X A;  3PX4 A;  4HDH A;  2HS0 A;  3PDN A;  4MKA A;  1DBD A;  4X2B A;  3SFG A;  4A8K A;  4IDK B;  3LP1 B;  4QPX A;  5H1S V;  3NEK A;  1S1W A;  3ILL A;  5J2N A;  4NLG A;  5F8I A;  3UDL A;  1N34 J;  2QLB B;  1X9S A;  1RT2 A;  3GJT B;  3AQP A;  2R7O A;  2R9L A;  2FVC A;  1HNI A;  4RPF A;  4Q0B B;  4DSI A;  4LQ9 A;  2FPH X;  4JV0 A;  3G82 B;  4Z7Y A;  5LXY A;  3TYT A;  4NRT A;  1X4E A;  3HP6 A;  3CPW R;  1XJW B;  2LEP A;  4J9O A;  1ZTT A;  4WFZ A;  1NCL A;  3VAF A;  1JXE A;  2NZC A;  1R3N A;  1FX4 A;  1KQS R;  1XMO F;  4Z37 A;  4DR6 F;  2E44 A;  2DCU B;  3ITH B;  1JLF A;  5H9F K;  4IG3 B;  4LSL B;  1LWX A;  3VGS A;  3GMG A;  1EB0 A;  4KFB B;  4IH5 A;  4DS5 A;  1C4A A;  4QWB A;  2F8H A;  3G6V A;  3OFH A;  4NWB A;  4WZM A;  2ZFH A;  2EFO A;  2DXD A;  3JB9 k;  1S9F A;  4OHV A;  4HVZ A;  1YBA A;  3HKZ D;  2ZHO A;  4G6V B;  4KRW A;  3BSA A;  4GRS A;  5E3Q A;  1TV6 B;  2XYP B;  5C42 B;  5FJ4 A;  4N41 A;  4DR7 J;  1NSP A;  4K4T A;  4DHV A;  1QY7 A;  5E0O A;  1OJ4 A;  2G0I A;  5J2Q B;  2XLK A;  1T0T V;  3F44 A;  3M6X A;  2IAJ B;  1CJT B;  3W2W A;  3MEG B;  5AJ3 J;  3UR3 C;  1KQF B;  2W4P A;  1VBK A;  3QAE A;  2G2Z A;  1AW0 A;  2AF6 A;  3PJX A;  2BUN A;  4BC7 A;  2CNN B;  2R7Q A;  2DNG A;  1HMV A;  2NXN A;  3QRP A;  2KVQ E;  4EGL A;  4Q0B A;  4L72 B;  5GAH U;  1FT8 A;  2KZZ A;  3KLH B;  4M5L A;  5CYQ B;  4NCG A;  3RTV A;  4L3N A;  1NEE A;  1ZYQ A;  4QYZ K;  1WEX A;  1ZM2 A;  3DFE A;  3LH2 S;  4B9T A;  3KNA A;  3UVJ B;  5A6W A;  5FD1 A;  4A46 A;  1KSP A;  1CQM A;  4C11 B;  5KFI A;  1ZZN A;  3G6X A;  4IG3 A;  4Z7C A;  4B3T F;  4R0J A;  4FNI A;  4Q43 A;  4AL6 A;  3RR7 A;  2QLJ B;  2ZZM A;  3RYL A;  1RDR A;  2KM8 C;  4KFB A;  1SH2 A;  2QO3 A;  1Q5Y A;  4DCO B;  2OML A;  4FVC A;  4KGM A;  3D0I E;  2COL A;  3BGR B;  2NPF A;  2E1A A;  2BX6 A;  4OLO A;  2Z30 B;  4IR1 A;  3K89 A;  1NND A;  2YNF B;  4KIA A;  3A3P B;  2W7P A;  1VBY A;  3I0S A;  4O3N A;  2OEJ A;  3O8W A;  2A2D A;  3DU5 A;  2RHS B;  1DTQ B;  2ROG A;  1H72 C;  2WON A;  2E5G A;  2RHQ B;  5KFL A;  4TQS A;  5J2Q A;  1N56 A;  3W66 A;  4LF6 F;  1D9F A;  2DYA A;  4ECS A;  3NMR A;  4K0K F;  4I68 A;  1FJ7 A;  3TRG A;  2IAJ A;  1NJY A;  4YY3 F;  1FEE A;  1QVG R;  2OD4 A;  3HHL A;  1IR1 A;  1PYS B;  1N6Q B;  3MUM P;  5HK4 A;  2ZZN A;  1P27 B;  1FRJ A;  2J0W A;  3HVT B;  2F9D A;  2ZWP A;  1JKH A;  1MG7 A;  3ZZZ A;  2LU2 A;  3DDK A;  3C6U B;  3O6Q A;  2V0N A;  3QJL A;  1TTH B;  2PMZ D;  1GH8 A;  1RLD A;  2O67 A;  3HK2 A;  4WFN Q;  3JSY A;  5CYQ A;  5KFU A;  3HVA A;  4YQW A;  5HJY A;  5J1N A;  2AW0 A;  3ETM A;  1X9W A;  2KI2 A;  4CLS A;  2RIL A;  1HI0 P;  2Z57 B;  4YOE A;  2WB4 A;  5IWA J;  3HLU A;  2HWT A;  4PYA A;  3I6P A;  2C2N A;  3UVJ A;  2Q79 A;  1U8S A;  3PG9 A;  3I56 S;  1CS4 A;  4WZQ A;  3GII A;  3EVW A;  2QG9 B;  1EP4 B;  5D4O A;  3MAH A;  4D3H A;  1Q8I A;  3V5R A;  1W26 A;  3M8P A;  2RRN A;  5G0R A;  5K14 B;  1N5V A;  4RW4 B;  3ENV A;  5A8W A;  1XMB A;  5IQQ A;  4FBU A;  4OZ3 A;  4DXL A;  2HS3 A;  1HKA A;  1TUV A;  5DQI A;  3TEG A;  1BHN A;  2MZJ A;  2AJF E;  1U24 A;  3HJV A;  2IC3 B;  1K9M T;  2UUA F;  1Y5N B;  2RU9 A;  4ZA1 A;  1YRU A;  4FXD A;  2PC6 A;  1JLC B;  2P6T A;  2XYH B;  2HZV A;  2DR6 A;  2ZOF A;  3UN3 A;  1N5Y A;  3HVR A;  4JI0 J;  1NZA A;  1HNV B;  4F4X A;  2VQE J;  1HNX J;  2V9W A;  1XNR F;  2IRX A;  2JEG A;  2DHG A;  2FY1 A;  1RTI A;  4X4S A;  3QGH A;  4N47 A;  3D6M B;  1PG5 B;  2KTQ A;  4DCP B;  1M1H A;  3C6U A;  1RAG B;  5F8J A;  4TY8 B;  5B0D A;  1RU1 A;  1U8W A;  4U9R A;  3ULH A;  2KRR A;  2FVR A;  3V4I B;  3ENW A;  1GMW D;  4L6V 3;  3T5H A;  4K4S A;  3CJT A;  3M2V B;  2BJ3 A;  1EKS A;  1K44 A;  3EPG A;  2HQC A;  3KJQ B;  4MTP A;  2GO8 A;  4IFY B;  3TX8 A;  3ONQ A;  1UVM A;  1WSR A;  3UW1 A;  1J5E F;  1JXL A;  1CVJ A;  5J1E B;  2ZKU A;  5T41 A;  1V5I B;  2Z2M A;  2UUB F;  3SSS A;  2AU0 A;  1Q8B A;  2KXF A;  3PRB A;  1M0S A;  5K14 A;  1FCA A;  3I0R A;  4Z2X A;  2OSR A;  1KKH A;  2PA8 D;  4L76 A;  3OL8 A;  2GHW A;  2ZEJ A;  5LJ3 Y;  3T5J A;  5CA5 A;  2BM1 A;  3NAI A;  4OYI A;  2DRD A;  1HD1 A;  4NE9 C;  4MJK A;  2IC3 A;  4M5N A;  3ADA C;  2J7K A;  1BQN B;  2WVF A;  4G1Q B;  3NKY A;  4QR2 A;  2DNL A;  2MKY A;  2JL9 A;  3FJ2 A;  4ZVE A;  1HNV A;  2MJN A;  3M8Z A;  1WC4 A;  1Q53 A;  2F8E X;  3POT A;  1PIL A;  2ZM6 F;  1N32 F;  3PRV A;  3OR2 A;  4JI2 F;  4EBD A;  2FLN A;  2D74 B;  4OYO A;  1VQL S;  5GVQ A;  2UUC J;  3MMC A;  2MXY A;  4O4R A;  2YH0 A;  3PO4 A;  4E0D A;  3KJV A;  3FUY A;  4C8N A;  2CQB A;  2HQ3 A;  3EGW B;  4RJV A;  3GZ7 A;  2W01 A;  4TYB A;  1EET B;  1TVR A;  2HRU A;  3M2V A;  2VBX A;  2PN6 A;  3U02 A;  1JLE A;  3WZ0 A;  3JTN A;  2HNY B;  3DRY A;  2PI5 A;  2LQB A;  1RHJ B;  2JNJ A;  4IFY A;  3VGV A;  2IM0 A;  2CJQ A;  3LPE A;  3EE3 A;  4C8Y A;  3FSX A;  3SBM A;  3WDO A;  2B0G A;  4I0W A;  4KE5 A;  2MZT A;  3BGO P;  1VS3 A;  1S97 A;  2B6A B;  1Y00 A;  1UVN A;  2EW9 A;  1PAE X;  3FFI A;  2QEX S;  3A4T A;  1VJW A;  4P74 A;  4K5R A;  2EKN A;  2NXJ A;  1WTF A;  4NLU A;  1B99 A;  1WI6 A;  3RBX A;  1PC5 A;  3T9N A;  4MT1 A;  4YHH F;  5F8M A;  4AXI A;  5FLX U;  2K1R B;  2VFR A;  2MHE A;  1SC1 B;  3TZX A;  5CD4 A;  4GKK J;  5BYR A;  3Q83 A;  4U67 Q;  3WIV A;  1N5Q A;  4N8O A;  2CQH A;  3W5Z A;  2LU1 A;  4DL6 A;  2VFV A;  5HP1 B;  1T94 A;  2CWX A;  2R8I A;  2BKO A;  1HIY A;  1VHI A;  1JXV A;  2JVO A;  1NPR A;  4DR4 F;  1IBK F;  3OSP A;  4JI7 F;  1S59 A;  3MPV A;  4GVB B;  1NUE A;  2LP4 A;  3GR1 A;  3K5N A;  4QIE A;  3MR6 A;  1XBW A;  2BA9 A;  1XMQ J;  1TFY A;  3V81 A;  1KS2 A;  4WPA A;  2BJE A;  5GAD I;  2G1D A;  4OZN A;  4EBE A;  5IM0 B;  3LGN A;  4KHR A;  5A0Y A;  4ILM A;  1NH7 A;  1SJF A;  2QYG A;  4ZVS B;  4CH0 S;  4ZPC A;  4M94 A;  3KLE A;  4F4Y A;  1FVQ A;  1FXR A;  4XPC A;  1JX4 A;  4LFA F;  4F3O A;  5M2P A;  3QT8 A;  3NGS A;  2C2D A;  4WKY A;  5F41 A;  3R1L A;  1NB2 A;  4HAC A;  4OHZ A;  2R42 A;  2AGP A;  4N5S A;  2XSJ B;  1HBM B;  4KO0 B;  2QA4 S;  3AB2 B;  4ZVO B;  2UUT A;  1RT5 A;  2VFU A;  3S01 A;  4K59 A;  1FDA A;  4KGK A;  3DOK B;  3UR0 A;  2YPY A;  3T1Y F;  2CA9 A;  5KFW A;  4BBY A;  3MPY A;  2EBG A;  4HKQ A;  2HAI A;  2AHO B;  2HHH F;  4RNF A;  1FEH A;  2IRY A;  4LT6 A;  2K1R A;  1HPZ B;  1Q5V A;  1RT3 B;  3OT9 A;  1VQ5 S;  4V19 J;  2AYE A;  1DFD A;  1TR0 A;  5J2M A;  1MML A;  5HP1 A;  7FDR A;  3J7Z 5;  3DRX A;  3BGF A;  2GA7 A;  2YX1 A;  2ZBI A;  1D3W A;  1VYA A;  2IPO B;  1RGV A;  3LP0 A;  4OYP A;  8ATC B;  4Q8E A;  4CQ1 A;  2XI3 A;  4ZCI A;  2X51 A;  4H4M B;  4JP8 A;  5HL7 Q;  1AUD A;  1ZZF A;  1RHR B;  3QQC D;  2HAF A;  4DV2 F;  5DS7 A;  2H4W B;  3C3L A;  3GYG A;  3J7Z T;  2KO1 A;  2K7K A;  3BQ0 A;  2M9K A;  4LSN B;  1FRM A;  1O8B A;  4OI1 A;  3WC2 A;  3C19 A;  4ECU A;  3B78 A;  2DD8 S;  2ZKT A;  2Y9H A;  4J37 A;  2CNO B;  4QIF A;  4DV6 F;  1FE4 A;  2W1B A;  5ETO A;  3FBB A;  2PFD A;  2WCX A;  2ILY A;  4DR7 F;  2HRY A;  5KG0 A;  2K3I A;  1J2V A;  1FWK A;  4FP9 A;  2XSJ A;  3UDV A;  1HBM A;  4KO0 A;  4JV1 A;  1HL6 A;  2AIR B;  4MYT A;  4L3K A;  3MFI A;  2OI2 A;  5DM7 Q;  5AJ3 F;  3RG6 A;  1KBR A;  4QW8 A;  2MSS A;  5AXM A;  4LMZ A;  3F0N A;  1YI2 S;  2DHA A;  3DOK A;  3K5P A;  1U48 A;  3GJQ B;  3FEX B;  3Q24 A;  3HHL D;  2R8K A;  1LK7 A;  2BQU A;  3ZZ0 A;  2ZUG A;  2QN6 B;  2LKZ A;  3OVB A;  4N77 A;  1RWN B;  4EYH B;  4DUY J;  3JAM Y;  2VG7 A;  3RUB L;  1U1N A;  1T9U A;  1S48 A;  3N79 A;  3PRD A;  3AJ2 A;  2ZHA A;  2VHG A;  1KTV A;  3CJ0 A;  2LQJ A;  5A2Q Y;  1ZTW A;  2N3L A;  4P10 A;  4LSZ B;  3UE2 A;  4HHH A;  3LUY A;  1U1R A;  2WVB A;  2LXU A;  1VJQ A;  4CLF A;  3HHL C;  4DL3 A;  3UFC X;  4H4M A;  1SL1 A;  4Y65 A;  1TL3 B;  3TVZ A;  2BJ8 A;  5HVH A;  4DG1 B;  3H40 A;  4X4V A;  1RAD B;  2FJA B;  4NPO A;  1WKL A;  4LRE A;  4B9S A;  2ZD1 B;  1LWF B;  2R2T A;  2QE5 A;  2OPQ B;  4NI2 B;  4NYZ A;  3J80 Y;  2HBY B;  4CTA B;  4C3L A;  4BWM A;  3UCZ P;  1C0U B;  4AXJ A;  1SJQ A;  1P9Y A;  4ED7 A;  2EC2 A;  4NRU A;  3RBE A;  5IOL A;  1T03 B;  2C1E B;  3IS9 B;  2I5J B;  4I6A A;  1DQ9 A;  4NLP A;  3QRR A;  4CM0 A;  2KH9 A;  4ANE A;  1KDN A;  3GFZ A;  2NS1 B;  4MKB A;  4JI8 J;  4DX6 A;  1RZM A;  3MTJ A;  3AOD A;  3A8E A;  4UOF A;  4WP9 A;  2PI4 A;  3W2V B;  1R8C A;  1G3O A;  4PUO A;  2D9P A;  1ZAW A;  3HM9 A;  3CVK A;  4YN3 B;  3MMJ A;  3KMS A;  5IWA F;  3H5Y A;  2NSC A;  3TP2 A;  2Z2Z A;  2FLL A;  4ED8 A;  1SH3 A;  2WVC A;  1KRP A;  2FIU A;  4PXD A;  1WJ9 A;  3VHQ A;  4IQX A;  2DGO A;  2GAG C;  6FDR A;  1B0T A;  5CHC B;  1TKZ A;  2DGX A;  4B3O B;  3GG1 A;  4QOT A;  1VQS A;  3I5A A;  1R8P A;  1U4B A;  1I94 F;  3KLF B;  4R0E A;  1RWO B;  3O1L A;  1RBL A;  4X65 J;  1S12 A;  2OPS B;  3OXG A;  1X0P A;  2AT1 B;  3OFG A;  3EWG A;  5HLF B;  4ZS6 A;  3CE8 A;  3SV3 A;  1X5T A;  1KHW A;  2O1P A;  3MM8 A;  3SSR A;  2HMI A;  4KYZ A;  1J27 A;  3PV8 A;  3ZZP A;  4NI2 A;  3CCJ S;  2Y1R I;  2ZUA A;  1QTM A;  4O0N A;  2LXF A;  1Z1Z A;  3TA2 A;  4BWJ A;  1P8G A;  1FKO B;  2R7V A;  1FKA F;  4CTA A;  4G65 A;  2FLP A;  3F41 A;  3M8Y A;  2O66 A;  2HQG A;  4USU A;  2ZH8 A;  3NOC A;  2V34 A;  3CGI A;  4RBT A;  4TLQ A;  2I0X A;  1GK8 A;  1UZD A;  2ZVS A;  3TVK A;  2B5J A;  4DN0 A;  3IS9 A;  3BN7 A;  2VQE F;  1HNX F;  4HI1 A;  2CPD A;  2VIH A;  2EFQ A;  5GAG I;  2IJN A;  2LEB A;  4J9M A;  5KT4 A;  4LFB J;  1JLB A;  1XWL A;  2PEH A;  3GJR B;  4CT8 A;  2FC9 A;  2ERR A;  1RUS A;  2WSE C;  1S77 D;  3HFK A;  4WYW A;  1BY9 A;  3M32 B;  2MQL A;  4LF8 J;  3TAM B;  2RDJ A;  4K4U A;  5H9F J;  2QSF A;  4LIR A;  3W2V A;  2AV5 A;  3Q23 A;  3THP A;  2AX0 A;  3DOM B;  3SV4 A;  1WSV A;  2B9W A;  2Y8W A;  4EUV A;  1S1V A;  4OZ2 A;  3US5 A;  1QJH A;  1UKU A;  4RW8 A;  2NUH A;  5ETR A;  3KFW X;  2GQ2 A;  3TAQ A;  5EUH A;  2XQC A;  1ZM4 A;  2ZC4 A;  2MKK A;  2CQ3 A;  4KV8 A;  3PJ9 A;  5KFG A;  3D4J A;  3H2V E;  2EEY A;  3HT0 A;  3IBW A;  1UWB A;  2E9T A;  5KFJ A;  1NBE B;  4HYK A;  5D8H B;  4OLP A;  5IC6 B;  3A8K A;  2JRS A;  1HBU B;  1T3O A;  4ANC A;  5T14 A;  2HHQ A;  3OLB A;  3FGV A;  3DCA A;  2XNR A;  1WC3 A;  1YQH A;  2RUS A;  2O01 C;  4PYD A;  3Q8Q B;  4CH1 A;  2W25 A;  4HR2 A;  1IR0 A;  1KWM A;  3T6J A;  4HL9 A;  1BC6 A;  1KEK A;  1Q82 T;  4R8U B;  3QYY A;  1ZA1 B;  4J7C A;  2ZBR A;  3GON A;  4UW2 A;  3E8O A;  3D67 A;  4P52 A;  1PIE A;  4C6A A;  4LVN P;  2R7T A;  1LV5 A;  2ZH1 A;  2PT0 A;  3AOA A;  3NP5 A;  2VC1 A;  3SDE B;  4L73 A;  4UF4 A;  4XDC A;  5KFD A;  1FJE B;  1FK9 B;  1T95 A;  2XHC A;  3Q89 A;  4RO0 A;  3BKT A;  4IYQ A;  5LXR A;  3PM9 A;  4USH A;  3KHG A;  2XMM A;  1J5O B;  3NS5 A;  4F2S A;  2FZC B;  4GKJ F;  1UPM B;  5E7O B;  2W2O P;  2CPI A;  1HBO B;  2BW7 A;  2W7A A;  2WOM B;  2AJ4 A;  4DPX A;  2FJB B;  1H73 A;  2GVD A;  2KHC A;  3SQO P;  4MKV A;  1C0T B;  5E2Q A;  2VPW B;  4F0H A;  1VK8 A;  3K59 A;  3M6V A;  3LP2 B;  1Q81 T;  3KMQ A;  2BYC A;  4QQB A;  2M2B A;  3M7V A;  1B70 B;  2QSW A;  1HNW J;  3NL0 A;  3K8V A;  2OEK A;  1SL2 A;  1N36 J;  2DVI A;  1F5C A;  1U0H B;  4WE1 A;  2ZH7 A;  1GT8 A;  3QO9 A;  1HQU B;  3M1V B;  4M5G A;  3JAM U;  4KBI A;  3NGT A;  4KGX B;  3RJM B;  2ZNZ A;  4K50 A;  1N5S A;  5C25 B;  1FNX H;  1HR0 J;  4OX7 A;  3MAQ A;  3U1M A;  2W4D A;  4PAB A;  2Q66 A;  5A2Q U;  2XM3 A;  2HHX A;  4ECQ A;  3ZO7 A;  3U27 A;  1RTJ A;  4DX8 H;  4ID8 A;  5I3U B;  1VQN S;  5GAH I;  1KFD A;  1WEZ A;  2AD9 A;  1XR5 A;  3BO4 A;  2MYF A;  2ZH6 A;  2KB2 A;  2J0Q D;  1SUQ B;  3SDE A;  1R8B A;  1RWP B;  2QMU B;  2R2S A;  1ZPV A;  4ENO A;  2ILZ A;  4WFY A;  3FRZ A;  4DWI A;  3C16 B;  3GWC A;  3V6D B;  1XMQ F;  1WEY A;  4QPT A;  4ZP6 A;  4B08 A;  2EPI A;  4F3Q A;  4DSF A;  2E7V A;  3ENQ A;  2B4V A;  1YJR A;  1HBO A;  2HVD A;  4YME A;  3N9U C;  3ET6 A;  2EBE A;  4ED1 A;  4IO9 Q;  3VWS A;  1RYR A;  2PSZ A;  4LFC J;  1JQG A;  3PW2 A;  4ZVG A;  4B3R J;  2OD6 A;  1WC5 A;  1S6P A;  3HFV A;  4A48 A;  2I2Y A;  1FNO A;  4WP8 A;  2NQP A;  3DGP B;  1VQM S;  4JUZ A;  1KLN A;  1S57 A;  3CJK B;  3K0J A;  1H38 A;  1XEZ A;  3NGK A;  3HDS A;  1QSL A;  2DNM A;  5F3Z A;  2HND B;  3LO3 A;  3R7S B;  2IM3 A;  2PE8 A;  2IVF B;  3FVY A;  5D77 A;  4PEO A;  4DLG A;  3EXY A;  3CDU A;  2J6U A;  3K58 A;  1FFW B;  2FLO A;  1S1X A;  1ZS6 A;  2DGS A;  3BKU A;  2RVJ A;  3PVX A;  4LBP A;  3DLE B;  1V3Z A;  1B7F A;  1K47 A;  3NBP A;  5D0G A;  2CQD A;  4Q5V A;  4NCA A;  2VBW A;  1AA1 B;  3I5B A;  4OYM A;  1S1T A;  3F56 A;  2C2R A;  3CDE A;  3LPY A;  2BRK A;  1YHQ S;  2GHV C;  3G71 S;  2DR8 A;  3V6K A;  2NR0 A;  3CC7 S;  4QJV A;  2QYC A;  1FRK A;  2WSF C;  2M88 A;  3NLC A;  3BQ2 A;  5DG8 A;  5HQL A;  4X62 J;  3DOL A;  2P5V A;  1R27 B;  3HI9 A;  4X4U A;  4I7F A;  5DDP C;  3KK1 B;  4MK9 A;  2EK6 A;  3NWR A;  4NLR A;  4DUT A;  1RHQ B;  4CLL A;  1R6V A;  3AB4 B;  1UVJ A;  4B3S J;  4ZLP A;  1UTA A;  4HLB A;  4QU6 A;  3N4W A;  1SJ3 P;  1KTQ A;  2ROP A;  2YNG B;  4C8O A;  2ROE A;  5F9N A;  3CF5 Q;  5D6G A;  4F26 A;  3M2R A;  1S10 A;  4LR7 A;  1RK8 A;  4P72 A;  4DPY A;  1X5S A;  1EAR A;  2VPX B;  3AA8 A;  3G8S A;  1L3S A;  2HQF A;  1LW0 A;  1BUX A;  4EWT A;  2LXI A;  3DGP A;  2N7C A;  4LRC A;  4F02 A;  2W2M P;  3CJK A;  4A4J A;  1B0P A;  1RT1 B;  2HGN A;  4TLR A;  3W9J A;  1SH0 A;  4M95 A;  4LIW A;  4C8K A;  2FC8 A;  2GNK A;  1S1U B;  1Q8L A;  3BYP A;  3NCP A;  2JDJ A;  2BV3 A;  5IV3 A;  2QTW A;  3VGT A;  3UNG C;  2CKW A;  3DLH A;  3GSD A;  5B0A A;  4P73 A;  4U7U D;  3J81 Y;  2M3D A;  4TQR A;  2W8L A;  3IR7 B;  2ZWO A;  3K2Y A;  2H4Y B;  3Q8Y A;  3AXK A;  3TW0 A;  4F0K A;  2HYI B;  5CCL A;  5GAE I;  3T6B A;  4XAK A;  3H90 A;  4DUY F;  1MLA A;  1QAI A;  3DRR B;  1S99 A;  3M4X A;  4R5P B;  3NWG A;  4FPR A;  1UZH A;  3L9Z A;  2IM1 A;  4ZN1 A;  1XQI A;  5CH7 B;  1X60 A;  3J7A N;  3EZ5 A;  2VFS A;  4TU8 A;  1XMO J;  3UPF A;  1NJI T;  1YDL A;  2CWK A;  1DQA A;  5E3R A;  5CYJ A;  2IA0 A;  5KFP A;  5L9N A;  3BGU A;  1KLM B;  4PQU A;  3W1Y C;  1OY6 A;  4OV1 A;  2O5D A;  2ZNY A;  2GMH A;  3CCZ A;  1IBM J;  3OVA A;  2RF2 B;  2OKQ A;  4ECX A;  4ZJQ A;  5L1I A;  1X5O A;  1FVS A;  2QA4 G;  2UVR A;  1VC0 A;  4C7Q A;  2QT7 A;  3FMW A;  2K7J A;  2DGU A;  2QZ8 A;  3MM9 B;  2UZA A;  2APO A;  2J8S A;  5KT2 A;  3QID A;  1NH8 A;  4WU2 A;  2IVM A;  4QR1 A;  1BWE A;  2XBP A;  3K8W A;  1EJ7 L;  3GP9 A;  5HAO A;  4DUZ J;  3CNQ P;  4X4O A;  3LOU A;  3BYR A;  4I64 A;  1S6U A;  1HD0 A;  1H98 A;  2BE2 A;  1NK9 A;  1EQM A;  1S0O A;  3R5C A;  3X1L B;  2KDO A;  5KFO A;  2KT5 A;  5L8R C;  1S9E B;  3V2U C;  3D1Q A;  4NYO A;  3R7N B;  1B0V A;  1NHK L;  3CCS S;  1F0X A;  4CO1 A;  4Y2M A;  2IYG A;  2ZH9 A;  3SCL E;  4PPZ A;  5M2U A;  4X64 J;  2R8G A;  5HI7 A;  2KG1 A;  1XR6 A;  2XWX A;  3SMZ A;  1Q8K A;  4IQM A;  1TL7 B;  3CDW A;  3MZI A;  2RQC A;  3HSG A;  3WIU A;  2NSB A;  1KD1 T;  5DQH A;  1TU0 B;  2DNY A;  2ZOG A;  1FKP A;  1GXU A;  4O3Q A;  1G1X A;  3A8I A;  5LJ5 Y;  3DLJ A;  2V50 A;  1F9H A;  4NA2 A;  4Q44 A;  3TZY A;  2QJ3 A;  4X65 F;  3NXZ A;  4ECR A;  4C8Z A;  2EFN A;  2H5J B;  3MCM A;  4DSL A;  1F3V A;  3Q0A A;  1Y11 A;  3GYN A;  4HHU A;  2RF2 A;  2ZDP A;  4DPW A;  3AH6 A;  2DBB A;  3R2D J;  2K2P A;  4K2X A;  2XMJ A;  2UU9 J;  3DHX A;  2G2Y A;  3BS9 A;  3QPI A;  4C0B A;  1ZBT A;  1GMU A;  1HHS A;  4NEY A;  3WX4 A;  1TMM A;  3MM9 A;  2HFS A;  3TUI C;  1RT4 A;  2UP1 A;  4KGV B;  5L38 A;  3PX6 A;  1YJ9 S;  3OVS A;  4LF6 J;  2NZ4 A;  4FNH A;  4K0K J;  4P2S A;  4CI0 B;  1FX2 A;  5K8M A;  3L7U A;  1UET A;  3OTB A;  4LFB F;  1U09 A;  4RU2 A;  2CQG A;  4YY3 J;  2XEX A;  1TEL A;  4KAI A;  2AZ3 A;  1BE4 A;  4ZPB A;  4OHY A;  3QLH A;  4DV3 F;  5U47 A;  3SSQ A;  2DKO B;  1NDK A;  4RLE A;  4ZPD A;  2OJ3 A;  3IC1 A;  1TFW A;  3VZI A;  1LNQ A;  4CO2 A;  2ALZ A;  3N6N A;  5IS2 A;  4YEA A;  3G4S S;  4ZPW R;  1R43 A;  4F8R A;  3RAQ A;  1VRT A;  4OI6 A;  4S0M A;  3TAR A;  4ZCL A;  1RT6 A;  1NHV A;  3CD6 S;  3JYT B;  3HHK A;  3KK3 A;  4ZVH A;  5I42 A;  4OJ1 A;  2DO4 A;  4OX9 F;  2IRU A;  4PG4 A;  4DR3 J;  1EQ0 A;  3M2U B;  1TMJ A;  5ETM A;  1VRU B;  1Y0H A;  2MQO A;  5KOW A;  1R8H A;  4UOC A;  1VIO A;  2L41 A;  2O3D A;  5KFZ A;  4I69 A;  2EFV A;  2MY7 A;  2IDE A;  1A6L A;  1RHM B;  2DIU A;  4WK3 A;  2I38 A;  5ETK A;  3IO1 A;  3H7H B;  1F9F A;  3CIZ A;  2XC9 A;  4C3M A;  2UUA J;  1LFP A;  1TL4 A;  3GSI A;  3FKB A;  1FTC A;  2RKI B;  4F2R A;  1CJV A;  1WD6 A;  2NUU G;  1R6Y A;  4ICL A;  4MMO A;  3FBF A;  3PIO Q;  4LQ3 A;  3ZZR A;  3BZQ A;  2OSQ A;  4P75 A;  4W4M A;  4RW6 A;  2P9C A;  1I3O B;  3QFH A;  4ZJL A;  2V2V A;  1IM6 A;  3T9Z A;  4M5D A;  2M0G B;  2HHT A;  4XK8 C;  2OPR B;  1VQ4 S;  1AFI A;  2EFP A;  4RNN A;  3MEE B;  3CCV S;  4A8S A;  1DY3 A;  4F4W A;  2W9B A;  2OP5 A;  2J9E A;  2VBZ A;  2F40 A;  1EIY B;  2MZQ A;  4DQP A;  1C1B B;  4OL8 A;  1NPP A;  2V69 A;  3CTR A;  4CM2 A;  1SV5 A;  2B43 A;  2U2F A;  1REG X;  4ZPA A;  2F65 A;  4DF4 A;  5K8O A;  4GC6 A;  1FDD A;  2DGV A;  1X4F A;  2M8H A;  4RL1 A;  4ECT A;  2VG5 B;  4YR2 A;  4DF8 A;  4CLK A;  3KJN B;  4J9P A;  3ZTQ A;  2E1C A;  3IRX A;  1J5E J;  3FEZ A;  1VRU A;  1UJ4 A;  1T05 A;  1N33 F;  2PMH A;  3J81 U;  1U6F A;  4DV7 F;  1X8D A;  1IM4 A;  3ISZ A;  3N5F A;  1KVK A;  2HFZ A;  2F4F A;  3IM9 A;  1T3N A;  1N36 F;  2M4M A;  1KHV A;  2GAH C;  2HW3 A;  4H4K A;  5HMY A;  3R97 A;  4XIU A;  3W63 A;  2IJR A;  1B4S A;  5KFX A;  4CO3 A;  1MWQ A;  2B4P A;  1Q7L B;  3ZZO A;  4HTI A;  4DMZ A;  1WKJ A;  4PG6 A;  5EN1 A;  1U2C A;  2MDA A;  5I3P A;  1HR0 F;  3MTK A;  1YG0 A;  3OXL A;  3FRY A;  3FC9 A;  2CJB A;  4DZ6 A;  2J8A A;  1WHX A;  5HJX A;  1S0N A;  1Q78 A;  2F7V A;  2Y1I A;  2CZV C;  5L1K A;  4EMD A;  1YVF A;  3EXC X;  1VIS A;  2AX1 A;  3HVW A;  5F3T A;  2GZO A;  3DYA B;  4JI2 J;  2VKR A;  3MWB A;  1LWE B;  3T5L A;  1FD8 A;  3MEE A;  5FII A;  3M8W A;  1GX6 A;  2LA4 A;  2BM0 A;  2XZW A;  4PG5 A;  4EYI B;  4PZV A;  1H2T Z;  1YJT A;  1WTB A;  1QSS A;  4LFC F;  1QUV A;  1DQ8 A;  4J90 A;  2C28 A;  1M1K T;  4B3R F;  3NGR A;  5AE3 A;  1W2I A;  1WEL A;  2D3U A;  2FHO B;  4PPD A;  1UA0 A;  1MN7 A;  4OX8 A;  3KUE A;  2DT9 A;  4O4G A;  4F3M A;  3QIP B;  4RW7 A;  3HSD A;  5D4N A;  4OYZ A;  4V19 X;  2DR9 A;  2WAQ D;  3I32 A;  3GB0 A;  4ZVQ B;  2LLZ A;  3DRP A;  3LGM A;  4USI A;  2V63 A;  2W9C A;  3ZZU A;  2V68 A;  2YX7 A;  2B8P A;  1S7H A;  4ELV A;  3WBZ A;  1LFW A;  2RQM A;  3W8P A;  2VH7 A;  4HH0 A;  4URQ U;  4JV2 A;  4RW9 A;  1DLO B;  2EXU A;  5DM6 Q;  3FBE A;  5IC4 B;  1U0S A;  3MED A;  1YRT A;  5HAN A;  3ILO A;  4UQG A;  5KFQ A;  2XS5 A;  2DHS A;  1T11 A;  4LF1 A;  1WOP A;  2GW8 A;  2AYM A;  1O6X A;  2MQQ A;  2YY3 A;  4M1K A;  1GEH A;  2RS8 A;  3MMB B;  5T7L A;  2C2Z B;  5A8K A;  1OQ3 A;  5SUH A;  3UN2 A;  1SQE A;  3PX0 A;  3SCI E;  2MQP A;  3DDI A;  4LF7 F;  3TO8 A;  3D6F B;  1G6B A;  2HHW A;  5AE1 A;  5BXI A;  1RTH B;  2BJ9 A;  4DR4 J;  4B9V A;  2I8E A;  4PXE A;  2RD5 C;  1IBK J;  2Z58 B;  2F8M A;  3DYA A;  1AYE A;  3R2C J;  1WC0 A;  1RTD A;  2GIR A;  1JLG B;  2W9A A;  1IKW B;  4Y0F A;  3ZNU A;  4DEZ A;  4A8O A;  2G0J A;  5FDL B;  4NLT A;  2PII A;  2XCP A;  1VBX A;  4RUH A;  3GV5 B;  1UEV A;  3JSM A;  1R7I A;  4ED3 A;  2QLW A;  5KG5 A;  1NDP A;  1REV A;  3MM6 B;  2BKP A;  4LFA J;  4UT4 A;  1NKB A;  2I9S A;  2WZ1 A;  4NZ7 A;  4LJM A;  5KT3 A;  5DQG A;  3G6E S;  2POK A;  3W64 A;  4H54 A;  3MM5 B;  3G96 A;  5KFE A;  2MJU A;  3TQ1 A;  1U1O A;  3LWL A;  2V8V A;  4MFB A;  3WHI A;  1N54 B;  4HDG A;  5E5N A;  5A8R B;  4UZC A;  3T1Y J;  2GML A;  1L5U A;  4P2M A;  1RYS A;  1HHT P;  3DMJ B;  3DRS A;  2GQQ A;  1L3K A;  1VQ8 S;  2HHH J;  3N6M A;  2GHP A;  1E6Y B;  3QNW B;  3SEO A;  3ILI A;  2BVZ A;  2PGC A;  4DFJ A;  1CJU B;  2UXD J;  3KNG A;  1QAX A;  5SZT A;  2HFO A;  4NA3 A;  5KFS A;  1LWC B;  4PKD B;  1HWI A;  2PA3 A;  4BLG A;  4DX5 A;  2E7X A;  3A8J A;  4O44 B;  1GFW B;  3CUN A;  2DNQ A;  4ZVU B;  3R6L B;  3BR8 A;  1VHF A;  4FF1 A;  1DTT B;  2XY7 A;  2BBE A;  4OV6 A;  1IBM F;  3DKD A;  4DV2 J;  2QX0 A;  2X1G A;  4PWD B;  2VOO A;  3HKW A;  4JYA J;  1UEU A;  1GNK A;  1RKI A;  2DEJ A;  1RI7 A;  4X84 A;  2A10 A;  4DV6 J;  3GQC A;  3KLV A;  3W8G A;  5C2G A;  4I6Y A;  5EWG A;  3D0G E;  1NU4 A;  3ZTR A;  4IH6 A;  3T1A A;  4RUB A;  1AT1 B;  4ZCM A;  2R2U A;  3M05 A;  1GTE A;  4H4O A;  2CDR B;  4I2P A;  4OYW A;  4RNH A;  1OSD A;  4ECW A;  1HW9 A;  4C98 A;  4DUZ F;  4ILR A;  4N7T A;  1FRI A;  1PJ5 A;  2XHW A;  2YXL A;  4IDK A;  4TVA B;  3LP1 A;  5K8P A;  4N8N A;  1IBC B;  2GC8 A;  5HN0 A;  3OL9 A;  3CCR S;  3A3O B;  4LRD A;  3LGH A;  1PKU A;  3IR6 B;  2BAN B;  1GQE A;  3DM2 B;  3Q2S C;  1E6Y A;  4PWW A;  3G82 A;  1UEK A;  3SI8 A;  4HT5 A;  1CJU A;  3PEJ A;  2C3P A;  3HSJ A;  3KKF A;  4X64 F;  4QWC A;  1HWJ A;  3UDE A;  4CT9 A;  1O51 A;  2WTF A;  5A76 A;  4XTT A;  5FLX Y;  1RAE B;  3OR1 B;  4ZP8 A;  1OS5 A;  3Q8S B;  3TVY A;  4J9L A;  3ITH A;  3PR4 A;  4LSL A;  1VMB A;  2HHS A;  4U95 A;  2ZOM A;  3W9H A;  2M7S A;  2E66 A;  3L7P A;  4J9V A;  5DLF A;  4K4X A;  1R31 A;  4ZVF A;  1VRQ C;  2GFF A;  2MKS A;  2MEW A;  4PWD A;  4P2F A;  3HSZ A;  2VB6 A;  2XUL A;  3TEH B;  2UU9 F;  1DAR A;  3D3C J;  2DRA A;  3BSO A;  4CIO A;  1QAY A;  3AOC A;  3EPI A;  2R8J A;  3KK2 B;  3P8B B;  2XS7 A;  2JHE A;  1TV6 A;  4A8X A;  5C42 A;  5C5J A;  3DN9 A;  1NPK A;  1F3F A;  3H2L A;  2FVQ A;  3MR2 A;  1R0A B;  2HPU A;  2QFI A;  1JJ4 A;  2DGQ A;  2JWN A;  1OY8 A;  1R89 A;  3RZA A;  3BPS P;  1CJT A;  3MEG A;  2R7U A;  2E5H A;  5D0H A;  1PO6 A;  2Z2L A;  1U49 A;  3QGG A;  2DEI A;  2A6O A;  1WKK A;  4J5O A;  3C15 B;  2WB1 D;  3D6T B;  1NSA A;  4GO7 X;  5J2P B;  3PAC A;  4DZD A;  3ENA A;  3OTD A;  1W2B R;  4LUB A;  4ZVR B;  2V94 A;  3NS7 B;  3KLH A;  5LMU J;  3FCW A;  2QLF B;  2J76 E;  3OHB A;  1FJG F;  1EHW A;  2Q6B A;  4X66 J;  4OQJ A;  3K57 A;  2DPI A;  2VPZ B;  4DV0 F;  3MD1 A;  3EVO A;  1S7I A;  4OIX A;  2VDI A;  1ARO P;  2EVZ A;  3EZU A;  3IWN C;  2R8H A;  2L48 A;  5HMZ A;  4DR3 F;  3RRK A;  4C11 A;  2G2O A;  2KM8 B;  1NJZ A;  4BDP A;  2X3D A;  2NXC A;  2YKN B;  2GO9 A;  4ES2 A;  1LXJ A;  2MZS A;  1S6O A;  3H0P A;  4F04 B;  4CWB A;  1H2V Z;  1TKX B;  1I94 J;  3C8Y A;  2C22 A;  1U47 A;  4LF9 J;  5DDO C;  1P1T A;  4LF4 J;  2JLF A;  2EG2 A;  4FDF A;  3BGR A;  4X4T A;  1DAX A;  2ZE2 B;  1T8E A;  5F0U A;  2EKY A;  4USJ C;  3N6L A;  4ID5 B;  5L1J A;  3AJD A;  3GV8 B;  3C46 A;  2JZ5 A;  1RAF B;  3E01 B;  4TY9 A;  2IBO A;  2YNF A;  2KL8 A;  3R5J B;  1F6T A;  1K0T A;  1Q86 T;  4LRB A;  1RIS A;  2I6W A;  3D9B A;  4YDX A;  1NK5 A;  1ELO A;  3VCD A;  1DTQ A;  3FCV A;  2FQQ B;  1RU2 A;  9RUB A;  5E3P A;  1HLW A;  3FCH A;  3CD0 A;  2E9Z A;  3HUL A;  2UVU A;  5D3G B;  3OTO J;  3H4D A;  2GVZ B;  5KG7 A;  1N6Q A;  2CG8 A;  3BH6 B;  3HVT A;  2DHX A;  4M8L A;  3D0H E;  1Y9O A;  2V2Q A;  5G4D A;  4KHM A;  4J9K A;  2W4C A;  3GJS B;  1UW4 A;  2H65 B;  2VIC A;  2AQ4 A;  1F5A A;  4EBC A;  3ZZT A;  3MCO A;  1VQK S;  1R0C B;  1SL0 A;  4DU8 A;  3VF0 B;  3R8Y A;  2DB1 A;  3D54 A;  2FJD B;  2C2M B;  1S0M A;  3PYG A;  1TL5 A;  2UXC J;  2H51 B;  1ZM9 A;  1Y3J A;  4DFP A;  2J9C A;  3FQK A;  3M30 B;  1TKT B;  2B7C B;  1V5V A;  5KTQ A;  3KDN A;  3ZZY A;  5JUM A;  2DR7 A;  3MMA B;  4NXN J;  2YKN A;  1PCA A;  1EP4 A;  2N4D A;  1BQX A;  1M5K C;  4N56 A;  3N28 A;  2ZJP Q;  2VD3 A;  1X4H A;  1WG5 A;  3KG1 A;  4KC5 A;  3GPA A;  2OEL A;  3GR0 A;  4RW4 A;  1Y5L B;  3P3D A;  8RUC A;  3F73 A;  2GQC A;  4PAA A;  1LQ9 A;  1RBA A;  1VFJ A;  4UQT A;  3HXM A;  3CMQ A;  2ZH2 A;  2ASD A;  1UAW A;  2VUG A;  3AHP A;  2C2O B;  1CBK A;  1DJ0 A;  4ZHR B;  1HQE B;  4IRD A;  2B56 A;  2K8G A;  2VL1 A;  3GFX A;  3D6H B;  5H9E K;  2V2K A;  5IT9 Y;  2PMW A;  2G13 A;  3FK4 A;  4A8F A;  2J9D A;  4J9R A;  1SIW B;  1JLC A;  1IKV B;  3QWP A;  4KH1 B;  1NJX A;  2AGO A;  3BKF A;  4FBT A;  1WF2 A;  4WFX A;  2ZJQ Q;  2AEM A;  2NXU A;  5D3G A;  1RB0 A;  4IUF A;  3KLI B;  2GVZ A;  2NYI A;  1S9G B;  4JBC A;  1M90 T;  4NLQ A;  4IOB A;  1H0H B;  3VQT A;  4XO0 A;  4OI4 A;  4TY8 A;  2WVE A;  1VR6 A;  5CQG A;  1JK9 B;  1SKS A;  2XS2 A;  1PJ6 A;  1Y10 A;  3THT A;  3TZZ A;  3JQK A;  4QYR A;  5JXS A;  4GKJ J;  1OYE A;  4UUW A;  2WW8 A;  3V4I A;  5MLC V;  3PFO A;  3TQE A;  3GV7 B;  4MK7 A;  3HO1 A;  2VON A;  4C4W A;  4QWD A;  2LYV A;  3H42 A;  3RB6 A;  4MIW A;  4A8W A;  2F9J A;  2OFG X;  1JWW A;  1WF0 A;  4NL5 A;  1Y3K A;  5IQ6 A;  5EHH A;  3GYX B;  4NMX A;  2DCL A;  4URG A;  2KG0 A;  2BJD A;  5J1E A;  4J91 A;  3A13 A;  4WU3 A;  3GE9 A;  1TK5 A;  2RNE A;  2JVR A;  3TAP A;  3LF0 A;  1NK4 A;  1K1Q A;  2G4B A;  1KNZ A;  4DBQ A;  3BH7 B;  1QSY A;  1JLA B;  4DPT A;  2BEF A;  1XER A;  2CPJ A;  4OZJ A;  3FSY A;  1RLC L;  1AB8 A;  3OLA A;  1MRO B;  1HQE A;  3L3C A;  4PWU A;  4CYU B;  2MPU A;  1SIZ A;  3DLG B;  2R7R A;  1BQN A;  2C3Y A;  1RAH B;  4G1Q A;  1RAB B;  4DLE A;  4B3M J;  3HHE A;  4OMF G;  4O3R A;  5KG3 A;  3PCO B;  4CLY A;  1DUR A;  4OZ1 A;  3L4B C;  2VOD A;  4MH8 A;  2MKH A;  3OJS A;  3IM8 A;  4DX7 A;  2LA6 A;  4ECZ A;  3MI7 X;  1ZH5 A;  1IKY B;  2HLT A;  1D1U A;  3D3B J;  3PTW A;  1RAI B;  3PKY A;  2OTL S;  2MLZ A;  4NA1 A;  3UD5 A;  1OWX A;  2XB2 D;  1C1C B;  3U1L A;  4UZB A;  1N8R T;  4FYY B;  2YQ0 A;  2E5L J;  1HWL A;  3BB5 A;  5CYM B;  5LT5 A;  3MDF A;  2V4J B;  4Y2I A;  1EET A;  1WAC A;  2HKE A;  2HVE A;  3I5C A;  1APS A;  2HNY A;  2W2Q P;  3CCU S;  3GFY A;  1OPI A;  4MIB A;  4EO8 A;  5HBM B;  2AP6 A;  5B0G A;  1Q1K A;  5D15 A;  3JTP A;  4P71 A;  3BO3 A;  2XCA A;  4ZIV A;  1MSW D;  2J0X A;  2CPH A;  1A9N B;  3Q22 A;  2B6A A;  3W60 A;  5KFC A;  5RUB A;  2AMC B;  4NLX A;  2QA2 A;  3BBC A;  4DSJ A;  2YKQ A;  5BYQ A;  5I4M A;  4ECY A;  2A0F B;  2DJW A;  2IM2 A;  5KT6 A;  2VOP A;  1EAY C;  5DG9 A;  3NG8 A;  2L3M A;  3RB0 A;  1YGY A;  2HVI A;  3NOG A;  5E3A A;  2VC0 A;  3OFE A;  3DXS X;  4M5H A;  3R5G A;  1U1P A;  1T9V A;  2OH2 A;  1YJU A;  2AEF A;  2UXD F;  2EG1 A;  4FS1 A;  1VQ9 S;  1SB6 A;  1ZAX A;  3EYZ A;  4LBH A;  4I67 A;  2D69 A;  4PXB A;  1UWA A;  4F4K A;  3KWM A;  4CZC A;  4FYW B;  4GVB A;  4JI1 J;  5J2N B;  2H3E B;  3AD8 C;  1RT2 B;  4RWW A;  4K4Z A;  2PD1 A;  5KG4 A;  3RW7 A;  2CNL B;  1HNI B;  3L95 X;  2B9Y A;  3VTI A;  2ZZT A;  2QLX A;  4M5J A;  4JYA F;  4ZP7 A;  5CYM A;  3NGU A;  3B4D A;  2V4J A;  2YWF A;  3P45 B;  5IM0 A;  3CXC R;  3R9L A;  3CW2 C;  2CZ4 A;  4IOA Q;  3KLG B;  3OXF A;  2NPI A;  2HSE B;  3U1N A;  4X4P A;  2WRM A;  3AAW B;  5AXK A;  2EI5 A;  3GIM A;  2GGP B;  2MKJ A;  2DNN A;  3KUH A;  1YJW S;  2WVD A;  1BQM B;  1JLF B;  2DO0 A;  4Q8F A;  2IBK A;  5GMD A;  3D68 A;  1CG2 A;  1I5O B;  1YZ7 A;  5KFF A;  3DI6 B;  4O3O A;  4ZKA A;  4CO0 A;  5LM7 E;  3E2E A;  4DV4 J;  3FDS A;  2R3V A;  2MTL A;  4QWE A;  2C3O A;  4TXS A;  5D4P A;  2N4C A;  2HBR B;  1RAO A;  1U02 A;  4HTJ A;  4USM A;  2C3U A;  1HPZ A;  1MMN A;  3R5B A;  2RU3 A;  5ETL A;  1RT3 A;  2IMW P;  4ES1 A;  2IJF A;  4URS A;  3LA0 A;  3CDB A;  1L3T A;  1NO8 A;  3PZP A;  2W24 A;  2Z4P A;  3W2W B;  3H8Y A;  4FYV B;  2LQ9 A;  4TKT A;  3BQ1 A;  3H4B A;  2FHM A;  3VR1 A;  3IAM 9;  3T19 A;  5L46 A;  1KVI A;  2YQ1 A;  1HMV B;  1HBN B;  1FRH A;  1YZ6 A;  2L9W A;  2ATC B;  3UCU P;  5KG1 A;  2D3Z A;  4ELT A;  3DXB A;  2CJY B;  2QA1 A;  5IT9 U;  4LSN A;  4NCG B;  3I87 A;  2ALY B;  1OY9 A;  3I4P A;  3KLG A;  3MGJ A;  1V6H A;  2CPY A;  3KOA A;  2RS2 A;  2W2P P;  2HQD A;  1FI4 A;  3QSY B;  2GGP A;  2GS8 A;  5CZX A;  5J1P A;  2DGW A;  1GXL A;  1BQM A;  3ZNJ 1;  1HNZ J;  1V3S A;  5LOQ A;  1H74 A;  4ETZ A;  4CCH A;  1FWL A;  5KAK A;  4P6Q A;  3KG0 A;  3OPK A;  3WX8 A;  2LQ8 A;  4B9N A;  3N0V A;  2VQF J;  2R7S A;  3DI6 A;  4OYA A;  2BKN A;  5AE2 A;  3GCX P;  2Y1J A;  4MKY A;  2OPP B;  2JFK A;  2UV8 A;  4U7U K;  1LOU A;  4PG8 A;  2KFZ A;  1X4A A;  3I0S B;  5BR8 J;  4J9S A;  4FS2 A;  5LMU F;  4Y2C A;  5KFR A;  2WON B;  4ETX A;  4ER8 A;  4FVM A;  2HGM A;  1N4L A;  4X66 F;  2H9Z A;  1H6K X;  2XSF A;  2YNI B;  2FDN A;  2D9O A;  4DV1 F;  3I55 S;  3HHL B;  2HGL A;  1RWX B;  1JKH B;  3HD1 A;  2N82 B;  3OL7 A;  5LL6 d;  1HBN A;  4LF9 F;  4HT7 A;  1TL3 A;  4CDI A;  4LF4 F;  4DS4 A;  2VA3 A;  2ZJR Q;  4ZCK A;  4DG1 A;  2B4O A;  1UJ5 A;  2XLI A;  2DH8 A;  3VAK A;  2ZD1 A;  1LWF A;  5AXL A;  3VVT A;  1PAU B;  2OPQ A;  1V3R A;  1RJJ A;  2YWG A;  4U8Y A;  2HRT A;  2QC3 A;  2ACM A;  2DXF A;  1WC6 A;  4DFK A;  4LRA A;  2VF3 A;  2AYG A;  3QRQ A;  2HFV A;  4TYA A;  2MST A;  1MWZ A;  1C0U A;  1CS4 B;  4G1P A;  3C14 B;  2ASY A;  2KT3 A;  3K5L A;  1XR7 A;  5KFV A;  3IGN A;  1T03 A;  4IFV B;  3OTO F;  4WP3 A;  2I5J A;  2F4V F;  4WFB Q;  3M8P B;  3AFG A;  4RUA A;  2QFJ A;  5G0R B;  4DPO A;  3V6J A;  2RJZ A;  5A8W B;  1B7Y B;  4YR0 A;  2OPP A;  3VV2 B;  1SC4 B;  2ZDO A;  3AQO A;  2RAQ A;  3HJF A;  4DV3 J;  4G1I A;  4M5I A;  1IXK A;  2HBQ B;  3EIC A;  2QV6 A;  3DLB A;  2DY9 A;  4LBI A;  1X4D A;  4F4Z A;  3RRG A;  1NXI A;  5KT7 A;  3UD4 P;  1YJV A;  3OD2 A;  2UXC F;  1N5Y B;  2YNI A;  1IWG A;  1S4F A;  3OJU A;  1VCT A;  2D3O 1;  1RBO B;  5MAO A;  3EZO A;  1RTI B;  3H25 A;  4NXN F;  2Y8Y A;  3Q8R B;  4OX9 J;  4B3O A;  3CMA S;  4KJI A;  2CIM A;  1YRX A;  4KHP F;  3TOQ A;  1SXL A;  3KLF A;  1TK8 A;  2YTC A;  1FHT A;  3OW2 R;  4B9L A;  3OFF A;  5ETS A;  2OPS A;  1LK5 A;  4DN9 A;  3TJA A;  1PSD A;  5HLF A;  2ADB A;  2FJX A;  1SQG A;  4XDD A;  1FE0 A;  1ZM3 A;  2BE7 D;  3H5U A;  2BJ7 A;  1D8Y A;  4RKU C;  4QU7 A;  2ABY A;  2V67 A;  1U1Q A;  4O3S A;  1FKO A;  3PJW A;  3FEY B;  1PC4 A;  4M5M A;  2CNK B;  2Q6C A;  3C14 A;  4YDD B;  1RAA B;  1IVZ A;  3IWX A;  5L39 A;  2ZBC A;  1UFL A;  4IFV A;  3BDE A;  2XMT A;  5ETQ A;  1B3T A;  2Z0G A;  3ELH A;  4OHW A;  5DLG A;  4CLW A;  3I0R B;  1M5O C;  2ZBP A;  4CO4 A;  3T41 A;  4IKA A;  2DHH A;  3BRE A;  1NK7 A;  4NLS A;  3M32 A;  2MZR A;  3QZ8 A;  2D3O R;  3TAM A;  2HHV A;  1FDN A;  1CUL B;  4NAS A;  1XNQ J;  4JI6 F;  3DOM A;  3PFE A;  5B08 A;  2AJQ A;  1NSK L;  3JXO A;  3EGZ A;  3W61 A;  4F4A A;  4K4W A;  4NLO A;  4IOC Q;  2Z8Q A;  4DJB A;  1D9D A;  3MEC B;  2CQC A;  5F9L A;  4RBU A;  4YR3 A;  3QSI A;  3POT B;  3CCW A;  4V1A k;  3LAL A;  1KQK A;  3TWZ A;  3OR2 B;  2RML A;  5GAE U;  2UVV A;  3D5M A;  1U7L A;  3PW7 A;  2OFH X;  1N33 J;  3NNH A;  3MMC B;  4DV7 J;  2AEJ A;  3BF4 A;  3PIP Q;  1HBU A;  2ASL A;  4NXM J;  3KJV B;  1DZ5 A;  5IZH A;  4FXV A;  1YJ7 A;  1N52 B;  4FF2 A;  3NNC A;  1FF2 A;  3THV A;  3CCT A;  1TVR B;  3BO2 A;  4DSE A;  2YPZ A;  2WHO A;  1JLE B;  2DIS A;  3QAT A;  4JI5 J;  4O23 A;  4WFA Q;  4AYB D;  3BSC A;  4R8U A;  1CSJ A;  4U8V A;  2V8G A;  4B3M F;  5THW A;  3P4U B;  1Q4R A;  3GIR A;  3MPU B;  3TUP A;  2HIQ A;  2C3M A;  3D1H A;  4CRJ A;  1NB7 A;  4YB5 A;  3CT9 A;  2U1A A;  5HVG A;  3FFI B;  3LTO A;  2DTJ A;  1M5S A;  4K2J A;  1FK9 A;  4JI4 J;  4U6P A;  3CJ8 A;  1J5O A;  1VDH A;  3V4M A;  2IVY A;  1CUL A;  1UVI A;  4AND A;  3UQS A;  2KZM A;  3W3S A;  3X3U A;  2A18 A;  1ZAV A;  2GJF A;  1NHU A;  3GIK A;  2E5L F;  1JJC B;  3NY0 A;  1RA6 A;  3LAM A;  2JJ4 D;  2ZBQ A;  5JVH Q;  2V9K A;  2WOM A;  4ATN A;  5I3Q A;  2VPY B;  5F8G A;  2XYG B;  3Q8V A;  2OO4 A;  4OJG A;  4ITS A;  1C0T A;  2DNZ A;  2KXN B;  3MEC A;  1BGX T;  3FZ2 A;  3H5X A;  1ZET A;  1OSC A;  1MN9 A;  5ETV A;  1FFS B;  2DIV A;  2CVI A;  3Q2T C;  4Q7A A;  5B0F A;  3HF5 A;  4OZ0 A;  3T5K A;  3LP2 A;  4NYP A;  3TJ8 A;  2G1H A;  4NZ0 A;  2M5Y A;  2MMY A;  4W90 B;  2Q1L A;  1QTN B;  3V81 B;  5ETP A;  4G3I A;  5BYS A;  2CXE A;  4QBU A;  2ACY A;  2GCF A;  3RW6 A;  1U0H A;  3W7B A;  5D4L A;  1UJ6 A;  5A0Y B;  2CJX B;  1QAJ A;  1U2R A;  1HQU A;  3M1V A;  2E1M C;  3DC2 A;  2BOA A;  3KLE B;  4DL4 A;  4FF4 A;  2MQ8 A;  3JSR A;  3RB3 A;  4FKX A;  1UVK A;  4AT1 B;  3CB4 A;  3KHL A;  5C25 A;  3UD3 P;  1HI8 A;  2BAB A;  2Z2Y B;  2XY6 A;  1UFW A;  1QM9 A;  4K8R A;  4HAC B;  1XC9 A;  1KOH A;  4NML A;  3IGV A;  4AQY J;  5I3U A;  1UFK A;  2FY8 A;  2PFF B;  3MM7 B;  5A6P A;  1HYS B;  5B0E A;  3S6E A;  4LF7 J;  1S76 D;  2DXE A;  1O5J A;  1RT5 B;  1SUQ A;  5DRK A;  2KJW A;  2EFG A;  1VI7 A;  3CJ5 A;  2K3K A;  4JI1 F;  1RCX B;  2LMI A;  4BC9 A;  3EGV A;  3C16 A;  4J9Q A;  3SZ2 A;  4LRF A;  3V6D A;  4DR5 J;  2IIH A;  2E1R A;  1RP5 A;  4DDF A;  3VAL A;  3QFW A;  4NLW A;  2B51 A;  2NYH A;  1FO1 A;  1WWH A;  3QT5 A;  4EU0 A;  3EVM A;  1CEZ A;  3VAG A;  2J6S A; 
#chains in the Genus database with same CATH homology
 2CJX B;  1NME B;  3EDR B;  4DCJ B;  2H5J B;  2C2M B;  1RWM B;  2Y1L B;  1RWV B;  2Y0B B;  5IC6 B;  3R7S B;  3D6F B;  1I3O B;  1PYO B;  2H51 B;  1SC4 B;  3R6G B;  1RWX B;  3R5J B;  3EDQ B;  2HBQ B;  3SIP B;  2HBR B;  2XZD B;  2CNK B;  4ZVS B;  3GJR B;  1QDU B;  1RWP B;  1RE1 B;  2CNL B;  4ZVR B;  2FQQ B;  2HBZ B;  3NS7 B;  4JB8 B;  3QNW B;  3GJQ B;  1F9E B;  2HBY B;  2XYG B;  5K20 B;  2QLF B;  2XZT B;  2CDR B;  4ZVQ B;  3KJQ B;  3P45 B;  3R7N B;  1RHK B;  2XYP B;  2QLB B;  2QL9 B;  2H48 B;  1PAU B;  1I51 B;  1SC1 B;  3GJT B;  1RWO B;  1RHR B;  2QLJ B;  2C2O B;  2XYH B;  2C1E B;  1SC3 B;  2H4W B;  1RWN B;  4ZVO B;  2P2C B;  1IBC B;  2H54 B;  2H5I B;  1RHM B;  1RWW B;  1GFW B;  4DCO B;  3D6H B;  3KJF B;  4ZVU B;  5IC4 B;  3R6L B;  1RWK B;  3P4U B;  3GJS B;  3KJN B;  2CNO B;  2H65 B;  2H4Y B;  3R7B B;  2DKO B;  1QTN B;  2QL7 B;  1BMQ B;  3IBF B;  3RJM B;  4LSZ B;  2C2K B;  1ICE B;  2CJY B;  3D6M B;  2QL5 B;  1RHJ B;  4ZVT B;  4DCP B;  1RHQ B;  1RHU B;  2CNN B;  3IBC B;  2C2Z B;  4ZVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...