1RWMB

Crystal structure of human caspase-1 in complex with 4-oxo-3-[2-(5-{[4-(quinoxalin-2-ylamino)-benzoylamino]-methyl}-thiophen-2-yl)-acetylamino]-pentanoic acid
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwmB00
1SC3B 1I51B 5IC4B 4LSZB 1GFWB 2C2KB 2CNNB 1RWNB 1RWPB 2CDRB 3NS7B 2C2ZB 2H5JB 2CNKB 4DCPB 2HBQB 2DKOB 2QL5B 2H4WB 1RHMB 2H65B 4DCOB 1RWKB 3D6FB 3R6GB 1SC4B 4ZVSB 3R7SB 1IBCB 1RHKB 3QNWB 3GJRB 2H48B 2XZDB 3KJQB 2CNLB 4JB8B 2HBRB 3R7NB 1RWMB 2QLBB 2C1EB 1RHJB 1RHRB 3IBCB 2XYHB 3GJSB 2QL7B 4ZVQB 1RWWB 3GJQB 4ZVRB 1RE1B 2CJXB 4ZVUB 1PAUB 2QLJB 2XZTB 2QL9B 4ZVPB 2C2OB 3RJMB 4ZVOB 2H5IB 2FQQB 2Y1LB 3EDQB 3P45B 1RWOB 2XYPB 3KJFB 1SC1B 2H54B 3KJNB 1RHUB 1RHQB 3IBFB 1ICEB 3D6HB 3P4UB 2H4YB 3EDRB 2H51B 1RWVB 4DCJB 2C2MB 5K20B 1QDUB 2CJYB 2CNOB 2Y0BB 1NMEB 1F9EB 3R6LB 2HBZB 2HBYB 3SIPB 1I3OB 1BMQB 3R7BB 4ZVTB 3D6MB 3R5JB 1QTNB 2P2CB 5IC6B 1PYOB 2QLFB 3GJTB 2XYGB 1RWXB
chains in the Genus database with same CATH superfamily
3OL8A 4DFJA 1S1TB 2IRXA 2ADCA 2L3MA 1HQ2A 2DJWA 3L7OA 2GGPB 1TUWA 4KKOA 3M8RA 1H2UX 5HI7A 4WU2A 1SUQB 3M05A 1KFSA 1TV6B 2MHEA 3W66A 1FTRA 1URRA 2QZ8A 1R8HA 1GAOA 1RWNB 1S9EA 3JYTB 1FD2A 2CDRB 1HMVA 2DHHA 4PQUB 3LF0A 3HFVA 4HYKA 1TL4A 1WC3A 5DGBA 5JVGQ 2ZDOA 3CD7A 3DRSA 3ELHA 5DZ6A 1X4BA 1ZZFA 1QJHA 2B6AA 3M32A 4O3QA 3J80U 4TU9A 3JSMB 3DDKA 2UXCF 3IRXB 1VQ5S 4KHPF 4ZPCA 1L3UA 1CBKA 3ICLA 4C3KA 1E6VB 1YRXA 2A2CA 1H0HB 1R8BA 3LPYA 2NSBA 1W2BR 2F8HA 4K4YA 1O0PA 3TZXA 3BO2A 3DLGB 3NWGA 4OI2A 4YR2A 2FDNA 4JV5J 5GAGI 1A6LA 2GQCA 3E8OA 2XNQA 3TUZC 3EZ5A 4G1IA 5SUHA 1KVIA 4I2PA 2CQPA 4JUZA 3RB3A 4MK8A 1BQMB 1T0TV 3IA0A 4Q2MA 3M4XA 2X1GA 4DOZA 1WC4A 2CYYA 3GYGA 4ZP9A 1IKVB 3MD1A 4UOFA 2HGNA 1NSKL 1RQ0A 4WYLA 1VQKS 1RHRB 3MDFA 5DG7A 2YWGA 1TL3A 3MM9B 3ZNUA 3W60A 3CULA 1U8WA 2I8EA 3W62A 3UCGA 3HLUA 3MM6B 2EXUA 2PMWA 1T05B 2ZBQA 3THVA 3BSAA 3TA1A 1N6QA 4UZBA 1GMWA 3PJ9A 2J6TA 2UXDF 4B9VA 2N3OA 4USHA 2V2KA 1D1UA 3VTIA 5U47A 4QWDA 2BM1A 1EQMA 2X1BA 1XBWA 3GU0A 4XDDA 2HVEA 4ECUA 3LGHA 4OYIA 1PAUB 1NB2A 2CG8A 3DRRA 4C0BA 1RTZA 2XZTB 1HNVB 4Q43A 1CJTA 1RLDA 4LF6J 1RAAB 1XJWB 3FCVA 3SDEA 1TKXB 4DR1J 3MEDA 2K3KA 2RVJA 5A8RA 4MKYA 1KFDA 3C46A 2HHUA 3CIMA 2VBWA 2QMWA 1F3VA 1NAQA 2WONB 3HM9A 5KT7A 3I0RB 1S1UA 4QW8A 3CO9A 1X9WA 4NXNF 2ZBCA 2L08A 3A3NB 4NLQA 1FA0A 5D4NA 2EKYA 2E5HA 3OFGA 3MR6A 2MGZB 5KFVA 1Q5VA 1QUPA 2KO1A 3I87A 3PG9A 1FF2A 5D0RA 2HHHF 3M9MB 2HK2A 3OJSA 2D69A 2AKWB 3NKYA 1JKHA 2V94A 4C8KA 2MQOA 3EVMA 5D0HA 3SQOP 4C2MA 3DU6A 1RYSA 5H9FJ 1X7VA 4RR5A 1ACMB 2PMHA 2NQPA 1Y5IB 2B4VA 1S0OA 2BOAA 1UMJA 1AA1B 4F0HA 4F3OA 1MLAA 4LQ3A 2XS5A 4O4RA 2B9WA 2EW9A 3BSNA 4IR9A 5J2MA 4MT1A 4HKQA 3Q8PB 3HULA 3CJKB 2FGCA 1QDUB 2M0GB 4C8NA 5E7OB 3NGSA 2CNOB 2EVZA 4P74A 5K9FA 3C8YA 3CDUA 3CVKA 3R6LB 1A7GE 2V6AA 1X4EA 4OYMA 2YKQA 1HBUB 1HBUA 1I3OB 3CCTA 5D0EA 3HD2A 4DUYF 3B8HA 2HFZA 3OUYB 3AFGA 1FFGB 4NYPA 3CMAS 4WXWA 3ZXWA 1RAGB 3NNHA 2EC2A 3HCXA 2HHTA 1SJQA 2OTLS 1F2HA 2F4VJ 4F04B 3NNCA 4ED1A 1U1RA 4ED6A 1NKBA 2KN4A 1S1WA 2KZZA 4I68A 1IN0A 5A8KB 1E6VA 2R7RA 1GH8A 2A1BA 2ZOMA 3W2VA 3CCLS 3AOCA 5AE1A 4LVOP 2W1BA 1JLEB 5B7WA 1H38A 4IRCA 2WAQD 2CNNB 1CC8A 3CSKA 1RWPB 5E33A 3M2RB 1UW9A 5LM7E 5GMKa 5LMNF 2KU7A 2C2EA 2HVHA 1RSCA 3SV4A 2QFIA 3UD5A 3T5JA 4X65J 3RTVA 4U7UD 3U1MA 2D3ZA 4C48A 4ZPAA 5I4MA 3MM8A 3QYYA 4R0JA 5FD1A 5C24A 4ZLPA 4DCPB 2DISA 5F8IA 1VQMS 4LR8A 3O1LA 3FCHA 1SKWA 2BEFA 3AJ2A 4O0NA 1RB0A 1MN7A 3DN9A 4WFBQ 3PX6A 1GXUA 3X3UA 2DNRA 2OAUA 2ZEJA 7FDRA 4FYYB 4C11B 2YH1A 1KLNA 2UVWA 2GS8A 3D28A 5DETA 1SI9A 3R1HA 1RT6B 4NLDA 2RHQB 4K5RA 1X4HA 3PXGa 3MEKA 4CLSA 1V9OA 4URQU 3BO3A 4C4WA 4ZK7M 2XZDB 2ROEA 4IQMA 3A8IA 1NSQA 4QR2A 3BYPA 4ZJLA 1ZM3A 4DMZA 5KT4A 2VB6A 1M5VC 1OQ6A 1OSDA 3CD0A 2KVQE 2PA3A 1ZAVA 4BHQA 5A6PA 2NCKL 4KGMA 4JI2F 4ZLLA 3TZZA 5F8GA 3MWBA 4AQYF 3CC4S 5EX3A 5KFGA 2E1MC 2OD6A 2R7UA 2MZJA 4RNMA 3D54A 1AROP 1N5QA 2FC9A 2KT5A 4YHHF 4GVBA 3UNYA 5B09A 2R8JA 1DTTA 3MPWA 1AT1B 3TEGA 2Z30B 1VBXA 2UVVA 2HWIA 3CF5Q 2DIUA 4B3OB 4OX6A 3PO4A 3NBPB 2CADA 2VH7A 2ZC4A 3MCSA 3QGIA 4QYRA 3HVRA 4X84A 2YPZA 3BGUA 4FS1A 1NJWA 1XMBA 2C2NA 2ZWOA 4AL6A 1E6YB 2VBXA 3HDSA 2LU1A 5HBMB 3GIIA 2QEXS 2UXDJ 1S6PA 1S6PB 1W7WA 2FZGB 4DPYA 1R0BG 2ZHOA 4EWTA 2B6AB 2OKQA 1JLAA 2C3PA 4LSNA 1NK8A 3PIPQ 2GW8A 2L48A 3DRPA 4TN2A 4OX9F 3ZO7A 1GEHA 3TX0A 3GV8B 2D7SA 3M6WA 4LFBJ 1IM6A 1IXKA 3GZ7A 1P27B 5CCMA 1CPZA 3BYRA 2MHNA 1IJEB 3PYDA 4CO3A 4M95A 2CQIA 3EXYA 2DPIA 2HSEB 3FGVA 4WIQA 5HMWA 5LXYA 2W25A 3KHHA 3TAMB 2HRTA 3GYXB 2YVSA 1XTZA 5F3TA 4FYXB 4LRBA 5J2PB 3CXCR 1XWLA 5J2PA 1JB0C 3TAQA 4H4MB 4OZ0A 3SEOA 4EYIB 4LF8J 4DPWA 2XSFA 3OHAA 5D4OA 2ZVSA 2R42A 3GWCA 1REGX 1KRPA 3OV7A 2DNLA 1RADB 1RAJA 3IO1A 1SKSA 2V68A 2W2OP 2GVDA 5K20B 1IWGA 4B3TF 2XNRA 2QYCA 3VWSA 2YKNA 2YKNB 3EPGA 2LA4A 3K57A 1UA1A 1F9EB 4B08A 2HNDA 3HZEA 3LALA 5K8PA 4DX7A 3MMBB 2ASYA 2BJ1A 1RT6A 1B0PA 2SXLA 3M2UA 3MTKA 3H2VE 2AWZA 3CMES 1S9EB 2HVZA 3IMQJ 1P8GA 2Z8QA 1HPZB 4LR7A 1DAXA 4FKXA 3G82A 3SYZA 1N33J 3I9V9 3ZZOA 2BX6A 1RTJB 4QR1A 3D4JA 1UWBA 4I0WA 3TQEA 4OJGA 3IAS9 3KK1B 2UXBF 3RGIA 2U1AA 3W5XA 1XNQF 5M2RA 2CWKA 3MF5A 1RBOB 1S7HA 4I6AA 2JH3A 3HMJG 4WBFA 4WFNQ 1BY9A 2VFTA 3DRSB 3CJ8A 5HP1A 5HP1B 1TAUA 2RRBA 4X66F 1B7YB 1OQ3A 3M8SA 4N76A 1TL1B 1HHQA 2N82B 3W3SA 3AQPA 3TVYA 1JWWA 4NCAA 1VQSA 4A4JA 4P72A 2PE8A 2VONA 2H4WB 2BKNA 2WVBA 1RXOB 1HNXJ 1YJWS 4Y2KA 5D8HB 2MQNA 1CS4B 4O23A 2EK6A 3UDCA 3KHGA 4W92B 1EB0A 3ILOA 3QAEA 1RHKB 2QRRA 3QNWB 4DPTA 1U2CA 2JVRA 4NRTA 2DGQA 2W2NP 2CPFA 2KXNB 4M5MA 1OIAA 4OV1A 2RQCA 1T03B 4MKVA 2W8KA 1BGXT 3WBZA 3VV2B 1R7IA 2R2SA 1TMJA 3AJDA 2Z56B 3SQGA 5DQGA 2HQGA 1X4CA 2LYVA 3DDNA 1PJ7A 3W5ZA 2XMKA 1FE0A 3ET6B 2ZJPQ 4S0MA 5IM0B 4C9DA 1G7CB 2BBEA 2CZVC 3J7YI 2QV6A 3D9BA 5J1EA 4X4RA 2KRRA 4EK2A 1AZSB 1N5YA 3WC0A 1F2GA 2BM0A 4OZ5A 1YLXA 3ZZ0A 5JMNA 5HL7Q 2IM3A 2WSFC 3D2WA 3MPDA 2FJWA 4QU7A 3DDIA 2F65A 2DHGA 1KKHA 3N5FA 3NCQA 3UDVA 2KFYA 5J1PA 1TAQA 2CQ3A 1QAYA 2R7OA 4NEZA 1I1GA 2JL9A 4M63A 1FJ7A 1UZHA 2A10A 1W25A 2W7PA 4F4WA 2E9TA 4USVA 2HNYA 1BHNA 2ZKUA 2J7UA 5J2QB 2NR0A 2NYHA 5KFRA 4JV0A 4YS2A 3QIDA 3THPA 1KR4A 2B0GA 2G1HA 2MQ8A 5IT9U 2HURA 3KJFB 5D4PA 5KFEA 3JQKA 4NCGB 4NCGA 1DTQB 1FKOB 3MXHP 1VIXA 2Z2MA 1V5VA 2DGVA 2HVIA 1S9GA 2J76E 3EUNA 4DV1J 3T1YF 4ID5B 3LUYA 3MAQA 3RAQA 3FEZA 4OYPA 1T9XA 3A4TA 3H40A 5IFMA 2AV5A 3P4UB 3BGLA 4DSFA 1SIWB 2DT9A 3T19A 1WG1A 5IQQA 4DSEA 4F50A 3GE9A 4OYAA 4DV3F 1FXLA 1RWVB 3J7Z5 4A8WA 1N32J 2MGZA 1N34J 3VAMA 1OSCA 2LDYA 1RT3B 4MIAA 3NL0A 2KXFA 4IFYA 4QIFA 4Y00A 3CD6S 1ZPWX 1YGYA 5DG9A 3C6TB 2V4QA 3RRHA 4RUCA 2QE5A 1IKYB 1F3FA 1QAXA 1RK8A 3D6MB 4EEYA 1R0AB 4LMZA 5H9FK 2WW8A 3JXOA 1X9MA 1PYOB 5I3UA 5ETLA 3I0RA 3I5CA 3M2VB 5IQ6A 3BQ1A 2DO4A 3KK2B 3KK2A 2UUCF 2IMWP 2HIQA 2YNFB 4NZ0A 1D9AA 3IXQA 2I5JB 5IC4B 3VGUA 5L46A 1F0XA 4Q0BB 3HSGA 1SJ3P 2OEJA 2XWXA 3Q83A 4OHWA 1H3DA 1J5OA 4KPYA 3CW2C 1RP5A 3ENAA 4R25A 5AXMA 5A8WB 3OUYA 3KLVA 4F4ZA 2HW3A 3RAMA 3PYGA 2BE7D 4ECRA 2KL8A 3TJ9A 1KD1T 4CLYA 4Y0FA 1N33F 1OY8A 4IG0A 4JBCA 4K0KJ 4X4UA 1K44A 5E5NA 4YOEA 2ZBPA 2XTJP 3F73A 1AFIA 3PACA 4DJBA 1SBRA 2VA2A 1VR6A 3CJ5A 4OLPA 3P96A 2VJUA 1JNRB 3MFIA 4ECXA 4C8MA 5K8OA 5BXIA 3MFHA 2E1CA 4KGZB 4WPAA 1UFKA 1FESA 3TR5A 1OJ4A 2LA6A 3HHLA 1RWKB 2VIHA 3V6DA 4PWWA 3NG8A 2UVRA 1KOOA 3HSJA 1VLYA 1REVB 1AUSL 4KHRA 2RUSA 1UVKA 4NMLA 3Q8RB 3KMQA 2MSTA 4P2SA 5KFOA 4D3GA 3C6TA 4AL5A 2XZWA 3OTBA 3DMJA 3K59A 3HJFA 1TUGB 1NJZA 4DR3J 4RW6B 2W2MP 4YB7A 4ZP6A 3DOMA 3OJUA 1HNWF 1YG0A 3QT7A 1RHJB 2L41A 1VQ4S 3MECA 4JP8A 4ER8A 3C14A 2GMLA 3M8QA 1X0PA 1HHSA 2UUBJ 2XI2A 5DS7A 5ETOA 5KT3A 2MQQA 1HI0P 4NASA 3FK4A 3DI6B 4LREA 4TVAB 2DGUA 3KUGA 3RB4A 2K3IA 3IWLA 2BQUA 1UTAA 3MPVA 1PJ6A 3JQMA 3MZIA 3TVZA 2ZH8A 3D3CJ 3V81B 3IS9B 1VIOA 1LEOA 2FVPA 2YNHA 3GG0A 2DNKA 4KB7A 3FRYA 4EUVA 4USMA 1SPBP 4YP3A 3G8TA 2JFKA 2UV8A 4LFAF 4NXMF 2UXCJ 2G9OA 5A76A 3LGNA 2ZKTA 4JV2A 5FIIA 2WBMA 3LOUA 1YITS 1B0TA 4NZ6A 1RYRA 2KXHA 3HHNB 1L3KA 2BANA 3HP6A 4LF5J 5IT0A 5KFCA 1XR7A 4OYXA 2E7XA 4R0EA 3BQ2A 2MKKA 2BR0A 1C0UB 1N5VA 2O1PA 3DM2B 4N77A 4NLVA 3SCJE 3WX4A 3GQCA 1HNWJ 1S79A 1QSYA 1JLGB 3JTOA 4A8OA 3IN5A 4KE5A 4ZPWR 1WACA 2BW7A 3DHXA 4KGVB 1HARA 4CO1A 4E98A 3UDLA 1IBLJ 4I67A 3H5UA 4F2SA 1ZM2A 2PSZA 2B4UA 2V9KA 1U2FA 1JLFB 4LSLB 4F4XA 5B0EA 2GQQA 2OSQA 4CTAA 5BYRA 4DX6A 5KOWA 1CG2A 1MU2B 2RDIA 3NAHA 1YI2S 1FK9A 1UJ6A 1U48A 1FEEA 1OPIA 4A8MP 2YH0A 1RJJA 2J8AA 3ADAC 3M32B 1BQNB 2HBZB 4ZVGA 5ADZA 3M2UB 4CLUA 1HR0J 2W01A 2ZUGA 1H6KX 2IVYA 4MAKA 5IT4A 1JXVA 1BMQB 2IAJB 3CO0P 3DLEB 4LF8F 4ZLJA 4IH6A 4CI0B 4PABA 3R5JB 1Z4UA 3D6TB 2C2RA 1RTHB 3IFEA 4ANCA 2J7KA 4U7UK 2HFNA 1XQIA 4HLBA 2V9WA 4P2MA 1T8EA 1UWBB 2DRDA 3BPSP 3MOZA 2FY8A 2CRLA 2YKMB 2YKMA 1SL0A 2OH2A 2PGCA 1K73T 1U0SA 3NP5A 3I4PA 2Q3PA 2DO0A 5B0DA 4DV4J 1TKDA 3SV3A 1C0UA 1NXIA 1UFLA 3DM2A 4AT1B 4EO6A 2OPPA 2JLEA 5BR8J 4ZCKA 4DPUA 4L73A 3CCSS 1OO0B 1L3SA 2JWNA 1HBMA 1NCLA 2VU5A 3OPKA 3KHLA 4ZKAA 3EXCX 2XMAA 2KT2A 3BGRB 3RZAA 3ZNJ1 3VAIA 2KFZA 4PG8A 1MG7A 4A8XA 3GV5B 4F26A 3R8YA 4P52A 2Y9HA 1NNDA 1I6JA 2JLFA 3AA8A 4ECWA 1ITPA 2B43A 2QN6B 1RT7A 2FHKA 2J8SA 3L7PA 1KP6A 3QQCD 1X5TA 1V5IB 2CVIA 3TQ1A 3GCXP 3QIPA 2AYGA 1HYSB 4B3OA 4KQZA 2D9OA 4WE1A 1VMBA 2KM8B 2HNZA 4OHXA 2W8LA 2QA4G 1IBMJ 1GX5A 4FF2A 2MXYA 4NYOA 2K7JA 1J5EF 1FERA 3TW0A 1SH3A 4ILMA 1NPPA 1CULB 3RBXA 4DV6J 1UVLA 2K06A 2W9CB 2HIYA 3HXMA 2HEKA 2ZH4A 1SJ4P 1S10A 1FKAF 1Y3KA 5E2QA 3CJSA 3KMSA 2APOA 2WVFA 1NU4A 4UF4A 2DPJA 1RWUA 2COLA 3GFXA 1Y0HA 3PJXA 2QA4S 3BSOA 4DN9A 4DL4A 4DZDA 1HBNA 1HI1A 4ZVQB 4OZLA 3W61A 2H3EB 5RUBA 3CNQP 4TY8A 1IM4A 2XCAA 3H5XA 5KG6A 1NH8A 5LJ5Y 2CQ4A 2VG5A 4MH8A 3BBFA 3E2EA 3T1HF 4WF9Q 4CLZA 3AOBA 4DV2J 1APSA 1X5PA 4DR5J 1IBMF 1U24A 3DC2A 4ALZA 3ZZTA 2LQJA 3PVXA 2J0WA 4F4YA 2OFGX 2LQ8A 2VL1A 1DFDA 1D0EA 1OMSA 1TZ0A 4U8VA 4ES1A 3TX8A 2AEJA 5EDWA 5C5JA 1Q79A 1FE4A 2A6MA 4JI8J 2QX0A 1BWVA 1FRJA 3EMTA 5G0RB 4I1TA 4Y3CA 2EFGA 1NK9A 2GJIA 4IRKA 3I9ZA 2BXJA 2GFFA 2Z2YB 2AJ4A 5C25B 6AT1B 3V6HA 2DIVA 5L1IA 2VOOA 4LF6F 1RAOA 5B0BA 3QSYB 5HMXA 3MI7X 1RGVA 3IR5B 4DG1A 4KR0B 5HQMA 2EG1A 1UL3A 4GMKA 4PG6A 4YY3F 4LF7F 1N32F 2OD4A 4M5LA 2HWHA 3CT9A 2CJAA 1YZ7A 5E3RA 4G1QB 4AXIA 4OV6A 3M1VA 1REVA 2ABYA 4L3NA 2DNNA 3FFIB 1U02A 4DV0J 5JUMA 2H4YB 1GXTA 2JX2A 2OI2A 3I5AA 5F8HA 2QA2A 3HHEA 5C2CA 4U8YA 3KDOA 5CYQA 1H7XA 4DCJB 1UVNA 2HHVA 1S72S 1VQLS 1UZDA 3WQPA 4LJMA 1U1KA 4DV2F 3BO4A 1NMEB 3OR2A 2G2ZA 1C1BA 4TYBA 4CDIA 2DK2A 1O5JA 1M5SA 1OY6A 4K4TA 2JEJA 3PFOA 2AGPA 3BV8A 3R7BB 1LK7A 5ETQA 3QLHB 5J2QA 2E5LF 2P6SA 2DNZA 3FBCA 5IC6B 4DWIA 1AYEA 1RLCL 4NI2A 4NLUA 1LV5A 2ZJQQ 2IA0A 2P8IA 3DXSX 3QMQA 1JKHB 4CM0A 2WB4A 3QT8A 4ID5A 7FD1A 3ILJA 3ZFVA 1HR0F 2I2YA 3KNGA 1I51B 3D1HA 3DRRB 4KBIA 3OVSA 4JYAJ 2WOMB 2UUAJ 4DUTA 4QYZJ 1FFWB 4DS4A 1PJ5A 1J27A 3UWTA 4X62F 4PWUA 2UU9J 4F02A 3NCPA 2I6WA 1H73A 2BJ7A 3K17A 5KFQA 1YBAA 1S5ZA 4DQSA 5CYJA 4WJBA 2HWTA 2ZUAA 4Y2CA 5ETKA 5F41A 4EGLA 4DHVA 1QLNA 2MKSA 3NS7B 2A18A 4U67Q 3CPWR 2MY7A 4J9UE 5LL6d 3NCRA 4NOHA 4C7QA 1LWXA 4F36A 1QSLA 2B56A 1CSJA 4AYBD 1IR2A 4RKUC 3SDEB 3GTYX 3TUIC 4ES2A 1N5YB 2KFNA 2M7SA 3BM7A 1R43A 2J9CA 3DGPB 2FJBB 5DDQC 2XS7A 1L3VA 5KFSA 3HFKA 4M1KA 2RQMA 5KFUA 2VJVA 3NNAA 3QPIA 3DHWC 3V4MA 4IO9Q 2Y1JA 3ZTRA 1WHXA 4Q8EA 2FTRA 4I2QB 4JB8B 4WTOB 4WWSA 4RUBA 1DTQA 1FKOA 3KK3B 2W4DA 4O3OA 4QIVA 2OPSB 3BKTA 3OQ2A 5GAHI 2GIRA 3HO1A 2C1EB 1MN9A 2BABA 2LXUA 2CZ4A 3AB4B 3KG1A 2HK3A 3FMWA 1BUXA 2W9BA 1IUJA 1X9SA 1T05A 2XYHB 3ET6A 2OMOA 4L74A 2LXIA 1NK5A 4CO5A 3UVJB 4UY8T 1H74A 2XS2A 2CPXA 1F6TA 4ZHRA 1WI6A 4LIWA 4EO8A 1DY3A 4HHJA 5CH7B 2YX1A 2WHOA 3QT5A 1GT8A 1VK8A 3OR1A 4ZCIA 3ZTQA 1YJUA 1RKJA 1PO6A 2D9PA 3JSRA 2DY1A 1S76D 1G1XA 4LUBA 1RZMA 2N3LA 2YWWA 3MAAA 4C6AA 3C15A 4P9SA 5F8NA 2B9XA 1JJHA 2RS8A 3ZTPA 1NRKA 2YTCA 3DLLQ 3K8WA 1HBOB 1MMNA 2H5IB 2ZVIA 4OJ3A 4OYZA 4ECVA 2HNYB 3H90A 4FPRA 3W9JA 2Y1LB 2ZH6A 4OLOA 1O51A 2Z2ZA 2O5DA 1FDDA 2QG9B 3HHLD 3DLKB 3R3TA 2UV8G 2ZH5A 3BR8A 1VJWA 3J81j 5DDOC 1WNEA 2C3MA 2VA3A 2CG4A 2HNDB 2QMUB 2BJDA 3MMCA 5CCLA 2XWYA 3OVBA 4ATNA 2F40A 1F5AA 2E5JA 3CTRA 5K8MA 3NGRA 2PI5A 1SC1B 4DR1F 3PKMA 2XMTA 1DTTB 3KJNB 1AUDA 5EN1A 1KTQA 3H5SA 2R9LA 2OELA 3AQOA 2IM0A 4JI1J 3G82B 2L9DA 3CD5A 3UN3A 3EM1A 3RR8A 2E9ZA 1ZPVA 4LQ9A 4K0KF 2EPIA 3TI0A 4A48A 5ITHA 3MPYA 1R8CA 4NXNJ 4ZS6A 2OUGA 3HT0A 1N0UA 4M5GA 4DL3A 4X4SA 1DARA 2UVUA 2D74B 1U45A 1GTHA 3FSYA 4IG3A 5LMNJ 2FHJA 2YNHB 5HSPA 5GAHU 1O6XA 2I9SA 1LOUA 4KIAA 2R7QA 3QO9B 4O44A 1B7FA 4UT4A 3M8WA 3EICA 3QWUA 3RB0A 4CNYA 2Z57B 3FJ2A 2V2VA 2CPHA 1R6YA 4UOCA 3MMAB 2FLPA 4ZVTB 2NUUG 3H42A 5FLXY 1FRHA 2OMLA 3GR0A 2A0FB 2LU2A 2ASDA 1QTNB 1VQ6S 5D4LA 3UN5A 4X65F 2BANB 1X31C 2NSCA 1RWXB 4QIEA 4MKAA 3DFEA 2DH9A 3Q2TC 5F9LA 2HS4A 2FIUA 2W2QP 4YEAA 3TARA 2A2DA 2ZC3A 3N01A 5C7PA 1FEHA 1KVKA 1XR6A 1GFWB 4I7FA 3PY8A 3AA9A 4QWEA 4G6VB 4QU6A 2ZJRQ 2IAJA 4ZOSA 2GAGC 4MYUA 3VZIA 5A8WA 3V6KA 4TLRA 4AFFA 4DX8H 1PAEX 2RT3A 4ZVHA 1M90T 4L75A 4C11A 5H9EJ 3T6BA 3CCWA 4X2BA 1C4AA 4KKOB 2NLWA 1ZETA 2J9EA 3LP1A 2HBQB 4LVNP 4RWWA 2DKOB 1VBYA 4PG5A 3Q22A 1FNMA 1R31A 2DGSA 2YKOA 5K5MA 2HQIA 3KLGB 3C15B 1UWAA 3MGJA 2IRYA 3OSNA 2R2TA 1ZTTA 4K50A 2ALYB 1UPPA 2YNIA 2YKAA 3GCWP 4E2FB 1SC4B 4IFVA 2IJFA 2J7WA 3FEYB 4YDDB 1PG5B 2HKEA 4N56A 3FQKA 2PO4A 1XMOF 3NMRA 4IOAQ 2RD5C 2CA9A 2UU9F 4TY9A 1WEYA 3F41A 2DNPA 1R8PA 3MM5A 3SFUA 3OR1B 5JVHQ 1QTMA 4NZ7A 1HWUA 2DB1A 2GVDB 4RW9B 3UO0A 4A8QA 2Y0SD 1WTFA 3EJMA 3UW1A 5CHCB 2GA7A 2FZCB 2M70A 3SI8A 1TVRB 3OSPA 2QL7B 1FRLA 2IYGA 1TKTA 2ZOGA 5EWEA 2C28A 1LXNA 2RSQA 1EP4B 2CUYA 4IO1A 2MKIA 2GVZA 2V8DA 3VR1A 1DZ5A 1LWFB 1HI8A 2MLXA 1JLGA 1JK9B 2PMZD 3K7RA 4KSEB 4AL7A 1X5SA 3ETOA 3ZC4A 4A8YA 2XLKA 1VGYA 2CJXB 1VDHA 2DCLA 4TYAA 3MMCB 4DL7A 3WIVA 1U2RA 1PC5A 2QSWA 5IOLA 3PZPA 5E41A 4ECZA 4J9PA 4FF1A 4ICLA 1JLAB 4NLGA 1S7IA 5DM6Q 4CP5A 1S4EA 4KV8B 3M9OB 3V5RA 4RW4B 3V2UC 4D3HA 5HN0A 3QFHA 4QIWD 2FQQB 4WFXA 4Y2IA 4IG0B 4DFMA 2MDAA 1TK5A 4MYTA 1YTYA 4OZ2A 4WIIA 2BDPA 2XMMA 2HQFA 1NBEB 4N47A 4FZVA 4RL1A 5A6WA 4IFYB 4DUYJ 4B3MJ 2V63A 2V8GA 2F5GA 3BS9A 5HQ8A 3EGNA 3CCVS 4GVLA 5D3GA 3CJQA 2YWHA 2XI3A 1RAIB 2DNHA 3E51A 1TKZA 2POKA 5CYQB 5EHHA 1RHQB 1T95A 5GAGU 3TA2A 2GHWA 3JTPA 3OR2B 4IR1A 3PRVA 1KHVA 1HBNB 3AXKA 4V19X 4RO0A 1S1VB 2ACYA 1TVRA 3BZQA 3D6HB 1T7PA 1LWCB 2UUAF 2YNFA 8RUCA 4DSLA 1Q7LB 3IWXA 1P9YA 3LGMA 4ZPTR 4ENOA 4ZIVA 1Q8KA 2AX0A 3EGWB 2PDAA 1WTBA 2DR5A 1WF2A 2CPZA 3H59A 1SB6A 4TKTA 1A9NB 2DR8A 5CYMA 3T1HJ 4DG1B 1LKZA 2ZM6F 2M9KA 5HMZA 2YNGB 4P6QA 1P1LA 2F7VA 2WZ1A 4OYOA 3HT3A 1U1PA 3EVOA 3QZ8A 4C8LA 3LA0A 2WB1D 2YPYA 5J1EB 4KH1B 4X62J 4EZ9A 3PX0A 2CQ0A 2V5HG 3X1LB 2KKHA 1RT7B 2YXLA 3CWJA 4JI0F 4F8RA 2KJWA 3DLGA 3QGPA 4QWAA 4O3SA 3GJTB 3H0PA 3IC1A 1EKSA 1NHUA 4ETXA 3LWLA 1N4LA 4NA1A 1CJTB 1GNKA 2XLJA 1WDTA 3A3OB 4ECYA 5LMUJ 2G0IA 5HLFB 1VISA 3OTDA 5HO4A 1KLMB 5DRKA 1TKXA 3BDPA 4IRDA 4WFAQ 3FZ2A 4OZJA 5IZHA 4BCAA 5CAAA 4KPCA 4ED4A 2HZAA 3TEHB 4HT5A 1T3NA 3K5PA 2C2ZB 1VYAA 2EG2A 3V4IB 3HK2A 5KFIA 2CPEA 2B8PA 1F5CA 3OHBA 1ZS6A 4PUOA 1WC0A 3RG6A 4ED3A 2Q66A 4B02A 1H98A 2AD9A 3V6JA 1JLQB 3ISNC 3EWGA 4UTGA 2MZ1A 4N8OA 3BR9A 1V3ZA 3JS9A 2B51A 4DEZA 4YMEA 1IKVA 3T5HA 3KWMA 5L1LA 1K0VA 3P6YC 2BE2A 1N88A 2PEHA 2E29A 3NWRA 1TTHB 4CLFA 4X4TA 4ERDA 3T1AA 1HW8A 2HS3A 3KJQB 2R4FA 1XK8A 1TV6A 1FXDA 2RUGA 1NDPA 5F0UA 2FB0A 2XMWA 5IM0A 1S0MA 2CJKA 1PSDA 3R2DJ 3VAHA 2CPDA 3FCWA 4IG3B 4OX7A 2F4VF 2QIFA 3J7AN 4J5OA 3TJAA 3BSCA 1BE4A 2B5JB 2FJAB 3IBCB 2RH3A 3DOLB 2BW2A 3LP2B 3O2IA 4M5DA 4O0IA 1X8DA 2NYIA 3D7SB 4HDGA 1HNZJ 3OTOF 2E1RA 2X3DA 3KLHB 3K5LA 3FFIA 4B9TA 1HD1A 1S1VA 2RILA 1BLUA 3MUVP 2R7TA 3KDNA 2PIIA 4W90B 2NREA 1QSSA 3PR5B 3QJJA 1X4FA 2DVIA 1FD8A 4CT9A 2L9NA 5KFJA 2HLTA 2O01C 1D8ZA 4ZVRB 3Q8YA 2DGTA 5GAEI 4U7CA 4BC9A 2QLJB 2BA9A 4F25A 3MR7A 2XO6A 2V2QA 4AE5A 1XMOJ 2AYBA 5FDLA 2Q43A 4L72B 1J5EJ 1IVZA 2OPPB 4OHYA 3G4SS 2XY6A 4I7FB 4OI6A 1EP4A 4RBVA 2HGLA 4RW8B 4ZVOB 3UDEA 4C3MA 3I56S 2BQRA 1NKEA 1FDNA 1IKWA 4E0DA 3A8KA 2DH7A 3KLFB 4NA2A 4OX8A 3EDQB 4X4PA 3ZTSA 3KJVA 4RLEA 4FBUA 3EZUA 4FPIA 4J7CA 3S01A 4TU7A 1BQNA 2B7BB 4HH1A 4B9UA 5J2NA 2I0XA 2RQKA 1EETA 1QE1A 1C1CA 3ILIA 4OZ3A 5C42B 2H54B 2IJNA 3G71S 3V81A 4DQIA 2OIHA 3RRKA 3W8PA 3ZZPA 1DBDA 3IG1A 4U6PA 4LFCJ 3HHLC 1KBRA 3G6YA 2HNZB 5D0GA 1JXLA 1M1KT 2UUCJ 1WJ9A 1OWXA 1Y7PA 1PIEA 3KLHA 3CIZA 1JNZB 2MQPA 3FNNA 5ETTA 4XIUA 1S99A 4WFZA 1KQSR 2BRLA 2IBKA 2KRBA 2KT3A 2R7SA 3R5GA 4KGXB 1WOOA 2KG0A 4KRWA 3Q86A 4URGA 1FX4A 3FUYA 4A47A 4RW9A 4R5PA 3MR3A 2W7AA 2ZZMA 4FXVA 2ZH2A 4F67A 2CJYB 2XC9A 5GVQA 1TQLA 1B3TA 1KN6A 2LECA 4C8OA 1MNEA 2FHJD 3DYAA 4I2PB 4IKAA 2RS2A 2RJZA 3HVTA 3W7BA 4KGKA 3ZZRA 1KQGB 2VQFF 2DHAA 5KFAA 4QPTA 5DLFA 1MSWD 1I94F 2PI4A 2QA1A 3LP0B 1Q8IA 1FTCA 2YQ3A 5HBMA 3MPUB 4FXWA 4KC5A 2CFXA 2NUHA 4ID8A 3KJVB 5KG3A 3PM9A 2F8EX 2EFOA 3HKWA 5GAEU 1AXQA 4CLTA 5F9NA 2DNYA 1TUVA 3LP1B 2XBPA 1U7LA 3K8VA 4JV1A 1NZ8A 2ROPA 3O3LA 2G0CA 4F0MA 4I2QA 1WKJA 2C2KB 3OXGA 3P3DA 5IWAJ 4DS5A 2HYIB 3ISND 1OPZA 1VQ9S 4YHHJ 4F3QA 3IG1B 2MQLA 2BV3A 1LWEA 2P9EA 1VHIA 1S12A 1PKUA 3IR7B 1FJCA 1KQKA 1YX2A 3HHLB 4C97A 3V6DB 1SUQA 1U1QA 4GO7X 2M52A 2DR9A 3TANA 1ROFA 3UVJA 5FDLB 5HJYA 3L09A 2N4CA 1BC6A 1HIYA 4W98A 3W9HA 3ZZYA 3FZBA 3D6FB 3W9IA 1TU0B 5HVHA 3TYTA 1XMQJ 1M0SA 2L9WA 4FNHA 3DOKA 4WZQA 3MMAA 3D68A 1K9MT 2BKPA 4CT8A 4CLWA 3CC2S 4CYUA 4JI5J 3G6XA 3PEHA 3KK3A 3NMAA 2KG1A 2OPQA 4YY3J 1MU2A 2EK1A 5L1JA 1G2EA 4Z37A 3H20A 2KM8C 4HACA 3KYLA 2DGOA 1UVJA 4MKBA 6FDRA 5DQHA 4P73A 3M30A 2E1PA 4DR2F 3BPDA 3VAGA 4J9KA 2M8HA 2WTFA 1TMMA 1Y5LB 1EJ7L 4CRJA 2Z58B 4GC7A 2MLZA 1NJYA 3CCJS 4N8NA 4YQWA 3MEEA 4HEA9 4FVMA 4NA3A 2K2PA 1HQEA 3CGIA 3IM8A 4MFBA 1U6BA 2V8VA 4B3RF 1JIHA 1Q78A 2ZBRA 3K2YA 4DR7J 2NZ4A 2UZAA 4I69A 2MKHA 3HVWA 2WOMA 4Q2LA 2CVEA 2MY8A 1UP1A 2VPYB 3JB9k 3W8GA 3VAJA 1Q16B 2FLOA 2GIQA 2JDJA 4RU9A 5A2QY 4RZRA 3SSQA 3RBEA 1RTIB 2XY7A 5H1SV 3DLBA 1P1TA 1SKUB 3PEJA 4CO2A 2ZE2B 3OW2R 4IUFA 3D3BJ 3JQJA 1DLOA 3P45B 5DG8A 3L9ZA 1NUEA 1WEXA 2DITA 3HVAA 4AQYJ 2MKCA 2G0JA 1QUVA 1NPRA 4OFZA 1RDRA 1EZZB 4H4OB 1DURA 4AXJA 4LF1A 1LW2B 4LRAA 2VF3A 2Q6BA 1R0AA 3CUNA 4IYQA 4JI7F 3ZZZA 4CWBA 1U09A 2HQDA 2X3GA 2R8KA 2KVIA 1LWFA 3GLJA 2MZRA 2WONA 3T9NA 2AZ3A 3LAKA 3WHIA 1L5UA 2J6SA 1KVJA 4GKJJ 5AJ3F 3FMBA 4YUDA 3IRWP 3FSIA 5F8LA 5D6GA 4MJKA 3J80Y 1FCAA 1NHVA 2DHSA 1N8RT 4YB1P 2IY5B 5KFPA 4JI6F 5DO2A 5KFDA 4NLXA 2OPRB 1S9GB 2KHCA 2AEMA 2JEFA 2Y8WA 3OLAA 5T41A 2PEBA 1IR1A 4UY85 1OY9A 2EEYA 1ZM4A 3I6PA 3WDOA 4Q5VA 1T9TA 4FS2A 1U1OA 2M8DB 3SZ2A 1K1QA 5C25A 2EKNA 1VC0A 1T3OA 1IJFB 2ASJA 2X51A 3QAUA 4UUWA 3C3LA 1AZSA 2LMIA 5MAOA 4PEOA 3W2WB 3SCKE 1UVIA 3J7YU 3QJLA 3P8BB 1LWCA 2O3DA 2JJ4D 4OMFG 4CZCA 4DR6F 3EGZA 5KG2A 1SQGA 2E9RX 3SSRA 2VKZG 1NH7A 3ENVA 3I32A 2XB2D 3VQTA 4XAKA 1X4AA 2QT7A 3B4DA 5HROB 2VC0A 4DV0F 4PUOB 1XIQA 1N36F 2E7VA 3VF0B 2E5IA 1S9FA 5C24B 2LDIA 1Q0NA 1KQFB 2HHPA 2YQ1A 3FKBA 2RNEA 4IOBA 4PQAA 4C8YA 3PRDA 4KHMA 1TL7A 4RNFA 4JI3F 5CD4A 1SL2A 1JXEA 3KOAA 1JLEA 2R2RA 2GGPA 2PC6A 4TQRA 4FDFA 2UUBF 4B3SF 2FHOB 5DM7Q 5KG5A 1MROB 4WP8A 4YB6A 2FZKB 3W63A 3LWMA 3PHTA 4O4GB 4AUKA 1T03A 2J9DE 3MAHA 4DCOB 3FVYA 2ZD1A 3O8WA 4ZN3A 4YR3A 4LR9A 1U8SA 1RU1A 3FBBA 1FT8A 3M1VB 4O3NA 1S77D 4QBUA 1HNVA 3OFFA 1HWJA 4DL6A 4GRSA 3UCUP 4USIA 3OBIA 1DRZA 3W64A 2DEIA 2DXFA 2OEMA 1WHYA 4H4OA 2HLUA 1Z2ZA 3MM7B 3PX4A 5I42A 4OI1A 2DHXA 1KOHA 1D9DA 3HPOA 3N28A 1DHMA 2YBVA 4EMDA 3Q0AA 4GKJF 3NGDA 1D3WA 1VBZA 1JJ2R 4RNHA 2X1AA 1YJNS 3BGRA 2MKJA 1CVJA 1C0TB 2P6TA 2EBEA 3AD8C 1DQ9A 5D77A 2WSCC 3VGVA 3WX8A 4ETZA 1ELOA 1WKKA 2IMOA 5ETNA 4K7QA 2DH8A 2OPQB 2BJ8A 3A3PB 3EPIA 4QIGA 5HANA 2F1FA 4NL5A 1NK0A 1TFYA 3VALA 5GADU 4ZVUB 5L9NA 1CLFA 5A0YB 4YDXA 3BREA 3E3XA 4ZVPB 1Q1KA 1RBAA 1B0VA 2B9EA 3SCLE 4EYHB 4LFBF 3N6MA 2GHPA 3JSBA 2GQ2A 4LF7J 5E3PA 3PKYA 1FXRA 1VOMA 4K2XA 2MB0B 1HL6A 3HI9A 3C16B 4C3LA 3R5AA 4DR2J 4JI4F 1SKRA 4ELUA 4OZNA 1SH0A 4RUAA 1Q7YT 2HG4A 2Z2LA 1NM2A 1EETB 1QE1B 3DGVA 1TELA 2B8QA 3G87A 2QFJA 4J9SA 4FF4A 4FF3A 1RT4A 1KS2A 3UR0A 1R89A 2B3TB 1ZM9A 1FVSA 2U2FA 3R5CA 2IVFB 1RHUB 4A46A 5HVGA 5IV4A 4K4UA 1VRQC 2E1AA 1ZTWA 3SBMA 1NDKA 3I4HX 1YRTA 2CPYA 3TVKA 5EWGA 4YFUA 1A0OB 3OLBA 2ZH9A 3GMGA 3I5BA 3KFWX 2AYEA 2HAFA 4EZ6A 3M8YA 2CIMA 4O3PA 4LF4F 4G3IA 1Q82T 4USJC 1SC6A 2YX4A 1N5SA 1Q95G 3N5BA 5M2PA 2O66A 1C1CB 5DLGA 4CCHA 2VG7A 2VG7B 3L3CA 2V0NA 1JLCA 3FQLA 3G2XA 3GR1A 3SIPB 2VV5A 1YDLA 2QGFB 2YWFA 3ENWA 4CTAB 4DU7A 1PYSB 9ATCB 2BVZA 2AQ4A 2DR7A 4N41A 3GSDA 1U4BA 2JEIA 4HI2A 1ZBTA 2AMCB 5AT1B 4NX9A 2FJDB 1CJVB 5DGAA 3M9NB 3C16A 2B5JA 1WWHA 3TZWA 1X4GA 5I42B 1MWYA 1P6TA 2ZOFA 3NY0A 1YJRA 2VDIA 2ZBIA 1U1LA 1F60B 2EFPA 2J0QD 4Y65A 4XO0A 3TUJC 3C6UA 3JSYA 2KI2A 1WC1A 4KT0C 4WXOA 2E5LJ 1XNQJ 1RISA 1ULRA 2XHCA 1WHWA 1IBLF 1NJIT 3G8SA 3QO9A 4O44B 2OGUA 4KTQA 4IQXA 4X4NA 5SZTA 3OTOJ 3CDEA 1WF0A 4NCBA 1S0VA 1IBKF 2KZMA 5KG7A 2D3O1 4I6YA 3AD7C 3RU0A 3RBZA 2CXEA 5CABA 4ZVFA 8ATCB 4DF8A 4Y34A 3S8SA 2RHSB 3MM7A 1JLFA 4LSLA 3T5KA 4DSKA 1IKWB 3OL7A 4WCEQ 2O67A 3P5BP 1HNXF 2CPJA 3OTEA 1KC8T 5KAKA 1RT1B 5IS2A 2LFVA 3R7SB 4DUZF 4CLPA 3HVTB 4HR2A 3DKDA 5L38A 1T9YA 3MMBA 1VC5A 2BQ3A 2HRUA 3T3FA 1H72C 1J5OB 2R8GA 2CNLB 5B0CA 2HBRB 1OS5A 2G2YA 2HPUA 5CYMB 3R7NB 1RWMB 2XQCA 2QLBB 3PW0A 4DSIA 4DV5J 2IC3A 1T9WA 1VRUA 4LF9F 1RACB 1WEZA 1WKLA 3Q8UA 4KO0B 1S1XB 4UW2A 3W1YC 2PN6A 4ZHRB 1KSPA 2EBGA 1RAFB 3J7A1 2GO9A 1VCTA 5J1NA 1C4CA 1W26A 1CJUB 1VQPS 4M8LA 5A2QU 4UOGA 3TWZA 1Q8LA 1VJQA 4CO0A 1KWMA 4DI6A 1V3SA 1LK5A 5HMYA 4RBUA 2ZZNA 3DLJA 2GIFA 1WSRA 1WDDA 3D0HE 3GILA 3O44A 3CCUS 2EC0A 4HT7A 4JI6J 1RT3A 1WG4A 4Y6IA 2N4DA 2AJ0A 7AT1B 5HLFA 4UQGA 2C42A 3H4BA 3QRPA 2AU0A 1XERA 2BYCA 4AD6A 4BBYA 2QL9B 1RABB 3A8EA 2C2OB 2FVCA 4DR3F 3GB0A 4V1Ak 4QQBA 2G4BA 2CQ1A 5B0AA 1HWKA 2BRKA 2AGOA 2R3VA 4HDHA 1F9FA 4XK8C 1N5TA 2FC8A 4GO5X 5KFBA 4H4KA 3W2VB 2ZHBA 1AFJA 2IBOA 5KFZA 3VAFA 3MECB 3FDSA 1FX2A 4JYAF 4HHUA 4RWXA 4DLEA 3LH2S 3PW7A 2CQ2A 2IHR1 1RT5B 5IWAF 3B6BA 2CZ9A 4DV5F 4LF9J 2C22A 1HD0A 1JJ4A 5CXTA 4RNNA 1SCJB 4F3MA 3K58A 2WK4A 4YR0A 3Q89A 3BJYA 4FVCA 2BJEA 3KTQA 1Y3JA 4RW7B 3KUEA 4OI3A 4RW7A 3U1NA 4ED7A 1YJ7A 4LF5F 1N36J 3I82A 2OHDA 3KG4A 2JSXA 2FPHX 3C2PA 1IKXB 4KH0B 5F3ZA 1LFPA 2JVOA 3N6NA 5HJXA 1J2VA 1H7WA 1WHVA 3L7UA 2X1FA 3H4DA 1S1UB 1YQHA 3B54A 1CQMA 2KJVA 4NEYA 4J9NA 2AYMA 4TY8B 2ALZA 1T94A 4PYDA 3DU5A 2UUTA 1U47A 2LQBA 2LEBA 3DGPA 1JLBB 2V4JA 2G1DA 5LXRA 3OT9A 4DDFA 2OPRA 3BEGB 4HL9A 4DQQA 1R6VA 5HROA 4HACB 1NDLA 4IH5A 1XMQF 2NS1B 4ZPVR 2F8MA 2DCUB 3CJTA 1RU2A 3HKZD 2VG6A 3Q8VA 1FRIA 2ILZA 5CZVA 3NS6A 4PXEA 1RA6A 5KFHA 5KT2A 3QLHA 1PBAA 1U1NA 2ZWPA 1EX8A 2OTJS 2D41A 4NRUA 1VQOS 3BF4A 3JYTA 4ZDNA 2AZ1A 2HMIB 4PQUA 4FYDA 1NSAA 2C2DA 2NZCA 1MWZA 1VHFA 4U96A 1RAEB 1XEZA 1XNRJ 4GKKJ 2I1RA 3O6QA 1M5OC 3ENQA 5KT5A 1S6UA 5KG4A 2FD2A 1LW0A 2ZZTA 3B4MA 1R3NA 5AXKA 3UN2A 4E8UA 4V19J 5L8RC 3C19A 4HH0A 4Q44A 2EFNA 3D66A 3MOJB 2KTQA 4ZCLA 2AIRB 3VAKA 1P9QC 4WKRA 1Y00A 4C0HA 1ZA1B 2K1RA 2H1YA 2WBRA 2GCFA 3MEGA 1M5PC 2DXDA 2RIJA 2FLLA 2PFDA 2H48B 2HHXA 1CEZA 2FVRA 3I96A 4DLGA 1UFWA 3MM5B 2VQFJ 3J81Y 1QY7A 2CJ9A 2OLWA 1LW2A 3PNIA 5B08A 1BQMA 2LCWA 3MHYA 4USUA 5E3CA 3N9UC 1D8YA 1S4FA 3PYFA 3I55S 1NK4A 4DSJA 4ED8A 2UP1A 4FN5A 2LVWA 1GK8A 4I4BA 4H4MA 1NHKL 1AB8A 1TKTB 1TFWA 2HVDA 4WZMA 3IGNA 2XGPA 4ITSA 2CKWA 4Z2XA 2JEGA 1Q53A 4QYZK 3B82A 3DXBA 4NLPA 5LSOA 2WSEC 1RT2A 3AAWB 3KUHA 3RAXA 2J6UA 4ICLB 2ZH7A 1RA7A 4XPCA 2F63A 1HMVB 2CQHA 2MTLA 1VQ8S 4RPFA 1VLOA 2RE1A 4BWJA 1CJKB 3US5A 2XM3A 5GADI 3CCQS 4PWDB 4ZCMA 1FKPA 4TXSA 1HYSA 1EARA 2RF2B 1QVFR 2BOPA 1RAHB 4C0OC 3CCRS 5E3AA 2GO8A 2F9DA 4KJIA 4WP3A 3BN7A 4IH7A 2K7KA 2VUGA 3HSZA 3NOCA 2N7YA 3QT6A 1SV5B 2GMHA 3H2LA 4MTPA 4F4AA 1N52B 4C98A 3J81U 1S48A 3POTA 4B9LA 3MEDB 3IM9A 5A8RB 3J7ZT 3OVAA 2W9AA 3JSMA 3GFYA 4OQJA 3ITHB 3MAAB 4XDCA 3CCES 3AB2B 3UD4P 1WD6A 2AJ1A 3GIMA 4CQ1A 2FLNA 4ANEA 5KFNA 1CC7A 1B64A 1U0HA 3R1LA 2QTWA 1WUUA 3QGGA 4PPDA 2VG5B 4NLWA 2CJQA 1JQGA 4EBEA 2I38A 5DDRC 2V34A 3DOKB 1BWEA 3U27A 1RT1A 2QSFA 1ICEB 1C0TA 2CWXA 1FK9B 1R8AA 4GKKF 2XGQA 2V2ZA 4J37A 1T9UA 3AXMA 4LT6A 4J9QA 2W4PA 1FHTA 2V50A 2ZNZA 1M5HA 3OL6A 3GPAA 3EDRB 2DYAA 1HQUA 3S7RA 2H51B 3DNCA 1NZAA 3VGTA 1VRUB 2C2MB 1HPZA 2DNGA 2AJ2A 2IC3B 2IM2A 1JLCB 2FVQA 1FKPB 3N0VA 3H5YA 4KHPJ 3IS9A 2EWHA 5BJRA 3IGVA 1H2VZ 4X4OA 5ETMA 3W5YA 3EYZA 2R2UA 1FNOA 2CDQA 3MCMA 1U49A 1UAWA 6FD1A 4ECQA 4RU2A 3KLEB 2B7CB 5KTQA 1MWQA 3C6UB 5C42A 1HA1A 1ZA2B 3QATA 4PRFA 4MMOA 2ASLA 3SXLA 2E7WA 1FRXA 1IQTA 2NXNA 2YNIB 3PW4A 3KLIA 3P49B 2KB2A 1UW4A 1F9HA 3LP2A 1C2PA 3QWPA 1FWLA 5CQGA 2RMLA 3TNVA 5KOXA 3PHEA 5L1KA 1SJRA 1Q4RA 3MTJA 1GX6A 2P9CA 3OFHA 1CQNA 1UPMB 2RAQA 1L3TA 4DQPA 2B4PA 2RQ4A 1RTHA 2HGMA 2QMXA 1HBOA 3A12A 1WSVA 2AF6A 3A8JA 3HZGA 3LQVA 2DD8S 3BGFA 3OTCA 3NS5A 3R97A 2IPOB 5KFYA 2RRAA 4F2RA 1MMLA 2H9ZA 4ZPDA 3ZZUA 3M2RA 1FVQA 2K1RB 1RT2B 4X4VA 1VI7A 1HW9A 2GAHC 2GZOA 3VHQA 2XMVA 5LSLA 1CJKA 2I5JA 4PWDA 1KNZA 2V8PA 3M8PB 2W4CA 1TK8A 4B9SA 2AP6A 4ZA1A 1JLQA 5THWA 1WC6A 3PR4A 1MROA 4GC6A 3DI6A 1KEKA 3HJVA 1BXNA 5I3UB 3AOAA 1UJ5A 3GSIA 4WYWA 2OPSA 4ZVEA 3U02A 3KLFA 2CPIA 1ZZNA 3AH6A 1N34F 3LANA 1PILA 1SV5A 4PG7A 4P75A 3TOQA 3VQSA 3G96A 3PYEA 3QSIA 3H25A 2ZH1A 1VQYA 2YX7A 4QWCA 1IBCB 2FJXA 1MW7A 4LRCA 3FBFA 5AE3A 3NRBA 4FBTA 5A0YA 3SSSA 1GMUA 4KAIA 2M88A 1N0VC 1HKAA 2C3OA 3M8ZA 1HNIA 1NPKA 3M6UA 3N6LA 3CC7S 5AE2A 1V6HA 5J2MB 2QO3A 2CQCA 3MUMP 3BBCA 2UUWA 4DV1F 3T1YJ 1BQXA 2FHMA 4M5KA 3IR6B 2GMJA 4RUHA 2B4OA 2EFQA 4DR5F 3UPFA 1H2TZ 3IAM9 2E5GA 3P5TL 2MJNA 2AT1B 3HSDA 3T41A 4BC7A 1GXLA 1WI8A 4RW6A 1B99A 4HVZA 1UEVA 4ECTA 3SCIE 1Q81T 2D1CA 2GC8A 4HTIA 1HHTP 4L3KA 5KG1A 4LF4J 3PCOB 4DL0C 3QRRA 2ZNYA 4OYBA 3EGVA 2WRMA 3IP0A 4PG4A 2EI5A 3TA0A 4MIBA 5KFMA 2C3UA 2AJFE 2PT0A 2Z4PA 5IXUA 3DMJB 2GV1A 2IRUA 3R5BA 4DPOA 3AD9C 2Y1IA 4WU3A 4GVBB 1LNQA 1LXJA 2E66A 3TJ8A 1QM9A 4NI2B 2R8HA 3TZYA 3O5TB 2PFFB 2F3JA 2LP4A 2ZHAA 3BQ0A 5F0WA 5I3PA 2X7IA 2BZ2A 4QR0A 3UD3P 1FI4A 1GMVA 1QAJA 1RWOB 4JOUA 1HLWA 4UQTA 1DQ8A 4URSA 3K5NA 4FNIA 1WOPA 1RT5A 2IDLA 5JXSA 3GP9A 3G6ES 1PGZA 2RU9A 2NXEA 1RTDA 2MQMA 4PZVA 3PJWA 3W2WA 3ONQA 9RUBA 2MPUA 4LRFA 5KFFA 4J9OA 4DR7F 1MMDA 2HAIA 4B3RJ 1S1WB 3Q8QB 3VVTA 3AT1B 1CJUA 5M2UA 3I31A 3BB5A 4PXBA 3FEXB 4I6WA 1YRUA 3NAIA 3C66A 4EU0A 5LMUF 1FDAA 3C14B 4Z7CA 3NGUA 1NEEA 1IKYA 1TP7A 3TRGA 2YWKA 5BR8F 1TKZB 2J5AA 3E01B 3UCZP 2YY3A 1YK9A 3CJRA 1JJCB 3ILLA 5E0OA 4WKYA 3KG0A 1U25A 3OD2A 3KKFA 4TQSA 2R8IA 1EKRA 2KYZA 3PDNA 2HBYB 4A8SA 1FWKA 1XC9A 4ZLNA 2UXBJ 4B17A 2JC0A 1ZYQA 4TNOA 1F1BB 2GVZB 4OHVA 1XR5A 4DV7F 3WC2A 4USWA 3PFEA 2JZ5A 4X64J 5GMDA 1CS4A 4CLLA 4ZMMA 1VQ7S 1U1MA 4F7VA 2M4MA 2NPIA 2QLFB 2RU3A 4X66J 4KV8A 4O4GA 1SJFA 4K4WA 1ZH5A 2Z0GA 2DTJA 4KO0A 2MLYA 4NLOA 5G0RA 1SC3B 2VPXB 3VVUA 1U26A 1HWIA 1JX4A 2JNJA 3TP2A 3QBCA 1SJ1A 1CULA 4PR6A 5K8NA 2BKOA 4DV6F 3T5LA 3EE3A 3D5MA 4DR4F 1N48A 1PCAA 3RW7A 2HMIA 4C8ZA 1IWAA 3RYLA 4ZJQA 4QPXA 4PYAA 1DQAA 1T02A 2DY9A 2MMYA 5D3GB 2H5JB 4DQRA 4K4VA 1VFJA 1Y10A 2XLIA 2BJ9A 3CJ4A 2ATLA 1WORA 1YSJA 2ILYA 4X64F 1T11A 4DL2A 1PYTA 1RHMB 4ZIWA 4LFAJ 4NXMJ 2ZE2A 2PD1A 4QZVB 4LRDA 1X60A 4JI3J 4ZVSB 1D09B 2BJ3A 1Y5NB 3GYNA 4P10A 4J90A 1M1HA 2ZDPA 4M5IA 4ANDA 3GJRB 4LBPA 4RJVA 4PKDB 2AX1A 2CQDA 2OO4A 2V69A 2YNGA 3CMQA 3UFCX 4DBQA 3BBBA 3U7JA 5EWFA 2XO7A 1SIZA 5LOQA 1U6FA 3H7HB 4NE9C 1Q86T 4PXDA 1U6ZA 4UOHA 2LQ9A 2QYGA 2MEWA 5E3QA 5LSRA 2R7VA 3KNAA 1Q5YA 1M1GA 1WG5A 2AHOB 3BH7B 3HHKA 3MEEB 4WE1B 3RR7A 1N56A 2DNQA 1X0FA 3PW5A 2HFSA 3Q2SC 4I64A 3GJSB 3MM6A 2MZTA 4NLYA 1IBKJ 3M6VA 4WTYA 2FYXA 3NGTA 2MKYA 2VD3A 2RKIA 4CH0S 3A1YG 4N5SA 1FNXH 3M7VA 2Y3YA 2WVCA 1VC6A 1WF1A 1RT4B 1X5OA 3D1OA 5L9XA 2XHWA 2RDDA 3VZHA 2D3OR 4F4KA 5AXNA 3K5OA 4K4ZA 2DNMA 1FRKA 1YHQS 4A8KA 3AODA 3KK1A 2N7CA 2AJQA 3MURP 3MD3A 1X4DA 1WC5A 2XEXA 3RJMB 1PC4A 5H9EK 3POTB 3EZOA 2DGWA 4YB5A 3L4BC 3EVWA 1FJGJ 2HQ3A 1QVGR 4KYZA 1TL3B 1HBMB 3MM9A 2QLXA 1SL1A 2LXFA 3DYAB 1PBUA 1IQZA 1LQ9A 3M8PA 2RF2A 4I56A 1U0HB 2W24A 4KFBB 4ED2A 2XMJA 3OXFA 4N7TA 3RW6A 5HATA 4ELVA 3JTNA 4BWMA 2GNKA 5DQIA 2R7XA 3LPEA 3AY0A 3EX7B 1CJVA 4KY3A 4EBDA 3QIPB 1SQFA 5T7LA 5T7LB 4DL5A 2HFOA 1FWPA 1SH2A 4EFAC 1E6YA 3GONA 4B3MF 4USKA 1HQUB 1QD1A 3R9LA 1NSPA 3DLEA 5BYSA 5DDPC 3KLGA 1S0NA 5CA5A 2NXJA 3CDWA 3PO5A 1S57A 1S59A 2HFUA 3KLIB 4J9RA 4PAAA 5AXLA 1YBUA 3IRXA 2LEAA 4M5NA 1TL1A 2JC1A 2VFUA 3DCAA 3DRPB 1FO1A 4QWBA 3KLEA 4PPZA 5KG0A 3NGKA 4ED0A 3ITHA 4K4XA 3GFHA 1B70B 3IWNC 2FJEB 3BKFA 1YVFA 3VCDA 3M6XA 1UJ4A 2MZQA 2JHEA 1O8BA 2P2CB 3Q8SB 2H5EA 3T6JA 4R5PB 4DV3J 3RB6A 2DXEA 1RCOB 5FLXU 3U1LA 4RW8A 4LFCF 1K8AT 4FYVB 4JI8F 2XYGB 5CD4H 4CIOA 2CAJA 1JMTA 3LTOA 2PA8D 3DLKA 2GHVC 2VASA 2LEPA 1ZOTA 1D9FA 3V4IA 3G8QA 3NBPA 3PTWA 4ZP8A 3KXDA 1WELA 4DPXA 2VICA 4JI5F 1TK0A 3H2UB 2M3DA 1UEUA 1VRTB 2BUNA 4H54A 2K8GA 1TL7B 4FYWB 4OIXA 2V4RA 2VODA 2YWEA 3TUPA 4JI0J 2HZVA 2IFXA 1OYEA 3BDEA 3CEDA 2BE2B 2JFDA 4Q0BA 2VC1A 2J9DA 3N4WA 2CNKB 5J2NB 4EI2A 3HF5A 2VBZA 1K0TA 2FVSA 4BLGA 2FGOA 2W2PP 2Y1RI 4IDKA 4LSNB 2WVDA 1HWLA 4Y28C 4ILLA 3F0NA 5LT5A 4ECSA 1UCNA 4K5SA 2RDJA 3CCZA 5KFXA 1B4SA 1KONA 2FUG9 2IM1A 5IV3A 1ZAWA 3AHPA 4MK7A 4B9MA 4LBIA 1FJGF 5HVFA 3MR2A 4TU8A 3DOLA 3UQSA 3HHDA 2A6OA 3QZ7A 1YWXA 4JV5F 2RKIB 3MMJA 4P2XA 2F4FA 2NXUA 1SXLA 4WK3A 3L95X 4YN3B 1T9VA 1IKXA 3G6VA 3E01A 8AT1B 4P71A 1DJ0A 2F9JA 2VFVA 4Z7YA 3SFGA 2RRNA 5GMEA 2HS0A 4FP9A 4ZITA 3K89A 2HFVA 2ZITA 3ZTOA 4DU8A 3M2VA 3ETMA 3FBEA 4Y2AA 1YZ6A 5KT6A 3HFZB 2GX8A 1XNRF 2V8HA 2ZFHA 1K1SA 5EX0A 4NLTA 5KFLA 3A13A 1NKCA 3DOMB 4B3SJ 1G3OA 3FSXA 4F0KA 2C3YA 1KHWA 3K5MA 2IA6A 3UE2A 1W2IA 2ACMA 4OJ1A 2V67A 1BD6A 2LQ5A 3GJQB 3H8YA 4LF2A 2AEFA 2IVMA 4ZN1A 2M2BA 3R27A 1C1BB 1YIJS 2D3UA 2QC3A 2YQ0A 4M5JA 2E44A 4CNZA 1RE1B 2ZD1B 4JI4J 2VG6B 3G86A 4KFBA 4OX9J 1FRMA 5JJBA 2MZSA 2J0SD 2MYFA 4J91A 4DXLA 4ELTA 2OFHX 4OZ1A 4OYWA 1Z2LA 3T9ZA 1FFSB 3TO8A 1TL5A 2NPFA 2CQGA 3ULHA 3I0SB 3HD1A 5L39A 2OJ3A 2ZH3A 1NO8A 4XPEA 3D67A 3MCNA 4G1QA 4M5DB 4EBCA 3QGHA 4OHZA 1LW0B 1Y4ZB 2HHQA 5I3QA 2XYPB 4QOTA 4K8RA 2HHSA 4RBTA 1Y9OA 3GIRA 4Q7AA 1S6QB 1S6QA 1NJXA 1EIYB 3CJKA 1IR0A 4W4MA 3R2CJ 2DGXA 5DJBA 4L6V3 3ISZA 3THTA 2WCXA 3JAMY 3GIJA 5A8KA 4CH7A 4Q8FA 1DLOB 3MEGB 5LJ3Y 4CO4A 2DRBA 3S1TA 2KHDA 3S6EA 4JI2J 3OXLA 4M5HA 1VBKA 2CQBA 2OEKA 2HQCA 1N54B 2XSJB 2XSJA 5EGYA 3M8QB 3R5DA 3M30B 3Q23A 2BMBA 4ED5A 2W9BB 5G4DA 4X4QA 4OI0A 1UEKA 1XN9A 5C2GA 4XTTA 1S97A 1K47A 5ETRA 2HHHJ 3D0IE 2RB7A 2DEJA 4OI4A 4DN0A 1KTVA 1RTDB 1RUSA 3D0GE 3IBWA 3MM8B 1Y11A 4WFYA 2AGQA 4HTJA 4WK1A 4CYUB 4J9MA 1URNA 2AW0A 3MCOA 5D78A 1UETA 3BN4A 5D15A 2M5YA 4R8UB 2LKZA 3Q24A 1VS3A 4DR4J 1G4CA 5KFKA 4Q45A 1S6OA 3RBDA 1OYDA 3I0SA 1YJTA 3QJPA 2A3JA 2LLZA 2VDHA 4RW4A 4USTA 4ZP7A 1WOSA 4HHHA 4P2FA 4G65A 4MIWA 2ERRA 2XMUA 3JAMU 4LBHA 2ZM6J 4IDKB 2HRYA 4CM2A 4LSZB 2GJ2A 2P9GA 2XY5A 2W9CA 4PXCA 3MUTP 3CJ2A 3FRZA 3D1QA 3BGOP 2QLWA 3SMZA 1YJ9S 4MFBB 3GG1A 4U9RA 3PW2A 4TLQA 5HQLA 2FY1A 1R0CB 1G6BA 2Y8YA 2MSSA 3PRBA 1VK3A 4H4KC 3GV7B 4DUZJ 4ILRA 3HX9A 1NK7A 1NK6A 2P5VA 3UR3C 1KLMA 2JLGA 1F5BA 2VBYA 3UI3A 4BS2A 2VFSA 1RTIA 1S1TA 2HZCA 4J9VA 4WP9A 5KFTA 2QL5B 3CCMS 2B9YA 1GMWD 2G13A 1RKIA 1Z1ZA 4FKYA 3WZ0A 4M94A 4K59A 1V3RA 2OSRA 3LP0A 2KH9A 1JLBA 2H65B 2V4JB 2G2OA 2NXCA 3F56A 3RUBL 2BACA 1UA0A 3R6GB 1NDCA 1EQ0A 4L76A 2Q79A 3OFEA 2IYIA 1HFEL 5ETSA 4R8UA 5F8JA 1YKWA 4UZCA 5IT9Y 3N79A 3PV8A 1HNIB 4DFKA 4B9NA 4O3RA 3NXZA 2VQEF 4DF4A 2IJRA 4K2JA 3G9CA 2FJVA 3CDAA 1HQEB 1YJVA 3WIUA 3OL9A 4JI1F 3LO3A 3NLCA 4RX6A 5HK4A 2CJBA 1TR0A 2DR6A 3QFWA 2MJUA 2KYXA 3NOGA 4ZPBA 5F8MA 1RWWB 5CZXA 3RRGA 4JI7J 4HI1A 2VKRA 4P7VA 1RBLA 5DZ7A 5B0FA 1VQNS 2GJFA 1EHWA 1KDNA 1SVDA 2ATCB 4MK9A 2JOQA 2VFRA 5ETVA 4QW9A 3W65A 2XULA 5AJ3J 2VHGA 3CB4A 4DX5A 2J0XA 2BE9B 1ZAXA 1UVMA 2ROGA 4DV7J 3TAPA 3QRQA 2VZ9A 1S49A 4QCLA 4DFPA 3PIOQ 1NB7A 1FJEB 2VQEJ 2IDEA 2WW4A 4IOCQ 3CJ3A 4P7TA 3DRXA 3TAMA 4J9LA 2ADBA 1M5KC 1SQEA 4A8FA 3SQGB 5B0GA 5K14A 1S1XA 1RCXB 1HNZF 1AW0A 3H98A 1FDBA 3BKUA 4NYZA 4OJHA 3MR5A 2YKPA 3F44A 3AJ1A 4NPOA 2VOPA 3B78A 5FJ4A 1RI7A 1Q8BA 1R27B 3NEKA 4Y2MA 1YBTA 4CLKA 4QJVA 3GIKA 4DZ6A 4K4SA 4B3TJ 1I94J 1LWEB 2KDOA 2VPZB 3BH6B 1LFWA 4NLRA 3K0JA 1RTJA 3IBFB 1GQEA 4NWBA 5ETPA 4IFVB 5T14A 1N6QB 2DNOA 4PCQA 5KFWA 3KHRA 2R7WA 1GTEA 2XG8A 4DV4F 4BDPA 4FXDA 3DLHA 3FC9A 3GFZA 3VGSA 4UUXA 4RNOA 4NMXA 2W7OA 2OP5A 3CE8A 2JRSA 2Q6CA 3LW5C 1QAIA 3CDBA 2HHWA 3DRYA 1NLKL 2IIHA 3UNGC 4U95A 4DR6J 2Y0BB 2DBBA 4OL8A 2QJ3A 4LIRA 4ES3A 2VPWB 4ZJOA 3LAMA 1EAYC 5MLCV 1VRTA 5BYQA 2WVEA 4G1PA 5EUHA 4CH1A 1I5OB 2DRAA 4NLSA 5HAOA 2EFVA 2Q1LA 1UKUA 3CJ0A 2XCPA 5K14B
chains in the Genus database with same CATH topology
1SC3B 1I51B 5IC4B 4LSZB 1GFWB 2C2KB 2CNNB 1RWNB 1RWPB 2CDRB 3NS7B 2C2ZB 2H5JB 2CNKB 4DCPB 2HBQB 2DKOB 2QL5B 2H4WB 1RHMB 2H65B 4DCOB 1RWKB 3D6FB 3R6GB 1SC4B 4ZVSB 3R7SB 1IBCB 1RHKB 3QNWB 3GJRB 2H48B 2XZDB 3KJQB 2CNLB 4JB8B 2HBRB 3R7NB 1RWMB 2QLBB 2C1EB 1RHJB 1RHRB 3IBCB 2XYHB 3GJSB 2QL7B 4ZVQB 1RWWB 3GJQB 4ZVRB 1RE1B 2CJXB 4ZVUB 1PAUB 2QLJB 2XZTB 2QL9B 4ZVPB 2C2OB 3RJMB 4ZVOB 2H5IB 2FQQB 2Y1LB 3EDQB 3P45B 1RWOB 2XYPB 3KJFB 1SC1B 2H54B 3KJNB 1RHUB 1RHQB 3IBFB 1ICEB 3D6HB 3P4UB 2H4YB 3EDRB 2H51B 1RWVB 4DCJB 2C2MB 5K20B 1QDUB 2CJYB 2CNOB 2Y0BB 1NMEB 1F9EB 3R6LB 2HBZB 2HBYB 3SIPB 1I3OB 1BMQB 3R7BB 4ZVTB 3D6MB 3R5JB 1QTNB 2P2CB 5IC6B 1PYOB 2QLFB 3GJTB 2XYGB 1RWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC3 B;  1I51 B;  5IC4 B;  4LSZ B;  1GFW B;  2C2K B;  2CNN B;  1RWN B;  1RWP B;  2CDR B;  3NS7 B;  2C2Z B;  2H5J B;  2CNK B;  4DCP B;  2HBQ B;  2DKO B;  2QL5 B;  2H4W B;  1RHM B;  2H65 B;  4DCO B;  1RWK B;  3D6F B;  3R6G B;  1SC4 B;  4ZVS B;  3R7S B;  1IBC B;  1RHK B;  3QNW B;  3GJR B;  2H48 B;  2XZD B;  3KJQ B;  2CNL B;  4JB8 B;  2HBR B;  3R7N B;  1RWM B;  2QLB B;  2C1E B;  1RHJ B;  1RHR B;  3IBC B;  2XYH B;  3GJS B;  2QL7 B;  4ZVQ B;  1RWW B;  3GJQ B;  4ZVR B;  1RE1 B;  2CJX B;  4ZVU B;  1PAU B;  2QLJ B;  2XZT B;  2QL9 B;  4ZVP B;  2C2O B;  3RJM B;  4ZVO B;  2H5I B;  2FQQ B;  2Y1L B;  3EDQ B;  3P45 B;  1RWO B;  2XYP B;  3KJF B;  1SC1 B;  2H54 B;  3KJN B;  1RHU B;  1RHQ B;  3IBF B;  1ICE B;  3D6H B;  3P4U B;  2H4Y B;  3EDR B;  2H51 B;  1RWV B;  4DCJ B;  2C2M B;  5K20 B;  1QDU B;  2CJY B;  2CNO B;  2Y0B B;  1NME B;  1F9E B;  3R6L B;  2HBZ B;  2HBY B;  3SIP B;  1I3O B;  1BMQ B;  3R7B B;  4ZVT B;  3D6M B;  3R5J B;  1QTN B;  2P2C B;  5IC6 B;  1PYO B;  2QLF B;  3GJT B;  2XYG B;  1RWX B; 
#chains in the Genus database with same CATH topology
 3OL8 A;  4DFJ A;  1S1T B;  2IRX A;  2ADC A;  2L3M A;  1HQ2 A;  2DJW A;  3L7O A;  2GGP B;  1TUW A;  4KKO A;  3M8R A;  1H2U X;  5HI7 A;  4WU2 A;  1SUQ B;  3M05 A;  1KFS A;  1TV6 B;  2MHE A;  3W66 A;  1FTR A;  1URR A;  2QZ8 A;  1R8H A;  1GAO A;  1RWN B;  1S9E A;  3JYT B;  1FD2 A;  2CDR B;  1HMV A;  2DHH A;  4PQU B;  3LF0 A;  3HFV A;  4HYK A;  1TL4 A;  1WC3 A;  5DGB A;  5JVG Q;  2ZDO A;  3CD7 A;  3DRS A;  3ELH A;  5DZ6 A;  1X4B A;  1ZZF A;  1QJH A;  2B6A A;  3M32 A;  4O3Q A;  3J80 U;  4TU9 A;  3JSM B;  3DDK A;  2UXC F;  3IRX B;  1VQ5 S;  4KHP F;  4ZPC A;  1L3U A;  1CBK A;  3ICL A;  4C3K A;  1E6V B;  1YRX A;  2A2C A;  1H0H B;  1R8B A;  3LPY A;  2NSB A;  1W2B R;  2F8H A;  4K4Y A;  1O0P A;  3TZX A;  3BO2 A;  3DLG B;  3NWG A;  4OI2 A;  4YR2 A;  2FDN A;  4JV5 J;  5GAG I;  1A6L A;  2GQC A;  3E8O A;  2XNQ A;  3TUZ C;  3EZ5 A;  4G1I A;  5SUH A;  1KVI A;  4I2P A;  2CQP A;  4JUZ A;  3RB3 A;  4MK8 A;  1BQM B;  1T0T V;  3IA0 A;  4Q2M A;  3M4X A;  2X1G A;  4DOZ A;  1WC4 A;  2CYY A;  3GYG A;  4ZP9 A;  1IKV B;  3MD1 A;  4UOF A;  2HGN A;  1NSK L;  1RQ0 A;  4WYL A;  1VQK S;  1RHR B;  3MDF A;  5DG7 A;  2YWG A;  1TL3 A;  3MM9 B;  3ZNU A;  3W60 A;  3CUL A;  1U8W A;  2I8E A;  3W62 A;  3UCG A;  3HLU A;  3MM6 B;  2EXU A;  2PMW A;  1T05 B;  2ZBQ A;  3THV A;  3BSA A;  3TA1 A;  1N6Q A;  4UZB A;  1GMW A;  3PJ9 A;  2J6T A;  2UXD F;  4B9V A;  2N3O A;  4USH A;  2V2K A;  1D1U A;  3VTI A;  5U47 A;  4QWD A;  2BM1 A;  1EQM A;  2X1B A;  1XBW A;  3GU0 A;  4XDD A;  2HVE A;  4ECU A;  3LGH A;  4OYI A;  1PAU B;  1NB2 A;  2CG8 A;  3DRR A;  4C0B A;  1RTZ A;  2XZT B;  1HNV B;  4Q43 A;  1CJT A;  1RLD A;  4LF6 J;  1RAA B;  1XJW B;  3FCV A;  3SDE A;  1TKX B;  4DR1 J;  3MED A;  2K3K A;  2RVJ A;  5A8R A;  4MKY A;  1KFD A;  3C46 A;  2HHU A;  3CIM A;  2VBW A;  2QMW A;  1F3V A;  1NAQ A;  2WON B;  3HM9 A;  5KT7 A;  3I0R B;  1S1U A;  4QW8 A;  3CO9 A;  1X9W A;  4NXN F;  2ZBC A;  2L08 A;  3A3N B;  4NLQ A;  1FA0 A;  5D4N A;  2EKY A;  2E5H A;  3OFG A;  3MR6 A;  2MGZ B;  5KFV A;  1Q5V A;  1QUP A;  2KO1 A;  3I87 A;  3PG9 A;  1FF2 A;  5D0R A;  2HHH F;  3M9M B;  2HK2 A;  3OJS A;  2D69 A;  2AKW B;  3NKY A;  1JKH A;  2V94 A;  4C8K A;  2MQO A;  3EVM A;  5D0H A;  3SQO P;  4C2M A;  3DU6 A;  1RYS A;  5H9F J;  1X7V A;  4RR5 A;  1ACM B;  2PMH A;  2NQP A;  1Y5I B;  2B4V A;  1S0O A;  2BOA A;  1UMJ A;  1AA1 B;  4F0H A;  4F3O A;  1MLA A;  4LQ3 A;  2XS5 A;  4O4R A;  2B9W A;  2EW9 A;  3BSN A;  4IR9 A;  5J2M A;  4MT1 A;  4HKQ A;  3Q8P B;  3HUL A;  3CJK B;  2FGC A;  1QDU B;  2M0G B;  4C8N A;  5E7O B;  3NGS A;  2CNO B;  2EVZ A;  4P74 A;  5K9F A;  3C8Y A;  3CDU A;  3CVK A;  3R6L B;  1A7G E;  2V6A A;  1X4E A;  4OYM A;  2YKQ A;  1HBU B;  1HBU A;  1I3O B;  3CCT A;  5D0E A;  3HD2 A;  4DUY F;  3B8H A;  2HFZ A;  3OUY B;  3AFG A;  1FFG B;  4NYP A;  3CMA S;  4WXW A;  3ZXW A;  1RAG B;  3NNH A;  2EC2 A;  3HCX A;  2HHT A;  1SJQ A;  2OTL S;  1F2H A;  2F4V J;  4F04 B;  3NNC A;  4ED1 A;  1U1R A;  4ED6 A;  1NKB A;  2KN4 A;  1S1W A;  2KZZ A;  4I68 A;  1IN0 A;  5A8K B;  1E6V A;  2R7R A;  1GH8 A;  2A1B A;  2ZOM A;  3W2V A;  3CCL S;  3AOC A;  5AE1 A;  4LVO P;  2W1B A;  1JLE B;  5B7W A;  1H38 A;  4IRC A;  2WAQ D;  2CNN B;  1CC8 A;  3CSK A;  1RWP B;  5E33 A;  3M2R B;  1UW9 A;  5LM7 E;  5GMK a;  5LMN F;  2KU7 A;  2C2E A;  2HVH A;  1RSC A;  3SV4 A;  2QFI A;  3UD5 A;  3T5J A;  4X65 J;  3RTV A;  4U7U D;  3U1M A;  2D3Z A;  4C48 A;  4ZPA A;  5I4M A;  3MM8 A;  3QYY A;  4R0J A;  5FD1 A;  5C24 A;  4ZLP A;  4DCP B;  2DIS A;  5F8I A;  1VQM S;  4LR8 A;  3O1L A;  3FCH A;  1SKW A;  2BEF A;  3AJ2 A;  4O0N A;  1RB0 A;  1MN7 A;  3DN9 A;  4WFB Q;  3PX6 A;  1GXU A;  3X3U A;  2DNR A;  2OAU A;  2ZEJ A;  7FDR A;  4FYY B;  4C11 B;  2YH1 A;  1KLN A;  2UVW A;  2GS8 A;  3D28 A;  5DET A;  1SI9 A;  3R1H A;  1RT6 B;  4NLD A;  2RHQ B;  4K5R A;  1X4H A;  3PXG a;  3MEK A;  4CLS A;  1V9O A;  4URQ U;  3BO3 A;  4C4W A;  4ZK7 M;  2XZD B;  2ROE A;  4IQM A;  3A8I A;  1NSQ A;  4QR2 A;  3BYP A;  4ZJL A;  1ZM3 A;  4DMZ A;  5KT4 A;  2VB6 A;  1M5V C;  1OQ6 A;  1OSD A;  3CD0 A;  2KVQ E;  2PA3 A;  1ZAV A;  4BHQ A;  5A6P A;  2NCK L;  4KGM A;  4JI2 F;  4ZLL A;  3TZZ A;  5F8G A;  3MWB A;  4AQY F;  3CC4 S;  5EX3 A;  5KFG A;  2E1M C;  2OD6 A;  2R7U A;  2MZJ A;  4RNM A;  3D54 A;  1ARO P;  1N5Q A;  2FC9 A;  2KT5 A;  4YHH F;  4GVB A;  3UNY A;  5B09 A;  2R8J A;  1DTT A;  3MPW A;  1AT1 B;  3TEG A;  2Z30 B;  1VBX A;  2UVV A;  2HWI A;  3CF5 Q;  2DIU A;  4B3O B;  4OX6 A;  3PO4 A;  3NBP B;  2CAD A;  2VH7 A;  2ZC4 A;  3MCS A;  3QGI A;  4QYR A;  3HVR A;  4X84 A;  2YPZ A;  3BGU A;  4FS1 A;  1NJW A;  1XMB A;  2C2N A;  2ZWO A;  4AL6 A;  1E6Y B;  2VBX A;  3HDS A;  2LU1 A;  5HBM B;  3GII A;  2QEX S;  2UXD J;  1S6P A;  1S6P B;  1W7W A;  2FZG B;  4DPY A;  1R0B G;  2ZHO A;  4EWT A;  2B6A B;  2OKQ A;  1JLA A;  2C3P A;  4LSN A;  1NK8 A;  3PIP Q;  2GW8 A;  2L48 A;  3DRP A;  4TN2 A;  4OX9 F;  3ZO7 A;  1GEH A;  3TX0 A;  3GV8 B;  2D7S A;  3M6W A;  4LFB J;  1IM6 A;  1IXK A;  3GZ7 A;  1P27 B;  5CCM A;  1CPZ A;  3BYR A;  2MHN A;  1IJE B;  3PYD A;  4CO3 A;  4M95 A;  2CQI A;  3EXY A;  2DPI A;  2HSE B;  3FGV A;  4WIQ A;  5HMW A;  5LXY A;  2W25 A;  3KHH A;  3TAM B;  2HRT A;  3GYX B;  2YVS A;  1XTZ A;  5F3T A;  4FYX B;  4LRB A;  5J2P B;  3CXC R;  1XWL A;  5J2P A;  1JB0 C;  3TAQ A;  4H4M B;  4OZ0 A;  3SEO A;  4EYI B;  4LF8 J;  4DPW A;  2XSF A;  3OHA A;  5D4O A;  2ZVS A;  2R42 A;  3GWC A;  1REG X;  1KRP A;  3OV7 A;  2DNL A;  1RAD B;  1RAJ A;  3IO1 A;  1SKS A;  2V68 A;  2W2O P;  2GVD A;  5K20 B;  1IWG A;  4B3T F;  2XNR A;  2QYC A;  3VWS A;  2YKN A;  2YKN B;  3EPG A;  2LA4 A;  3K57 A;  1UA1 A;  1F9E B;  4B08 A;  2HND A;  3HZE A;  3LAL A;  5K8P A;  4DX7 A;  3MMB B;  2ASY A;  2BJ1 A;  1RT6 A;  1B0P A;  2SXL A;  3M2U A;  3MTK A;  3H2V E;  2AWZ A;  3CME S;  1S9E B;  2HVZ A;  3IMQ J;  1P8G A;  2Z8Q A;  1HPZ B;  4LR7 A;  1DAX A;  4FKX A;  3G82 A;  3SYZ A;  1N33 J;  3I9V 9;  3ZZO A;  2BX6 A;  1RTJ B;  4QR1 A;  3D4J A;  1UWB A;  4I0W A;  3TQE A;  4OJG A;  3IAS 9;  3KK1 B;  2UXB F;  3RGI A;  2U1A A;  3W5X A;  1XNQ F;  5M2R A;  2CWK A;  3MF5 A;  1RBO B;  1S7H A;  4I6A A;  2JH3 A;  3HMJ G;  4WBF A;  4WFN Q;  1BY9 A;  2VFT A;  3DRS B;  3CJ8 A;  5HP1 A;  5HP1 B;  1TAU A;  2RRB A;  4X66 F;  1B7Y B;  1OQ3 A;  3M8S A;  4N76 A;  1TL1 B;  1HHQ A;  2N82 B;  3W3S A;  3AQP A;  3TVY A;  1JWW A;  4NCA A;  1VQS A;  4A4J A;  4P72 A;  2PE8 A;  2VON A;  2H4W B;  2BKN A;  2WVB A;  1RXO B;  1HNX J;  1YJW S;  4Y2K A;  5D8H B;  2MQN A;  1CS4 B;  4O23 A;  2EK6 A;  3UDC A;  3KHG A;  4W92 B;  1EB0 A;  3ILO A;  3QAE A;  1RHK B;  2QRR A;  3QNW B;  4DPT A;  1U2C A;  2JVR A;  4NRT A;  2DGQ A;  2W2N P;  2CPF A;  2KXN B;  4M5M A;  1OIA A;  4OV1 A;  2RQC A;  1T03 B;  4MKV A;  2W8K A;  1BGX T;  3WBZ A;  3VV2 B;  1R7I A;  2R2S A;  1TMJ A;  3AJD A;  2Z56 B;  3SQG A;  5DQG A;  2HQG A;  1X4C A;  2LYV A;  3DDN A;  1PJ7 A;  3W5Z A;  2XMK A;  1FE0 A;  3ET6 B;  2ZJP Q;  4S0M A;  5IM0 B;  4C9D A;  1G7C B;  2BBE A;  2CZV C;  3J7Y I;  2QV6 A;  3D9B A;  5J1E A;  4X4R A;  2KRR A;  4EK2 A;  1AZS B;  1N5Y A;  3WC0 A;  1F2G A;  2BM0 A;  4OZ5 A;  1YLX A;  3ZZ0 A;  5JMN A;  5HL7 Q;  2IM3 A;  2WSF C;  3D2W A;  3MPD A;  2FJW A;  4QU7 A;  3DDI A;  2F65 A;  2DHG A;  1KKH A;  3N5F A;  3NCQ A;  3UDV A;  2KFY A;  5J1P A;  1TAQ A;  2CQ3 A;  1QAY A;  2R7O A;  4NEZ A;  1I1G A;  2JL9 A;  4M63 A;  1FJ7 A;  1UZH A;  2A10 A;  1W25 A;  2W7P A;  4F4W A;  2E9T A;  4USV A;  2HNY A;  1BHN A;  2ZKU A;  2J7U A;  5J2Q B;  2NR0 A;  2NYH A;  5KFR A;  4JV0 A;  4YS2 A;  3QID A;  3THP A;  1KR4 A;  2B0G A;  2G1H A;  2MQ8 A;  5IT9 U;  2HUR A;  3KJF B;  5D4P A;  5KFE A;  3JQK A;  4NCG B;  4NCG A;  1DTQ B;  1FKO B;  3MXH P;  1VIX A;  2Z2M A;  1V5V A;  2DGV A;  2HVI A;  1S9G A;  2J76 E;  3EUN A;  4DV1 J;  3T1Y F;  4ID5 B;  3LUY A;  3MAQ A;  3RAQ A;  3FEZ A;  4OYP A;  1T9X A;  3A4T A;  3H40 A;  5IFM A;  2AV5 A;  3P4U B;  3BGL A;  4DSF A;  1SIW B;  2DT9 A;  3T19 A;  1WG1 A;  5IQQ A;  4DSE A;  4F50 A;  3GE9 A;  4OYA A;  4DV3 F;  1FXL A;  1RWV B;  3J7Z 5;  4A8W A;  1N32 J;  2MGZ A;  1N34 J;  3VAM A;  1OSC A;  2LDY A;  1RT3 B;  4MIA A;  3NL0 A;  2KXF A;  4IFY A;  4QIF A;  4Y00 A;  3CD6 S;  1ZPW X;  1YGY A;  5DG9 A;  3C6T B;  2V4Q A;  3RRH A;  4RUC A;  2QE5 A;  1IKY B;  1F3F A;  1QAX A;  1RK8 A;  3D6M B;  4EEY A;  1R0A B;  4LMZ A;  5H9F K;  2WW8 A;  3JXO A;  1X9M A;  1PYO B;  5I3U A;  5ETL A;  3I0R A;  3I5C A;  3M2V B;  5IQ6 A;  3BQ1 A;  2DO4 A;  3KK2 B;  3KK2 A;  2UUC F;  2IMW P;  2HIQ A;  2YNF B;  4NZ0 A;  1D9A A;  3IXQ A;  2I5J B;  5IC4 B;  3VGU A;  5L46 A;  1F0X A;  4Q0B B;  3HSG A;  1SJ3 P;  2OEJ A;  2XWX A;  3Q83 A;  4OHW A;  1H3D A;  1J5O A;  4KPY A;  3CW2 C;  1RP5 A;  3ENA A;  4R25 A;  5AXM A;  5A8W B;  3OUY A;  3KLV A;  4F4Z A;  2HW3 A;  3RAM A;  3PYG A;  2BE7 D;  4ECR A;  2KL8 A;  3TJ9 A;  1KD1 T;  4CLY A;  4Y0F A;  1N33 F;  1OY8 A;  4IG0 A;  4JBC A;  4K0K J;  4X4U A;  1K44 A;  5E5N A;  4YOE A;  2ZBP A;  2XTJ P;  3F73 A;  1AFI A;  3PAC A;  4DJB A;  1SBR A;  2VA2 A;  1VR6 A;  3CJ5 A;  4OLP A;  3P96 A;  2VJU A;  1JNR B;  3MFI A;  4ECX A;  4C8M A;  5K8O A;  5BXI A;  3MFH A;  2E1C A;  4KGZ B;  4WPA A;  1UFK A;  1FES A;  3TR5 A;  1OJ4 A;  2LA6 A;  3HHL A;  1RWK B;  2VIH A;  3V6D A;  4PWW A;  3NG8 A;  2UVR A;  1KOO A;  3HSJ A;  1VLY A;  1REV B;  1AUS L;  4KHR A;  2RUS A;  1UVK A;  4NML A;  3Q8R B;  3KMQ A;  2MST A;  4P2S A;  5KFO A;  4D3G A;  3C6T A;  4AL5 A;  2XZW A;  3OTB A;  3DMJ A;  3K59 A;  3HJF A;  1TUG B;  1NJZ A;  4DR3 J;  4RW6 B;  2W2M P;  4YB7 A;  4ZP6 A;  3DOM A;  3OJU A;  1HNW F;  1YG0 A;  3QT7 A;  1RHJ B;  2L41 A;  1VQ4 S;  3MEC A;  4JP8 A;  4ER8 A;  3C14 A;  2GML A;  3M8Q A;  1X0P A;  1HHS A;  2UUB J;  2XI2 A;  5DS7 A;  5ETO A;  5KT3 A;  2MQQ A;  1HI0 P;  4NAS A;  3FK4 A;  3DI6 B;  4LRE A;  4TVA B;  2DGU A;  3KUG A;  3RB4 A;  2K3I A;  3IWL A;  2BQU A;  1UTA A;  3MPV A;  1PJ6 A;  3JQM A;  3MZI A;  3TVZ A;  2ZH8 A;  3D3C J;  3V81 B;  3IS9 B;  1VIO A;  1LEO A;  2FVP A;  2YNH A;  3GG0 A;  2DNK A;  4KB7 A;  3FRY A;  4EUV A;  4USM A;  1SPB P;  4YP3 A;  3G8T A;  2JFK A;  2UV8 A;  4LFA F;  4NXM F;  2UXC J;  2G9O A;  5A76 A;  3LGN A;  2ZKT A;  4JV2 A;  5FII A;  2WBM A;  3LOU A;  1YIT S;  1B0T A;  4NZ6 A;  1RYR A;  2KXH A;  3HHN B;  1L3K A;  2BAN A;  3HP6 A;  4LF5 J;  5IT0 A;  5KFC A;  1XR7 A;  4OYX A;  2E7X A;  4R0E A;  3BQ2 A;  2MKK A;  2BR0 A;  1C0U B;  1N5V A;  2O1P A;  3DM2 B;  4N77 A;  4NLV A;  3SCJ E;  3WX4 A;  3GQC A;  1HNW J;  1S79 A;  1QSY A;  1JLG B;  3JTO A;  4A8O A;  3IN5 A;  4KE5 A;  4ZPW R;  1WAC A;  2BW7 A;  3DHX A;  4KGV B;  1HAR A;  4CO1 A;  4E98 A;  3UDL A;  1IBL J;  4I67 A;  3H5U A;  4F2S A;  1ZM2 A;  2PSZ A;  2B4U A;  2V9K A;  1U2F A;  1JLF B;  4LSL B;  4F4X A;  5B0E A;  2GQQ A;  2OSQ A;  4CTA A;  5BYR A;  4DX6 A;  5KOW A;  1CG2 A;  1MU2 B;  2RDI A;  3NAH A;  1YI2 S;  1FK9 A;  1UJ6 A;  1U48 A;  1FEE A;  1OPI A;  4A8M P;  2YH0 A;  1RJJ A;  2J8A A;  3ADA C;  3M32 B;  1BQN B;  2HBZ B;  4ZVG A;  5ADZ A;  3M2U B;  4CLU A;  1HR0 J;  2W01 A;  2ZUG A;  1H6K X;  2IVY A;  4MAK A;  5IT4 A;  1JXV A;  1BMQ B;  2IAJ B;  3CO0 P;  3DLE B;  4LF8 F;  4ZLJ A;  4IH6 A;  4CI0 B;  4PAB A;  3R5J B;  1Z4U A;  3D6T B;  2C2R A;  1RTH B;  3IFE A;  4ANC A;  2J7K A;  4U7U K;  2HFN A;  1XQI A;  4HLB A;  2V9W A;  4P2M A;  1T8E A;  1UWB B;  2DRD A;  3BPS P;  3MOZ A;  2FY8 A;  2CRL A;  2YKM B;  2YKM A;  1SL0 A;  2OH2 A;  2PGC A;  1K73 T;  1U0S A;  3NP5 A;  3I4P A;  2Q3P A;  2DO0 A;  5B0D A;  4DV4 J;  1TKD A;  3SV3 A;  1C0U A;  1NXI A;  1UFL A;  3DM2 A;  4AT1 B;  4EO6 A;  2OPP A;  2JLE A;  5BR8 J;  4ZCK A;  4DPU A;  4L73 A;  3CCS S;  1OO0 B;  1L3S A;  2JWN A;  1HBM A;  1NCL A;  2VU5 A;  3OPK A;  3KHL A;  4ZKA A;  3EXC X;  2XMA A;  2KT2 A;  3BGR B;  3RZA A;  3ZNJ 1;  3VAI A;  2KFZ A;  4PG8 A;  1MG7 A;  4A8X A;  3GV5 B;  4F26 A;  3R8Y A;  4P52 A;  2Y9H A;  1NND A;  1I6J A;  2JLF A;  3AA8 A;  4ECW A;  1ITP A;  2B43 A;  2QN6 B;  1RT7 A;  2FHK A;  2J8S A;  3L7P A;  1KP6 A;  3QQC D;  1X5T A;  1V5I B;  2CVI A;  3TQ1 A;  3GCX P;  3QIP A;  2AYG A;  1HYS B;  4B3O A;  4KQZ A;  2D9O A;  4WE1 A;  1VMB A;  2KM8 B;  2HNZ A;  4OHX A;  2W8L A;  2QA4 G;  1IBM J;  1GX5 A;  4FF2 A;  2MXY A;  4NYO A;  2K7J A;  1J5E F;  1FER A;  3TW0 A;  1SH3 A;  4ILM A;  1NPP A;  1CUL B;  3RBX A;  4DV6 J;  1UVL A;  2K06 A;  2W9C B;  2HIY A;  3HXM A;  2HEK A;  2ZH4 A;  1SJ4 P;  1S10 A;  1FKA F;  1Y3K A;  5E2Q A;  3CJS A;  3KMS A;  2APO A;  2WVF A;  1NU4 A;  4UF4 A;  2DPJ A;  1RWU A;  2COL A;  3GFX A;  1Y0H A;  3PJX A;  2QA4 S;  3BSO A;  4DN9 A;  4DL4 A;  4DZD A;  1HBN A;  1HI1 A;  4ZVQ B;  4OZL A;  3W61 A;  2H3E B;  5RUB A;  3CNQ P;  4TY8 A;  1IM4 A;  2XCA A;  3H5X A;  5KG6 A;  1NH8 A;  5LJ5 Y;  2CQ4 A;  2VG5 A;  4MH8 A;  3BBF A;  3E2E A;  3T1H F;  4WF9 Q;  4CLZ A;  3AOB A;  4DV2 J;  1APS A;  1X5P A;  4DR5 J;  1IBM F;  1U24 A;  3DC2 A;  4ALZ A;  3ZZT A;  2LQJ A;  3PVX A;  2J0W A;  4F4Y A;  2OFG X;  2LQ8 A;  2VL1 A;  1DFD A;  1D0E A;  1OMS A;  1TZ0 A;  4U8V A;  4ES1 A;  3TX8 A;  2AEJ A;  5EDW A;  5C5J A;  1Q79 A;  1FE4 A;  2A6M A;  4JI8 J;  2QX0 A;  1BWV A;  1FRJ A;  3EMT A;  5G0R B;  4I1T A;  4Y3C A;  2EFG A;  1NK9 A;  2GJI A;  4IRK A;  3I9Z A;  2BXJ A;  2GFF A;  2Z2Y B;  2AJ4 A;  5C25 B;  6AT1 B;  3V6H A;  2DIV A;  5L1I A;  2VOO A;  4LF6 F;  1RAO A;  5B0B A;  3QSY B;  5HMX A;  3MI7 X;  1RGV A;  3IR5 B;  4DG1 A;  4KR0 B;  5HQM A;  2EG1 A;  1UL3 A;  4GMK A;  4PG6 A;  4YY3 F;  4LF7 F;  1N32 F;  2OD4 A;  4M5L A;  2HWH A;  3CT9 A;  2CJA A;  1YZ7 A;  5E3R A;  4G1Q B;  4AXI A;  4OV6 A;  3M1V A;  1REV A;  2ABY A;  4L3N A;  2DNN A;  3FFI B;  1U02 A;  4DV0 J;  5JUM A;  2H4Y B;  1GXT A;  2JX2 A;  2OI2 A;  3I5A A;  5F8H A;  2QA2 A;  3HHE A;  5C2C A;  4U8Y A;  3KDO A;  5CYQ A;  1H7X A;  4DCJ B;  1UVN A;  2HHV A;  1S72 S;  1VQL S;  1UZD A;  3WQP A;  4LJM A;  1U1K A;  4DV2 F;  3BO4 A;  1NME B;  3OR2 A;  2G2Z A;  1C1B A;  4TYB A;  4CDI A;  2DK2 A;  1O5J A;  1M5S A;  1OY6 A;  4K4T A;  2JEJ A;  3PFO A;  2AGP A;  3BV8 A;  3R7B B;  1LK7 A;  5ETQ A;  3QLH B;  5J2Q A;  2E5L F;  2P6S A;  2DNZ A;  3FBC A;  5IC6 B;  4DWI A;  1AYE A;  1RLC L;  4NI2 A;  4NLU A;  1LV5 A;  2ZJQ Q;  2IA0 A;  2P8I A;  3DXS X;  3QMQ A;  1JKH B;  4CM0 A;  2WB4 A;  3QT8 A;  4ID5 A;  7FD1 A;  3ILJ A;  3ZFV A;  1HR0 F;  2I2Y A;  3KNG A;  1I51 B;  3D1H A;  3DRR B;  4KBI A;  3OVS A;  4JYA J;  2WOM B;  2UUA J;  4DUT A;  4QYZ J;  1FFW B;  4DS4 A;  1PJ5 A;  1J27 A;  3UWT A;  4X62 F;  4PWU A;  2UU9 J;  4F02 A;  3NCP A;  2I6W A;  1H73 A;  2BJ7 A;  3K17 A;  5KFQ A;  1YBA A;  1S5Z A;  4DQS A;  5CYJ A;  4WJB A;  2HWT A;  2ZUA A;  4Y2C A;  5ETK A;  5F41 A;  4EGL A;  4DHV A;  1QLN A;  2MKS A;  3NS7 B;  2A18 A;  4U67 Q;  3CPW R;  2MY7 A;  4J9U E;  5LL6 d;  3NCR A;  4NOH A;  4C7Q A;  1LWX A;  4F36 A;  1QSL A;  2B56 A;  1CSJ A;  4AYB D;  1IR2 A;  4RKU C;  3SDE B;  3GTY X;  3TUI C;  4ES2 A;  1N5Y B;  2KFN A;  2M7S A;  3BM7 A;  1R43 A;  2J9C A;  3DGP B;  2FJB B;  5DDQ C;  2XS7 A;  1L3V A;  5KFS A;  3HFK A;  4M1K A;  2RQM A;  5KFU A;  2VJV A;  3NNA A;  3QPI A;  3DHW C;  3V4M A;  4IO9 Q;  2Y1J A;  3ZTR A;  1WHX A;  4Q8E A;  2FTR A;  4I2Q B;  4JB8 B;  4WTO B;  4WWS A;  4RUB A;  1DTQ A;  1FKO A;  3KK3 B;  2W4D A;  4O3O A;  4QIV A;  2OPS B;  3BKT A;  3OQ2 A;  5GAH I;  2GIR A;  3HO1 A;  2C1E B;  1MN9 A;  2BAB A;  2LXU A;  2CZ4 A;  3AB4 B;  3KG1 A;  2HK3 A;  3FMW A;  1BUX A;  2W9B A;  1IUJ A;  1X9S A;  1T05 A;  2XYH B;  3ET6 A;  2OMO A;  4L74 A;  2LXI A;  1NK5 A;  4CO5 A;  3UVJ B;  4UY8 T;  1H74 A;  2XS2 A;  2CPX A;  1F6T A;  4ZHR A;  1WI6 A;  4LIW A;  4EO8 A;  1DY3 A;  4HHJ A;  5CH7 B;  2YX1 A;  2WHO A;  3QT5 A;  1GT8 A;  1VK8 A;  3OR1 A;  4ZCI A;  3ZTQ A;  1YJU A;  1RKJ A;  1PO6 A;  2D9P A;  3JSR A;  2DY1 A;  1S76 D;  1G1X A;  4LUB A;  1RZM A;  2N3L A;  2YWW A;  3MAA A;  4C6A A;  3C15 A;  4P9S A;  5F8N A;  2B9X A;  1JJH A;  2RS8 A;  3ZTP A;  1NRK A;  2YTC A;  3DLL Q;  3K8W A;  1HBO B;  1MMN A;  2H5I B;  2ZVI A;  4OJ3 A;  4OYZ A;  4ECV A;  2HNY B;  3H90 A;  4FPR A;  3W9J A;  2Y1L B;  2ZH6 A;  4OLO A;  1O51 A;  2Z2Z A;  2O5D A;  1FDD A;  2QG9 B;  3HHL D;  3DLK B;  3R3T A;  2UV8 G;  2ZH5 A;  3BR8 A;  1VJW A;  3J81 j;  5DDO C;  1WNE A;  2C3M A;  2VA3 A;  2CG4 A;  2HND B;  2QMU B;  2BJD A;  3MMC A;  5CCL A;  2XWY A;  3OVB A;  4ATN A;  2F40 A;  1F5A A;  2E5J A;  3CTR A;  5K8M A;  3NGR A;  2PI5 A;  1SC1 B;  4DR1 F;  3PKM A;  2XMT A;  1DTT B;  3KJN B;  1AUD A;  5EN1 A;  1KTQ A;  3H5S A;  2R9L A;  2OEL A;  3AQO A;  2IM0 A;  4JI1 J;  3G82 B;  2L9D A;  3CD5 A;  3UN3 A;  3EM1 A;  3RR8 A;  2E9Z A;  1ZPV A;  4LQ9 A;  4K0K F;  2EPI A;  3TI0 A;  4A48 A;  5ITH A;  3MPY A;  1R8C A;  4NXN J;  4ZS6 A;  2OUG A;  3HT0 A;  1N0U A;  4M5G A;  4DL3 A;  4X4S A;  1DAR A;  2UVU A;  2D74 B;  1U45 A;  1GTH A;  3FSY A;  4IG3 A;  5LMN J;  2FHJ A;  2YNH B;  5HSP A;  5GAH U;  1O6X A;  2I9S A;  1LOU A;  4KIA A;  2R7Q A;  3QO9 B;  4O44 A;  1B7F A;  4UT4 A;  3M8W A;  3EIC A;  3QWU A;  3RB0 A;  4CNY A;  2Z57 B;  3FJ2 A;  2V2V A;  2CPH A;  1R6Y A;  4UOC A;  3MMA B;  2FLP A;  4ZVT B;  2NUU G;  3H42 A;  5FLX Y;  1FRH A;  2OML A;  3GR0 A;  2A0F B;  2LU2 A;  2ASD A;  1QTN B;  1VQ6 S;  5D4L A;  3UN5 A;  4X65 F;  2BAN B;  1X31 C;  2NSC A;  1RWX B;  4QIE A;  4MKA A;  3DFE A;  2DH9 A;  3Q2T C;  5F9L A;  2HS4 A;  2FIU A;  2W2Q P;  4YEA A;  3TAR A;  2A2D A;  2ZC3 A;  3N01 A;  5C7P A;  1FEH A;  1KVK A;  1XR6 A;  1GFW B;  4I7F A;  3PY8 A;  3AA9 A;  4QWE A;  4G6V B;  4QU6 A;  2ZJR Q;  2IAJ A;  4ZOS A;  2GAG C;  4MYU A;  3VZI A;  5A8W A;  3V6K A;  4TLR A;  4AFF A;  4DX8 H;  1PAE X;  2RT3 A;  4ZVH A;  1M90 T;  4L75 A;  4C11 A;  5H9E J;  3T6B A;  3CCW A;  4X2B A;  1C4A A;  4KKO B;  2NLW A;  1ZET A;  2J9E A;  3LP1 A;  2HBQ B;  4LVN P;  4RWW A;  2DKO B;  1VBY A;  4PG5 A;  3Q22 A;  1FNM A;  1R31 A;  2DGS A;  2YKO A;  5K5M A;  2HQI A;  3KLG B;  3C15 B;  1UWA A;  3MGJ A;  2IRY A;  3OSN A;  2R2T A;  1ZTT A;  4K50 A;  2ALY B;  1UPP A;  2YNI A;  2YKA A;  3GCW P;  4E2F B;  1SC4 B;  4IFV A;  2IJF A;  2J7W A;  3FEY B;  4YDD B;  1PG5 B;  2HKE A;  4N56 A;  3FQK A;  2PO4 A;  1XMO F;  3NMR A;  4IOA Q;  2RD5 C;  2CA9 A;  2UU9 F;  4TY9 A;  1WEY A;  3F41 A;  2DNP A;  1R8P A;  3MM5 A;  3SFU A;  3OR1 B;  5JVH Q;  1QTM A;  4NZ7 A;  1HWU A;  2DB1 A;  2GVD B;  4RW9 B;  3UO0 A;  4A8Q A;  2Y0S D;  1WTF A;  3EJM A;  3UW1 A;  5CHC B;  2GA7 A;  2FZC B;  2M70 A;  3SI8 A;  1TVR B;  3OSP A;  2QL7 B;  1FRL A;  2IYG A;  1TKT A;  2ZOG A;  5EWE A;  2C28 A;  1LXN A;  2RSQ A;  1EP4 B;  2CUY A;  4IO1 A;  2MKI A;  2GVZ A;  2V8D A;  3VR1 A;  1DZ5 A;  1LWF B;  1HI8 A;  2MLX A;  1JLG A;  1JK9 B;  2PMZ D;  3K7R A;  4KSE B;  4AL7 A;  1X5S A;  3ETO A;  3ZC4 A;  4A8Y A;  2XLK A;  1VGY A;  2CJX B;  1VDH A;  2DCL A;  4TYA A;  3MMC B;  4DL7 A;  3WIV A;  1U2R A;  1PC5 A;  2QSW A;  5IOL A;  3PZP A;  5E41 A;  4ECZ A;  4J9P A;  4FF1 A;  4ICL A;  1JLA B;  4NLG A;  1S7I A;  5DM6 Q;  4CP5 A;  1S4E A;  4KV8 B;  3M9O B;  3V5R A;  4RW4 B;  3V2U C;  4D3H A;  5HN0 A;  3QFH A;  4QIW D;  2FQQ B;  4WFX A;  4Y2I A;  4IG0 B;  4DFM A;  2MDA A;  1TK5 A;  4MYT A;  1YTY A;  4OZ2 A;  4WII A;  2BDP A;  2XMM A;  2HQF A;  1NBE B;  4N47 A;  4FZV A;  4RL1 A;  5A6W A;  4IFY B;  4DUY J;  4B3M J;  2V63 A;  2V8G A;  2F5G A;  3BS9 A;  5HQ8 A;  3EGN A;  3CCV S;  4GVL A;  5D3G A;  3CJQ A;  2YWH A;  2XI3 A;  1RAI B;  2DNH A;  3E51 A;  1TKZ A;  2POK A;  5CYQ B;  5EHH A;  1RHQ B;  1T95 A;  5GAG U;  3TA2 A;  2GHW A;  3JTP A;  3OR2 B;  4IR1 A;  3PRV A;  1KHV A;  1HBN B;  3AXK A;  4V19 X;  4RO0 A;  1S1V B;  2ACY A;  1TVR A;  3BZQ A;  3D6H B;  1T7P A;  1LWC B;  2UUA F;  2YNF A;  8RUC A;  4DSL A;  1Q7L B;  3IWX A;  1P9Y A;  3LGM A;  4ZPT R;  4ENO A;  4ZIV A;  1Q8K A;  2AX0 A;  3EGW B;  2PDA A;  1WTB A;  2DR5 A;  1WF2 A;  2CPZ A;  3H59 A;  1SB6 A;  4TKT A;  1A9N B;  2DR8 A;  5CYM A;  3T1H J;  4DG1 B;  1LKZ A;  2ZM6 F;  2M9K A;  5HMZ A;  2YNG B;  4P6Q A;  1P1L A;  2F7V A;  2WZ1 A;  4OYO A;  3HT3 A;  1U1P A;  3EVO A;  3QZ8 A;  4C8L A;  3LA0 A;  2WB1 D;  2YPY A;  5J1E B;  4KH1 B;  4X62 J;  4EZ9 A;  3PX0 A;  2CQ0 A;  2V5H G;  3X1L B;  2KKH A;  1RT7 B;  2YXL A;  3CWJ A;  4JI0 F;  4F8R A;  2KJW A;  3DLG A;  3QGP A;  4QWA A;  4O3S A;  3GJT B;  3H0P A;  3IC1 A;  1EKS A;  1NHU A;  4ETX A;  3LWL A;  1N4L A;  4NA1 A;  1CJT B;  1GNK A;  2XLJ A;  1WDT A;  3A3O B;  4ECY A;  5LMU J;  2G0I A;  5HLF B;  1VIS A;  3OTD A;  5HO4 A;  1KLM B;  5DRK A;  1TKX A;  3BDP A;  4IRD A;  4WFA Q;  3FZ2 A;  4OZJ A;  5IZH A;  4BCA A;  5CAA A;  4KPC A;  4ED4 A;  2HZA A;  3TEH B;  4HT5 A;  1T3N A;  3K5P A;  2C2Z B;  1VYA A;  2EG2 A;  3V4I B;  3HK2 A;  5KFI A;  2CPE A;  2B8P A;  1F5C A;  3OHB A;  1ZS6 A;  4PUO A;  1WC0 A;  3RG6 A;  4ED3 A;  2Q66 A;  4B02 A;  1H98 A;  2AD9 A;  3V6J A;  1JLQ B;  3ISN C;  3EWG A;  4UTG A;  2MZ1 A;  4N8O A;  3BR9 A;  1V3Z A;  3JS9 A;  2B51 A;  4DEZ A;  4YME A;  1IKV A;  3T5H A;  3KWM A;  5L1L A;  1K0V A;  3P6Y C;  2BE2 A;  1N88 A;  2PEH A;  2E29 A;  3NWR A;  1TTH B;  4CLF A;  4X4T A;  4ERD A;  3T1A A;  1HW8 A;  2HS3 A;  3KJQ B;  2R4F A;  1XK8 A;  1TV6 A;  1FXD A;  2RUG A;  1NDP A;  5F0U A;  2FB0 A;  2XMW A;  5IM0 A;  1S0M A;  2CJK A;  1PSD A;  3R2D J;  3VAH A;  2CPD A;  3FCW A;  4IG3 B;  4OX7 A;  2F4V F;  2QIF A;  3J7A N;  4J5O A;  3TJA A;  3BSC A;  1BE4 A;  2B5J B;  2FJA B;  3IBC B;  2RH3 A;  3DOL B;  2BW2 A;  3LP2 B;  3O2I A;  4M5D A;  4O0I A;  1X8D A;  2NYI A;  3D7S B;  4HDG A;  1HNZ J;  3OTO F;  2E1R A;  2X3D A;  3KLH B;  3K5L A;  3FFI A;  4B9T A;  1HD1 A;  1S1V A;  2RIL A;  1BLU A;  3MUV P;  2R7T A;  3KDN A;  2PII A;  4W90 B;  2NRE A;  1QSS A;  3PR5 B;  3QJJ A;  1X4F A;  2DVI A;  1FD8 A;  4CT9 A;  2L9N A;  5KFJ A;  2HLT A;  2O01 C;  1D8Z A;  4ZVR B;  3Q8Y A;  2DGT A;  5GAE I;  4U7C A;  4BC9 A;  2QLJ B;  2BA9 A;  4F25 A;  3MR7 A;  2XO6 A;  2V2Q A;  4AE5 A;  1XMO J;  2AYB A;  5FDL A;  2Q43 A;  4L72 B;  1J5E J;  1IVZ A;  2OPP B;  4OHY A;  3G4S S;  2XY6 A;  4I7F B;  4OI6 A;  1EP4 A;  4RBV A;  2HGL A;  4RW8 B;  4ZVO B;  3UDE A;  4C3M A;  3I56 S;  2BQR A;  1NKE A;  1FDN A;  1IKW A;  4E0D A;  3A8K A;  2DH7 A;  3KLF B;  4NA2 A;  4OX8 A;  3EDQ B;  4X4P A;  3ZTS A;  3KJV A;  4RLE A;  4FBU A;  3EZU A;  4FPI A;  4J7C A;  3S01 A;  4TU7 A;  1BQN A;  2B7B B;  4HH1 A;  4B9U A;  5J2N A;  2I0X A;  2RQK A;  1EET A;  1QE1 A;  1C1C A;  3ILI A;  4OZ3 A;  5C42 B;  2H54 B;  2IJN A;  3G71 S;  3V81 A;  4DQI A;  2OIH A;  3RRK A;  3W8P A;  3ZZP A;  1DBD A;  3IG1 A;  4U6P A;  4LFC J;  3HHL C;  1KBR A;  3G6Y A;  2HNZ B;  5D0G A;  1JXL A;  1M1K T;  2UUC J;  1WJ9 A;  1OWX A;  1Y7P A;  1PIE A;  3KLH A;  3CIZ A;  1JNZ B;  2MQP A;  3FNN A;  5ETT A;  4XIU A;  1S99 A;  4WFZ A;  1KQS R;  2BRL A;  2IBK A;  2KRB A;  2KT3 A;  2R7S A;  3R5G A;  4KGX B;  1WOO A;  2KG0 A;  4KRW A;  3Q86 A;  4URG A;  1FX4 A;  3FUY A;  4A47 A;  4RW9 A;  4R5P A;  3MR3 A;  2W7A A;  2ZZM A;  4FXV A;  2ZH2 A;  4F67 A;  2CJY B;  2XC9 A;  5GVQ A;  1TQL A;  1B3T A;  1KN6 A;  2LEC A;  4C8O A;  1MNE A;  2FHJ D;  3DYA A;  4I2P B;  4IKA A;  2RS2 A;  2RJZ A;  3HVT A;  3W7B A;  4KGK A;  3ZZR A;  1KQG B;  2VQF F;  2DHA A;  5KFA A;  4QPT A;  5DLF A;  1MSW D;  1I94 F;  2PI4 A;  2QA1 A;  3LP0 B;  1Q8I A;  1FTC A;  2YQ3 A;  5HBM A;  3MPU B;  4FXW A;  4KC5 A;  2CFX A;  2NUH A;  4ID8 A;  3KJV B;  5KG3 A;  3PM9 A;  2F8E X;  2EFO A;  3HKW A;  5GAE U;  1AXQ A;  4CLT A;  5F9N A;  2DNY A;  1TUV A;  3LP1 B;  2XBP A;  1U7L A;  3K8V A;  4JV1 A;  1NZ8 A;  2ROP A;  3O3L A;  2G0C A;  4F0M A;  4I2Q A;  1WKJ A;  2C2K B;  3OXG A;  3P3D A;  5IWA J;  4DS5 A;  2HYI B;  3ISN D;  1OPZ A;  1VQ9 S;  4YHH J;  4F3Q A;  3IG1 B;  2MQL A;  2BV3 A;  1LWE A;  2P9E A;  1VHI A;  1S12 A;  1PKU A;  3IR7 B;  1FJC A;  1KQK A;  1YX2 A;  3HHL B;  4C97 A;  3V6D B;  1SUQ A;  1U1Q A;  4GO7 X;  2M52 A;  2DR9 A;  3TAN A;  1ROF A;  3UVJ A;  5FDL B;  5HJY A;  3L09 A;  2N4C A;  1BC6 A;  1HIY A;  4W98 A;  3W9H A;  3ZZY A;  3FZB A;  3D6F B;  3W9I A;  1TU0 B;  5HVH A;  3TYT A;  1XMQ J;  1M0S A;  2L9W A;  4FNH A;  3DOK A;  4WZQ A;  3MMA A;  3D68 A;  1K9M T;  2BKP A;  4CT8 A;  4CLW A;  3CC2 S;  4CYU A;  4JI5 J;  3G6X A;  3PEH A;  3KK3 A;  3NMA A;  2KG1 A;  2OPQ A;  4YY3 J;  1MU2 A;  2EK1 A;  5L1J A;  1G2E A;  4Z37 A;  3H20 A;  2KM8 C;  4HAC A;  3KYL A;  2DGO A;  1UVJ A;  4MKB A;  6FDR A;  5DQH A;  4P73 A;  3M30 A;  2E1P A;  4DR2 F;  3BPD A;  3VAG A;  4J9K A;  2M8H A;  2WTF A;  1TMM A;  1Y5L B;  1EJ7 L;  4CRJ A;  2Z58 B;  4GC7 A;  2MLZ A;  1NJY A;  3CCJ S;  4N8N A;  4YQW A;  3MEE A;  4HEA 9;  4FVM A;  4NA3 A;  2K2P A;  1HQE A;  3CGI A;  3IM8 A;  4MFB A;  1U6B A;  2V8V A;  4B3R F;  1JIH A;  1Q78 A;  2ZBR A;  3K2Y A;  4DR7 J;  2NZ4 A;  2UZA A;  4I69 A;  2MKH A;  3HVW A;  2WOM A;  4Q2L A;  2CVE A;  2MY8 A;  1UP1 A;  2VPY B;  3JB9 k;  3W8G A;  3VAJ A;  1Q16 B;  2FLO A;  2GIQ A;  2JDJ A;  4RU9 A;  5A2Q Y;  4RZR A;  3SSQ A;  3RBE A;  1RTI B;  2XY7 A;  5H1S V;  3DLB A;  1P1T A;  1SKU B;  3PEJ A;  4CO2 A;  2ZE2 B;  3OW2 R;  4IUF A;  3D3B J;  3JQJ A;  1DLO A;  3P45 B;  5DG8 A;  3L9Z A;  1NUE A;  1WEX A;  2DIT A;  3HVA A;  4AQY J;  2MKC A;  2G0J A;  1QUV A;  1NPR A;  4OFZ A;  1RDR A;  1EZZ B;  4H4O B;  1DUR A;  4AXJ A;  4LF1 A;  1LW2 B;  4LRA A;  2VF3 A;  2Q6B A;  1R0A A;  3CUN A;  4IYQ A;  4JI7 F;  3ZZZ A;  4CWB A;  1U09 A;  2HQD A;  2X3G A;  2R8K A;  2KVI A;  1LWF A;  3GLJ A;  2MZR A;  2WON A;  3T9N A;  2AZ3 A;  3LAK A;  3WHI A;  1L5U A;  2J6S A;  1KVJ A;  4GKJ J;  5AJ3 F;  3FMB A;  4YUD A;  3IRW P;  3FSI A;  5F8L A;  5D6G A;  4MJK A;  3J80 Y;  1FCA A;  1NHV A;  2DHS A;  1N8R T;  4YB1 P;  2IY5 B;  5KFP A;  4JI6 F;  5DO2 A;  5KFD A;  4NLX A;  2OPR B;  1S9G B;  2KHC A;  2AEM A;  2JEF A;  2Y8W A;  3OLA A;  5T41 A;  2PEB A;  1IR1 A;  4UY8 5;  1OY9 A;  2EEY A;  1ZM4 A;  3I6P A;  3WDO A;  4Q5V A;  1T9T A;  4FS2 A;  1U1O A;  2M8D B;  3SZ2 A;  1K1Q A;  5C25 A;  2EKN A;  1VC0 A;  1T3O A;  1IJF B;  2ASJ A;  2X51 A;  3QAU A;  4UUW A;  3C3L A;  1AZS A;  2LMI A;  5MAO A;  4PEO A;  3W2W B;  3SCK E;  1UVI A;  3J7Y U;  3QJL A;  3P8B B;  1LWC A;  2O3D A;  2JJ4 D;  4OMF G;  4CZC A;  4DR6 F;  3EGZ A;  5KG2 A;  1SQG A;  2E9R X;  3SSR A;  2VKZ G;  1NH7 A;  3ENV A;  3I32 A;  2XB2 D;  3VQT A;  4XAK A;  1X4A A;  2QT7 A;  3B4D A;  5HRO B;  2VC0 A;  4DV0 F;  4PUO B;  1XIQ A;  1N36 F;  2E7V A;  3VF0 B;  2E5I A;  1S9F A;  5C24 B;  2LDI A;  1Q0N A;  1KQF B;  2HHP A;  2YQ1 A;  3FKB A;  2RNE A;  4IOB A;  4PQA A;  4C8Y A;  3PRD A;  4KHM A;  1TL7 A;  4RNF A;  4JI3 F;  5CD4 A;  1SL2 A;  1JXE A;  3KOA A;  1JLE A;  2R2R A;  2GGP A;  2PC6 A;  4TQR A;  4FDF A;  2UUB F;  4B3S F;  2FHO B;  5DM7 Q;  5KG5 A;  1MRO B;  4WP8 A;  4YB6 A;  2FZK B;  3W63 A;  3LWM A;  3PHT A;  4O4G B;  4AUK A;  1T03 A;  2J9D E;  3MAH A;  4DCO B;  3FVY A;  2ZD1 A;  3O8W A;  4ZN3 A;  4YR3 A;  4LR9 A;  1U8S A;  1RU1 A;  3FBB A;  1FT8 A;  3M1V B;  4O3N A;  1S77 D;  4QBU A;  1HNV A;  3OFF A;  1HWJ A;  4DL6 A;  4GRS A;  3UCU P;  4USI A;  3OBI A;  1DRZ A;  3W64 A;  2DEI A;  2DXF A;  2OEM A;  1WHY A;  4H4O A;  2HLU A;  1Z2Z A;  3MM7 B;  3PX4 A;  5I42 A;  4OI1 A;  2DHX A;  1KOH A;  1D9D A;  3HPO A;  3N28 A;  1DHM A;  2YBV A;  4EMD A;  3Q0A A;  4GKJ F;  3NGD A;  1D3W A;  1VBZ A;  1JJ2 R;  4RNH A;  2X1A A;  1YJN S;  3BGR A;  2MKJ A;  1CVJ A;  1C0T B;  2P6T A;  2EBE A;  3AD8 C;  1DQ9 A;  5D77 A;  2WSC C;  3VGV A;  3WX8 A;  4ETZ A;  1ELO A;  1WKK A;  2IMO A;  5ETN A;  4K7Q A;  2DH8 A;  2OPQ B;  2BJ8 A;  3A3P B;  3EPI A;  4QIG A;  5HAN A;  2F1F A;  4NL5 A;  1NK0 A;  1TFY A;  3VAL A;  5GAD U;  4ZVU B;  5L9N A;  1CLF A;  5A0Y B;  4YDX A;  3BRE A;  3E3X A;  4ZVP B;  1Q1K A;  1RBA A;  1B0V A;  2B9E A;  3SCL E;  4EYH B;  4LFB F;  3N6M A;  2GHP A;  3JSB A;  2GQ2 A;  4LF7 J;  5E3P A;  3PKY A;  1FXR A;  1VOM A;  4K2X A;  2MB0 B;  1HL6 A;  3HI9 A;  3C16 B;  4C3L A;  3R5A A;  4DR2 J;  4JI4 F;  1SKR A;  4ELU A;  4OZN A;  1SH0 A;  4RUA A;  1Q7Y T;  2HG4 A;  2Z2L A;  1NM2 A;  1EET B;  1QE1 B;  3DGV A;  1TEL A;  2B8Q A;  3G87 A;  2QFJ A;  4J9S A;  4FF4 A;  4FF3 A;  1RT4 A;  1KS2 A;  3UR0 A;  1R89 A;  2B3T B;  1ZM9 A;  1FVS A;  2U2F A;  3R5C A;  2IVF B;  1RHU B;  4A46 A;  5HVG A;  5IV4 A;  4K4U A;  1VRQ C;  2E1A A;  1ZTW A;  3SBM A;  1NDK A;  3I4H X;  1YRT A;  2CPY A;  3TVK A;  5EWG A;  4YFU A;  1A0O B;  3OLB A;  2ZH9 A;  3GMG A;  3I5B A;  3KFW X;  2AYE A;  2HAF A;  4EZ6 A;  3M8Y A;  2CIM A;  4O3P A;  4LF4 F;  4G3I A;  1Q82 T;  4USJ C;  1SC6 A;  2YX4 A;  1N5S A;  1Q95 G;  3N5B A;  5M2P A;  2O66 A;  1C1C B;  5DLG A;  4CCH A;  2VG7 A;  2VG7 B;  3L3C A;  2V0N A;  1JLC A;  3FQL A;  3G2X A;  3GR1 A;  3SIP B;  2VV5 A;  1YDL A;  2QGF B;  2YWF A;  3ENW A;  4CTA B;  4DU7 A;  1PYS B;  9ATC B;  2BVZ A;  2AQ4 A;  2DR7 A;  4N41 A;  3GSD A;  1U4B A;  2JEI A;  4HI2 A;  1ZBT A;  2AMC B;  5AT1 B;  4NX9 A;  2FJD B;  1CJV B;  5DGA A;  3M9N B;  3C16 A;  2B5J A;  1WWH A;  3TZW A;  1X4G A;  5I42 B;  1MWY A;  1P6T A;  2ZOF A;  3NY0 A;  1YJR A;  2VDI A;  2ZBI A;  1U1L A;  1F60 B;  2EFP A;  2J0Q D;  4Y65 A;  4XO0 A;  3TUJ C;  3C6U A;  3JSY A;  2KI2 A;  1WC1 A;  4KT0 C;  4WXO A;  2E5L J;  1XNQ J;  1RIS A;  1ULR A;  2XHC A;  1WHW A;  1IBL F;  1NJI T;  3G8S A;  3QO9 A;  4O44 B;  2OGU A;  4KTQ A;  4IQX A;  4X4N A;  5SZT A;  3OTO J;  3CDE A;  1WF0 A;  4NCB A;  1S0V A;  1IBK F;  2KZM A;  5KG7 A;  2D3O 1;  4I6Y A;  3AD7 C;  3RU0 A;  3RBZ A;  2CXE A;  5CAB A;  4ZVF A;  8ATC B;  4DF8 A;  4Y34 A;  3S8S A;  2RHS B;  3MM7 A;  1JLF A;  4LSL A;  3T5K A;  4DSK A;  1IKW B;  3OL7 A;  4WCE Q;  2O67 A;  3P5B P;  1HNX F;  2CPJ A;  3OTE A;  1KC8 T;  5KAK A;  1RT1 B;  5IS2 A;  2LFV A;  3R7S B;  4DUZ F;  4CLP A;  3HVT B;  4HR2 A;  3DKD A;  5L38 A;  1T9Y A;  3MMB A;  1VC5 A;  2BQ3 A;  2HRU A;  3T3F A;  1H72 C;  1J5O B;  2R8G A;  2CNL B;  5B0C A;  2HBR B;  1OS5 A;  2G2Y A;  2HPU A;  5CYM B;  3R7N B;  1RWM B;  2XQC A;  2QLB B;  3PW0 A;  4DSI A;  4DV5 J;  2IC3 A;  1T9W A;  1VRU A;  4LF9 F;  1RAC B;  1WEZ A;  1WKL A;  3Q8U A;  4KO0 B;  1S1X B;  4UW2 A;  3W1Y C;  2PN6 A;  4ZHR B;  1KSP A;  2EBG A;  1RAF B;  3J7A 1;  2GO9 A;  1VCT A;  5J1N A;  1C4C A;  1W26 A;  1CJU B;  1VQP S;  4M8L A;  5A2Q U;  4UOG A;  3TWZ A;  1Q8L A;  1VJQ A;  4CO0 A;  1KWM A;  4DI6 A;  1V3S A;  1LK5 A;  5HMY A;  4RBU A;  2ZZN A;  3DLJ A;  2GIF A;  1WSR A;  1WDD A;  3D0H E;  3GIL A;  3O44 A;  3CCU S;  2EC0 A;  4HT7 A;  4JI6 J;  1RT3 A;  1WG4 A;  4Y6I A;  2N4D A;  2AJ0 A;  7AT1 B;  5HLF A;  4UQG A;  2C42 A;  3H4B A;  3QRP A;  2AU0 A;  1XER A;  2BYC A;  4AD6 A;  4BBY A;  2QL9 B;  1RAB B;  3A8E A;  2C2O B;  2FVC A;  4DR3 F;  3GB0 A;  4V1A k;  4QQB A;  2G4B A;  2CQ1 A;  5B0A A;  1HWK A;  2BRK A;  2AGO A;  2R3V A;  4HDH A;  1F9F A;  4XK8 C;  1N5T A;  2FC8 A;  4GO5 X;  5KFB A;  4H4K A;  3W2V B;  2ZHB A;  1AFJ A;  2IBO A;  5KFZ A;  3VAF A;  3MEC B;  3FDS A;  1FX2 A;  4JYA F;  4HHU A;  4RWX A;  4DLE A;  3LH2 S;  3PW7 A;  2CQ2 A;  2IHR 1;  1RT5 B;  5IWA F;  3B6B A;  2CZ9 A;  4DV5 F;  4LF9 J;  2C22 A;  1HD0 A;  1JJ4 A;  5CXT A;  4RNN A;  1SCJ B;  4F3M A;  3K58 A;  2WK4 A;  4YR0 A;  3Q89 A;  3BJY A;  4FVC A;  2BJE A;  3KTQ A;  1Y3J A;  4RW7 B;  3KUE A;  4OI3 A;  4RW7 A;  3U1N A;  4ED7 A;  1YJ7 A;  4LF5 F;  1N36 J;  3I82 A;  2OHD A;  3KG4 A;  2JSX A;  2FPH X;  3C2P A;  1IKX B;  4KH0 B;  5F3Z A;  1LFP A;  2JVO A;  3N6N A;  5HJX A;  1J2V A;  1H7W A;  1WHV A;  3L7U A;  2X1F A;  3H4D A;  1S1U B;  1YQH A;  3B54 A;  1CQM A;  2KJV A;  4NEY A;  4J9N A;  2AYM A;  4TY8 B;  2ALZ A;  1T94 A;  4PYD A;  3DU5 A;  2UUT A;  1U47 A;  2LQB A;  2LEB A;  3DGP A;  1JLB B;  2V4J A;  2G1D A;  5LXR A;  3OT9 A;  4DDF A;  2OPR A;  3BEG B;  4HL9 A;  4DQQ A;  1R6V A;  5HRO A;  4HAC B;  1NDL A;  4IH5 A;  1XMQ F;  2NS1 B;  4ZPV R;  2F8M A;  2DCU B;  3CJT A;  1RU2 A;  3HKZ D;  2VG6 A;  3Q8V A;  1FRI A;  2ILZ A;  5CZV A;  3NS6 A;  4PXE A;  1RA6 A;  5KFH A;  5KT2 A;  3QLH A;  1PBA A;  1U1N A;  2ZWP A;  1EX8 A;  2OTJ S;  2D41 A;  4NRU A;  1VQO S;  3BF4 A;  3JYT A;  4ZDN A;  2AZ1 A;  2HMI B;  4PQU A;  4FYD A;  1NSA A;  2C2D A;  2NZC A;  1MWZ A;  1VHF A;  4U96 A;  1RAE B;  1XEZ A;  1XNR J;  4GKK J;  2I1R A;  3O6Q A;  1M5O C;  3ENQ A;  5KT5 A;  1S6U A;  5KG4 A;  2FD2 A;  1LW0 A;  2ZZT A;  3B4M A;  1R3N A;  5AXK A;  3UN2 A;  4E8U A;  4V19 J;  5L8R C;  3C19 A;  4HH0 A;  4Q44 A;  2EFN A;  3D66 A;  3MOJ B;  2KTQ A;  4ZCL A;  2AIR B;  3VAK A;  1P9Q C;  4WKR A;  1Y00 A;  4C0H A;  1ZA1 B;  2K1R A;  2H1Y A;  2WBR A;  2GCF A;  3MEG A;  1M5P C;  2DXD A;  2RIJ A;  2FLL A;  2PFD A;  2H48 B;  2HHX A;  1CEZ A;  2FVR A;  3I96 A;  4DLG A;  1UFW A;  3MM5 B;  2VQF J;  3J81 Y;  1QY7 A;  2CJ9 A;  2OLW A;  1LW2 A;  3PNI A;  5B08 A;  1BQM A;  2LCW A;  3MHY A;  4USU A;  5E3C A;  3N9U C;  1D8Y A;  1S4F A;  3PYF A;  3I55 S;  1NK4 A;  4DSJ A;  4ED8 A;  2UP1 A;  4FN5 A;  2LVW A;  1GK8 A;  4I4B A;  4H4M A;  1NHK L;  1AB8 A;  1TKT B;  1TFW A;  2HVD A;  4WZM A;  3IGN A;  2XGP A;  4ITS A;  2CKW A;  4Z2X A;  2JEG A;  1Q53 A;  4QYZ K;  3B82 A;  3DXB A;  4NLP A;  5LSO A;  2WSE C;  1RT2 A;  3AAW B;  3KUH A;  3RAX A;  2J6U A;  4ICL B;  2ZH7 A;  1RA7 A;  4XPC A;  2F63 A;  1HMV B;  2CQH A;  2MTL A;  1VQ8 S;  4RPF A;  1VLO A;  2RE1 A;  4BWJ A;  1CJK B;  3US5 A;  2XM3 A;  5GAD I;  3CCQ S;  4PWD B;  4ZCM A;  1FKP A;  4TXS A;  1HYS A;  1EAR A;  2RF2 B;  1QVF R;  2BOP A;  1RAH B;  4C0O C;  3CCR S;  5E3A A;  2GO8 A;  2F9D A;  4KJI A;  4WP3 A;  3BN7 A;  4IH7 A;  2K7K A;  2VUG A;  3HSZ A;  3NOC A;  2N7Y A;  3QT6 A;  1SV5 B;  2GMH A;  3H2L A;  4MTP A;  4F4A A;  1N52 B;  4C98 A;  3J81 U;  1S48 A;  3POT A;  4B9L A;  3MED B;  3IM9 A;  5A8R B;  3J7Z T;  3OVA A;  2W9A A;  3JSM A;  3GFY A;  4OQJ A;  3ITH B;  3MAA B;  4XDC A;  3CCE S;  3AB2 B;  3UD4 P;  1WD6 A;  2AJ1 A;  3GIM A;  4CQ1 A;  2FLN A;  4ANE A;  5KFN A;  1CC7 A;  1B64 A;  1U0H A;  3R1L A;  2QTW A;  1WUU A;  3QGG A;  4PPD A;  2VG5 B;  4NLW A;  2CJQ A;  1JQG A;  4EBE A;  2I38 A;  5DDR C;  2V34 A;  3DOK B;  1BWE A;  3U27 A;  1RT1 A;  2QSF A;  1ICE B;  1C0T A;  2CWX A;  1FK9 B;  1R8A A;  4GKK F;  2XGQ A;  2V2Z A;  4J37 A;  1T9U A;  3AXM A;  4LT6 A;  4J9Q A;  2W4P A;  1FHT A;  2V50 A;  2ZNZ A;  1M5H A;  3OL6 A;  3GPA A;  3EDR B;  2DYA A;  1HQU A;  3S7R A;  2H51 B;  3DNC A;  1NZA A;  3VGT A;  1VRU B;  2C2M B;  1HPZ A;  2DNG A;  2AJ2 A;  2IC3 B;  2IM2 A;  1JLC B;  2FVQ A;  1FKP B;  3N0V A;  3H5Y A;  4KHP J;  3IS9 A;  2EWH A;  5BJR A;  3IGV A;  1H2V Z;  4X4O A;  5ETM A;  3W5Y A;  3EYZ A;  2R2U A;  1FNO A;  2CDQ A;  3MCM A;  1U49 A;  1UAW A;  6FD1 A;  4ECQ A;  4RU2 A;  3KLE B;  2B7C B;  5KTQ A;  1MWQ A;  3C6U B;  5C42 A;  1HA1 A;  1ZA2 B;  3QAT A;  4PRF A;  4MMO A;  2ASL A;  3SXL A;  2E7W A;  1FRX A;  1IQT A;  2NXN A;  2YNI B;  3PW4 A;  3KLI A;  3P49 B;  2KB2 A;  1UW4 A;  1F9H A;  3LP2 A;  1C2P A;  3QWP A;  1FWL A;  5CQG A;  2RML A;  3TNV A;  5KOX A;  3PHE A;  5L1K A;  1SJR A;  1Q4R A;  3MTJ A;  1GX6 A;  2P9C A;  3OFH A;  1CQN A;  1UPM B;  2RAQ A;  1L3T A;  4DQP A;  2B4P A;  2RQ4 A;  1RTH A;  2HGM A;  2QMX A;  1HBO A;  3A12 A;  1WSV A;  2AF6 A;  3A8J A;  3HZG A;  3LQV A;  2DD8 S;  3BGF A;  3OTC A;  3NS5 A;  3R97 A;  2IPO B;  5KFY A;  2RRA A;  4F2R A;  1MML A;  2H9Z A;  4ZPD A;  3ZZU A;  3M2R A;  1FVQ A;  2K1R B;  1RT2 B;  4X4V A;  1VI7 A;  1HW9 A;  2GAH C;  2GZO A;  3VHQ A;  2XMV A;  5LSL A;  1CJK A;  2I5J A;  4PWD A;  1KNZ A;  2V8P A;  3M8P B;  2W4C A;  1TK8 A;  4B9S A;  2AP6 A;  4ZA1 A;  1JLQ A;  5THW A;  1WC6 A;  3PR4 A;  1MRO A;  4GC6 A;  3DI6 A;  1KEK A;  3HJV A;  1BXN A;  5I3U B;  3AOA A;  1UJ5 A;  3GSI A;  4WYW A;  2OPS A;  4ZVE A;  3U02 A;  3KLF A;  2CPI A;  1ZZN A;  3AH6 A;  1N34 F;  3LAN A;  1PIL A;  1SV5 A;  4PG7 A;  4P75 A;  3TOQ A;  3VQS A;  3G96 A;  3PYE A;  3QSI A;  3H25 A;  2ZH1 A;  1VQY A;  2YX7 A;  4QWC A;  1IBC B;  2FJX A;  1MW7 A;  4LRC A;  3FBF A;  5AE3 A;  3NRB A;  4FBT A;  5A0Y A;  3SSS A;  1GMU A;  4KAI A;  2M88 A;  1N0V C;  1HKA A;  2C3O A;  3M8Z A;  1HNI A;  1NPK A;  3M6U A;  3N6L A;  3CC7 S;  5AE2 A;  1V6H A;  5J2M B;  2QO3 A;  2CQC A;  3MUM P;  3BBC A;  2UUW A;  4DV1 F;  3T1Y J;  1BQX A;  2FHM A;  4M5K A;  3IR6 B;  2GMJ A;  4RUH A;  2B4O A;  2EFQ A;  4DR5 F;  3UPF A;  1H2T Z;  3IAM 9;  2E5G A;  3P5T L;  2MJN A;  2AT1 B;  3HSD A;  3T41 A;  4BC7 A;  1GXL A;  1WI8 A;  4RW6 A;  1B99 A;  4HVZ A;  1UEV A;  4ECT A;  3SCI E;  1Q81 T;  2D1C A;  2GC8 A;  4HTI A;  1HHT P;  4L3K A;  5KG1 A;  4LF4 J;  3PCO B;  4DL0 C;  3QRR A;  2ZNY A;  4OYB A;  3EGV A;  2WRM A;  3IP0 A;  4PG4 A;  2EI5 A;  3TA0 A;  4MIB A;  5KFM A;  2C3U A;  2AJF E;  2PT0 A;  2Z4P A;  5IXU A;  3DMJ B;  2GV1 A;  2IRU A;  3R5B A;  4DPO A;  3AD9 C;  2Y1I A;  4WU3 A;  4GVB B;  1LNQ A;  1LXJ A;  2E66 A;  3TJ8 A;  1QM9 A;  4NI2 B;  2R8H A;  3TZY A;  3O5T B;  2PFF B;  2F3J A;  2LP4 A;  2ZHA A;  3BQ0 A;  5F0W A;  5I3P A;  2X7I A;  2BZ2 A;  4QR0 A;  3UD3 P;  1FI4 A;  1GMV A;  1QAJ A;  1RWO B;  4JOU A;  1HLW A;  4UQT A;  1DQ8 A;  4URS A;  3K5N A;  4FNI A;  1WOP A;  1RT5 A;  2IDL A;  5JXS A;  3GP9 A;  3G6E S;  1PGZ A;  2RU9 A;  2NXE A;  1RTD A;  2MQM A;  4PZV A;  3PJW A;  3W2W A;  3ONQ A;  9RUB A;  2MPU A;  4LRF A;  5KFF A;  4J9O A;  4DR7 F;  1MMD A;  2HAI A;  4B3R J;  1S1W B;  3Q8Q B;  3VVT A;  3AT1 B;  1CJU A;  5M2U A;  3I31 A;  3BB5 A;  4PXB A;  3FEX B;  4I6W A;  1YRU A;  3NAI A;  3C66 A;  4EU0 A;  5LMU F;  1FDA A;  3C14 B;  4Z7C A;  3NGU A;  1NEE A;  1IKY A;  1TP7 A;  3TRG A;  2YWK A;  5BR8 F;  1TKZ B;  2J5A A;  3E01 B;  3UCZ P;  2YY3 A;  1YK9 A;  3CJR A;  1JJC B;  3ILL A;  5E0O A;  4WKY A;  3KG0 A;  1U25 A;  3OD2 A;  3KKF A;  4TQS A;  2R8I A;  1EKR A;  2KYZ A;  3PDN A;  2HBY B;  4A8S A;  1FWK A;  1XC9 A;  4ZLN A;  2UXB J;  4B17 A;  2JC0 A;  1ZYQ A;  4TNO A;  1F1B B;  2GVZ B;  4OHV A;  1XR5 A;  4DV7 F;  3WC2 A;  4USW A;  3PFE A;  2JZ5 A;  4X64 J;  5GMD A;  1CS4 A;  4CLL A;  4ZMM A;  1VQ7 S;  1U1M A;  4F7V A;  2M4M A;  2NPI A;  2QLF B;  2RU3 A;  4X66 J;  4KV8 A;  4O4G A;  1SJF A;  4K4W A;  1ZH5 A;  2Z0G A;  2DTJ A;  4KO0 A;  2MLY A;  4NLO A;  5G0R A;  1SC3 B;  2VPX B;  3VVU A;  1U26 A;  1HWI A;  1JX4 A;  2JNJ A;  3TP2 A;  3QBC A;  1SJ1 A;  1CUL A;  4PR6 A;  5K8N A;  2BKO A;  4DV6 F;  3T5L A;  3EE3 A;  3D5M A;  4DR4 F;  1N48 A;  1PCA A;  3RW7 A;  2HMI A;  4C8Z A;  1IWA A;  3RYL A;  4ZJQ A;  4QPX A;  4PYA A;  1DQA A;  1T02 A;  2DY9 A;  2MMY A;  5D3G B;  2H5J B;  4DQR A;  4K4V A;  1VFJ A;  1Y10 A;  2XLI A;  2BJ9 A;  3CJ4 A;  2ATL A;  1WOR A;  1YSJ A;  2ILY A;  4X64 F;  1T11 A;  4DL2 A;  1PYT A;  1RHM B;  4ZIW A;  4LFA J;  4NXM J;  2ZE2 A;  2PD1 A;  4QZV B;  4LRD A;  1X60 A;  4JI3 J;  4ZVS B;  1D09 B;  2BJ3 A;  1Y5N B;  3GYN A;  4P10 A;  4J90 A;  1M1H A;  2ZDP A;  4M5I A;  4AND A;  3GJR B;  4LBP A;  4RJV A;  4PKD B;  2AX1 A;  2CQD A;  2OO4 A;  2V69 A;  2YNG A;  3CMQ A;  3UFC X;  4DBQ A;  3BBB A;  3U7J A;  5EWF A;  2XO7 A;  1SIZ A;  5LOQ A;  1U6F A;  3H7H B;  4NE9 C;  1Q86 T;  4PXD A;  1U6Z A;  4UOH A;  2LQ9 A;  2QYG A;  2MEW A;  5E3Q A;  5LSR A;  2R7V A;  3KNA A;  1Q5Y A;  1M1G A;  1WG5 A;  2AHO B;  3BH7 B;  3HHK A;  3MEE B;  4WE1 B;  3RR7 A;  1N56 A;  2DNQ A;  1X0F A;  3PW5 A;  2HFS A;  3Q2S C;  4I64 A;  3GJS B;  3MM6 A;  2MZT A;  4NLY A;  1IBK J;  3M6V A;  4WTY A;  2FYX A;  3NGT A;  2MKY A;  2VD3 A;  2RKI A;  4CH0 S;  3A1Y G;  4N5S A;  1FNX H;  3M7V A;  2Y3Y A;  2WVC A;  1VC6 A;  1WF1 A;  1RT4 B;  1X5O A;  3D1O A;  5L9X A;  2XHW A;  2RDD A;  3VZH A;  2D3O R;  4F4K A;  5AXN A;  3K5O A;  4K4Z A;  2DNM A;  1FRK A;  1YHQ S;  4A8K A;  3AOD A;  3KK1 A;  2N7C A;  2AJQ A;  3MUR P;  3MD3 A;  1X4D A;  1WC5 A;  2XEX A;  3RJM B;  1PC4 A;  5H9E K;  3POT B;  3EZO A;  2DGW A;  4YB5 A;  3L4B C;  3EVW A;  1FJG J;  2HQ3 A;  1QVG R;  4KYZ A;  1TL3 B;  1HBM B;  3MM9 A;  2QLX A;  1SL1 A;  2LXF A;  3DYA B;  1PBU A;  1IQZ A;  1LQ9 A;  3M8P A;  2RF2 A;  4I56 A;  1U0H B;  2W24 A;  4KFB B;  4ED2 A;  2XMJ A;  3OXF A;  4N7T A;  3RW6 A;  5HAT A;  4ELV A;  3JTN A;  4BWM A;  2GNK A;  5DQI A;  2R7X A;  3LPE A;  3AY0 A;  3EX7 B;  1CJV A;  4KY3 A;  4EBD A;  3QIP B;  1SQF A;  5T7L A;  5T7L B;  4DL5 A;  2HFO A;  1FWP A;  1SH2 A;  4EFA C;  1E6Y A;  3GON A;  4B3M F;  4USK A;  1HQU B;  1QD1 A;  3R9L A;  1NSP A;  3DLE A;  5BYS A;  5DDP C;  3KLG A;  1S0N A;  5CA5 A;  2NXJ A;  3CDW A;  3PO5 A;  1S57 A;  1S59 A;  2HFU A;  3KLI B;  4J9R A;  4PAA A;  5AXL A;  1YBU A;  3IRX A;  2LEA A;  4M5N A;  1TL1 A;  2JC1 A;  2VFU A;  3DCA A;  3DRP B;  1FO1 A;  4QWB A;  3KLE A;  4PPZ A;  5KG0 A;  3NGK A;  4ED0 A;  3ITH A;  4K4X A;  3GFH A;  1B70 B;  3IWN C;  2FJE B;  3BKF A;  1YVF A;  3VCD A;  3M6X A;  1UJ4 A;  2MZQ A;  2JHE A;  1O8B A;  2P2C B;  3Q8S B;  2H5E A;  3T6J A;  4R5P B;  4DV3 J;  3RB6 A;  2DXE A;  1RCO B;  5FLX U;  3U1L A;  4RW8 A;  4LFC F;  1K8A T;  4FYV B;  4JI8 F;  2XYG B;  5CD4 H;  4CIO A;  2CAJ A;  1JMT A;  3LTO A;  2PA8 D;  3DLK A;  2GHV C;  2VAS A;  2LEP A;  1ZOT A;  1D9F A;  3V4I A;  3G8Q A;  3NBP A;  3PTW A;  4ZP8 A;  3KXD A;  1WEL A;  4DPX A;  2VIC A;  4JI5 F;  1TK0 A;  3H2U B;  2M3D A;  1UEU A;  1VRT B;  2BUN A;  4H54 A;  2K8G A;  1TL7 B;  4FYW B;  4OIX A;  2V4R A;  2VOD A;  2YWE A;  3TUP A;  4JI0 J;  2HZV A;  2IFX A;  1OYE A;  3BDE A;  3CED A;  2BE2 B;  2JFD A;  4Q0B A;  2VC1 A;  2J9D A;  3N4W A;  2CNK B;  5J2N B;  4EI2 A;  3HF5 A;  2VBZ A;  1K0T A;  2FVS A;  4BLG A;  2FGO A;  2W2P P;  2Y1R I;  4IDK A;  4LSN B;  2WVD A;  1HWL A;  4Y28 C;  4ILL A;  3F0N A;  5LT5 A;  4ECS A;  1UCN A;  4K5S A;  2RDJ A;  3CCZ A;  5KFX A;  1B4S A;  1KON A;  2FUG 9;  2IM1 A;  5IV3 A;  1ZAW A;  3AHP A;  4MK7 A;  4B9M A;  4LBI A;  1FJG F;  5HVF A;  3MR2 A;  4TU8 A;  3DOL A;  3UQS A;  3HHD A;  2A6O A;  3QZ7 A;  1YWX A;  4JV5 F;  2RKI B;  3MMJ A;  4P2X A;  2F4F A;  2NXU A;  1SXL A;  4WK3 A;  3L95 X;  4YN3 B;  1T9V A;  1IKX A;  3G6V A;  3E01 A;  8AT1 B;  4P71 A;  1DJ0 A;  2F9J A;  2VFV A;  4Z7Y A;  3SFG A;  2RRN A;  5GME A;  2HS0 A;  4FP9 A;  4ZIT A;  3K89 A;  2HFV A;  2ZIT A;  3ZTO A;  4DU8 A;  3M2V A;  3ETM A;  3FBE A;  4Y2A A;  1YZ6 A;  5KT6 A;  3HFZ B;  2GX8 A;  1XNR F;  2V8H A;  2ZFH A;  1K1S A;  5EX0 A;  4NLT A;  5KFL A;  3A13 A;  1NKC A;  3DOM B;  4B3S J;  1G3O A;  3FSX A;  4F0K A;  2C3Y A;  1KHW A;  3K5M A;  2IA6 A;  3UE2 A;  1W2I A;  2ACM A;  4OJ1 A;  2V67 A;  1BD6 A;  2LQ5 A;  3GJQ B;  3H8Y A;  4LF2 A;  2AEF A;  2IVM A;  4ZN1 A;  2M2B A;  3R27 A;  1C1B B;  1YIJ S;  2D3U A;  2QC3 A;  2YQ0 A;  4M5J A;  2E44 A;  4CNZ A;  1RE1 B;  2ZD1 B;  4JI4 J;  2VG6 B;  3G86 A;  4KFB A;  4OX9 J;  1FRM A;  5JJB A;  2MZS A;  2J0S D;  2MYF A;  4J91 A;  4DXL A;  4ELT A;  2OFH X;  4OZ1 A;  4OYW A;  1Z2L A;  3T9Z A;  1FFS B;  3TO8 A;  1TL5 A;  2NPF A;  2CQG A;  3ULH A;  3I0S B;  3HD1 A;  5L39 A;  2OJ3 A;  2ZH3 A;  1NO8 A;  4XPE A;  3D67 A;  3MCN A;  4G1Q A;  4M5D B;  4EBC A;  3QGH A;  4OHZ A;  1LW0 B;  1Y4Z B;  2HHQ A;  5I3Q A;  2XYP B;  4QOT A;  4K8R A;  2HHS A;  4RBT A;  1Y9O A;  3GIR A;  4Q7A A;  1S6Q B;  1S6Q A;  1NJX A;  1EIY B;  3CJK A;  1IR0 A;  4W4M A;  3R2C J;  2DGX A;  5DJB A;  4L6V 3;  3ISZ A;  3THT A;  2WCX A;  3JAM Y;  3GIJ A;  5A8K A;  4CH7 A;  4Q8F A;  1DLO B;  3MEG B;  5LJ3 Y;  4CO4 A;  2DRB A;  3S1T A;  2KHD A;  3S6E A;  4JI2 J;  3OXL A;  4M5H A;  1VBK A;  2CQB A;  2OEK A;  2HQC A;  1N54 B;  2XSJ B;  2XSJ A;  5EGY A;  3M8Q B;  3R5D A;  3M30 B;  3Q23 A;  2BMB A;  4ED5 A;  2W9B B;  5G4D A;  4X4Q A;  4OI0 A;  1UEK A;  1XN9 A;  5C2G A;  4XTT A;  1S97 A;  1K47 A;  5ETR A;  2HHH J;  3D0I E;  2RB7 A;  2DEJ A;  4OI4 A;  4DN0 A;  1KTV A;  1RTD B;  1RUS A;  3D0G E;  3IBW A;  3MM8 B;  1Y11 A;  4WFY A;  2AGQ A;  4HTJ A;  4WK1 A;  4CYU B;  4J9M A;  1URN A;  2AW0 A;  3MCO A;  5D78 A;  1UET A;  3BN4 A;  5D15 A;  2M5Y A;  4R8U B;  2LKZ A;  3Q24 A;  1VS3 A;  4DR4 J;  1G4C A;  5KFK A;  4Q45 A;  1S6O A;  3RBD A;  1OYD A;  3I0S A;  1YJT A;  3QJP A;  2A3J A;  2LLZ A;  2VDH A;  4RW4 A;  4UST A;  4ZP7 A;  1WOS A;  4HHH A;  4P2F A;  4G65 A;  4MIW A;  2ERR A;  2XMU A;  3JAM U;  4LBH A;  2ZM6 J;  4IDK B;  2HRY A;  4CM2 A;  4LSZ B;  2GJ2 A;  2P9G A;  2XY5 A;  2W9C A;  4PXC A;  3MUT P;  3CJ2 A;  3FRZ A;  3D1Q A;  3BGO P;  2QLW A;  3SMZ A;  1YJ9 S;  4MFB B;  3GG1 A;  4U9R A;  3PW2 A;  4TLQ A;  5HQL A;  2FY1 A;  1R0C B;  1G6B A;  2Y8Y A;  2MSS A;  3PRB A;  1VK3 A;  4H4K C;  3GV7 B;  4DUZ J;  4ILR A;  3HX9 A;  1NK7 A;  1NK6 A;  2P5V A;  3UR3 C;  1KLM A;  2JLG A;  1F5B A;  2VBY A;  3UI3 A;  4BS2 A;  2VFS A;  1RTI A;  1S1T A;  2HZC A;  4J9V A;  4WP9 A;  5KFT A;  2QL5 B;  3CCM S;  2B9Y A;  1GMW D;  2G13 A;  1RKI A;  1Z1Z A;  4FKY A;  3WZ0 A;  4M94 A;  4K59 A;  1V3R A;  2OSR A;  3LP0 A;  2KH9 A;  1JLB A;  2H65 B;  2V4J B;  2G2O A;  2NXC A;  3F56 A;  3RUB L;  2BAC A;  1UA0 A;  3R6G B;  1NDC A;  1EQ0 A;  4L76 A;  2Q79 A;  3OFE A;  2IYI A;  1HFE L;  5ETS A;  4R8U A;  5F8J A;  1YKW A;  4UZC A;  5IT9 Y;  3N79 A;  3PV8 A;  1HNI B;  4DFK A;  4B9N A;  4O3R A;  3NXZ A;  2VQE F;  4DF4 A;  2IJR A;  4K2J A;  3G9C A;  2FJV A;  3CDA A;  1HQE B;  1YJV A;  3WIU A;  3OL9 A;  4JI1 F;  3LO3 A;  3NLC A;  4RX6 A;  5HK4 A;  2CJB A;  1TR0 A;  2DR6 A;  3QFW A;  2MJU A;  2KYX A;  3NOG A;  4ZPB A;  5F8M A;  1RWW B;  5CZX A;  3RRG A;  4JI7 J;  4HI1 A;  2VKR A;  4P7V A;  1RBL A;  5DZ7 A;  5B0F A;  1VQN S;  2GJF A;  1EHW A;  1KDN A;  1SVD A;  2ATC B;  4MK9 A;  2JOQ A;  2VFR A;  5ETV A;  4QW9 A;  3W65 A;  2XUL A;  5AJ3 J;  2VHG A;  3CB4 A;  4DX5 A;  2J0X A;  2BE9 B;  1ZAX A;  1UVM A;  2ROG A;  4DV7 J;  3TAP A;  3QRQ A;  2VZ9 A;  1S49 A;  4QCL A;  4DFP A;  3PIO Q;  1NB7 A;  1FJE B;  2VQE J;  2IDE A;  2WW4 A;  4IOC Q;  3CJ3 A;  4P7T A;  3DRX A;  3TAM A;  4J9L A;  2ADB A;  1M5K C;  1SQE A;  4A8F A;  3SQG B;  5B0G A;  5K14 A;  1S1X A;  1RCX B;  1HNZ F;  1AW0 A;  3H98 A;  1FDB A;  3BKU A;  4NYZ A;  4OJH A;  3MR5 A;  2YKP A;  3F44 A;  3AJ1 A;  4NPO A;  2VOP A;  3B78 A;  5FJ4 A;  1RI7 A;  1Q8B A;  1R27 B;  3NEK A;  4Y2M A;  1YBT A;  4CLK A;  4QJV A;  3GIK A;  4DZ6 A;  4K4S A;  4B3T J;  1I94 J;  1LWE B;  2KDO A;  2VPZ B;  3BH6 B;  1LFW A;  4NLR A;  3K0J A;  1RTJ A;  3IBF B;  1GQE A;  4NWB A;  5ETP A;  4IFV B;  5T14 A;  1N6Q B;  2DNO A;  4PCQ A;  5KFW A;  3KHR A;  2R7W A;  1GTE A;  2XG8 A;  4DV4 F;  4BDP A;  4FXD A;  3DLH A;  3FC9 A;  3GFZ A;  3VGS A;  4UUX A;  4RNO A;  4NMX A;  2W7O A;  2OP5 A;  3CE8 A;  2JRS A;  2Q6C A;  3LW5 C;  1QAI A;  3CDB A;  2HHW A;  3DRY A;  1NLK L;  2IIH A;  3UNG C;  4U95 A;  4DR6 J;  2Y0B B;  2DBB A;  4OL8 A;  2QJ3 A;  4LIR A;  4ES3 A;  2VPW B;  4ZJO A;  3LAM A;  1EAY C;  5MLC V;  1VRT A;  5BYQ A;  2WVE A;  4G1P A;  5EUH A;  4CH1 A;  1I5O B;  2DRA A;  4NLS A;  5HAO A;  2EFV A;  2Q1L A;  1UKU A;  3CJ0 A;  2XCP A;  5K14 B; 
#chains in the Genus database with same CATH homology
 1SC3 B;  1I51 B;  5IC4 B;  4LSZ B;  1GFW B;  2C2K B;  2CNN B;  1RWN B;  1RWP B;  2CDR B;  3NS7 B;  2C2Z B;  2H5J B;  2CNK B;  4DCP B;  2HBQ B;  2DKO B;  2QL5 B;  2H4W B;  1RHM B;  2H65 B;  4DCO B;  1RWK B;  3D6F B;  3R6G B;  1SC4 B;  4ZVS B;  3R7S B;  1IBC B;  1RHK B;  3QNW B;  3GJR B;  2H48 B;  2XZD B;  3KJQ B;  2CNL B;  4JB8 B;  2HBR B;  3R7N B;  1RWM B;  2QLB B;  2C1E B;  1RHJ B;  1RHR B;  3IBC B;  2XYH B;  3GJS B;  2QL7 B;  4ZVQ B;  1RWW B;  3GJQ B;  4ZVR B;  1RE1 B;  2CJX B;  4ZVU B;  1PAU B;  2QLJ B;  2XZT B;  2QL9 B;  4ZVP B;  2C2O B;  3RJM B;  4ZVO B;  2H5I B;  2FQQ B;  2Y1L B;  3EDQ B;  3P45 B;  1RWO B;  2XYP B;  3KJF B;  1SC1 B;  2H54 B;  3KJN B;  1RHU B;  1RHQ B;  3IBF B;  1ICE B;  3D6H B;  3P4U B;  2H4Y B;  3EDR B;  2H51 B;  1RWV B;  4DCJ B;  2C2M B;  5K20 B;  1QDU B;  2CJY B;  2CNO B;  2Y0B B;  1NME B;  1F9E B;  3R6L B;  2HBZ B;  2HBY B;  3SIP B;  1I3O B;  1BMQ B;  3R7B B;  4ZVT B;  3D6M B;  3R5J B;  1QTN B;  2P2C B;  5IC6 B;  1PYO B;  2QLF B;  3GJT B;  2XYG B;  1RWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...