1RWPA

Crystal structure of human caspase-1 in complex with 3-{6-[(8-hydroxy-quinoline-2-carbonyl)-amino]-2-thiophen-2-yl-hexanoylamino}-4-oxo-butyric acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
b'TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwpA00
1RWVA 3BIJA 3H1PA 4JJEA 4ZVUA 5IBRA 4ZVSA 3R7SA 2C1EA 4QUHA 5I9TA 2H48A 5JFTA 1CP3A 4ZVOA 4EHAA 3NKFA 4QUIA 4FGUA 3R6LA 2J33A 3DEHA 2NN3C 4EHNA 3GJSA 1RWXA 4EHDA 4M9RA 3P45A 3V4LA 1NMEA 4N7JA 5IAKA 2C2MA 4AW9A 1QTNA 2H5JA 1F9EA 1NW9B 3IBCA 1NMSA 4EHHA 2J31A 3UOAB 4NOKA 2J32A 2QLJA 4N6NA 4HQRA 5LUBA 3H11B 1QDUA 2H4WA 2J30A 4ZVTA 3D6MA 3V4OA 1RHQA 4QU8A 2QL9A 3UO8B 1SC4A 3R5KA 1RHJA 3GJTA 3GJRA 1I3OA 2DKOA 5IAEA 2QLFA 4QUJA 1JXQA 3EDQA 2WDPA 1I4OA 2FUNB 3V55A 2QLBA 4JR2A 3KJFA 1QX3A 2Y1LA 3V6MA 3D6HA 1IBCA 1SC3A 2K7ZA 4N7MA 3SIRA 2H5IA 4D3YA 2HBQA 3ITNA 3S70A 4QTYA 4D3XA 4I1RA 4DCJA 3GJQA 1NMQA 3H0EA 5K20A 3EDRA 4NOMA 2FQQA 4QUEA 1KMCA 1GFWA 4AWBA 3S8EA 1M72A 5IASA 3KJNA 3H11A 4PRYA 4QUDA 4QUAA 4NOLA 2HBRA 1CVRA 3NS7A 3SIPA 4QU0A 2CJYA 3KJQA 4FXOA 5LUAA 4EHLA 3OD5A 4QUBA 4EJFA 1RE1A 4ZVQA 4EHFA 5IANA 4I1PA 1SHLA 3PCXA 4IEFB 1ICEA 4JB8A 5LU8A 1I51A 2CJXA 2CNOA 2CNNA 1RHRA 4FDLA 3R7BA 4JQYA 1GQFA 1RHUA 3H13A 1F1JA 2Y0BA 4JJ8A 4NBKA 4QULA 3V6LA 4HQ0A 2C2OA 2CNKA 3P4UA 1RWKA 5I9BA 2HBZA 2QL7A 5IAJA 4DCPA 1I4EB 1K88A 1PYOA 4FEAA 4QU9A 5IABA 1RHKA 4NBLA 5IAGA 4LSZA 3D6FA 5LU9A 2H54A 3DEIA 4N6GA 2H4YA 3DEJA 1RWOA 4N5DA 5IARA 4JQZA 5H0IA 2XZDA 3NR2A 3PD1A 3K7EA 4QUGA 1BMQA 2CNLA 2P2CA 1PAUA 3IBFA 4NOJA 4AWAA 1RWWA 1RWPA 2AR9A 3PD0A 4N6OA 3R7NA 3R5JA 4PS1A 1K86A 1RWMA 4ZVPA 4EHKA 4PS0A 1RHMA 4ZVRA 3QNWA 4IYRA 4DCOA 4JJ7A 5IBCA 3RJMA 2XYGA 2C2KA 3E4CA 1SHJA 2CDRA 2H65A 2XYPA 2HBYA 2XZTA 4HVAA 4PRZA 4QU5A 4QTXA 5IC4A 1RWNA 4D3ZA 2XYHA 3DEKA 4NBNA 2FP3A 2C2ZA 5IBPA 3R6GA 4JR0A 5IC6A 1SC1A 3V3KA 4JR1A 2QL5A 2H51A
chains in the Genus database with same CATH superfamily
5KAMA 3DXXA 5BUZA 7MHTA 2PUFA 2OHFA 2EQAA 2BELA 5KSOA 3PEEA 5JMPA 4D9CA 1Z4MA 1R6BX 5ICCA 1F6WA 1A0OA 4MYSA 5CFNA 3I42A 3OQPA 3IXLA 5T5QA 3ROFA 1J0CA 1BHQ1 3D2AA 2FMUA 2P2GA 3EA5A 4R8MA 1BSVA 1JDZA 3KYCB 2Z5LA 4H7EA 4LDPA 4WVFA 4CQMB 1NMYA 3JTMA 4RC9A 1R9JA 1UPBA 4XYEA 4A0QA 1QGUA 3IMGA 3F8WA 4GXRA 3SBXA 4E51A 1GWNA 1QPBA 3RYTC 5ES4B 3FF4A 4DLKA 4XYLA 3ICVA 2GCNA 1KEKA 2BRUC 3GVHA 3TH5A 1NFRA 1TDJA 1VFNA 5D8DA 5ECYA 3DOFA 4ZDKA 5A4MS 3ADDA 4CTMA 1VCIA 3MS2A 4KYUA 3C6MA 2DPHA 2EFHB 1MO4A 5EP1A 3TL6A 4XD7D 1R4ZA 4WBNB 2B8TA 5LLDA 1JIUA 1RW4A 2RGBA 5DULA 4PCLA 3DNPA 1L5VA 5TEWA 4BVAA 5GOTA 2NO4A 5CEEA 2CL7X 4NONA 5MFZA 3NHMA 2PX4A 3P7MA 2CXSA 2J3DA 2Z2XA 3I34X 4HUQA 4BKRA 4HAIA 4FGSA 3R9KA 5ECGC 1TF2A 1FX0B 3FPCA 4RORA 5DGIA 4D3XA 2P1ZA 4OA8A 4XJVA 1SHKA 3ETDA 4TSFD 3S99A 4X63A 1VSTA 4IG9A 1CR0A 1UAGA 4D92A 3EDYA 4TOIA 5CLGA 3HFSA 3CR8A 3TNJA 1PR4A 1U7UA 3BF7A 1TTPB 5C4IA 1M1ZA 3W5AA 4B3JA 1NPDA 3LDFA 4QDZA 1GQQA 4F71A 1FFBA 3AESA 3V5NA 3P19A 3DL7A 4YUVA 4OBBA 3PF8A 4FVTA 1LPPA 1OLOA 1IH8A 3AUSA 4EABA 4DNOA 3ABQB 3S2FA 1EP1B 1YVDA 1UFOA 1W30A 1IVYA 3EZFA 4WKCA 5TQJA 4J1TC 2GBLC 4D45A 4DWOA 2GPWA 5H9WA 1TFRA 2QG6A 4MO9A 5DYYA 5CYGA 1TT7A 3RD5A 3I39X 1CERA 2X8WA 2X14A 1VJ1A 3FHLA 2VP9A 1AKUA 2AYYA 1X1EA 1KJ8A 1L8XA 5HJ5A 1NULA 3X3HA 1Z0KA 2PRKA 2ZUVA 5FYDA 5A5EA 2ZKLA 1WSBA 4ZRDA 5LQNA 2XVZA 3TLBA 3INRA 4JQZA 4CM8A 3GZ4A 1I0LA 2IUYA 3A37A 3FF1A 3QNMA 3UMVA 5C1OA 4A91A 4W9NC 3UY4A 5JS7A 4AWAA 3OKPA 3L6RA 5C34B 1G42A 2MSKA 3HU1A 4NJEA 5HF5A 2WWTA 5AHOA 4AG6A 2NZVG 4CCAA 1JEYB 1HDIA 1NDQA 3NAGA 1T1EA 4RAQA 1T3SA 3CLSD 2ZRAA 2D5AA 3GFOA 1ABBA 3LUHA 4CLXA 2V7TA 3TW4A 4KQJA 4ZAYA 4PNZA 5GY7A 3C45A 3SSOA 4BQFA 3R5FA 4BFSA 2XQKA 4DUYB 2A1UA 3DUFA 4UE6A 1FP7A 1CS0B 1ZNQO 5LYYA 3VTAA 4CI0B 4MRNA 1OWPA 2B4QA 4JVMA 3DS8A 4EKDA 4RD1A 3R7SA 1U7DA 1J2TA 2Z56A 1LPBB 4GMHA 5CD1A 1EU1A 1SXHA 1SUSA 2AN9A 4PHCA 2P9BA 4Q9DA 4JI7B 2I3GA 3DVAA 3ORHA 1PJTA 3GLTA 4NFLA 3FKJA 1JN0A 5TF0A 1RQXA 2IIVA 2R66A 4B9EA 3ZX4A 3I6IA 1HQKA 1R5NA 2YFYA 3OWHA 1GPUA 5IAKA 3U7GA 3RK0A 2QY6A 2NZWA 4EPYA 3W5UA 3CNQS 4QOGA 3OIWA 4C7VA 1AKVA 2FDRA 1KQNA 3UQYS 1VMIA 3ZTTA 4TLMB 4Q15A 2HWYA 1C7RA 3M33A 1ZUWA 1OXVA 2V7PA 4N6NA 5JPIA 5B12A 2HWUA 1G5RA 1KO1A 3AM3A 2HAEA 3CW2A 3R3UA 4DIDA 2NG1A 1RHJA 1PWXA 1K9VF 3O3CA 4IWNA 2F43B 3CH5A 4OHWA 2WOJA 4PLGA 4WNIA 5TGTA 3RS2A 1E3DA 2BZSA 1E0DA 2W8ZA 3IO5A 1RKVA 3KQQA 1L4LA 3I5XA 2AD1A 4PFJA 3AYXB 2OQRA 3B2QA 1TJPB 4QPDA 5BN4B 5K45A 1T3GA 4DBVO 5CH5A 3BMNB 4Z3OA 1NVXQ 4L4RA 4MLCA 1SC3A 2AEJA 3C4JA 1M6NA 3Q9UA 4FR2A 2K2QB 4P4NA 4G81A 1TAGA 2ZAOA 1NBMD 3DFUA 2BUAA 3E5HA 3EODA 4V1CB 1ZEMA 4DXHA 1GNLA 4I99A 4WXMA 2VUHB 1G1AA 3FWKA 3DZIA 4Z9XA 3JQBA 4L72A 1VHLA 2VDOB 4BASA 1UJ6A 2OAEA 3EIOA 4IGFA 1GXSB 1GLNA 4D9BA 3TNFA 4CL2A 2WWGA 2Y1FA 5DBOA 1H3NA 4U2BA 2VPWA 4NOLA 1W85B 5L4LA 1R5OA 2XX3A 1CZHA 3M49A 3UW1A 3I4FA 4R9SA 4NYJQ 1KWKA 5DHFA 4WERA 2EWMA 3PQ6A 3L7DA 2I33A 3ON5A 3WAGA 2CHFA 1K7XB 2OXIA 2FZEA 2VG8A 1KAGA 1Z5GA 2BFFB 2NP7A 3QVTA 3U9SA 3OWOA 3SC2A 1K7FB 1JR3D 5CLFA 2ZYDA 2Q0XA 4H0NA 4HQ0A 1M83A 3CNOA 3C7KA 4PPQA 2PS3A 4V24A 4QM6A 1S9HA 2GILA 2AFHE 4J16C 4ZVVA 4LK3A 4OFBA 4GGMX 3WHKA 4BKPA 3CLSC 2OAP1 4OQPA 1G20A 1HT0A 3MB5A 3N8DA 5C51B 2XB6A 2IBSA 1JVNA 2Z3ZA 1N92A 2KE5A 1ZLXA 1E79A 4C7JA 4DM7A 1D6MA 1U0LA 1J8FA 3DMHA 2RK3A 4GD3Q 4WFQA 4OHYA 4D26A 4CKCB 2CDAA 1ECPA 1UWVA 2I7DA 5AKJA 3B1JA 2EWVA 3BWCA 5FWDA 3W5VA 4F04A 2PUGA 4OUDA 4E2YA 3HJGA 1S4QA 3QLVC 5FPKA 3NBKA 4Q03A 5E9AA 1IOLA 3Q85A 5JE8A 1VPWA 1JHOA 3R4CA 4HLCA 1ID8A 2CK3A 2HUNA 4L7QA 3U80A 4XUCA 1GTZA 2J4CA 4LZNA 3SBEA 1T2UA 2OXEA 4PO3X 2CYCA 2YWJA 4JENA 4EQZA 1Z37A 1SY7A 1UXHA 4G5YA 5JDIA 4D8TA 5ARBA 1PVOA 1M2FA 2WSMA 1LBTA 1MAUA 3T9DA 2P3LA 4J7AA 3PFNA 1BD4A 2G08A 3SBOA 4DCSA 4I1OA 4C0KA 1GAWA 5HUHA 4B09A 2O7NA 3R6LA 1DMRA 1YIDA 1VZ3A 3O4RA 1T1JA 4P80A 3WGGA 1EFLA 2GBFA 2IYPA 3MUFA 4YTEA 1HF3A 1F1BA 3DO5A 2EIHA 4IVRA 4LRXA 3U3OA 3WGIA 3UMSA 4N7JA 1SELA 5CW1A 2VDWB 1OF1A 1W6UA 2XBUA 3A4MA 3LPAA 4QHYA 3ADPA 3R24A 4ZV9A 1Z5VA 2H2GA 4L78A 3FYHA 4NKRA 1XKTA 2OQ2A 2HA4A 2RDMA 5JQGB 4GNRA 3OA2A 1BEUB 1GG2A 1NHGA 1DKPA 2ZUCA 3CGWA 4FR5A 4HAUA 4ITVA 4J6EA 2X19A 5CJJA 3ER8A 1N8NA 1JE1A 2FJUA 1SA0B 2ONYA 2X8AA 3ES9A 3UGJA 2GD1O 2NUTB 3DULA 5LPNA 2VZEA 3KQVA 1WOMA 3K9LA 4P82A 2Z5GA 3TUZC 1A27A 1UANA 3QOWA 1SN7A 1U1CA 1UKBA 2CWDA 3FPKA 1OBOA 1D4AA 4DXAA 1DGQA 1BOFA 3OFNA 3JS5A 1N1DA 2QTBA 4M76B 4E14A 3IDSA 3Q5DA 1V1MA 3AVXA 4CVNA 3R3HA 3DW1X 1XQ1A 2QLMA 5LYJA 4QD3A 4BCDA 4BRWA 1JHQA 2JCSA 4IW3B 1SKYB 2ODAA 5DN6A 3IR6A 1YQGA 2JGKA 2JK0A 2Q7XA 4D0RA 1WB9A 3FE2A 2EARA 4BX8A 5HA5A 4UU0A 2BHLA 2DULA 1XNGA 3PFCA 4R1QA 1XDSA 2CCJA 1VM6A 4ZWNA 1DEXA 1EMDA 2P9HA 2Q2OA 4BYMA 4UHFA 4ZRNA 2O1WA 2W6NA 5J58A 2YXNA 1ISGA 2VHXA 2C3YA 3EDCA 5B5SA 1DQPA 4KQFA 2RSLA 2NUAB 5D3MB 2HHCA 3IRVA 3JALA 4WJZA 2YFQA 3GLGE 1IWBB 3PX2A 1EJ0A 1HE3A 4CNQA 4DT1B 1M1YE 3FTFA 2WMNB 1PFWA 4HV4A 4IJWA 4IWXA 1ESEA 2C5BA 2DU8A 3VC1A 2PA3A 1W25A 3TB4A 4UHJA 2C83A 3OTIA 1R4MA 3OESA 4RL6A 2QP9X 5AJTA 1NE2A 1X80A 2PX0A 3HYNA 4B6EA 1J00A 4Y6PA 3DEIA 8GPBA 4AJ1A 1TTTA 5B7PA 1VKJA 2B30A 2HMSA 4ZC8A 1TRHA 4JT2A 2J3IA 2MTBA 2NV0A 1SQ0A 3CR7A 4OQ4A 4U7HA 5KINB 2R4TA 4P7JA 4E32A 3ILXA 3VJKA 1AMNA 5EFOA 3SDSA 2QU8A 1QV7A 3DOHA 2ILTA 4PPYA 2OV6A 5CTJA 3WQQA 5KB3A 2XXAB 1FQKA 4DCOA 1E1MA 1Q2UA 4DLRA 1RCFA 4KXNA 5CGQB 2VSNA 1NASA 2XUOA 4DCTA 1B0AA 2PO7A 3OEHA 1GQ2A 2OUKA 1IXRC 1J1IA 3DAHA 3FGNA 5KYGA 2IY8A 1IXYA 1HDZA 4DS3A 4PYJA 3L1KA 4Z1MA 3WMFA 1A9YA 4HNUA 4JVOA 3S68A 2BJWA 4C5AA 1Y98A 1UJCA 2FH5B 3QHQA 4KACA 3WJAA 4DLBA 2ZBDA 2WFMA 3S44A 1WY5A 3P2YA 5EJ8A 1Y82A 2DQKA 3QPVA 3RVPA 4CT4B 1Y4AE 3WGMA 1EM6A 3DEHA 2WE8A 1DCTA 4JLBA 2XQJA 1UAAA 3UBMA 2QDKA 3MN1A 3A6ZA 1W2WB 2JD1A 1QFSA 1KJJA 1SCQA 3NFRA 4FSHA 1IM2A 1U7TA 3K96A 3RNLA 5IVKA 1QKKA 3FYUC 4E0BA 3EIQA 1ULBA 1WVGA 1H69A 2ACKA 4OBWA 1E0JA 4NECA 2YNMD 3HCDA 3OSZA 3PGA1 4X94A 4WOBA 2Q0HA 3ITEA 4UTZA 3UKDA 3G68A 4OFXA 3REOA 3KD2A 3WSVA 4D1YA 1Y8AA 3OF3A 3PQ2A 3QK7A 4DDHA 1Z83A 2QMEA 1H93A 3A3PA 3VFDA 5F33A 3L6DA 1M6YA 3ADOA 3LQ2A 3A3OA 3FPJA 2CUTA 2AHRA 4TYWA 2ACWA 2AIRA 4AAYA 3N2EA 1ZGZA 1FCJA 3KHTA 1UDWA 3BEOA 4MYCA 1X15A 1OV6A 3LHDA 4AUNA 2MINA 2PO5A 3OAAD 4XYMA 2K7ZA 1FMTA 1L3IA 2GK6A 3T4PA 3VDNB 5KDLA 3SZGA 4E1AA 3O5AA 3LBYA 1QUFA 3OUTA 1TK2A 2FFQA 4D9HA 1Q7BA 5JAHA 1PSZA 4LYYA 4ESEA 3S27A 4UXIA 2PGOA 1R4MB 3UT5B 3W5DA 1UDCA 3EMVA 3WWYA 4R3WA 2R79A 4KP7A 4HMQA 4QBKA 1KMCA 3EUAA 4RACA 3U48A 4G01B 4HXGA 1CRWG 4Y0NA 5EHGA 1IJBA 1YF3A 1ENYA 1CVRA 1DHRA 2AG6A 2VS1A 3C14C 5DHUA 1ZZGA 5KYXB 3T35A 3K09C 4GOLD 3I01A 1KYYA 1R4AA 1HYGA 1MNAA 2E5FA 3R0ZA 4JLUA 2BMDA 4E33A 4I1PA 1HFEL 2X3YA 3KYJB 4FI3C 4XOUA 5FTKA 3U3XA 1O96B 1A2KC 1UMBA 2FW6A 2BI4A 1NVAA 3BIFA 4F4CA 2XZLA 2BMFA 1VGVA 4KIJA 3H42B 3RFTA 4YRSA 1XRLA 3KQYA 3JY6A 3QOXA 1H2FA 4HC4A 3WQSB 2WYHA 5C5IA 5JYDA 1T6XA 4HQ6A 3OH8A 4ZOCA 3SZRA 1DXOA 4QOIA 4D8XA 2ZROA 2EL7A 3ASZA 3RHSA 1QTQA 1Z0UA 1UP7A 4NATA 4DR1B 2O5VA 2ZS8A 4B8ZA 4D8VA 4MMYB 3UMBA 4P5DA 1HR0B 1NR5A 4FFMA 2XBLA 3W1WA 3TL3A 2EFDB 1KWGA 1DO2A 1LY1A 4A2PA 1EESA 3PEUA 1G5TA 1WW8A 2VDLB 3AV0B 5EJFA 1RKUA 1CJBA 2H4XA 2VT7A 3L18A 2ZRKA 4C29A 4CF3A 4LBVA 3BWEA 3FB1A 1ODLA 3IBFA 2JGDB 5DV9A 3GN2A 5FNVB 4H6VA 1KP2A 1N6LA 3N53A 1QPGA 4KN5A 3JRWA 3ZNNA 5CRIA 3FNRA 2IXTA 4MDHA 1LQTA 4RM2A 4X7MA 5AKKA 2OXRA 2GEBA 2BFCB 1N9ZA 2R84A 2VT6A 3QJGA 2WLSA 3HWRA 3K0CC 1A9RA 4I5EA 4V2UA 3KVYA 1HTTA 2HZBA 3BCHA 3LO5A 2NU7A 4N9WA 1S8NA 3H9QA 3NHJA 5BSRA 3T3HA 3ZKWB 1BS1A 1TC2A 4K8RB 1QZZA 3ANNA 1HDXA 1QLJA 4ZYTA 5JI3E 1JU3A 1X7DA 2DUWA 4JR0A 5GWXA 4EBFA 3M9XA 1SD1A 3QVUA 1UBJS 3ORSA 4IDPA 3X1KA 1MC5A 3NBYC 4G4SP 4Q4LA 4C4TA 2J41A 4P7FA 2QTLA 2VOJA 4QPJC 4B31A 4HVLA 4MUYA 2JCVA 2I03A 1W9MA 5HZKA 1ZXBA 2WMDA 4L8LA 1U8ZA 3UZUA 4V1CA 2I3DA 5DRYA 3MJRA 4YLYA 1BFKA 3NHWA 4WN9B 1NN1A 5CCDA 3MLEA 4EYGA 2AJLI 4I8DA 1Z5UA 1PGOA 4L07A 4PWZA 1K2VN 5JUWA 2EKPA 2UU9B 3SFTA 1D2HA 3A4VA 3AERA 2I9PA 3H5OA 1DJPA 4J1QA 2IHJA 2YMLA 1DCFA 1ZGHA 2PM8A 1E3LA 1C9YA 1ZCZA 3DYIA 3ZY6A 5JC1A 1P60A 2IY9A 4HPJB 5I5EA 1MDFA 2HK6A 5A3JA 5EIOA 4EDHA 3GGPA 3W2HA 2N1BA 1A9QA 2X1HA 3FYDA 3HXTA 4JVNA 4Q1AA 5A0FA 4DGSA 2D3WA 3E1GA 4RH1A 5LWHA 2Q0QA 3IHWA 4MHOA 2H4ZA 3SS9X 1G3QA 4EGFA 1WEHA 2C07A 4GYKA 4DE5A 3SGLA 3GGCA 2EKZA 3NHFA 3ICQB 1OJ7A 4GR9A 3HHPA 3WQHA 2MWMA 5K20A 1YI0A 3ENZA 4F5EA 4RVNA 1Y89A 1X1QA 1WPRA 2O2EA 2ZSAA 4LWOA 3I30X 4B7XA 4ZHQF 3TPCA 5B7GA 4LYFA 5ADVA 3NVKI 3DBHA 5DNYB 4UFNA 1ONNA 5H3HA 1DRKA 4G5XA 2HJ9A 4DVGA 4AY2A 2VHUA 1NIPA 3L84A 2RH5A 4B80A 1KI3A 2GH1A 4MI1A 4XX1A 3AVUA 1BS2A 1N7IA 3S5UA 3QMWA 1YKGA 4OP2A 1SKBA 4NBKA 2I34A 5EJAA 3LFUA 1P6XA 4P7KA 4ARBA 4B7CA 3IL2A 4MPTA 4LNUA 1FDTA 2CYBA 3JASA 1FXSA 5HK8A 2Q0SA 1RYYA 3THWA 1YDGA 2D4AA 4QAJA 1E2BA 4YCNA 5JD4A 1UPXA 1TC1A 4AZVA 2J3KA 1FY2A 1QF6A 2GSDA 1NNUA 2H59A 3I5AA 3K32A 4N8SA 1X2BA 1L7EA 3W5HA 2Z6AA 4CEJB 3B6MA 4RX1A 1SXJB 1A2BA 1VJDA 1W46A 2PLRA 1L7AA 1OLSB 2Y4NA 4URUR 4M8NE 1TM3E 3UANA 1P80A 2QF7A 4BZQA 1XTZA 1GR0A 1XK6A 3AUXA 1HSZA 2R65A 1TO2E 1KZHA 5FBHA 4IOLA 4KR2A 3I62A 4DADA 4YWJA 3LL4A 4HN9A 3ZWPA 4R16A 4EFMA 4BX0A 5KKAA 3OZGA 1CHDA 3DV9A 3JQ8A 1JLLA 2XEDA 1TAQA 4QG3A 1TTQB 5K8JB 3P20A 3D0OA 4IQ8A 4TV9A 5GONB 2F9FA 2VF7A 2X8JA 5JWHA 3PG5A 3HBNA 2FWMX 2R0QC 1HYQA 4RVSA 3UYKA 4BE7B 4WFJA 2ZP1A 5G4LA 4DBZA 4GE0A 1U5CA 1XWFA 4OIMA 5JISA 1GQYA 2CDNA 2GZ1A 4BKQA 5CFRA 2AMFA 1T1GA 1PJAA 4PFKA 2PJDA 3VYWA 1CDOA 3WKAA 1QIIA 2WAMA 2FPWA 5IM4F 4DJFC 4IHQA 4JKIA 1VLHA 3KQKA 2XGJA 1Y7LA 3GFRA 1H3EA 2RB4A 1YHNA 3LBIA 2WC1A 1TKBA 2HEGA 3H2JA 3Q6MA 4QSMA 3VGJA 3LP8A 5FI3A 2O6LA 4JXKA 1HMPA 1UWLA 3ZLBA 1ICIA 1CUDA 2ZWOA 3M4XA 1C2YA 1JSRA 2GJ8A 3GNTA 2IPOA 1V8BA 2G04A 3QW2A 4UTOA 1VKOA 5EC8A 3T9CA 4ALJA 1DC6A 5LZ5A 3UAXA 1JR3A 4KN9S 4EM6A 1EK1A 1HZZA 1Y3BE 3EUFA 4DM3A 1YE8A 2SICE 1NXQA 5FI1B 3KZVA 1B14A 3GJTA 3CKYA 1ZWLA 4EYKA 1PKXA 1PL8A 1VI5A 2I0FA 2J6CA 3K2EA 5EIFA 3SX4A 4HYTA 4XDGA 1NTRA 3E2IA 5ITZA 1U8FO 4RESA 3ZV6A 2A58A 4XRGA 5CG1A 3BSFA 1LQUA 5AUPB 3KJZA 4UZEA 4MUEA 1J2UA 4IF6A 4C6TA 2HN9A 1Z4IA 3D3KA 4OLAA 4RIIA 4TT3D 3LUKA 5HXAA 3ABIA 1U1DA 3H5AA 3CVYA 2DXIA 2ON6A 3A6KA 2F3QA 1XN4A 2GKSA 2VF8A 3GDGA 2QM7A 4CQMA 4O4IB 1ULUA 5EWLB 4MQ5A 4NICA 1KY3A 2YY5A 4QUDA 4CMEC 4GLBA 1M5RA 2JFGA 4JV5B 4IUBS 2QG4A 4JMLA 2CK3D 4KRYA 1U80A 3AF6A 1KA9H 2GWHA 4XTRA 2WY2D 3IB3A 2YS6A 4BVBA 4ESVA 3V2UA 4Q3NA 1D7OA 3TD6A 5HKLA 1KBZA 2XT6A 5DBEX 4E88A 4D9NA 2PUJA 4F7DA 4Z51A 2BGNA 1Q0PA 2ATVA 2H1OA 3ONEA 3GD5A 4GP6A 5IU6A 2WYWA 3FRIA 3K92A 1V7ZA 5G0UA 3WV5A 2Y0PA 1P2VA 4HFMA 5GP1A 3P52A 3OP4A 3CQ9A 5EOVA 4C21A 2BFWA 3HMQA 1KETA 2WINI 1GL3A 3KLPX 1W2HA 3OCWA 5IABA 3HCNA 2P9ZA 4LVCA 3ACCA 2OFPA 2YRFA 3BYZA 2GN8A 4HUQB 3DM9B 4IILA 4C0BA 5EZYA 3GRRA 1UXKA 3E5RA 3R4VA 4XIGS 2JEYA 1JFTA 1KVRA 4EIWA 3CF2A 2QYHA 4OX9B 2JS7A 3R8CA 1TEVA 3GC6A 1FUEA 1NGSA 3P32A 4XCXA 1H05A 3GIWA 4KDCA 2YV3A 4E15A 4CKWA 4LRWA 4HGQA 1RQ2A 3EXEB 2FRVA 4AYXA 2ZZNA 3FDIA 4NYMQ 3DZFA 4OLHA 4X5OA 5AVYA 2FPGA 1MOZA 3AETA 5T4HA 2V4MA 2ZTVA 3QVWA 1MIOA 1D5CA 1UP6A 5DDIP 3DZHA 3KEGA 1TM2A 4D3FA 2VYND 1NXVA 1Q1ZA 2Y1KA 3EVCA 3I9OA 3NWJA 4NHEA 4QO7A 4JI6B 5K6AC 1YB7A 4NCKA 2ZRCA 2C9MA 2QD2A 4P33A 3Q7EA 1NQWA 4PRLA 4B3SB 3NBUA 1SK8A 3TPFA 4I9UA 7REQA 1M10A 4UBKA 1ZOPA 2WD7B 2NPFA 3IQGX 1U7ZA 4OFZA 1P4GA 3ZDAA 4AXBA 4B46A 1C9DB 3DYBA 2CHEA 1S2OA 2J3JA 4FILA 4HXEB 5DXJA 1C8BA 1QDEA 5ENDA 4ZJYA 3THYA 5F78A 1Q1GA 1F3OA 4ATNA 1GGEA 5HGXA 2GA8A 3IPAA 5AKEA 5KTNA 1ZR2A 1J6UA 5JS6A 3D8BA 4XR9A 4KXYA 5FUYA 2NSHA 2GJSA 3PL5A 4E1VA 2YJNA 3CZMA 2Z9BA 1YMQA 5AICA 4UW9A 1F20A 3KT3A 1VMEA 2GBGA 2WM9B 2YZKA 3HXPA 4UMFA 1BAPA 2B0CA 1JHPA 4PLCA 5G0TA 4IZHA 1J39A 4IQFA 3AGQA 3H2KA 3GUHA 5DBGA 4WNAA 4CN8A 5LOVA 2X6RA 3R7FA 4DG5A 4UJ5A 4ZQCB 4DNPA 3IEIA 1HDEA 3QUBA 2O2HA 1MO5A 1P17A 3IVXA 5U1PA 2R5WA 3FPBA 4PLYA 2QTMA 3JAKB 1BKSB 3AESB 4IS2A 5EMNA 5HOEA 2FR1A 4DIOA 1Q0SA 2QTFA 3T3IA 1TRKA 3AEUA 1RFLA 2BP7B 4C1BA 3B9QA 3RE1A 3F8SA 5JPCA 3L7NA 2OG1A 2QX4A 2BDEA 1US8A 4HAOA 4PLVA 1O03A 2J4FA 4EUKA 5I6DA 1XTQA 5B1DA 2UYQA 2HA0A 3QE3A 1O1YA 1P61B 4BNKA 4HFJA 3NGXA 4EUHA 4BO9A 4L76A 1V71A 1P0CA 3OLCX 4EPTA 4ROSA 5KQRA 1X3LA 4M0CA 3KOOA 1KI6B 5B2ZA 5KTMA 1CF9A 1JLHA 4I6EA 5COAA 5FH9A 1I4LD 2ZXUA 1BROA 1RIIA 3JWGA 3ERCA 1GZ6A 1BGXT 2XWBF 3GCXA 2X5OA 3ZXIA 4H7KA 4F12A 1Z6ZA 4C7BA 1W0KD 4NYMR 1E6LA 1JIKA 3C3PA 4UAGA 3C7DB 5CA1B 2AFIE 4IQ4A 1O9HA 1HL3A 2HK7A 1WMBA 1WW3A 2H3EA 1GA6A 2A0YA 4ARAA 1NXSA 1T5BA 1XD9A 2HPHA 4GVPA 1N57A 2WAXA 1M0TA 1RM3A 4LCEA 3PGJA 2G17A 1RHUA 1T4MA 3G7NA 5HG0A 4GXQA 1SXJE 3UJ6A 3QVSA 3W8EA 1ISIA 1Q15A 1GPYA 2REOA 3N2YA 5LLSA 1SD5A 4F11A 1U04A 3HZOA 1RRMA 1VG0B 1QJCA 1L8AA 2CF5A 3LNCA 2QTWB 3P9RA 3B9RA 4J0EA 4Q82A 4QU9A 1P1JA 1Z5OA 2CLFB 3A4IA 3NIFB 5DHPA 1C9KA 5IAGA 5L9AA 5GADl 4RMGA 4YRJA 1NFQA 4FN5A 1K3UB 1O7JA 4E6EA 3B3JA 3KM0A 3PUJA 3RRXA 3AM4A 3V8BA 2VHVA 2YNMC 3KX2A 1PVVA 3TLKA 3BD9A 3CLRC 2CNLA 4K87A 4R7TA 4E5MA 4W5QA 2WZDA 3FCYA 1EJBA 1KJNA 2CXPA 2X9GA 3BGOS 3MSXA 3Q1LA 5AOAA 5HCNA 2IU6A 4PS1A 2QP4A 1G20E 5K3EA 4RPGA 1BQ3A 4UEQA 4JBWA 2VDPB 3A6EA 4LQLA 3TOSA 3LDUA 1RAHA 1E99A 4DMCA 4EO4A 1DI0A 2YMPA 4LVNA 5FFFA 5HUQA 4GDMA 3ET4A 3HMKA 3P1JA 2QPTA 3M83A 4HX5A 4XVQA 3QG5A 2GDJA 4QTXA 3O1JC 1QE5A 3OIFA 3K94A 1H1LA 3PI6A 1T24A 4FCTA 2IYOA 4RJLA 5CLLA 3KQTA 2BPOA 3K8YA 4YA6A 2BTQB 3LQQA 1E3EA 5AXAA 5H3LA 5EMKA 4IMJB 5KWEA 1INLA 4I6GA 2CLMB 4GMFA 3C24A 3QVXA 2CXQA 4QUHA 2UYGA 1SEPA 2VLIA 1KEPA 2AKAB 3TINA 1GPMA 1LI7A 1S9DA 3N8IA 3NKFA 4DQXA 5GIPE 4K6OA 4G0UA 3F3MA 2P3SA 4IZIA 4ZYVA 1QYVA 4D4IA 5BMVA 5J3JA 5C8YF 4C01A 3IODA 3W5BA 4NU8X 2P9GA 3FB4A 3OHPA 4KCGA 3WLFA 1MC4A 2VTBA 2ODBA 3JRXA 1PWHA 1EGHA 4HDSA 1Z0SA 2P5YA 1KQPA 1U2ZA 2GCGA 2ZYHA 1QR2A 1QCZA 1A7UA 2P4EA 2TMGA 1X92A 3VU8A 3C1UA 2PX3A 3NP7A 3M6FA 1KI7A 2YHIB 5DLYA 3K6SB 3EZ7A 4J94A 3FMPB 3DDCA 1G8HA 2FEMA 5AJYA 1GZ5A 4NPHA 3P9QA 5LZ8A 1GXSA 3KPWA 1GCUA 2F1IA 1H1TA 2YBEA 3FCCA 3A9VA 3OJCA 3IJEB 4GGPA 2A59A 4FN4A 4RVCA 2HHHB 4B3RB 3E53A 3RODA 4XB6B 2E4UA 1UC9A 3G2LA 4FS3A 1OA1A 1N5JA 1DPFA 3JASB 5INTA 2QV0A 1OT3A 1U6KA 3AC0A 2NZ2A 3D3JA 3WBKA 4BNZA 4R9RA 1L7XA 4Q00A 1G98A 2IOQA 1FP1D 2FW0A 3IILA 4N7MA 2BHRA 3BE5A 2I78A 2YWRA 1EX9A 5C7YA 2K4MA 3IIIA 4NBSA 4MI6A 3TL2A 2F4VB 4NL4H 4EG0A 1RC0A 2ZAIA 4MPDA 1C0LA 4XFDA 5ALGA 1DBVO 1YVPA 3OBIA 2AV6A 3AONB 2Q1UA 2BGGA 1FYEA 1AQLA 1OOEA 1H0SA 4Z4FA 2F7SA 3AIIA 3KBBA 2XLCA 3LLSA 2QS9A 3L8DA 4XARA 1N0WA 1AB5A 4ETIA 2CD9A 4TTAA 4E7OA 4H15A 1M34E 4OHMA 4QZVA 4IKEA 3PQEA 1W44A 2HDWA 1EK5A 4CCWA 5I7EA 3L1IA 1SCIA 1YCDA 2DBYA 3BRQA 3EBLA 4G26A 3DB1A 5E38A 4BUZA 1XJ0A 5ADHA 1LGYA 3N28A 4HQLA 1GLVA 3U26A 2CNKA 3EPHA 1VHQA 1RD4A 5DXFA 9ABPA 1Q0TA 4NFHA 2JIQA 4H7JA 1FUKA 1A77A 1FZQA 2ISSD 3C4QA 3DB2A 3ED1A 3T0FA 1U90A 4JCCA 3ZD9A 5KNCA 3E4DA 2PNFA 3K0FB 4PHHA 4AKEA 2HGSA 3NIWA 3ETGA 1O58A 3LPCA 4RWEA 1D5WA 4UHKA 3RRMA 4I5DA 1CD5A 3LHFA 3A70A 3KEOA 5ALPA 2VR1A 1WCWA 2LTAA 1NAHA 1KAOA 4LGMA 3JQ7B 1ZIOA 3OO0A 4HEA1 4OCZA 2WJIA 1X8JA 4Z2YA 3U4HA 2HO4A 4LDAA 4XIYA 1AMOA 5TNXA 1WHSA 4EL5A 4LZAA 4MPPA 4CIAA 1D6SA 3CNNA 4YUXA 4JC0A 2DCUA 1JI3A 3L1HA 4XD2A 4JC8A 2AI3A 2BGKA 4RTPA 1BDHA 3M70A 3RVSA 1D1TA 2WSLA 5F7JA 2RHLA 4UTPA 3MFQA 4MVJM 4BNNA 3JR7A 3LWBA 3LZDA 5AVOA 1NM5A 2ZKIA 4YT8A 4ZEMA 1EFAA 2BR5A 2H1FA 3R1IA 3MWKA 1J20A 4XJSA 3NCHA 1DOHA 3VTFA 1RI2A 5BQPA 2IU0A 4GH5A 4TRNA 3D31A 1I2CA 4N48A 1KJWA 3JWPA 4G86A 3JD0A 1Z4LA 1TQ4A 4UNRA 4IH1A 1BGWA 1ISHA 5IJ9B 3Q41A 1N6PA 1P5ZB 5FV7A 5LJLA 1QIHA 3PUZA 2Q3DA 3I5MA 4KI0A 3U4IA 2ZVDA 4O4JB 4Q18A 3ANSA 1GZ7A 1RSZA 3E7DA 5BY2A 5DNCA 3HJBA 4YFVA 1LWOA 3I9V1 1Y3HA 2W0MA 1N2BA 1Q14A 1ZZEA 2RHTA 2W6ID 3AHHA 3CE6A 4IIJB 4ZVMA 2IHTA 1XTJA 3IR7A 2IS4A 3LDHA 3T8YA 4UMEA 4K0KB 4UARA 4NV3A 2QL9A 3H6KA 1D9ZA 2WHPB 4GLFA 3K70C 1H2RS 2FN3A 4EF5A 1PZXA 4KDRA 4ZIRA 3EZXA 1O0SA 2YWGA 3GJ3A 1E0SA 1E7RA 1AV6A 1KVTA 2QLFA 3TZQA 2IXDA 2NWQA 4MJLA 4B44A 4J6FA 4M8LA 4DZZA 1V2GA 4RHCA 5LA6B 3WA6A 4O2AF 2VATA 3GT4A 4BNTA 4ZGWA 1LTQA 4TMZA 1YTLA 5JMWA 2Z2YA 1T9AA 2G1AA 3C3XA 1CY0A 4BX3A 3Q5GA 4PN3A 4IFBA 3E9QA 4M0LA 2FX2A 3HLYA 3WYDA 5JNUA 5FLXA 2NU6A 1NMXA 3VU0A 1CJUC 3ZLJA 3AUFA 3DTVD 3EXEA 2AVDA 5SYNA 3TD2A 4C6RA 5CX4A 3V4VB 2VKTA 3PWTA 3KQNA 1JHDA 3TAHA 1DBRA 5T64A 1E2LA 1QTRA 5AWFC 1T0IA 5JRJA 3Q8MA 5BYKA 3HG7A 3JQ7A 1VHWA 3OEWA 4N65A 3EVBA 5JLAA 4YUZA 2BCJQ 1HDOA 2YW9A 4W9RA 8LDHA 1QHIA 2H92A 2KQUA 3H1FA 3K4PA 4NH4A 2OBFA 4LF8B 1ZGGA 2A0KA 5K8CA 1ZUNB 3G23A 2BGLA 3KQPA 4U4AA 1XZAA 3WWZA 1M9NA 5CB4F 4UEWA 2FUCA 4P22A 2V55B 1ZK1A 1H2AS 2JFZA 2YINC 4LSZA 1D0VA 2JBAA 4BO8A 1WP4A 4HNHA 2FR0A 1CUUA 2O8FB 2PGDA 4S35A 3W90A 4D9IA 3SAJA 2I4MA 1YT5A 5DOZA 5IM5A 3LOUA 4HWPA 5JASA 5A03A 2OE2A 5D6NA 2PIAA 1JIJA 4BECA 3DTNA 1Q95A 3OM9A 1P1HA 4RIEA 3YASA 4CTKA 5F9FA 3MMNA 1HTWA 4ILKA 1T9CA 4TKVB 1OKKD 3ZI0A 3VR1A 2X9NA 2Y4OA 3VOBA 3E48A 3TMKA 1MAHA 3GO4A 4GBGA 5DNEA 1SHJA 4WKGA 3KOMA 2HBYA 4IHKA 1Y1RA 1ZUD1 3FCSB 4X95A 3L8HA 1JIVA 1SQGA 1VLZA 1YJAA 4A16A 5BN5A 1NQTA 1CBUA 1YC2A 3AQ4A 3C7AA 2VHQA 2CZGA 3CU5A 2QZ9A 4M83A 3V3KA 2B34A 1UOEA 3DGFC 4Q47A 3S0JA 4DA4A 4MDFA 2GVDC 3KIPA 2YNMA 4NEQA 4RTKA 2O8VA 3HXLA 2Q8PA 4YACA 1DX4A 1GKUB 3CF4A 2QRMA 1DV2A 2C4HA 2ZITA 4AY4A 3NETA 2CUKA 1DT3A 4W8GA 4G8CA 3DO6A 4RVDA 2WTBA 2ZTLA 3DEYX 3KJHA 2KWIA 4DABA 5H68A 2RAVA 2OV3A 3L4KA 4QQFA 1NG1A 2JB9A 1UKVY 4JS0A 1E2EA 1E2PA 3A6LA 3QA9A 2ZWVA 3G2QA 5LM3A 4BNIA 1SCJA 3N5CA 1QRAA 5C1IA 1U98A 4ZZ0A 4U5XA 2CLDX 6NULA 1GAEO 5BNZA 4LGYA 4IDQA 1F9EA 4MEJA 5KQMA 5LQKA 2PZLA 4W99A 2E2WA 2D0IA 1HL7A 4WK2B 3AKYA 2GXUA 1TD9A 3AKCA 1MX9A 1SBZA 3ED5A 4D42A 3K9GA 3OQIA 1QG6A 2BF7A 1V1JA 1VL8A 3ENQA 1T5DX 4R8SA 3TGWA 3ZZTA 1A9OA 3IE1A 1VBFA 1MXFA 4YMLA 3QF7A 3AL0C 1NVDA 4V3CA 1N3IA 1IY9A 2I7TA 2CFIA 2LZ0A 2X8BA 4KLCA 4M9SA 3DVQX 3ZJ5A 4Q4JB 4OEHA 4R0MA 1Y34E 2Q6IA 3ESCA 5GTDA 1U3TA 1M8KA 2IODA 2OQVA 3EZLA 4L4ZA 4BJ1A 2HHJA 3MTBA 2HCJB 2BR4A 3EZ9A 3GLUA 3SI7A 3VVBA 2WWFA 4BVJA 2FZLA 3VYTB 4REOA 3EIHA 2W2OA 3B70A 5E2BA 1M74A 1Q44A 3S70A 2DHEA 3Q1KA 4NRDA 2FOIA 2DFKB 1N2CE 2BLLA 3N6XA 3TN7A 1GZHB 1CUYA 3D64A 5B1IA 1E2GA 3TXYA 3IUSA 3TQCA 5HILA 2QD4A 2SHKA 4D6YA 2H06A 4KFSA 4G23A 4ZU1X 4IDBA 4KHZA 1FXUA 4Z99A 4HGNA 4LZJA 2DLCX 1T0BA 1THTA 5IJXA 3W79A 1CJKC 1L9KA 1XKLA 4PGGA 1F8FA 2FV8A 3NC1C 3MUOA 3OZFA 2CB0A 3IUEA 4LPSA 4C76A 2CBXA 1ZGJA 2IQ5A 3H3JA 1RPTA 1Z8NA 1A5TA 1E5DA 1UR5A 1JLRA 1H2YA 1RKBA 3ELYA 1ZDMA 3S40A 4YBZA 4I8XA 4H77A 3F5QA 4NAHA 3IDAA 1D7AA 2XRFA 2C4TA 2AC7A 3FPFA 5BW5A 4G97A 1USVA 4LF9B 3G8AA 4DYDA 3DKRA 1Y3FE 3FRJA 2Q9CA 1GADO 2C1ZA 2PLWA 5D3QA 5IFLA 4YMWA 2C4UA 1T5SA 4DRXA 3CVUA 1M34A 2JDIA 2OZVA 4RO0A 3LBHA 1YR8A 3OF2A 3UMRA 1ADYA 4Z9AA 1N6NA 4JT8A 4BWFB 4DMFA 2ZJ4A 1SOUA 5CLQA 3WIOA 4B9AA 5FRDA 1VJ5A 2X58A 2HH9A 4L8FA 4FCVA 3E2PA 1EVEA 3NQ41 4BVKA 1X6VA 3OCXA 2P68A 3ESDA 3ZDQA 1J5PA 3F90A 1N7JA 2R6ZA 1AN9A 2X0KA 2QORA 2KBEA 3CUEF 4J0JA 1RWNA 1AKMA 1XAJA 2WT8A 3A31A 4K5QA 3O0DA 1PHRA 2VBIA 1O6FA 4BLVA 4J7CA 2VIIA 5CVJA 4OAOA 1ZRMA 2VJNA 4KX5A 3RTAA 2RI1A 3ZNPA 4A0RA 4PZ0A 1A2QA 5AM4A 1U02A 1LW6E 1SCBA 4MW1A 3ZW7A 3P9XA 5K0SA 2LCIA 3PITA 3H8VA 4X3PA 4YJFA 5DASA 1QXSA 2VQFB 5LQUA 3R8FA 3ENNA 5DZSA 2H5LA 2ANBA 1AH2A 3LVFO 3VMFA 4EHAA 2PGIA 4CIVA 3DVSX 3B8HA 4WJLA 4P9NA 4HS9A 1DAOA 3OPVA 2ESRA 2PMEA 1L8QA 1TLTA 4KL8S 3TJZA 3FKQA 1REQA 2ZR7A 1XD2A 4INPA 4J1NA 3RBXA 1XZQA 1ZJ6A 1V7QA 4X20B 1E3WA 3H16A 1G8FA 2TSYB 3DEFA 4IIBA 1ML4A 4OIFA 3RAFC 4G8JA 1R0YA 3LXXA 4FDAA 5ALQA 3P8ZA 1JHAA 2J8ZA 3AB3A 1IN1A 1H3FA 1P5JA 5HIJA 4UHHA 1E7WA 4AIIA 3C3DA 1AA9A 3FVVA 3L2OB 3PNSA 4I55F 1RADA 3O03A 4OHFA 3RVQA 4YCSA 3CEAA 4OGKA 2C54A 3AY3A 4WK6A 4CF5A 4ND3A 3ZBUA 2XGGA 2I6XA 3A1VA 4Z7OB 2YUIA 5C8ZA 4WUVA 2PUEA 2JJ2A 1R00A 4LJRA 3NXSA 1PEAA 2PQ6A 3PEFA 3HB4X 2JH8A 3K0FA 3LWNA 1PJZA 4Z0HO 2JLUA 3AVYA 2CVZA 2HM7A 1SK9A 3IT3A 5BR1A 3WLKX 1WZIA 2Z30A 5LFAA 2YJ3A 3C2QA 4D56A 4F4DA 3WNDA 3R7WB 2WVHA 3MLBA 4UREA 4YMSA 3QE0A 3T7RA 3FZYA 3GJQA 5L3QA 3NEAA 5GQSA 2G1KA 2NVUA 2WTEA 1NBOA 1T8UA 3Q3CA 3GLHA 3LP6A 2R6DA 3TTWA 1JH8A 4E1BA 5CB0A 1IBMB 1WB5A 4B74A 1T25A 2P79A 3HWSA 2FEAA 2AG5A 2DF8A 3ODGA 4KVZA 5KYTA 4HGRA 5IK2D 5G40A 3K71B 4UM7A 3VPBA 3BT7A 3GBSA 2HXSA 1F2UA 1UZUA 4TXNA 4HN4B 4IEFB 5JY1A 3AVVA 4M49A 5H8WA 4LHSA 1EFTA 3H1BA 3LUGA 1YR3A 4MH0R 4NEGA 5SV2A 3ST7A 3VKWA 4EB0A 1OAKA 1NVEA 4FKZA 2KM1A 2CBZA 3VZDA 4TUYA 3OTOB 2DT8A 1ETHA 1JNXX 3NNSA 5I4BA 5JDIC 1EWRA 1W96A 2HTEA 1ZH0A 3SF0A 3KUUA 4ZPXA 2N42A 3L40A 5L6MB 1WDLA 2NZUG 2Q3CA 3KXDA 2IHUA 3NYIA 4O0LA 4O8CA 4GC5A 4PQRA 2A7XA 1N5MA 1TQDA 4MIKA 4RA6A 2AE2A 4X1KB 2ZE7A 3UB4A 3ZIUA 3QELA 4EBBA 4M0UA 1RACA 1SXPA 2J59A 4KOEC 1HNZB 1YZKA 3TYXA 1R1DA 1MJHA 1N6HA 1RWPA 5ANRB 4YCJA 4U8GA 5LR6A 3R5JA 1GUAA 2NT3A 2H9IA 3PQFA 4BX9A 2E1RA 4TTTS 2D13A 4OU5A 5TARA 4DMUB 5KJCA 4D02A 1F0NA 5A7FA 2WQ7A 2CXXA 2QGNA 3PNKA 4QX6A 4ND8B 3DEKA 1G6HA 2IQIA 1OI7A 1JQEA 2A5YB 2FE1A 3LNTA 4R9NA 3B2EA 4MWCA 1VCNA 2C9DA 4AIRA 3U4DA 1ZR4A 2F1KA 1TMYA 4P53A 5JZ9A 3NWPA 3G0DA 1O57A 1UH5A 1ZSVA 2H63A 4TWAA 2XB2A 1QRDA 1J1ZA 4O02B 2WICA 4WA8A 4RK6A 1F8YA 1P2UA 2BFDB 1JKIA 4ZVOA 3CA8A 4V2IA 2IZOA 3SE7A 2C4NA 4CXMA 2GPJA 5KSPA 4DWJA 3W3AH 5LP6B 1XF1A 3IJRA 1TQ8A 3L3BA 4WCFC 4QYWA 4KE7A 1Y8RB 2CD7A 4GM1A 3AFMA 3VH1A 3F0TA 1I32A 4A2CA 2DEUA 1GDTA 2PMDA 1QH9A 2ZSIA 1KFCB 4EARA 3FCEA 3QMMA 4O08A 5HFAA 5JS8A 3IAXA 3D81A 4PONA 1C3JA 1Y33E 2Z8ZA 1U0JA 4FD3A 4BAGA 1KMIY 3G0IA 1PFUA 4HQRA 1GUBA 1Y80A 3RH0A 4AJHA 1VFPA 1TZKA 3LC2O 4MINA 4H4DA 1SKAA 1XXHE 2QZZA 5HDBB 3ZEAA 1AO0A 4MW2A 5C5CA 3F7NA 1UZNA 3DLHA 1B0ZA 2FWAA 1JHVA 1C7IA 2DBZA 2H1CA 2PTGA 1B8VA 4BFXA 1LPSA 3D3EA 2QN2A 3N0RA 3W2GA 4UTRA 1EFDN 4NP6A 1T13A 4HLQB 3EDOA 2WJVA 5M7EA 3H2BA 1R4NB 1UEJA 3BIXA 3VBEA 4BDTA 4Z53A 1I2AA 1UMKA 5HDQA 3HXKA 1NKVA 1S01A 3DVAB 1GSIA 3ZGXA 1FRQA 4OB6A 3FBGA 2Z1DA 3HJAA 3B3FA 2R1TB 3DZKA 5EZYB 3RR2A 2VK8A 2AR0A 5FWXB 2PN1A 1YONA 4PQYA 5EZ6B 3G7SA 1KF0A 2WLTA 3EZYA 4LHWA 1EFHA 5DX0A 1SNYA 2J1LA 4P4LA 2C7VA 1XRMA 3TBHA 2PL1A 4PGMA 3OCYA 4EJ2A 1QFJA 4NJMB 1L1EA 4WNAB 1Z2NX 2O9JA 1VSBA 1XLWA 2O50A 3HI4A 3QRWA 3HVRA 2P0EA 5CVUA 2Q7DA 3GJYA 3LT5A 4NCAA 4FMBB 1XRPA 5EZQA 4PHGA 1DT5A 3KU4A 1C7ZA 3B8EA 3IB6A 2I6GA 4NDZA 2XCOA 3NUQA 2X76A 1RXEA 2W6PA 3BS4A 2DJIA 1ZOIA 2EATA 3LHKA 3VZPA 5JROA 5KYYA 1Q19A 2YFHA 1XU4A 1PSDA 1XQXA 1XCLA 2O5RA 3GUVA 4KEAA 1YS9A 2HWKA 2JA2A 4C78A 1T9HA 1UPAA 3L79A 3EXAA 1VDMA 3E61A 1KAEA 1NC3A 2MSDB 4GUDA 3V1YA 4OJQA 1WZUA 2SKEA 3IELA 3A11A 4ZEVA 621PA 5B6PA 2IJGX 1F3LA 3PZRA 4BMYA 1PR3A 2G6TA 3T7EA 1UBNA 5CYOA 3UYLA 5AUOB 1O89A 1MIHA 5EMJA 2I4RA 3ZVRA 1CTQA 3G6KA 5LUAA 1T5HX 1DELA 5I7HA 4MULA 3GLHE 4F5ZA 3PPWA 2XKAA 2CFTA 1RQRA 2PAFA 3MUEA 4JJ7A 3H75A 3G2PA 4OYLA 4DN6A 3I04M 2FMFA 4QRDA 4RTOA 2R1VA 3D0KA 1OBVA 4G25A 2PZBA 4GYWA 4FEGA 5ENZA 5JVDB 2Q6TA 1ZI9A 1Z4JA 3NUGA 2JG3A 3TFQA 3HFGA 2GAOA 1DHTA 3DLBA 3KD3A 3MQ2A 1GSHA 4TWBA 3BMCB 2F1JA 3T7AA 5IDQA 5E7JA 2GVZC 1OJLA 3W9BA 3NV7A 3I73A 3CEHA 1ZAYA 5K3FA 1KE2A 4LEIA 2O20A 4LOAA 2UZ1B 3PUVA 4WVLA 2PS1A 2V9PA 3P26A 3R5SA 1I7LA 2ZJZA 4E5NA 3DH0A 5GV8A 1HO3A 1OXSC 2H2FA 4EVSA 2D62A 3ZDCA 2NQ2C 1A97A 3AY7A 3A32A 3SF8A 4I50B 2CMKA 2PH7A 1GPNA 5E95A 2AS0A 2GYWA 2VYVD 4JYCA 4ZGBA 2W4MA 3M82A 3OPYA 3D1VA 4PTLA 3OQBA 4MRMB 1JLLB 2F1HA 4N12A 2QT1A 1DJQA 5IEJA 2D3TA 4WL0A 4PLFA 2GPSA 3WYGA 4MWSA 3WJ1A 1NYRA 2AFHB 2W11A 4XTCS 1K0UA 4LNHA 2JIOA 3GVPA 2Q2QA 3O1HB 3SVLA 2OZLA 2XCIA 1NN3A 4W8HA 1U0HC 3CVWA 4CV0A 1G7CA 4WKNA 4AKSA 1GYPA 3COJA 3MCZA 2BY4A 5HRAA 3OZAA 4M0MA 2V7VA 4L8WB 2RBGA 4RMNA 1PLKA 2D5CA 2AD5A 2GESA 2VZLA 4WH0A 3AEQA 2WFLB 2Y1LA 4LIPD 5J5VA 3UUEA 1N0IA 5KYUB 3QYFA 4Z7JA 3VO8A 3SIRA 4ESHA 3D8SA 2HA7A 2ADOA 2GZRA 4FPXA 3DWEX 1CU1A 3UH1A 5DX1A 3ABZA 3NVMB 2D7CA 1GQSA 5BOVA 1ZM7A 4LKRA 3DMDA 1Q16A 5BNFA 1Q74A 2W70A 4W7HA 4YRAA 1DKRA 1G4AE 1SBNE 1D6NA 2W37A 2Z43A 3FUXA 1J0DA 3WIBA 3FIJA 3W5JA 1OH8A 1I33A 3O8RA 4OGWA 1P1CA 1XIVA 2H7VA 4EB3A 1R8SA 3RYHB 1U8XX 3AW9A 3SM9A 3FNFA 5BUSA 1GAJA 2P30A 2CCGA 3DC2A 2XBMA 3T7SA 1N2EA 2XH8A 1E9DA 2FSFA 3JYLA 3WS7A 4L0MA 2BBWA 2A86A 3FLMA 4DF3A 1TLLA 4XFKA 4QULA 1C81A 3V42A 4YJHB 5B1YA 2BD0A 2VYFA 1V9LA 2XY4A 4ZOBA 3EQ8A 4ME6A 4RTMA 3O4VA 3W8FA 3BHNA 1BHSA 2QGFA 1G5IA 2VCHA 2VLBA 4EA6A 4S1TA 2R4QA 4TKMA 3WISA 3DNFA 3GJZA 3SQLA 3ORFA 5DBFA 2VJCA 4R9UC 2F4NA 4XXHA 5EI5A 3WGQA 4F2PA 4BY9E 1YR2A 1JJAA 1FF9A 3Q5EA 1XWIA 2VVTA 3SP1A 4EPXA 4KBYA 3NVAA 4O4HF 1COWD 4YRQA 4GKKB 2F1RA 1BMQA 1DTWA 4H4CA 4RD2A 2NYAA 3K2QA 3R41A 4KMSA 3D8RA 1PJCA 1OLXB 9ATCA 1YMVA 3WLNA 3SXJA 1NQUA 1WF3A 5IF3A 2BTOA 5ADUS 3ZCXA 4B6QA 4I4TA 2P2ZA 4YCMA 3NH6A 2NQTA 2IIBA 3LV8A 3NCTA 3ILYA 4HRXA 5HR5A 1SCUA 1U9JA 3A05A 2K7FA 2D1YA 3IBTA 4XLLA 3AW8A 4NX2A 4HB0A 3D02A 1ZCAA 1JDSA 2VF2A 3QPBA 4IAOA 4JI0B 4B8WA 2BJHA 1WDTA 4MWBA 2WUGA 5K2MA 3AM1A 3AF3A 4KQWA 3FKSA 1M2EA 2Q6LA 2FR8A 4LZOA 1KH2A 1VG8A 3BTUA 1GRQA 3IBYA 3ZHZA 5CLJA 4YRDA 4X3CA 2YQ5A 1RJGA 3T1QA 1HZJA 4FGWA 2YICA 3ZEIA 4G89A 3PGXA 3EIWA 1L5SA 4MS4A 2BUCA 2OCBA 1GM5A 3GEEA 4GAEA 3QVOA 4BQIA 1S1MA 3Q8KA 1AXGA 3EAQA 2QROA 2IP4A 2VYVA 2V5UA 2WWXA 5EEHA 3NAZA 4HAXA 1WHSB 4U0KA 4F4FA 4DIBA 3MJHA 2P78A 1I2MA 3TIVA 4ZI7F 1F2UB 2O8NA 4AJ4A 1I24A 5DJ5A 3RAPR 3F9IA 1BE8A 1FOEB 3UJCA 1K7EB 3PTZA 4JL5A 1EGMB 4YREA 4DSNA 1TEZA 2Y1WA 1RRKA 5ESXA 3S1AB 4BRZA 4OFWA 5EHXA 5J47A 3UO8B 2I6UA 1WF6A 3GARA 3HDQA 1XZHA 4P0QB 3O2QB 2AOVA 1VSQA 4MVJH 2QRVA 2GQ0A 3RIGA 2JKZA 4MA5A 1VL0A 1BDJA 4EA8A 3UXHA 4UNNA 4JR2A 5THXA 3Q8LA 1WD7A 3DF7A 3FJYA 3PFHA 4KBGA 4IIXA 2AA3A 5HF9A 1UBKS 3WGNA 3N2GA 4C03A 5JNLA 1PZGA 4D4JA 2Q49A 3P2OA 4G0VA 3VNQA 1FNNA 4EGJA 3TEMA 1M2NA 3FTPA 5FOTA 1XJWA 4DCJA 1PS9A 1POWA 1G3IA 4M89A 2AZ4A 2GJ9A 3UNXA 2YMQA 1ISRA 1DINA 2CLLB 3DMFA 2YTZA 1G9TA 5PGMA 1SBTA 2AXEA 4HQNA 4YWHA 3K1JA 2GBCA 1X9GA 2OHVA 5EXSA 5BXYA 3NDBB 1KSJA 1NLMA 4GZMA 4H7HA 4P4SA 2RCNA 3LQRA 2RG1A 3QUSA 4HKTA 3VVLA 1N0UA 4ZOLA 5DM1A 2XMBA 2KI5A 5ALFA 3IP1A 5H59A 1KJZA 4KW7A 4X84A 3VPAA 4EUNA 1A5ZA 4OOEA 2C78A 4UBOA 4NYIR 4JL8A 4IHJA 4JLJA 1FTNA 2FSSA 5AJHA 3X2EA 4PICA 3R7DA 3JQRA 5LQRA 3QU5A 4L74A 4Q7JB 1U99A 1IL0A 1B26A 3NNDA 1ZCJA 1BXRA 1NIJA 3PHLA 2L19A 4YO7A 3AL3A 2XMDA 4N41A 4FZ5A 4BFUA 4AKIA 1IG3A 4IDEA 1GZVA 4BLRA 2HB6A 2JFXA 4L2IB 3UCXA 5KTYA 2PZKA 5B4UA 5I8PA 1YQ9A 1MVNA 1S1CA 5FWNA 1B2RA 2QN1A 3HCBA 2VT3A 3OAAA 4O4JF 4Q39A 4DCGA 3KKPA 5FOSA 1G0OA 3QKSA 5LBIA 2CHQA 3EIUA 3K0EA 3LRXA 3LCRA 4QUGA 3KOXA 4GBJA 1PNVA 2J45A 4D43A 1O8BA 3M81A 1CUXA 5ALHA 1G2IA 2Y92A 2HOQA 3DR5A 2FZ4A 3UATA 2R8YA 3J81A 5IVPA 4JGIA 1EJ2A 1WZNA 3LTEA 3ZV7A 4JH0A 1E89A 5CX1B 2GGSA 2PSJA 1N75A 2DWQA 1QGYA 4XB2A 4D8YA 1HI9A 1EWKA 2CBGA 1JEQA 1QH1A 4ZMRA 3V8PA 2B4TO 4AJIA 3D4IA 4Y2SA 2D5LA 1LPOA 4EVIA 2OXTA 2IBTA 4MUXA 2XD9A 1DNPA 1JSXA 3GW8A 1WUJS 4JJKA 4DIFA 5LXTB 2DB3A 1YZFA 3VOTA 1ITZA 4LGCA 3SQWA 1N2CB 1W47A 4JBXA 4JLSA 3MJSA 4EUFA 5KQSA 1YVEI 1W8DA 3PTLA 5F2EA 1A8IA 2XUQA 4PX5A 3ZDBA 3GLGB 5F3DA 4W1PA 1JKJA 2BIFA 3CLUD 5BVGA 3KLMX 2A9QA 3Q7SA 4O4LF 4RGYA 5CDSA 4RY9A 3QLUC 1YR9A 1AUQA 3I64A 2PT6A 2BMVA 1RWXA 2C8JA 4PPNA 1H66A 2MSNA 3L0DA 1EVKA 3FZNA 3P9NA 4W5OA 1JQJC 4CM3A 4UD6A 2QX8A 5HKAA 3PX7A 1PW5A 1Y7TA 2QLJA 3MAJA 4CG1A 2ZDHA 4JJAA 3OOSA 2FB9A 4ENPA 4OF4A 3BMQB 2O3RA 4YJ3F 4E08A 4E2XA 1HC7A 2I4LA 1PNRA 1GTG1 2IEAA 3II6X 1LKZA 2FA9A 1XTIA 3AL2A 4PO9A 5K8VA 5KYWA 4AVYA 2CSUA 4Q1EA 3PT9A 4YAEA 3R20A 4NWIA 5EPUA 3L4EA 1LF0A 1QCCA 2G70A 5C3UA 3OZDA 2QUIA 1F4VA 3C4VA 4X97A 5G4KB 3TLCA 5EUCA 5EZ5A 7ABPA 3S1LA 1Z39A 1SWVA 1SG0A 4BKOA 2XUGA 4KSBA 3IRUA 3LRTA 2B78A 4WASA 3BFPA 4DG9A 1Y1TA 1GU7A 4D0SA 4YY3B 2XTZA 2ZE5A 3EMKA 1GN8A 4YQEA 4NJEB 3GQBB 4RD4A 3VA7A 5JJIA 3A2LA 3EYWA 1GQRA 5TRTA 3DCIA 1BFUA 1DKLA 5CM2Z 3O93A 5DNDA 3INTA 2J67A 2Q5OA 3FD8A 2ECFA 2R1VB 2QZSA 4XZ3A 1RE0A 1NP6A 1B43A 3ELBA 3MYYA 3T6KA 4F3TA 4AF8A 1U5BA 3EEQA 4K9LA 3Q6NA 1BVHA 3LA8A 2V6GA 5F3RA 2OCKA 1G55A 3FHOA 4X00A 3Q10A 3R5HA 4NNPA 4BVEA 2EX1A 4LVOA 4QGFA 3WHPA 4ONEA 1QVVA 1FUIA 4BRUA 3JQAD 4DBLC 1OC2A 1YASA 2DUUA 2EU8A 3EG5A 6LDHA 3FJOA 3I2YX 3BILA 2C2YA 2FUG6 1XA0A 1OGIA 5A02A 1Y37A 5J5CA 2VP6A 4ZALA 4CV3A 4DA9A 1TM5E 4KXLA 2Y9MB 2ZBPA 4Y0AA 4AP9A 2YFKA 4YHHB 4I2VA 2C2BA 4NZ9A 4C4PA 1PD0A 1QSGA 1PCXA 1AKYA 1G8YA 1GHTA 3I45A 3OQNA 5EUQB 1X8KA 1N77A 1OTHA 3C3EA 4S1OA 2VUSA 1Z4KA 4V38A 4DJEC 1KGDA 2A9RA 2H8GA 2YS7A 5GAJA 3U5TA 5HNKA 2GBPA 3MTEA 3CJQA 2YMMA 1HA3A 3EXFA 3IHTA 5T41A 2A8YA 3GEDA 5F3WB 3CH6A 2J3QA 1ZWKA 4B4UA 2CXHA 4PZ9A 2J0UA 4J3FA 2KYRA 4B82A 4E30A 1TAUA 5FDFA 5D85A 2PT5A 3IBGA 3LX8A 5F2OA 4CT0A 1YNOA 2YDXA 4P7BA 1XWWA 3CM0A 3FMFA 3UF0A 4BMVA 2W2NA 3MJ4A 4DJDC 2MSEB 2I71A 2WPDA 4TWJA 3RLFA 2Z08A 2F43A 2GFHA 2R6CA 3OZUA 5F4BA 4AU1A 2BCEA 5IDWA 3C1AA 3CTPA 4I5FA 4YRTA 5LDHA 2QBYB 4Y9TA 1R27A 3V1TC 1OBCA 4GKVA 3D43A 1YC5A 1CY1A 1FS4A 3A1UA 3IVGA 2HA3A 2GAAA 4O8ZA 2ZYSA 4MRRA 4N7BA 4XRRA 4EYSA 1FUYB 4EW3A 4L4SA 3WG9A 1GNSA 3OC0A 3NEYA 2NYRA 3CZRA 4CYMA 1CF4A 1KZ9A 2A9JA 2FF5A 1Z0IA 4PSVA 3RJZA 1KAMA 1OGJA 1GUFA 4U6QA 2OHGA 5BQ5A 2OXFA 3MEQA 2Y2UA 1V6SA 3AP1A 3BD6A 3LC1O 4Z8XA 1I8TA 1WRBA 4IMRA 2CL0X 1I5EA 4GRAA 1ZI8A 1UDBA 4AI6A 2GD6A 3QXHA 3L02A 3M5PA 1DZ3A 3VJMA 1QOPB 3D6JA 1L7VC 3MIIA 4FBMA 1FFAA 3VR4H 2GF9A 4KREA 4M9ZA 1C41A 5EGNA 3GZNB 1D2MA 4BNVA 2HSJA 4ZQIA 4AXXA 4AZ3A 4HOYA 2WUFA 5CBKA 2NAPA 1R5BA 2HMAA 1FQJA 3IUPA 4MS3A 2D6FA 4Z4QA 2JJYA 3HV0A 3EB9A 2DFTA 1K3TA 4YALA 3RROA 2IYVA 1CY8A 1GV0A 2EKQA 4QFMA 5B1HA 5KTKA 3LVQE 4U02A 3SK0A 3RVMA 5ALWA 2QRNA 4I36A 4OI2A 2AGVA 2ZAYA 3FOFC 1E66A 3H5LA 1RJWA 4PYOA 1PYGA 3O83A 2DFDA 2K6GA 1DFHA 1YO6A 4JLVA 2P4HX 1Y8CA 2NQ8A 4HJRA 2VPZA 1DTWB 1U2PA 2VQSA 5JAQA 3T7IA 2BKVA 3HKEB 5REQB 2XW6A 4F3NA 2Z8XA 3L0OA 1KMQA 1LSJA 1TM4E 2EZUA 2FJPA 1QU3A 5E7QA 3E27A 3VDXA 2EHJA 4OOFA 3LOPA 3RABA 2QX6A 2ZSKA 1RTTA 3UAYA 2A9KA 3HEMA 1E6MA 3CBGA 1X1DA 4FDLA 3USES 3MCWA 3O38A 2XGOA 4KR7A 4TKUA 1JEEA 1VJ0A 1X3SA 1GZUA 1KKMA 2ZRFA 1F4PA 1GTJ1 3BBPA 2I1WA 3BB4A 3BH7A 3DPUA 1YRAA 2LKCA 2QTVB 2WUVA 3EH2A 3NTUA 4AQ7A 4CQNA 2D8AA 2QJRA 2ZFUA 2WV7A 2E4YA 5EP2A 3BFXA 2QRQA 4MQFB 3SJAA 3R0JA 1Q7TA 5CNIA 3QX9A 2H4YA 2MDTA 1DX6A 5HRCA 5KTRA 1NM5C 4ZO4A 4UBIA 2PPVA 2AE1A 5EJ4A 3PD1A 4P81A 3A6FA 3NBMA 4ZOEA 2ZTMA 3ESRA 2B2NA 5KTPA 3KVVA 4C43A 1KYVA 1U8YA 1NURA 3BORA 2HU2A 4ZVPA 2GCIA 4OHRA 5CCXA 2G4CA 3KKZA 1RZRD 2XYGA 1AXEA 3B85A 4E4RA 2E9SA 2QQFA 1KARA 1P39A 4IG4A 1C3EA 1Q57A 4MR9A 4OB8A 5DTMA 4G5FA 3G9UA 2XRYA 4N54A 4CWAA 2WPDD 3U4CA 2NMVA 3P9IA 2CE7A 2FQ1A 2E6KA 4G36A 4YK7A 2XUIA 2I22A 4EW2A 1F48A 4MVJP 3VYRB 3FHCB 3QFTA 3R77A 4A5SA 2PVCA 1HNNA 4JYAB 3T5GA 4D4LA 3HFRA 3QVVA 4CKBB 3RFXA 1L5YA 2NPOA 2XVYA 3NHBA 5T3YA 5JFGA 2CEAA 4W6ZA 1FRVA 3NMUF 4MIEA 2X0NA 4B33A 4DDKA 4IDAA 4DR5B 2E48A 4G0NA 4WWHA 5K8UA 2ZCJA 2JCGA 2V0CA 2JASA 2JJ2D 3QEBZ 3G2JA 1VE1A 1WXDA 4L6CA 4M4SA 1CKEA 2EJCA 5F52A 5TMEA 3V46A 4HRYA 4YYEA 2IYAA 2OGTA 3ZVLA 1RM5A 1ZA1A 5DCLA 4AW9A 3PE3A 3GLFE 1N2ZA 3PHGA 4FINA 4FJ0A 1XX6A 1LTKA 2QLNA 2XNKA 2QXYA 1JDPA 5ERXA 3BRCA 3WRYA 1AQNA 3C5HA 4QYXA 4U7FA 1ISPA 1CR6A 1R6UA 2G80A 2PUVA 2V7GA 5GM2A 3U81A 4CLRB 3HCCA 3LSTA 1SR8A 1K75A 3W6PA 1QZ3A 2QL6A 1T9DA 1TT5A 1WP9A 1QBKC 1TJ4A 1HV8A 1FFXA 2EV9A 4MUNA 1YQUA 2C2XA 3N8HA 2IU3A 1WXWA 2ZRHA 4RVHA 2O5EA 1KDRA 2CVFA 2FZGA 1UBUS 1YMUA 2I66A 2JIDA 3PJGA 1ZD8A 4U7JA 2P2LA 4AMUA 3Q4GA 2FSUA 3AOEA 1AZSC 1QX3A 5CVCA 2VAPA 3AFHA 1V5GA 1QGZA 2JFBA 3L0SA 5F1OA 4OK5A 3ZPXA 1U3UA 4DMGA 1E3SA 2IXGA 3EZ2A 1XZDA 3LX6A 3COVA 3HRKA 1E20A 5FADA 1F6BA 2YZGA 3C6KA 3K4HA 3ZIDA 3SC3A 3FI9A 5LJIA 1XTKA 4Z3KA 4JLWA 2A5FA 4Q66C 2RGAA 1OB2A 2C99A 2IHYA 1A1SA 1AF7A 1YRBA 2XTAA 2ZUUA 3F4KA 3ZDRA 1ZOSA 2FLWA 5CHYA 2OVFA 1A96A 3W1EA 1QH0A 1TAHA 2VP3A 2BYTA 1UOQA 3INGA 4GQAA 3PI7A 2A5LA 3PQCA 2HZ7A 1L5MA 2J6IA 2YY7A 4OM7A 2O2XA 2OL4A 4QASA 4UPDA 2PMFA 4JK3A 2IELA 1MVOA 3HV2A 1ZBDA 4JI3B 4R0VA 3KZKA 2GBIA 2PH5A 1DVRA 2RKBA 1UIMA 2I4OA 4ND8A 1HT2E 1KDYA 5FNZA 1ORHA 3CN7A 3VOSA 4RZQA 3OLWA 2CXUA 1FTYA 3INYA 5KPJA 1YACA 3G9TA 3TQQA 3FYUB 1R8JA 4AMBA 5CP8A 3CMMA 1W36B 5K05A 4LC0A 1UJ4A 3A9UA 4H1HA 5IYZF 2IUFA 3RTCA 1T4CB 2O48X 2RIPA 1E1RA 1ZN2A 2HWXA 5H0IA 1Z7BA 5LCXA 5CXUA 4Q1DA 3K7EA 4RTQA 3LC7O 1MT3A 4E21A 2VRNA 3OY7A 4AYWA 2BMJA 4U2KA 5H02A 3UJHA 1YNSA 3KQWA 3F3KA 2D1QA 5BUQA 4BZXA 1QB7A 4ARUA 4J0FA 3RJMA 4J1TA 1ULAA 2FGKA 1G1MA 1ULZA 3OJLA 3UJ9A 4V0LA 5EJ2A 2NSDA 4MW0A 1MOSA 3VR6H 2GPTA 3MW8A 1EVYA 4MWEA 2WHEA 4Q1VA 3CUUA 5J4VA 3KPVA 1RR6A 2GN1A 1BXKA 2BMAA 2I4IA 1LPMA 2JCYA 3QTTA 4POOA 4G2NA 2BVNA 3OTHA 1NUUA 3D8HA 2QLTA 1C4WA 3LX5A 1FXWF 1PU2A 4NAUA 2R8ZA 4LWPA 1OAOC 4G8BA 3VX3A 3OPXA 4W9NA 3HP4A 3BC1A 5I7OA 5CR9A 2H2IA 4FKMA 1TM1E 4G5SA 2F6RA 1RWBA 2QTGA 2AF4C 2ZULA 1O5OA 1JR2A 1W0JD 2PH1A 3P4XA 5L3VA 3EQ2A 5C31A 3HDHA 5NULA 4ON9A 1OH7A 4ARCA 3RSLA 1YZYA 2JIMA 4ND6A 5H9VA 3L8YA 1R15A 4IQGA 4OXNA 1NN5A 2FSGA 3QYAA 3W9SA 4QT4A 2VJYA 3GPCA 5KJFA 3RSGA 4WRRA 3TR5A 3OLZA 3IDFA 2XUFA 2MYTA 3W06A 3U7EB 4K2HA 3AHFA 3IBCA 3IESA 5DI9A 1RQLA 3HB9A 5E9JA 4C30A 1CNMA 2A67A 5ESRA 3WYNA 1VQ1A 1AG9A 2LBPA 5IKMA 5K3OA 2QW0X 2PUBA 1DRVA 2WJ6A 5TPZA 3ZWKA 1KQGA 3IH5A 2GN6A 4TVOA 3WGZA 4NXMB 5AW5A 3Q9SA 5F35A 3W7BA 2XUAA 2GAFA 1OXTA 1JDJA 2R2AA 1S3IA 1DQRA 3JZAA 3QKIA 4HHEA 4II3A 1UBCA 3OT1A 1PUXA 1YHYA 1CW2B 3UMFA 3D8UA 3R3WA 4YAUA 1EUYA 2C0PA 1QOZA 3ZZNA 2EJUA 3G8CA 3NDRA 5K3FB 1XEWY 1X1RA 5DLDA 4E12A 3RU9A 1MAWA 4BP1A 1NT2A 5CPBA 5ALTA 2V8OA 1YZVA 1FLNA 4F93B 3ID6C 5JHGB 2ZSDA 3NHZA 3HSYA 3ZIAA 4B6SA 4DV6B 2VPPA 1I3NA 2HU8A 2XOKA 3G9ZA 3PC8C 4G0XA 4G56A 4LX8A 3OUUA 4RA9A 2HIHA 3N0WA 5EJ9A 1MJGA 1GIAA 2A57A 3CZ9A 3N70A 4L5AA 3SEAA 5AVZA 3K6SA 3ICOA 3B13B 5ELMA 4DLYA 3U7IA 4AS1A 2PSFA 3DQQA 4NEHB 4ZJUA 3TEJA 4QOSA 4GX5A 5IUJC 1KERA 4AY6A 2GM9A 4JLOA 1JKXA 1E7MA 2H7CA 2G71A 4C6HA 1Y9EA 1PNOA 4K3VA 2WNHA 3K0CA 4R1TA 5JCZA 3ZD8A 4DCPA 3K8OE 3BJRA 4EJMA 1UMCB 4O4LB 1EINA 1JIXA 2PX8A 2WIBA 2VBCA 3W6UA 4MKRA 3V4ZA 3TAUA 3WADA 3K70B 1LSOA 4QNMA 4F72A 3GF4A 5EE5B 5HKOA 1M8FA 2UZ1A 1WXQA 4R3NA 3VBCA 4KRFA 1JTEA 1JFSA 2FPMA 3UHFA 4NCNA 3HJTA 4L6AA 3IS3A 4UUNA 5L7TA 3GDWA 2JI4A 4S1VA 1XEAA 3QEMA 521PA 2VQDA 5T8KC 2JHPA 4Z0PA 3T9AA 2XCSB 4MARA 1I0IA 2WIKA 3LUDA 3TW8A 3UJDA 3J7AC 3MQFA 3SJUA 2QD1A 3LKBA 3WLIA 4BP8A 1E8NA 4Z1MD 1CUVA 3O8DA 1PR0A 3DVLA 4UVGA 3WIVA 1VBNA 4ZTZB 1DJMA 3EGDB 5DYNA 1I3LA 2CGEA 3ESQA 5K99A 3AWIA 1CK4A 3DMTA 1ODTC 4UDYX 2INGX 1C8VB 6REQB 1F12A 3LFHA 2CXRA 3P0JA 4U2FA 4F3YA 3DEZA 5KYUA 4Q5IA 1LVUA 2XRMA 3H2ZA 2KX7A 2CB9A 1EUCB 3HKEA 3GAFA 1IFXA 3ZQJA 1HG1A 3IPYA 4CMGA 1PKEA 2RHBA 3STXA 2FPSA 2R5NA 3N2LA 3SMVA 4AS2A 1BVUA 2HRZA 3VU9A 2VNKA 4NMWA 1FFYA 1KI4A 1EVIA 4DDWA 1PR5A 3I6ZA 1ATZA 1V8DA 1XAGA 3AH8A 4GX0A 1BDBA 2WF6A 3K9WA 3OX1A 5U4XA 4DKJA 3GN1A 1SCUB 3WB0A 1IQ0A 1T6NA 3CRNA 3WB1A 3BFKA 5KWSA 1KEWA 5CNKA 2P11A 5J23A 3ETJA 3ND7A 4G5HA 4IWYA 4JDPA 4X85A 1BWRA 1W4CA 4NR0A 1K4MA 2HCFA 2FHPA 1HLGA 6Q21A 4AFNA 4CEHB 3TVYA 1SH7A 2NV6A 1CQIB 3IR5A 3I0ZA 1NJSA 4TTRA 4XQGA 1COWA 1YRLA 3HA5A 3KR9A 4KLAA 3VDQA 4ALKA 1GCGA 3VSBA 3ZHVA 1NX6A 5F21A 3AVWA 3KVNA 4NV1A 4TL9A 3RS9A 1PX0A 1GJRA 2BLNA 3I2GA 5E4YA 4BYGA 2D5IA 2OPBA 1E61A 1Z2AA 3TLYA 4A1OA 4WINA 2QN6A 1I5RA 4R40A 1R50A 4UZSA 4N47A 2V7WA 3ENWA 1ZU4A 2ZJ0A 4MTLA 3OPQA 3GELA 4A1FA 1EYZA 3TE6A 1F7UA 3O1IC 4GLLA 1XHEA 1FA9A 4DEYA 2ZRMA 2AMJA 3DXZA 1HE4A 1PQ4A 2EC5A 4AN0A 2DQYA 2VI5A 4ZKEA 2BH9A 5HKBA 4N82A 2R97A 2WU3A 1W76A 1P74A 1LXCA 2QD3A 3DF9A 1SUAA 3ISVA 4JQYA 4I5IA 3OMXA 2J3EA 1MRSA 1V8FA 3F6RA 1H9CA 3E0XA 2FEOA 3AUAA 2WJPA 2C2OA 4Y98A 4C2AA 4AYTA 2HRCA 4EPVA 1EFPA 4F4HA 3DA8A 4M7OA 3RS0A 4IOMA 3WO1A 4D2IA 3DTVA 4JX8A 2AN4A 4QLBA 3CFYA 5AKZA 3E9EA 5ALXA 2NAFA 4NVRA 5DO9A 5B3AA 4JUFA 1KSFX 4MUFA 4C4SA 1J0XO 3EGDA 1OI2A 4GMKA 4YV1A 1CVIA 1SU6A 4HVTA 1X77A 4K86A 3RYCA 1CUEA 1K1EA 3ILSA 3UK6A 2RARA 2X0DA 1TADA 3NI2A 1YQEA 3DXFA 3EIXA 1JL3A 1OYOA 4AP6A 4RWZA 4ESOA 1JWBB 5E4TA 3BWVA 2E21A 1KI2A 1XJ5A 4D3ZA 2J5XA 2W2PA 4QJ3A 4JKYA 2UAGA 2OFFA 5DNAA 5A1JA 1EUDA 4LRSB 4Z0NA 1M0EA 4EGCB 1KK3A 4JU9A 1XMPA 3H5WA 4DUZB 1JG4A 4RK0A 3PIDA 3RG8A 4DDTA 3QI2A 2WWYA 3L0YA 1XNJA 1LC0A 2J09A 1LDNA 4NQZA 1T9GR 5EGSA 3ZE6A 3C87A 1P45A 2OBMA 3B51X 3VUEA 3A6GA 3QH4A 3SEQA 1UJMA 4JLMA 1VB5A 1AQIA 5KS2A 2JBAB 1YAHA 4RHTA 3AK4A 2CJWB 2IYLD 2XNHA 5TV2A 1RYMA 1A9PA 1XJCA 2FPUA 2HHAA 4BO3A 1LJ8A 1PT6A 5IXJA 4CMAA 3IT1A 3LWZA 3ZZ0A 4FTWA 5E8JA 3EYAA 3PFBA 2V96A 4JELA 4D6XA 3QX7A 2NO5A 3VYSB 4RDIA 1KJYA 3V7YA 3IIEA 2PH3A 3VSCA 4ZYWA 2XDQA 3I6MA 3VR5A 4BZPA 1RXUA 1JR4A 3AO0B 4PHFA 2AZDA 1JWLA 4AZ0B 2WVGA 3LYHA 4Y1GA 4YAFA 1P7VA 2VPTA 5AW7A 5GIOE 1DTSA 1NN0A 4EG8A 4RHEA 5AK3A 1ZJ5A 2X1LA 4ZQGA 1Z5ZA 2CKDA 1SHZA 3OLVA 4JY7A 5IUKC 2J5RA 1U0RA 3DMPA 4PBTA 2PS0A 3BSYA 3ASVA 5HFJA 3NWBA 3UC5A 2ONKA 4RW0A 1PWZA 5LXTA 2QM8A 4KVAA 5EJEA 3P97A 3NM5A 4WK4B 3IDZA 4QLAA 1OBHA 4RQAA 1K2WA 3U0BA 1TCVA 4D3YA 2EQBA 2YVQA 1CUWA 3T3MB 1W5FA 3QKRA 3A3KA 5FJIA 5CA0B 4QOHA 1DAFA 2Z98A 4MICA 2BFAA 1PX2A 2WKRA 2ZRQA 3GFGA 2MYPA 2OBLA 1EP2B 4LSWA 4B73A 2B4YA 4PTYA 4K9SA 4NTZA 3H9CA 4FFDA 3EF0A 2QTRA 1NJ1A 4US0R 1DQSA 3DE1X 4P4TA 1FJ2A 2RAUA 2VAMA 3ORRA 3QKSB 5FBRB 4KR0A 3JQEA 5CM9C 2B20A 4M0KA 1W87A 1FVOA 1YK0A 2MU1A 2H2HA 2FP4A 1E2JA 2IYYA 1RLIA 2IS2A 2Q9AA 1K6EA 2DUJA 3F5MA 3K4QA 3R7BA 1KI1A 1G7SA 1UDAA 4WESB 5DCUA 3TZHA 1UT6A 3BMQA 3FNEA 3M3PA 4XQEA 4LF7B 4LMBA 4YI3A 4QGAA 2PU7A 1GV1A 2QENA 1YBVA 3PFWO 2FQXA 5EZSA 3I52A 4TXJA 4PYQA 1FFSA 5GM1A 4YP5A 4F9GA 5I3CA 5DYTA 4OI0A 3T3OA 3GT7A 2ONCA 2A9VA 1FLVA 4EKGA 2H52A 4P6VF 3PC8A 1WMSA 4LDJA 4TLEA 1KZYC 4ZYZA 1VE6A 4H4EA 2NXEA 2BM8A 3D7MA 3DCYA 3L93A 4MR8B 3C6BA 4UATA 5JECA 1APBA 3U7HB 3U4MA 4B6RA 3E9CA 8MHTA 3JQ6A 1D4ZA 4E2WA 5AO9A 1VLLA 1MEJA 1NPTO 4YR9A 4DEXA 1UK7A 3MLAA 4DQLA 1UOPA 3IQDB 5CFQA 5FX2A 2V1XA 3T3NA 1VL1A 1B6SA 1NQXA 3EBPA 1N8SA 1RHMA 3ZU6A 4QQRA 1RAAA 4GOMD 4L4UA 2C96A 5E2IA 4HB4A 2W2LA 1LW7A 2XMQA 3GJ6A 4PRZA 3HHEA 1D2RA 2QMUA 2R8XA 2SKDA 3U1TA 3UOGA 1DQYA 1ZD9A 1MG5A 1TF7A 2EXXA 3A1EA 1IEXA 2IYQA 3IULA 4JB3A 3PDJA 4M1SA 4D44A 3RSZA 5IVIA 3U2QA 1PGJA 2WUWE 3WLQA 3PPXA 4FB4A 1CLEA 4I4IA 2BFBB 1KZ4A 2YIMA 2XWSA 1M2JA 3G9QA 3ICPA 4FK8A 5KQGA 3ZDYB 3MBIA 1KIAA 2E5WA 1OILA 1PJ2A 3W1VA 3HB7A 1SB9A 3OJ0A 2PJZA 4TROA 4BQQA 4QYSA 4NXNB 4LYGA 1ZNXA 3KO8A 3W2EA 1BMFA 1AK1A 1Q6YA 2VQ6A 3HKDB 4HMPA 1CULC 4K0RA 4Y2GA 5HF8A 1P18A 3MUNA 1LFAA 1Z2DA 3KKOA 4KQEA 1SBQA 4PXYA 5AKYA 3VDMA 5J2TA 4LOKA 1U9ZA 2I4NA 4K88A 3RKRA 1IN6A 3IHKA 5CXSA 4MVYA 3RVBA 3HXMA 2EL9A 5LLTA 2VNHA 2IBMA 2PSDA 1NVKA 4R8RA 4HDMA 1R6XA 1ENOA 1JEDA 2PGJA 3HJFA 1ZM3A 1TJ3A 3GUCA 4B2PA 2BSAA 4BTVA 1V25A 2A33A 5DE3A 4RJIA 4FDUA 3NC4A 1Y48E 2B1QA 3FUTA 1CSEE 3MTIA 3M4NA 4ZYYA 2GXAA 3QMPA 3O3NB