1RWPA

Crystal structure of human caspase-1 in complex with 3-{6-[(8-hydroxy-quinoline-2-carbonyl)-amino]-2-thiophen-2-yl-hexanoylamino}-4-oxo-butyric acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 47
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwpA00
4EHKA 1SC1A 5LUBA 3UOAB 5I9BA 2WDPA 4ZVRA 4NOLA 1ICEA 1K86A 4D3YA 2HBYA 5IABA 3E4CA 4JJEA 2FP3A 2H51A 3KJNA 4HQRA 4NOMA 4PRYA 4N7MA 1NW9B 4FXOA 3R7BA 1KMCA 2CNLA 4QUGA 3V4LA 2QL7A 2XZTA 3GJQA 3KJFA 1RWNA 2DKOA 2QL9A 3IBFA 3KJQA 4N6NA 4LSZA 4NBLA 4QUIA 2C2MA 1RHRA 3DEHA 3ITNA 1SC4A 3SIPA 4EHLA 4DCPA 1K88A 1CVRA 2CDRA 4NBNA 4EHNA 1RHQA 3NKFA 4M9RA 5LUAA 5IBRA 4QTYA 4ZVOA 3D6FA 1SC3A 1QX3A 2CNOA 4QU0A 4EJFA 2H48A 4IEFB 4JR1A 2CNKA 4N5DA 2FQQA 4QUAA 2C2OA 2CJYA 5IAEA 1RHUA 1CP3A 5IAKA 1RWPA 3GJSA 3D6MA 3DEKA 3S8EA 1RWVA 2FUNB 2H54A 2H4YA 1RWKA 3H11A 5IBPA 2C1EA 2QL5A 5IARA 1BMQA 4QU9A 2C2ZA 4FEAA 3EDQA 5I9TA 4D3XA 4FGUA 2H4WA 2H5IA 4ZVSA 1RHKA 3PD0A 3H11B 2Y0BA 2QLJA 1F1JA 2HBZA 1RHMA 2HBRA 3R6LA 4N6GA 5IC6A 3V4OA 4DCOA 1RWOA 3DEJA 5IBCA 2CNNA 1SHJA 2XZDA 1PYOA 1SHLA 3R5KA 3V55A 3V6LA 2P2CA 1RHJA 3PCXA 4JQYA 4JJ7A 1NMEA 2H65A 1NMSA 4QU5A 1I51A 4PS1A 4QUHA 4D3ZA 4NOKA 1RWWA 4I1RA 5IAJA 1IBCA 2NN3C 2XYGA 3H0EA 4EHDA 2AR9A 2QLBA 3NS7A 4DCJA 4QUDA 3RJMA 4AWBA 5K20A 1GFWA 4IYRA 4AWAA 2XYHA 2XYPA 4QULA 2H5JA 3SIRA 3R5JA 4FDLA 2J32A 3DEIA 3P4UA 4QUJA 3GJTA 3S70A 3H1PA 4JB8A 4JR0A 4QUBA 4PS0A 4ZVTA 5IC4A 1QTNA 3NR2A 4JR2A 5LU9A 2J33A 4HVAA 1PAUA 2K7ZA 1NMQA 2Y1LA 4ZVQA 3K7EA 4ZVUA 5H0IA 4EHHA 3BIJA 4NBKA 4I1PA 4EHFA 3P45A 3H13A 1M72A 1I3OA 1RE1A 4PRZA 1RWXA 4NOJA 3OD5A 1QDUA 1GQFA 3R7SA 3R6GA 3UO8B 5LU8A 2HBQA 5JFTA 3PD1A 4QTXA 4JQZA 5IAGA 2CJXA 4EHAA 1JXQA 4JJ8A 3GJRA 5IASA 4N7JA 3V3KA 4ZVPA 1I4EB 3QNWA 2J31A 4QU8A 5IANA 4HQ0A 3IBCA 3V6MA 1RWMA 3R7NA 1F9EA 1I4OA 2C2KA 3EDRA 4QUEA 2J30A 3D6HA 2QLFA 4AW9A 4N6OA
chains in the Genus database with same CATH superfamily
5IJ9B 3RRMA 1JVNA 4BQPA 1K6XA 1R4NA 2WRZA 3QVUA 1R9MA 3GPIA 5HP4A 3PCTA 4MVJF 3E05A 3UOGA 1Q2UA 1MVLA 3VZPA 3H9GA 3CJQA 3IDAA 4FE4A 2YXPX 4FFMA 2PKWA 4CM3A 3PDIA 1JPNA 4DCSA 1K7CA 1YMQA 4K6OA 4HGZA 3IL2A 5I7RA 4HAWA 2HU2A 1T2UA 2G07A 3FNFA 4HN4B 3I62A 1NC3A 4U6QA 1EVJA 3KEMA 2ZWIA 4F11A 4PX3A 3SHQA 5GV8A 2I7VA 1KI4A 3DV0B 5BVGA 2GARA 5ADWA 2V6GA 3UFXB 2DCMA 2PZLA 4NE2A 4MI6A 4G0XA 2CDRA 4PVDA 3CZMA 4PFSA 4XJTA 3BRSA 3WTBA 4ACBA 1BDIA 2CXXA 2JVKA 3DV0A 2RG1A 2OV6A 1TOAA 3INTA 3ND8A 3LY8A 3KVVA 2OGWA 4FYPA 3RF6A 3WSVA 1MOQA 4IG4A 5HZHA 5BV2P 3L93A 3VZSA 3DWEX 3MBKA 4HX2A 2NZVG 3LT0A 2IX3A 5CW1A 5AI9A 2EJTA 3VOSA 3B6MA 3KR1A 5G2OA 2PIDA 3E70C 2Y3IA 4R2WA 1WXGA 2RD2A 3QM1A 2X4DA 1XMJA 4IZ6A 2L2QA 2NTYC 3LD9A 4DVJA 1TCUA 1P72A 1Z16A 3ADDA 4TKVB 1E62A 3C14C 1Z0AA 1Z3CA 2NO6A 2HLDA 2WSSD 1L4YA 3KB8A 3KEOA 2K6GA 1X6VA 4M1SA 3V4OA 1JR4A 4BEJA 3WHLA 4Y2QA 1USIA 4UQOA 2JW5A 3R0XA 4RV4A 2WAXA 2I55A 3AVWA 5CXXA 1T36A 2PR7A 3ET4A 1DBQA 3SBOA 5B3LA 3TLGB 1H4QA 4DSAA 1P7ZA 4NCXA 3L0CA 3U3XA 4HATA 2H0QA 1E5VA 4H77A 3H5AA 1E1QA 3EUWA 4Z4EA 4ND1A 1T9CA 2E82A 1IWPB 1BGVA 3BCRA 4IIDA 3TI7A 2PJUA 4FYMA 2ENWA 3HGQA 2P4SA 2XCLA 1ZC3A 4WJKB 4IH9A 1Z2OX 3AVVA 1O5TA 3PGA1 4N9WA 4P3OA 2YC4C 1UFVA 2O0HA 3WLPA 4F21A 2EW1A 1TQ8A 3DTNA 4WERA 3C15C 2C5SA 4LTDA 4GPBA 4XPZA 2ZVPX 1W96A 3H9BA 1Z0ZA 2ASEA 3CUWA 3K6SA 1HR0B 1J8VA 3FMOB 3A4TA 3VDNB 1UBCA 2OLEA 2QUZA 3K05A 2R5FA 2XB6A 1RPNA 4P34A 4PPFA 5G1NA 3BB1A 4Q9AA 1NI4B 1AHHA 3D0RA 2VDVE 4MW1A 3ZV5A 3RSLA 3KJZA 3DMDA 3AHJA 2IOFK 4H7KA 4J29A 1Y7LA 4OLJA 2JAQA 3CR3C 2CDCA 3WGJA 4GW3A 1DB3A 1VBMA 3X1JA 2A94A 2WHPB 1RP7A 2UZ3A 2M9MA 4B4VA 2JFFA 2VHZA 1SELA 1Y6RA 3DOOA 1SZDA 3FKQA 5F5XA 2J3MA 4Y2TA 10MHA 2J9XB 1U1FA 2LCIA 4M1KA 3QP9A 4TV9B 4RPJA 2O1WA 4U7JA 4E88A 2I2CA 3LYLA 1KJZA 1KEEB 3BTVA 5E9QA 3RS5A 3DEYX 4P7FA 4DW8A 2HB6A 2VQDA 2F8SA 3JAMA 1ZAKA 4LNUA 1ZITA 3I37X 1NV9A 4KK4A 4PPQA 2DC1A 3CMCO 3CNOA 3BDAA 3OM0A 4WI1A 2AI1A 4EB6A 3R7NA 3UAZA 1KQ3A 4JY7A 2M6RA 4GXQA 4RMGA 3ZDRA 4EGSA 1QYCA 5IXYA 4EJ0A 2Q0QA 3ZN2A 2YHIB 1XHFA 2J59A 1TRHA 3D8UA 2QHXA 1AGXA 3EAGA 1BXKA 2RGAA 2J07A 4PSDA 4HS9A 2QK4A 2HSDA 2OC9A 1B7GO 3KV3O 1QV6A 4Z0PA 2AI2A 4GX0A 1I5OA 4F8JA 2ZRKA 2NZYA 3I2YX 3KJNA 3MT9A 4UULA 3LKDA 3N75A 4EG8A 2WM8A 3ILXA 3KT6A 1DUSA 3P9IA 4MWGA 5I7EA 5KTMA 3SZMA 4ZI5A 3ED5A 1OQAA 5EAIA 2AQIA 1RWNA 1PR2A 1I1NA 3DE7X 1TCAA 3A3KA 3ZS9A 4YAUA 1BFUA 4RCZA 4AKEA 3BWCA 6ABPA 2B4QA 4DG8A 1RAIA 4OFBA 4GLBA 5CAEB 3D8RA 4AJPA 4LHSA 3DTVB 5HQ3B 1XZPA 2Y0EA 4KYIB 2VHWA 5J1TB 3IT0A 5KJFA 2VJKA 3WMRA 4QYWA 2AG1A 3REQB 4DSUA 4CCYB 1S9DA 2C9OA 4JKOA 4Q1AA 4B44A 4UU7A 2RARA 1XZGA 1CP3A 1RQXA 2NXEA 3KYIB 3IV6A 4LBVA 2GZHA 4BYGA 2EATA 3S8EA 2YWHA 2GS9A 1MO6A 3RNOA 2QM7A 1QDLB 2HPHA 4HTFA 4IDQA 1G8AA 1I5EA 3BMNA 5JLJA 5K09A 2GWRA 1JXMA 4PR3A 1G8MA 2XWQA 4R9VA 3NOQA 3TAHA 3EC7A 1D8AA 2AR0A 5CFZA 3G2NA 6NULA 2ZQ5A 3GF4A 4HNAB 1VLHA 1Z2DA 3OFJA 4N9QA 2ETXA 4NR0A 5DYTA 4EJSB 1H2AS 1PNQA 4NP6A 1ZJYA 4NV1A 4DPKA 3B51X 5IUNC 2BFBB 1N1DA 5FR1A 3ILVA 3P8ZA 3A1EA 5ENDA 3BVPA 3N0RA 3TW6A 5LXTF 2A1UA 3V4RA 3A2MA 1VA5A 2HXYA 4EHDA 2CKMA 2OHGA 3K0FA 2ZXFA 1KJ9A 3NS7A 1SKBA 1A98A 3FLBA 3UK0A 1DINA 2H4JA 5EJGA 4FT2A 3NH6A 1BO6A 1I80A 1OXXK 4MLCA 4S35A 1RPAA 4UNNA 3AH8A 1SUAA 5DXAA 4JOCA 4A73A 4PLFA 1YRWA 2P35A 4IINA 4LYFA 3WRWA 1CR2A 3QY9A 2A92A 1FX0A 1U7TA 3NNNA 1FFWA 4E51A 4ZVTA 4PYNA 3P2MA 1FP4B 2RHDA 3KU4A 2AB0A 3ICCA 1MTZA 3NR2A 2BGKA 4B6EA 3T7TA 4EEKA 4YT2A 2OAQ1 1PAUA 2AF3C 4Z86A 4RPIA 3FDFA 3HZHA 3FUTA 4QBTA 4K1XA 5E8RA 4I66A 4ZAZA 3RT1A 3GLHB 4LGMA 1RE0A 3ZPXA 3GK3A 1XXLA 1J24A 3PHJA 4R2LA 2ORVA 5KKCA 3IQFA 5DISB 2R1VA 3HJGA 3TW4A 5LU8A 3Q6IA 1CEQA 3N6XA 1ISGA 2C20A 3QU4A 1AH2A 1WR8A 1ISJA 5JVDB 4BKPA 1IUNA 1XZJA 1Z0DA 4DLBA 2XTZA 2GERA 4G0PA 2Q5OA 1CZLA 3ETEA 5EZ5A 3QVXA 2OORC 4QGSA 3X1ZA 3C6KA 3QFTA 3TZCA 4JI7B 2IXTA 4E30A 1T5SA 4C7VA 3ZZTA 3BGWA 4P4LA 1M7HA 1PJRA 2F43A 3BE6A 1KH3A 3OETA 3WRVA 1QAOA 4JT8A 4IMIB 4OXKA 4BJ1A 1GFIA 1YL6A 1N36B 1T3ZA 3QLJA 3RIXA 4I5IA 3FSEA 2SCUA 4TRMA 4RTRA 1BHSA 3LNTA 1FMCA 4UUNA 4ZAFA 3T9DA 5B2EA 2G1UA 4ROTA 4TTAA 5KNBH 4XASA 1SG0A 3GW8A 4RCYA 4P86A 5TVGA 3OX2A 3UWSA 2PRKA 1A95A 2PXCA 4XYLA 4A0RA 2R4UA 4L5JA 3KUKA 4O25A 3LG2A 4GF5A 4X8HA 2GVDC 1H2RS 2XWBF 4UREA 3TZHA 4BUCA 2DQKA 4FQ7A 1ZEJA 1C4WA 3USZA 2WVAA 3RRXA 2BRUA 4A92A 1E2PA 1TT5A 4QPPA 4X91A 3JAKB 3P5BA 1Z0JA 1RWBA 5EKDA 2R60A 5B7GA 5BMVA 3GT3A 4WFQA 1F0NA 4NSNA 2IQ5A 2JAOA 3PJEA 4P92A 4PLWA 1KZ6A 2CNKA 2WTNA 1X1QA 3B8HA 1L5GB 1CK4A 5JG7A 3SR4A 1J0XO 1KAGA 2FSUA 9LDBA 1E3EA 1HUQA 5BSUA 4CETA 4M46A 2ZE6A 1EP1B 3P27A 3SR3A 4BIIA 1P6QA 2FAXA 2XA9A 4L85A 2JB9A 1TM5E 1FMFA 3KKNA 1BMQA 3DHVA 1KY4A 1LDGA 4ZPXA 3SZOA 4ZI7A 2YHUA 1DIHA 1ML4A 4RW0A 1JT9A 1V8DA 4UXJA 5JY6A 4NDNE 3NI2A 2OAP1 5JAZA 1VB5A 3NCHA 4MW5A 3AF1A 3Q0IA 4FSHA 2VLIA 4UCQA 1BX0A 5ALMA 3DXFA 5JPIA 4FMDF 3PGJA 1Q0ZA 3I2IA 1EHCA 2PUHA 3U49A 3ADBA 2IH2A 3PFCA 4RIFA 3ICQB 2JFGA 3WKAA 2CYCA 3R44A 4UVEA 1PJTA 1X1AA 3I6IA 1LU9A 4IH1A 1LLUA 3EZ6A 4ZAVA 4P0PB 3GFQA 5BXQC 1ECLA 2FE1A 3KAJA 3L04A 1HMYA 4R98A 4TVKA 2AX4A 4WW0A 4NJEB 3OZFA 4UHBA 5EIHA 4Y6RA 4YUYA 1H85A 4WAUA 3LP8A 2R00A 4OI1A 4EL5A 1YS1X 1Z5NA 4NZMA 2B5WA 4LI0A 2IPXA 2C58A 2J3DA 3VYVA 4B7XA 4G5QA 4CMAA 1W2WB 4XLTA 4Y2JA 1N8TA 1GGEA 4G9BA 3U1TA 2J32A 4WACA 1XD9A 4GZ3A 2V03A 5AVKA 3K2QA 3WKEA 1V45E 3TSZA 1X7XA 5LU9A 1GUDA 3KOXA 2P9JA 3PEEA 2EBUA 4F84A 3N0XA 1SVNA 1OAAA 2G70A 2VUHB 3Q7QA 1PL8A 3OTOB 1VSUA 1PFVA 1UZMA 2ZREA 1HQYE 5ICMA 3AX6A 4LC0A 2DP4E 4EEXA 1K8RA 2CGEA 4ZT4A 2A33A 3B3JA 4IGIA 3UJ8A 3W6NA 5E6UB 1V4BA 1ZGAA 4GH5A 3JD3A 2IHVA 3BD6A 3WP1B 3HJFA 3AESB 2LP4Y 2LIVA 1NHWA 1MEOA 3I1JA 2JLSA 2WD9A 1V8BA 1NDQA 2JANA 1NYRA 3BIXA 2Q2OA 3D3JA 4H0NA 5J2UA 1SCJA 1JALA 5JE8A 1WPXA 1GAQA 2PUVA 1WL8A 3VTFA 1FRVA 1XUOA 3KSUA 1U1EA 3L49A 3T7RA 2Q5HA 4UBOA 2WF7A 1EUZA 3IESA 4LYHA 3EJ6A 4EB3A 5TSDA 3R7AA 1SVUA 3WZLA 3PI6A 4BATA 4CIXA 1QX4A 1ZO8A 1B1CA 1WUKS 1Z5VA 1QVZA 2BT4A 3AM4A 3GFFA 5AMXA 3DO6A 4Q1VA 1RRMA 3DEZA 4HX5A 5EQDA 1NMZA 4ONEA 4C0HA 2E9SA 2GD0A 1KDOA 2OCDA 2XZTA 3GDFA 3ONVA 3EDCA 4J0GA 4PAOA 4Q05A 4PZEA 4YACA 3IA2A 3EEQA 2ISSD 5A9RA 1RXVA 1XTSA 1P7YA 4LFCB 4LSGA 5HIKA 4P7JA 5GV7A 4CIAA 5E9JA 1WSAA 4I6JA 3WQHA 2AGVA 5FTMA 4MICA 3DLIA 4GMKA 5K3AA 3AV0B 1ADGA 3DZIA 1P2TA 2W2LD 2W6CX 3QI2A 4O2AB 3OZBA 2Z2KA 1UOQA 4RENA 4DIUA 2A9OA 4WN9A 3EZXA 2PUWA 4DY4A 2X8BA 1K8QA 3AZOA 3CUTA 4OQDA 2X0DA 3RKRA 4B84A 4X0EA 4IS2A 3GT0A 4YJDA 3WBBA 4QXOA 4ENSA 2BFOA 3PUWA 4AS2A 1Y7IA 3AETA 4OGFA 2YDXA 3MGBA 1XQVA 4YLEA 2G0AA 4FOSA 5BNIA 3EEOA 3MUFA 5TQJA 3AERA 1ZJ5A 1F4LA 2XOKA 2VVTA 1ZJWA 3VR6A 1R4MB 4GE3A 1XQXA 3K1YA 5B4TA 1BQ3A 4P53A 4OXXA 3KXIA 4PRLA 3NAGA 1ABFA 3E9EA 3LL4A 4GM4A 4RWZA 3HC7A 3LLUA 3WAGA 1NF8A 3AVQA 4Q3DA 4Q7JB 2IS1A 4W1RA 2A1UB 4PR0A 3T38A 1ZSVA 2WKPA 4D0SA 1Y3DE 5AHWA 2C99A 4MHOA 3V80A 3AILA 2Z6UA 4KOEC 2DFDA 2C61A 1D4AA 1W25A 1SRRA 2RBKA 4JIMA 5JY1A 3K2EA 2P6PA 3U4CA 5LQJA 3BL6A 3K71B 1TO1E 1M83A 2QMHA 1HYEA 1Y34E 3ONNA 1GZ6A 1SM4A 1JEEA 2QTWB 3LVBA 4HI0E 4UU1A 1RYDA 5CITA 3T5AA 5D6OA 2WIDA 3H65A 5GM2A 4M1TA 1ZJZA 2FUCA 2OZEA 3O9ZA 1GKKA 2YINC 3CXRA 3ZWQA 2Q4OA 4MV0A 3DFFA 5CRIA 3SX4A 5FTLA 3KPYA 3NUGA 3ANLA 2ZTHA 2DQYA 3GFTA 2D2VA 2R8PA 3KAKA 3KC2A 3N70A 5B30A 4G4JA 3NXSA 3KBBA 3MXOA 3I30X 1STOA 4ZMBA 3BHJA 1C0LA 1DMSA 1XQ1A 3IOEA 1TTHA 2OVFA 5C35A 2QX6A 5E4TA 1FZQA 1PG0A 1YIAA 2C3PA 3KVYA 5TIIA 3UPUA 3CZCA 4GI5A 3KD3A 4I9UA 2BMWA 4RY8A 4WFKA 3FPGA 3UICA 3WJ7A 3UO8B 2HHHB 5EA2A 4MGIR 4YP1A 2JHCA 3EA4A 3ZE0B 3F6RA 5IZCC 4MAMA 4XUCA 2EQ5A 1NR5A 2P1ZA 1J21A 2HCJB 1DAEA 2B0JA 4I4NA 4LZNA 4LECA 1UKYA 4TM8A 1E2IA 4ALLA 3ED1A 2Q4RA 1DCMA 1PKXA 2YRWA 3MT8A 3E0XA 3A9WA 5JAQA 1IEQA 3EIXA 3RYFB 1M76A 1GDHA 3AU8A 1GIAA 2RKOA 2WJZB 1PK8A 2AFIB 3N5KA 4IKOA 3TE7A 3COPA 4BO9A 3DAFA 4US2R 2C4TA 1YU6A 2DLCX 1KK0A 2BF4A 5ILQA 1K86A 1KO1A 1UPTA 3OBBA 2FEPA 3I9V6 3ZW7A 3K5WA 1IZ0A 2O6LA 3MCWA 4I46A 5FUYA 4LNUB 4Y2HA 3PENA 1ECCA 3PQDA 4IF6A 4QYMA 4EG7A 5I7UA 1E7RA 5BR1A 1CLUA 1I24A 1WEKA 2H2IA 3JY6A 5DNWA 1XNQB 1PJ8A 4JWKA 1CW2B 2XW6A 4XLZA 1OU4A 3QLUC 1P1BA 2YVKA 5JWOA 4BE4A 5HCIA 5HDQA 1IVNA 3Q7EA 3V42A 5K0SA 1D2AA 1F4PA 3Q7IA 1NLYA 4RKYA 5CLFA 3FPSA 1MEJA 1Z36A 3W4KA 1VP3A 4GL2A 1A8HA 1VE1A 2ZWOA 4FNAA 3TI9A 2POCA 1E3IA 1T5OA 3CFYA 4PSAA 1RPTA 4JNKA 1YIOA 4PIPA 3HB7A 1KAHA 3V34A 2WD7A 3VBCA 2GVZC 3MUOA 1ST2A 3PKZA 4E31A 1Y8RA 2H54A 4B34A 3DZCA 3ONFA 3QPUA 3WLMA 5HYVA 1Z28A 3BPSA 4H31A 5CEJA 1KMMA 2ESRA 3CW9A 1M2OB 3EDQA 4OMDA 5DGIA 1KDYA 1NQTA 5HHTA 5E38A 2YYZA 1NF2A 2CV1A 3BXZA 3B2QA 3IOMA 4M7PA 2P79A 3JZDA 1COWA 3IUNA 3D31A 5KJEA 5CDHA 2FN9A 2OYCA 4RNDB 4MI1A 1J07A 3CVWA 4GBED 2PT5A 2I62A 2RGEA 2GK7A 4DM4A 2EBWA 4DJEC 3CH6A 3UCXA 2V58A 3V5NA 1KIFA 4RTOA 4GRDA 5EJ6A 4F3TA 4HH0A 1NMEA 5JO0A 4F3RA 3UMCA 4H7IA 2OBLA 5BP7A 4P7GA 5HA5A 2ZYTX 4CKWA 2PNJA 3KFXA 3SJAA 4E1BA 1ULHA 3HKDB 1EK6A 4Y1FA 4YPOA 4K9QA 1UPCA 3ZE9A 3LLCA 1S0UA 1VBNA 2WVJA 4JLPA 3UANA 4WX2B 2AQKA 3VAYA 1Y89A 2X8AA 4CQMD 3BAZA 2PX0A 3VHXB 1I0LA 2B8WA 5H7XA 1UBOS 2ZRDA 5JCOA 2HEGA 4X66B 1Z56C 1UPXA 3A9VA 3LWNA 2NZ8A 2RONA 3WGHA 4EGAA 1R0ZA 4QYTA 1XQ9A 5JATA 5JDIC 3UPTA 4ARZA 3C3JA 3GU3A 1NI5A 3INYA 2E4AA 2RGUA 2XI4A 3P2IA 1KRHA 4I81A 4GMDA 4LRYA 2VT3A 3WA7A 4EI7A 1HDYA 2NQ2C 2VI5A 2PX4A 4XCQA 3EASA 4EHFA 1NP3A 2JD1A 4PCAA 1PV4A 2UZ1A 5LSAA 5JNSA 2PR2A 1C0KA 3MGKA 5HKAA 4KYVA 5DI9A 2VRBA 4KPYA 4HWOA 4UCWA 4RIIA 5JJ5A 5KVQA 4B79A 3IVMA 4HWTA 2H31A 3DBLB 3GYBA 4GL4A 2WNIA 4XYMA 4YFVA 4YMUA 1H6BA 3A4NA 4JFAA 3OKCA 4UOQA 3TSYA 4IX1A 6LDHA 5T7BA 1J70A 1AGYA 1LDEA 1SO8A 3ADKA 3JD0A 2W2MA 2IZOA 4IX9A 5A4MS 2BONA 1KGSA 1DT5A 1KSHA 2EERA 1LVGA 2H1WA 2B7BA 2PMKA 2Q5IA 3KE8A 2XVAA 1HM5A 5AK4A 5I9BA 3GRKA 3VH4A 2M1XA 1GGMA 1W75A 1QG6A 2IOHA 3T1OA 3B52X 4WHMA 3QY0A 5B6PA 4OATA 3LKVA 3CIOA 1ZVJA 2N3ZA 4H16A 4BU1A 3Q6MA 3COWA 3Q98A 4WESA 1C7JA 2C4NA 3HBMA 3JYPA 3ABQB 4NCAA 3NP9A 4XQ9A 1DUVG 2JL1A 1B2RA 1P31A 2GJAA 1RJ9B 2ZLBA 1CNEA 3H16A 3MJRA 3OZAA 4EKIA 2YYSA 6REQA 1ODSA 2IZ5A 2VJAA 5ENVA 4HDNB 5F1YA 5TY0A 2YS7A 2Y1KA 1VL5A 4EQ6B 1K92A 1W94A 3ZJ4A 4ER0A 3O4IA 1EVLA 2RFLA 4R1UA 1OLUB 1N6HA 1RSZA 3BG5A 1XMPA 3LC0A 1X0VA 3C7KA 1NXTA 1VP9A 3CNHA 4MCJA 4TKUB 1JR6A 3X2SA 4BRSA 1BA3A 4G07A 1VMDA 2JHGA 3HUUA 1H8HA 2C8VA 3N2GB 4YJ2A 4HZUA 2X58A 1K0UA 2IA5A 3OJXA 5HS6A 4B1FA 1P0FA 4A1FA 4JBGA 2ZSKA 3WYEA 1K6EA 5GGYA 4XUEA 3T3MB 1BWQA 3UFXA 3R0IA 3V33A 4F86A 4KR6A 1QUEA 2Q62A 3PC4A 1JU3A 2QE6A 3QG1A 2P7IA 5CT5A 3UUFA 4EA7A 1OBFO 4NL4H 4QFBA 3DQZA 5JT1A 4JXZA 2VT7A 1VE5A 3HYNA 2H9YA 2W2VA 4D9JA 4QZVA 2HBRA 2FEMA 4BC1A 1M74A 1M8JA 2JDIA 2YICA 3BH0A 4ZGWA 1IAVA 2A0KA 3GG2A 3GJXC 3O2SB 3UA3A 2V3CC 1U11A 2FW8A 5FOTA 1SVLA 3EIEA 2VQ6A 1CBUA 4XX1A 5BN4A 4HDMB 1F14A 1YBAA 1GRNA 3HVIA 1T2VA 5IVDA 3CEMA 3T12A 2WPDD 3ZOKA 4LOHA 3RJTA 1LV7A 5KSZA 5KTRA 2IKQA 3QLVC 2OT3B 1KDPA 2D74A 2PLAA 2RIPA 3BN3A 3PC7A 4XGNA 4CM7A 2HC9A 3RTBA 2YFKA 3BF8A 3LF2A 3CLSD 3NEYA 4YCLA 1T4MA 2JGDA 2RI1A 3G5UA 3CEJA 3C43A 1EFAA 2O2DA 2ODPA 2E4ZA 4HRYA 4MV5A 3HNPA 2VXOA 4IR7A 1WY5A 1UOPA 4QBHA 4M7OA 4TYMA 1TM4E 1IUPA 2PAAA 1JBKA 5AOCA 3HXTA 4BO7A 3RG8A 3KYCB 1U7DA 1XAGA 2J33A 1NONA 5KREA 3J81A 1ZAYA 1WMFA 2IF2A 1N75A 1BX1A 1CERA 2I1QA 2XY4A 2CN1A 3ECCA 4JD5A 5FO1A 4G63A 1XZ8A 3WGTA 1A1VA 3ZU2A 3ZDQA 2WE7A 2WP0A 3NPMA 2V7GA 3A2LA 1AC5A 2B2CA 1NASA 3WYFA 3CC8A 1X15A 1C4XA 5FTNA 2YCLA 2PANA 1KR2A 1TTQB 3RANA 5DDIP 4CU2A 5EIEA 3FA2A 2NMVA 1L5HB 1NU6A 4NU0A 5BSKA 4EZEA 4DLTA 1ZN8A 2CDBA 2ZBVA 4R4JA 2OCIA 2RHRA 1ZK2A 1BXRA 2Q4EA 3IA7A 3RV3A 3VMFA 4GMFA 3WJ1A 5KYWA 4OIMA 1AUQA 2FTKE 2QRUA 4AW9A 4F5WA 1NI3A 1Y8QB 2HSGA 2YWBA 4PZ0A 4TUYF 2BWJA 5KVCA 1HLGA 3L6BA 1N1MA 1KEWA 4ZRDA 2PX6A 2JPDA 2MIIA 1EM6A 4TYPA 3CPEA 2VWGA 4XOUA 3REGA 4RS4A 3S1AB 2IBTA 4U1RA 4XWKA 1GQRA 2BKAA 1RXEA 3QW2A 1TZCA 3T4XA 3AESA 4G5GA 4QG3A 3TLKA 2QVBA 1NF9A 2Q3CA 3QKUA 4ZQEA 3BRCA 4ZXPA 4BNZA 2Q3BA 2JI7A 5HZKA 2CNDA 4L9WA 2PUDA 2YX1A 5CK4A 1XWWA 2QTVA 1P0MA 4NLLA 5TARA 4ZOLB 2VP0A 1ZSNA 4TS9A 5AIBA 1B6GA 4X71A 1LS6A 2XQIA 2IS2A 5K3SA 4NMXB 4N41A 2Z83A 4Q5IA 1L4NA 3IAHA 2G9RA 2XB8A 3IAXA 4L6CA 3UMFA 3WADA 1CJVC 4HV4A 1RYNA 4N65A 4X6XA 3ZH2A 3OCCA 4N4AA 2CYBA 4NF2A 1R15A 1YGPA 4KK3A 4CM4A 5CFQA 1OE0A 4YJ3B 1GR1A 1OLXA 3RFTA 2JVJA 2PLFA 3ZZUA 1JZTA 3QYPA 2A14A 3RT9A 1ZVQA 4LMRA 3PWSA 4PWYA 2JHFA 1WZEA 3H2JA 3VX4A 3EQ9A 4GSKA 4LDAA 3ZVLA 1ZK1A 1C5KA 1Q1NA 2C1EA 1N77A 3BFPA 1OXKB 2CY0A 1CIJA 3W1EA 2PY6A 3TEFA 3N8NA 1RHMA 1WCIA 4ND6A 5E1BA 1UIRA 3R0JA 3ZYCA 4BLSA 4X85A 4Z4GA 1BHO1 1SBTA 3MC1A 4ZV9A 2V7QD 4B0OA 5LLDA 1S4QA 4YQZA 3GRCA 3QYAA 4CCWA 2KE5A 1M2FA 1Y7TA 1CU1A 3I4FA 3SP1A 5BUSA 2XCRB 5LP6F 3R6WA 1ZNQO 2BOVA 4HK4A 3JQGA 4HDRA 1T5HX 1N6LA 3H1FA 4YAEA 3GZJA 3UV7A 3VR4D 4X64B 4RC9A 3V1YA 3NVKI 3ZVRA 3E4DA 1H2YA 5A3VA 3G2KA 2ZULA 3ZJVA 1MENA 2K2WA 3GOQA 3TQSA 4RGVA 3F8WA 4ALJA 2P3LA 2GCIA 4GPZA 4YP5A 2WJJA 2B8JA 2C59A 2XMRA 3DAHA 3AFGA 4XPIA 4ZZ0A 2ZYUX 1V5IA 3EH1A 3G68A 4C0WA 2HSJA 1G4HA 1VMKA 4V1CB 2BTQB 3CRW1 2YXEA 5BQFA 1C9JA 3C8DA 4HDKA 3TCKA 1ID8A 2ILVA 3EQ6A 2IYTA 1WXDA 1MXHA 1OWNA 1V7CA 1GAWA 4DR4B 3T3DA 1ECPA 1EXNA 1LPMA 3PX3A 1N5JA 3OY7A 4I4IA 2NW6A 3FNQA 4CLEA 4ANFA 1KETA 3WO0A 1X7XB 2AEMA 3LQRA 4QGFA 4DS3A 2BZGA 1UFQA 3ZV6A 1SCUB 4PRZA 4FFWA 2DPXA 2X3FA 3FUCA 3ZHXA 1RPJA 1B6SA 4E4YA 3OQJA 2HA6A 3I04A 4NECA 4CLRB 3BMCA 1XZDA 3PE4A 3D81A 1W52X 4QGHA 4DQKA 4YI3A 1COZA 2AA3A 5EIFA 1I94B 5IFLA 2VJYA 4J0KA 2BHRA 3QLTA 3EF0A 2C98A 1M6YA 2FY8A 3C3XA 3LCJA 2HMVA 1E18A 1WNTA 1RVV1 2BC9A 4O2BB 4U7HA 3KB1A 3M83A 2WG2A 3L2OB 1N32B 3AF3A 4QQNA 5LR6A 1A71A 1EB8A 1HXHA 4QG7A 5AKJA 2NU9A 4GBJA 1Q95A 2HBYA 1OBHA 2H07A 3EIQA 4JA2A 4G4SO 4AWXA 1RI4A 5BVHA 2GBIA 3AIIA 3HB9A 4HQFA 3EBOA 4TRNA 5GJCA 4U8GA 4B2YA 5K0ZA 2V1UA 1OT5A 1RACA 3EGDB 5J2TA 1QF9A 2GN8A 1VL1A 3CF4A 4QM6A 5E6RB 5AFSA 1HNNA 3GG9A 4YP9A 4ESOA 1UBHS 3W8RA 4MPPA 4QUIA 1SNYA 2FJUA 4FU0A 4G1BA 4QXMA 4XX0A 5CU7A 3S2SA 1V1MA 1LRKA 2P9GA 3QUTA 5F2OA 3PKIA 1A4RA 3RIMA 2PU5A 4INJA 2SKCA 1JJFA 2AHRA 2ZSAA 3FNGA 4Q9HA 3FPLA 5E7MA 4L3WA 3U48A 1QIJA 4A2QA 3TZQA 1TE2A 3LI2A 4IHJF 4RH3A 1E79D 7REQA 5DM60 2XQGA 3TTYA 4CKYA 3GRUA 4LSMA 1A1SA 1W85A 1DCKA 4NBSA 1E6EA 1PQPA 1SIOA 2Q41A 3DTVA 2GLUA 4X1YA 5A0VA 4P4NA 1TA9A 4FMBB 3S1LA 1H3EA 4WA7A 3ZD6A 1MJGA 4AY6A 1NZFA 4KIFA 4LJ5A 2AW5A 4KFSA 4BBJA 1L7XA 4NV3A 5TT1A 3QRWA 4HB3A 1M1ZA 4NMMA 1EUQA 3SHTA 3HN6A 2XBMA 1IVYA 4IDAA 5EJ5A 2UYCA 2YQZA 1LV8A 4GC9A 4K2HA 3IGFA 3TBHA 1RXWA 1YE5A 1K4YA 2EGUA 2PS3A 3H04A 3LYUA 5DHUA 3K16A 4YV7A 1RR6A 4ZHQB 3S4YA 3AKYA 1H5NA 2WP8J 2EIHA 4WCVA 4FHGA 1SBIA 1I2MA 4ZT6A 3V8NA 4B7CA 4DMLA 1GR0A 1R00A 2ZYDA 5ADVA 4FR0A 1ULSA 1NMSA 1RTTA 3PNYA 4KMSA 4BKMA 2GN2A 4ZANA 2W7TA 3QVJA 1NVKA 3FB1A 1RM4A 3FG9A 3AUAA 1I33A 4QX6A 4Y67A 5KHAA 1GPMA 1V6CA 1Z5PA 2VS1A 1USKA 4QA9A 4AO6A 1TECE 3LE8A 4FI3F 3WYGA 2NU6A 1NN3A 2D7CA 1KI3A 2PVPA 4EQZA 1HE4A 3JS5A 4LC1A 4M1EA 5DCWA 4C6SA 3VC2A 4AZ0A 1Q1BA 2GCGA 1BYUA 2FPOA 3INGA 3P0RA 3U13A 2PRIA 3KQUA 1IBMB 3RSQA 3GLHA 1YOBA 3BH7A 2UYQA 4KYUA 1FB5A 1MEEA 3D5EA 1V16A 1OX5A 3GJ4A 3IVRA 4M9CA 5DEIA 3P7MA 5LBIA 4BE9A 2I6QA 3E15A 1NW3A 2PL3A 3U7EB 1JIXA 3R3UA 3G17A 3TOXA 1T29A 2BCGY 4Z8XA 1VOTA 2XE4A 5THQA 4EX6A 3TSAA 2C07A 4ISBA 4K5QA 1N9GB 3LFUA 2BDEA 4O2BA 4M54A 5LXTA 1GTVA 1FYWA 2VXCA 4BIMA 5K6AC 4EUEA 2YWDA 3ZQJA 3QEOA 4HLDA 2DRIA 4OHKA 2BUCA 1U2TA 1V1JA 5HXAA 3A11A 5JXJA 4YRBA 1PP4A 4D46A 3IOYA 1E32A 2WOJA 3P9NA 1GLNA 2D5AA 3PSAA 5KYVA 3DCYA 4IXDA 2HA4A 4QGBA 1MB3A 5HF5A 2C2KA 3L7YA 1C0EA 2OVBA 2V6JA 5LUAA 4NVRA 2D1FA 3KTOA 1V11A 4HG2A 3NV7A 5LMZA 2QRGA 2FSVC 2Z1NA 1J9EA 5LVAA 3OZUA 1OF1A 2IEIA 4IVRA 3IBTA 2I2WA 5C5EA 5KWSA 2NYUA 4EI9A 1DDIA 3KBOA 5FP0A 5HIJA 3RJZA 4YMLA 1UJ5A 3OMWA 2NGRA 1UT6A 2HMAA 4KN9S 5K0NA 4CZ2A 4BEWA 1M33A 1IZ7A 1UADA 3D3EA 3KL2A 3D3NA 3M1YA 3H2ZA 4HSEA 5CH8A 4HGPA 5EJ7A 3IDOA 2A0WA 1XWFA 3KXKA 3L8YA 3CHYA 2V6BA 4I3HA 2PZ8A 2O0KA 3LVQE 1XVIA 4B75A 4JB0A 4KLCA 2WJ4A 1ACJA 1JTFA 5LZ8A 3S2YA 4MUEA 3H5TA 3UGKA 3C3CA 4DLLA 2GAFA 2UV8A 5BVHB 4K81B 4C0JA 3LHFA 3C16C 1OXSC 1SCNE 1OUMA 3IPAA 1QHXA 3EGDA 5ELMA 5H1YA 3IIIA 2NO0A 1QOZA 1U63A 5IBQA 4QUAA 2XGJA 4ZQBA 2BRUC 4CL0A 3O21A 5C4GB 2V3WA 2JGKA 3GCXA 3U6KA 4R2XA 2CL5A 4AO8A 2PUFA 2XUDA 4MWSA 3O31A 3SS9X 3VYWA 1WCYA 4BZPA 3UUWA 1G7TA 4MMZB 3V7NA 3F78A 5DGTA 4TKMA 4AZWA 1GWNA 1V1RA 3OJFA 3DNFA 1RP1A 5IM4A 2V8OA 1JZSA 3NWOA 8OHMA 2QRPA 1CR4A 1MO4A 5FUBA 1KK1A 3FDXA 2Z5GA 5AKEA 4LIPD 4BNTA 2EJWA 4D9KA 2XUPA 1QPZA 1Y6ZA 3WL4A 1ESZA 1KAOA 1OZFA 1U0RA 3GELA 4NU6A 1TA4A 2C04A 1QZ3A 4M1ZA 3X1DA 1P0IA 2O4UX 3DS8A 2XODA 2ZIVB 1E5DA 3K8QA 3RCBA 2Q6TA 2CHFA 1UAGA 5JRZA 1C3EA 1T36B 1XTPA 4NOKA 2V55B 3AM3A 4MLZA 4TX1A 1UEXC 4K28A 4Q4JA 4CDMA 5JHGB 4EX7A 3ADOA 4WOJA 2QQFA 5JZVA 1FU7A 1WXQA 1EFCA 1L9KA 4B74A 5EFZA 1EVKA 2EX0A 2IE8A 5HMMA 3KZ1E 5JTUA 2JCYA 1WW2A 2YVQA 3I5AA 4AMUA 1BXZA 5AK3A 2EQAA 5BN4B 1ENPA 3IMKA 1ZX1A 3MWGA 2J48A 2VK4A 2X9LA 4EWLA 7ADHA 2Z8XA 3EXFB 4IDOA 1EMDA 4OQYA 4ZOQI 3W05A 1U80A 2B61A 3UGTA 3GPLA 2NUAB 2GZMA 1A27A 4LDNA 2JCVA 2VCHA 4H7FA 5L40A 1T4CA 2JFYA 2OWEA 1ZM4A 4QM7A 3H9UA 1ADCA 4UAVA 3PNOA 3S27A 4YCNA 3BMQA 3C3PA 4I5FA 2YXLA 3LCVB 3MFYA 1SK9A 4M8NE 4DMUB 2ZM5A 1M1NA 2AYZA 3OOSA 2BMFA 3I92A 5DLPA 5TRTA 2N46A 1N6RA 3D6JA 2GLXA 4MQ5A 5CA1F 4G5YA 2XRMA 3PHHA 1EFRD 3ASUA 3KQPA 4JBYA 4M9SA 4EG0A 2O2JA 2QMUA 2I1VB 2WEKA 4Q4AB 2AFRA 4P36A 4WLVA 3IBCA 2YN4A 3N2IA 4HGRA 2P4HX 1JHRA 2EG9A 4LWQA 1P5HA 4QOHA 4YAFA 5THXA 4N3AA 2NNWB 3T3NA 2MSLA 1TI7A 4LN1A 3PFGA 1KS9A 3CSSA 1AKYA 1JDTA 2IELA 2WIKA 4AF8A 3R0QA 5IN4A 1EHIA 3UCEA 4E5VA 5BQ3A 4DJTA 2ENUA 3A6HA 4YREA 2IOFA 1J0AA 2E0IA 3K31A 4KRFA 1KYQA 2APJA 1Q83A 2QZ9A 1PQYA 3JVUA 3PI7A 4MA5A 5LZ7A 2XIJA 3DCNA 4YUVA 1A5TA 1JQAA 2O1SA 2IEYA 2EFYA 3ZJYA 4X7MA 1CTQA 3GEHA 3GRAA 1XZKA 3GZ4A 1Q2XA 1RI1A 1K8YB 2W6MA 5EQFA 5G0VA 3WIVA 2NZ2A 4F5ZA 2VBIA 3PB3A 3G89A 5EE3A 3TVTA 3TLCA 3WNQA 3U0VA 3AHDA 4WN3A 5BQ5A 3DE3X 3FZQA 3JSXA 1H94A 2D1YA 3FPCA 3KT3A 4GWGA 4DLAA 2W58A 4LS3A 4YMGA 1G6KA 2ZFUA 2ASVA 5IBRA 5IT0A 1MW8X 5ITZA 4B3SB 3VHQA 2YFQA 4RFSA 1EWYA 1F12A 2BD0A 1D6JA 2QJWA 3K9HA 4Y1RB 1G21A 3TL2A 1KYZA 4ETMA 7GPBA 4ZV4A 2JGFA 3MJFA 1JBQA 1QF6A 1Y3BE 4L75A 4NICA 2QRZA 3B1FA 1FNDA 2WICA 4TZKA 4JP8A 2JJMA 4IJQA 1IHPA 1GQSA 1SUBA 1SUFA 4BMOB 2O8FB 1KBOA 5H8WA 5GONF 5TF4A 4KXFB 3W0LB 3PXUA 2HGZA 4ZP1A 3MT0A 4BO3A 4L8VA 4KNVA 3LUPA 4Z0TA 4D98A 4F3KA 4V0QA 2LDXA 3JQ8A 1PV2A 3H99A 1MZVA 4OP3A 3U7HB 1SULA 4LBWA 4PO3X 1PHPA 2GTIA 5EPEA 3ZKWA 3D4IA 2OFOA 1I8TA 3MNFA 5DRYA 3RS4A 4G36A 1RBMA 4EB0A 1GCOA 3DZJA 1OTYA 1P1FA 3KR2A 3RE1A 1ZOSA 5A3SA 3ZV3A 4I5EA 4MVJH 2D0DA 2BBWA 2R2GA 1KJYA 4QFMA 2JRCA 4QOFA 2ZR7A 5BRAA 3HJRA 2KX7A 5JD4A 3VZDA 5KOJB 2EYUA 4JDPA 3A2KA 3CMMA 1CUYA 3N28A 1D6MA 2L18A 4ZMSA 1RQRA 3LCMA 3TZEA 4CLOB 2YOFA 3BFVA 4QDTA 2E6UX 4FKZA 4P81A 4B73A 4ZQIA 1X9GA 4JLAA 2P1DA 3STTA 2W2PA 1LVHA 1HEIA 5AVUA 3CGGA 1W1IA 4CM1A 1G1AA 4D79A 1SVOA 4DN6A 2MMGA 4HBZA 1XEAA 1LTKA 2E1PA 3M4XA 5T4HA 3A70A 3HDJA 5KHLB 3DR3A 4QL3A 1W19A 3PGVA 5FQNA 1DC5A 4TMTA 5EXXA 1ZW1A 3FYUC 3OJEA 3F5MA 1KZ9A 4S12A 2NP7A 3DH0A 2AFHE 1ORRA 2QTGA 2X2OA 3RYHB 3U9TA 1PSZA 3R4VA 1W49A 4NBWA 3THRA 5AVYA 3KKZA 3MSXA 3PLRA 2R66A 1M8GA 5E2BA 4KU4A 1N0IA 1ZJ6A 2BH9A 1UANA 2WJWA 2YS6A 4JQZA 2CJXA 3LX8A 3W04A 1NBAA 1Y37A 2IYSA 5FR2A 2OBMA 1C7FA 3G2JA 3QKIA 4MVJE 1LTQA 4N7JA 4OA8A 4E5PA 2AQHA 2C7BA 1G38A 3DLCA 2MOKA 3K2IA 3E18A 1D6SA 4I3FA 3FTDA 4MRMB 3RC3A 3QVLA 2R97A 3NEAA 2BFFA 3CURA 3V8MA 1UAYA 4O4HF 1FYDA 1KFJB 1UFKA 3EWNA 2RHLA 4DCMA 2FKNA 2VP2A 2HI0A 2P2ZA 2QM8A 1NLFA 2ZE7A 1T13A 5IKOA 1UK7A 4W9RA 5HIAA 2BEJA 4F1JA 2C5AA 4RETA 3B2EA 4GX1A 4FK8A 5FL7A 1SHZA 1E6KA 1XRLA 3O90A 5GONB 4O02B 4UOEA 4AP9A 1YB5A 1HLDA 4LVCA 3ZK7A 2P2SA 2QWXA 2XUAA 1B0ZA 3KJQA 4P08A 4CNQA 4D99A 4NAHA 4GVPA 2ZGVA 1QRSA 3PQFA 4J7UA 2WV9A 1EVIA 5F64A 4XB6B 2WTEA 1EQAA 1KVTA 4JKYA 3B5IA 2G08A 4LNAA 3VR6H 1H1DA 5SZKB 3TFQA 1UZLA 4K26A 3CZPA 2VYQA 3GOHA 4FDVA 2R87A 5GM1A 3VPAA 3W5HA 3ZHCA 5JZBA 5BYJA 1DBWA 1VYHA 3NRJA 1WB5A 3BJIC 1N8SA 2ILTA 4PGGA 3HP1A 2PQ2A 2VJDA 2ERCA 5E4YA 2YZNA 1ODLA 1B93A 4AYXA 2JGLA 4BWVA 1XDWA 4A1OA 1QCZA 4DBVO 4YDSA 4GXNA 5C7LO 1QZXA 5LQCA 3H11A 5IU6A 2ZYHA 1C30A 3DB2A 1CFJA 1V5GA 1Z0UA 4Q9JA 3TLZA 1KO7A 5MDHA 3OUUA 2VUUA 2DMRA 4AY3A 4XTCS 2BFMA 2QENA 2VHXA 1W35A 4I4TB 1ZDMA 4P83A 4MYDA 3VPSA 2GPNA 1F7VA 4ZU1X 1PD1A 1QIGA 4BN4A 3IBYA 4QJ4A 4U00A 5A71A 4AQ7A 3BE4A 4Z0NA 4GSYA 5IXSA 3GRVA 5CIQA 3OU7A 3RC1A 1NLMA 2IU6A 1N7JA 2HZBA 1MQ9A 2QRKA 3C8ZA 1KNXA 4Q7KA 5ALLA 3QPDA 3N07A 1I2ZA 4MW2A 3ZIUA 1L7BA 2SKEA 3IIKA 2IYYA 2JAHA 5F5NA 3UZUA 1C50A 1YZHA 1YZNA 4REQA 1W5EA 3KKKA 3ROKA 1J20A 1E7MA 3C2QA 1DJOA 4IIBA 1TJPB 4QVGA 2E1RA 1KBQA 2HCBA 5EE9A 4G8DA 5F2EA 5HF9A 4CWAA 4BVBA 3LX6A 2Y1EA 3I0NA 5TPZA 5AM3A 1CIVA 1BXGB 4U8HA 5LYYA 3D4OA 1E1CA 1VJ0A 2HUPA 4W8OA 3OJ0A 3P2KA 3D64A 4DQUA 5KUTA 3RAFC 2VJLA 3PC6A 2WI8A 4G56A 4MKIA 4BO4A 1Z5OA 2RI6A 3ABSB 1ZNYA 2O6HA 4I1PA 1AKVA 2J08A 4WY2A 4EUKA 1LF0A 2QAGA 6PFKA 3SF8B 4P58A 1RMQA 2QI9F 4UZEA 3VTKA 4CFSA 4RXUA 5JAMA 2PUGA 4EEZA 1P19A 4ZYUA 3UAGA 1N2CB 1LQ2A 1JHUA 1U8YA 3GFSA 4J7AA 1P45A 5JNTA 2OBBA 4UM8B 1M6NA 3HVHA 3JATB 1TW2A 3GFOA 2VKTA 3R24A 1C8BA 5KHOC 5KBYA 4BNNA 2HHJA 5D87A 1KMIY 2B1RA 2NT4A 3M49A 3ORRA 2GPTA 4FD3A 4C7JA 5JDCA 3NBMA 1ZI9A 4PVCA 5CVUA 3TJMA 4DIFA 4BWGA 1U0JA 1I4TD 4NDZA 3TW0A 1OI4A 1G63A 13PKA 4OJKA 1WKCA 4P38A 5AUPB 5FLXA 2O05A 1SUPA 3KLMX 4Y7CA 3AMVA 4E5YA 3U3RA 3DUFA 3LVRE 3KHUA 4LRUA 1PJCA 5DBEX 1VECA 4WGGA 2Q3MA 5EOVA 5AUQA 3X2EA 2BYTA 1UPBA 1RAEA 4LJAA 4ZREA 3T41A 1IN5A 4JT2A 1Z33A 3FCEA 3HCAA 3HVUA 2ZYVX 1QQ5A 1DAMA 2QMOA 2XUJA 3HO1A 4IUDS 1I0ZA 2ZIXB 1QCDA 2BEVA 1R8XA 1VL0A 1GL6A 4O2AA 4P5DA 1GP2A 2CJWB 2R1TB 3IDSA 3OPXA 3TBFA 1C1XA 3ZLVA 1SBZA 3T3IA 1HDXA 1ONPA 1TYAE 1TKBA 2UVPB 3N53A 2HF9A 4BVFA 1XEXA 1SC3A 3QKRA 1I7SB 2VRCD 1KTIA 3ZWAA 3VAAA 4X20B 3C74A 3V8EA 4M83A 1XN4A 1B42A 1VLQA 4WRRA 1K97A 1Z35A 2WU1A 2H3EA 1ONOA 3RVRA 4BP3A 5HGXA 4HVLA 3ZVMA 4TUYB 3SC2A 1TU4A 2FSFA 5FFNA 2I8CA 1GL9B 3C5CA 4RF4A 1TQ2A 3IQWA 5TQ2A 4D9EA 3CH5A 1G8YA 1BOFA 1NYTA 1VIAA 1I6WA 1LX6A 1Q19A 2CBZA 2QPTA 3FWNA 3NFYA 3SZLA 3WBJA 2XCQA 4P54A 3RVSA 3IJPA 1B3RA 2OCBA 3DP7A 4JGBA 4BQSA 4MI9A 1X9HA 5J43A 1A9XB 1RWOA 3DEJA 3L6UA 4H15A 2IYWA 3AEYA 3AQ4A 4O8ZA 3NTRA 3B38A 1PYOA 4Q3OA 4WE3A 4CFZA 5CBPB 4EGQA 1HDRA 4X7BA 5FBWB 2C9DA 3ND5A 4D74A 2XRFA 2DUUA 2AD1A 1QNLA 5G41A 2FNAA 2HREA 2ZIGA 1Z07A 2QTCA 1KAMA 3D2AA 4PQFA 2CV2A 4TVOA 1FX1A 1K7SN 5E3IA 3ZXSA 5A62A 4JJ6A 2OR3A 2OP0A 3W8NA 4EO4A 1H42A 5DM70 3S3TA 2HQ1A 1OTHA 4OQPA 3ROTA 4AZ0B 3KDAA 4RTQA 3LBNA 4IQGA 1H0SA 4IHJB 2IVZA 2H8GA 3BT7A 4TWZA 4P0QB 4AKIA 1J6UA 3ZBUA 5CVTA 5TB5A 4E5SA 3OZCA 3RFCA 2YMQA 4ZK6A 3D7KA 2ZATA 3FFBA 2FV8A 3K5HA 3EPJA 2AKEA 1CY0A 5NLLA 3ZY5A 1J8FA 2YWGA 3AIOA 1N9GA 1WUTA 2D1TA 3OOHA 2QV7A 3SS7X 5L4NA 1D1PA 1YCHA 4ENRA 1QVVA 3FFWA 3JAWB 4QO7A 1F0KA 3WJAA 1SBQA 1M6EX 4Q1BA 3EBLA 4K3UA 1NDUA 4EF6A 1E3SA 3RD5A 4ARBA 3OZWA 4PCLA 3EXHA 5AHRA 3HCPA 4B43A 1SOUA 3WIUA 5BN3B 3D2BA 2OM2A 2VR1A 4Q34A 5HWSA 3G8YA 2HCFA 1ZH8A 4LE2A 4PLCA 3HBLA 3EVDA 1F6WA 3PEVA 4XQGA 4X94A 3WGQA 1UUFA 1NQAO 1N78A 1X38A 2J7PA 4NI5A 3UCFA 1E2DA 2R6ZA 5DNCA 1Y42X 3HXOA 3VJLA 3FUUA 3DMTA 1ESNA 5ALWA 4DJAA 4FOOA 3UMGA 5IM4F 1F7UA 5A0TA 1BFDA 4Z9YA 3T1NA 5HCNA 5SYAA 1ZKDA 1YZUA 3KYJB 4OAQA 4IDEA 3LUAA 3CE6A 4AKSA 4DRXB 3ELWA 5FL7D 1V26A 4OQLA 4FMDB 1RBQA 4Q6WA 1U02A 3I5YA 3OZSA 3HJTA 2QRMA 5EXTA 3FHTA 1L5FA 4CEJA 4PAQA 1I7NA 3QI7A 4GGOA 2SCUB 1PNTA 2V5VA 1E3WB 5EJ2A 1BOOA 4ZK2A 4II3A 5I9LA 4G0UA 3QMMA 4TXLA 2E4YA 1T2EA 1DKPA 3KR9A 3ZI0A 1BN6A 3U7IA 3RG2A 3T7EA 5A4AA 3UUEA 2WYVA 2ZUVA 4M9UA 4PBTA 5KYGA 1FMTA 2RG7A 2DFNA 2IYFA 2VYVD 2M6LA 5LM3A 1II8B 1W93A 1Y0BA 3H1EA 3IURA 3NC1C 3NDIA 3DYBA 4OB6A 5F2KA 4MO9A 1XZFA 1XDDA 3L1IA 1O54A 1C41A 1R1DA 2BGRA 2GMWA 2ATIA 2YXNA 3F8TA 3WLRA 3W5JA 1ZM2A 4FJ1A 3NDPA 3KETA 2B34A 2DYKA 1O95A 5F3DA 5DVZA 3WWCA 4AYWA 4BVHA 2V4UA 4UEKA 1Q0PA 1JUDA 2WYWA 5G53C 5EUCA 3CB4A 4MEBA 2PL9A 4O4LF 5FIUA 4DUGA 3C7CB 3GGOA 5AVTA 1GFZA 5CX1A 3M0EA 3W90A 3NT2A 3OZXA 5HS4A 5I3ZA 1EPUA 3B1ZA 2AT1A 1KJ8A 2VOEA 1UMDA 3LQKA 2IEDA 1SR8A 4V0OA 3ZYZA 3DAGA 4R40A 1Q1AA 2GN0A 5EC8A 1SD1A 4QTZA 5FUWA 3DDCA 1FXUA 4C0LA 1U2PA 3KEQA 1JIJA 5JD5A 3EVCA 3I61A 3ZX5A 1SWVA 2FN7A 1IXSB 3U3MA 1QFJA 2J0EA 2TYSB 3RFUA 5FYQA 1T8RA 2Z9CA 4D9FA 2JAUA 1NIJA 2QRVA 1T10A 3KKPA 4FFPA 5HJEA 2FDCA 621PA 4DJJA 5FT9A 1MC1A 3AUTA 4KIWA 1BVUA 3CLSC 4ZIRB 1L7VC 4L50A 3Q7PA 2VL7A 2IPLA 4N39A 2BTQA 2VSXA 1KEZA 2C1XA 2QTRA 1GYPA 1MNAA 3FMVA 3IV7A 2AN4A 4MQFB 1GV1A 3HGMA 4WDRA 2VA9A 1O7JA 2GM3A 1T5IA 2YCBA 1KKMA 4P4TA 1YZ3A 1Y5IA 4C29A 3UC9A 3SOZA 5KS2A 3UFBA 1G5FA 1HT0A 5BMVF 1WUJS 3TCNA 1RLOA 3BJMA 3UMSA 1JAXA 1GNQA 5ALTA 3PGLA 1LFAA 2P2NA 3ZI4A 1QO7A 3D7SA 3OIGA 4I5DA 4E6EA 3OLYA 1NPDA 1CVLA 2BM1A 3S5UA 2O0LA 3AUSA 1UZNA 1CZUA 3H8JA 1VBFA 4WDQA 2QGNA 4B6QA 2CD9A 4QECA 4NEQA 1IK4A 2EFCB 4OQXA 1ZI8A 3U56A 3TM4A 1FJHA 3E7WA 1UT8A 3ETLA 3AONB 2FUEA 4E4RA 1CQJB 4ARCA 3EWAA 3L8CA 1NL3A 5LPNA 3TH5A 1U2GA 1CVIA 3O83A 4I50F 1BJKA 1WZUA 1IG0A 3QOXA 4KODA 2DAPA 3OQIA 1PZGA 3AFMA 1GQOA 3HJUA 1LW6E 5EN4A 2CBXA 3ZZ1A 5I7SA 2I3BA 4RJIA 1IN1A 4MQEA 2AJLI 4IIGA 5ALDA 2POQX 2OCGA 2G4LA 2ZUEA 3ZLTA 1ZRMA 1D2GA 3OCJA 4HKTA 2OENG 1TPZA 1UK8A 3FF4A 3IT1A 3ZHVA 1BC5A 1DC4A 2GF2A 3THOA 2JJ1A 1C81A 1G5RA 3DDUA 2HADA 2B92A 1NBIA 2DQSA 4IIVA 3FVVA 3OT1B 1WW3A 4E4TA 4O2LA 4YMVA 4PW0A 2FZVA 2YJ4A 3CGWA 1HSOA 3BQNB 3ORFA 3FDZA 1QIKA 4MLPA 3ZCUA 3UJ7A 2VDKB 4DNPA 4LZWA 2R5WA 1DBPA 3AHCA 3EA5A 2TMKA 3OQPA 4U7PB 4UVIA 4CKZA 4Z8YA 1JDUA 3C4JA 3AL2A 5BSMA 1X8KA 2HRRA 4BNIA 3W7VA 3O94A 3HZRA 2HSZA 1Y63A 1NVGA 1UDCA 3WNBA 3QYFA 4KQ9A 1MFPA 1TYCA 1JAYA 4Q24A 1X7ZA 2PWZA 5IF3A 1YTUA 1TKCA 1R6AA 1GILA 4OMFG 4QHSA 4LYGA 2N9UA 3V4ZA 1OYVA 1E96A 4K9NA 1QC5A 4ZAXA 1UBLS 1G7SA 3UATA 4KJXA 4V3CA 2VDUE 3EF3A 4C1BA 4ON9A 4V0RA 4AJ4A 3ODPA 4FGJA 1JHPA 1IJFA 1IEWA 1SRQA 3GDOA 4RQTA 3VOTA 3ZD9A 3JQGB 3OJWA 2Q8PA 4HDRB 3U4AA 1PT6A 1QCCA 3V4VB 2X7XA 4CQMB 4J1TA 1J5XA 1BEEA 2V7BA 2EXXA 3ABIA 4B6PA 3ETNA 4TS1A 3A04A 4I55B 3FWYA 4U2DA 4B71A 1XRMA 3F3KA 2ISQA 4AG5A 4ENTA 4DR6B 4G0YA 4WMLA 3TL6A 2XRZA 3WVNA 3FMGA 4UHDA 4N5LA 4PLYA 1Z4MA 3KOMA 3WY9A 4QHYA 4B6SA 4DLUA 2D0OB 3OFSA 2XQJA 3NJRA 1BXGA 2QQ5A 4OJQA 1U8AA 2CFRA 2D3TA 4HJXA 1JS1X 4TQUS 4F2DA 5IX8A 1Z4OA 2ONYA 3LBIA 3NH9A 4FSDA 5M3BA 5BQXA 3L7OA 4I1IA 5DX1A 5HNKA 4FWTA 2CB9A 1K3FA 5A9SA 1NVXQ 2F8MA 3T3GA 2YMPA 2CUZA 3GMTA 1N34B 1I32A 2WU4A 1R7RA 1Y9DA 2CXUA 3DWFA 4K9SA 5JROA 1JKJB 5GP1A 1VMIA 3ZHTA 5IT9A 4HS4A 3GGSA 2NTNA 3EC1A 4M1QA 3AB7A 4EJMA 4FNOA 3MJHA 3GVPA 4LTMA 4RZUA 5LOVB 1Y98A 5EYPA 5C0OE 5JSFA 3RU9A 1EA5A 4BQRA 1FK8A 4EA8A 5AXBA 4BAUA 1LI7A 1EWRA 3MAGA 4NJMB 4RKQA 2ETVA 4JQOA 2HWWA 1XQ6A 1B1AA 1JFVA 2CHUA 1N4AA 1R10A 2F8TA 5DV9A 2GA9A 4ZRMA 2OILA 5AVXA 3PR3A 4IILA 4XPIB 4F85A 3K0AB 1A5BB 4I08A 1U99A 1JZQA 3H42B 4GYKA 1BYIA 2XEXA 2NYRA 2Q5FA 3MCUA 2HT1A 3MUEA 3ZW9A 4FOLA 4EFKA 3A1TA 4RQAA 1DQYA 1J99A 1TAGA 2VP3A 3JZIA 3QHQA 1XPOA 3FZYA 4DLWA 1G21E 5EJ9A 1S4MA 2UUCB 4AY2A 5D3KA 4B2PA 3S7ZA 1M67A 4OMUA 4RJKA 5FHRA 1M54A 3U7FB 4J6EA 3BRQA 1R16A 3IO5A 1NFQA 5FNZA 1FFXB 2NWQA 3T15A 3BK1A 4B3FX 4LF4B 2PSFA 3LKBA 1Q12A 1UC9A 4FC7A 3ASYA 2W2TA 3AR5A 2D54A 3L79A 4QOIA 1IN4A 1WD5A 4UPVA 1H0RA 1ZN7A 2R7KA 3D4LA 4R7GA 1G4UR 1QTIA 1TUBB 1GPKA 1U3FA 1Y8QA 1YHNA 2NNLD 1NUUA 1FDVA 2P9YA 4KQGA 5AI0A 4IMPA 2OGTA 4X8MA 4CW7A 5JALA 4ZTUB 3E2MA 1NJ1A 4FBGA 5TEVA 4JUAA 3VSEA 1FPQA 5DT9A 1VE7A 4C6TA 4H0FA 5HKOA 2KBFA 2W6JD 3CG0A 1E3DA 1FSFA 3BOSA 3GLGA 4D4KA 3SM9A 3R2JA 3F1KA 5BWLA 2WYUA 2XKBA 3MOSA 1Y4SA 2ADMA 3TD6A 4BV3A 5A4KA 3GLRA 4CM4B 1UKAA 1R6UA 2O3JA 1LLQA 2YL2A 2WHXA 4I1SA 4XSHA 4RD3A 1H2ZA 3D6AA 1WKBA 1Z2NX 1M1YE 4F96A 4IJVA 4FDMA 4R7TA 1PYGA 1H65A 4KR7A 2QE7D 3CLRC 1MVNA 4W5OA 4W4TA 4WQMA 4BBAA 2ZT8A 2WDZA 5JBIA 5DSTA 2B7LA 4J7XA 5AI8A 5JNUA 2DX7A 1E6MA 1LTHR 4UVDA 1TD9A 4EQ6A 2RSLA 2VP9A 4MZDA 2VJPA 5KOJA 1EP2B 5DLEA 4GOND 2F9FA 2HHCA 4GMHA 4YI5A 1XMOB 3QEAZ 2RE8A 3NWJA 5HKKD 5LOVF 2GBLA 1T6ZA 1BGXT 1XLTC 7MDHA 1M5UA 1HYQA 1DRWA 3B5EA 1JQ3A 1SHJA 1W8DA 4IRXA 1TJ5A 5D2CA 1F6BA 1KE2A 4BMSA 5BN1A 4TQAA 1CDOA 3O03A 4CMBA 2W5UA 2V5AA 5JI3E 3R1IA 1U2EA 3DO8A 2DY1A 4PHHA 2OYRA 4X5OA 1BD3A 1XG5A 2IBMA 2XT6A 4NZPA 2XPCA 3MYYA 5F73A 3O74A 5K4AA 3VXKA 1KIMA 5KQPA 3PDCA 1XCMA 1MX5A 1DKRA 1Z47A 2Y92A 3UV3A 4YGYA 3OWHA 4IYRA 3LCRA 2R86A 4D02A 2JLCA 5DGXA 3K6JA 4JK3A 4FDUA 2GK6A 4G1EB 3WKCA 4YALA 1EJ0A 1JLRA 1G5IA 2ZT7A 3IP5A 3VYTB 1R9JA 3ITDA 3HXLA 3BGIA 1ZH2A 3NGXA 5CK5A 3CH4B 2QTAA 3G5AA 3ZDXB 3DNPA 5FKJA 5JJBA 3ML1A 2IXAA 1VPLA 4PC6A 3PFNA 3RLIA 3V32A 2AMVA 4RK6A 5CVEA 4ZVLA 4NBKA 5LDGA 5TQ0A 4MRMA 1CUGA 1IK6A 1A72A 4WCDA 1T4CB 5ED0A 2BJVA 4HQNA 2QNIA 2PKRA 2ZRMA 5D3QA 2GASA 3OD5A 2PE5A 2PK3A 5IJ9A 4WH0A 5JYDA 2H4FA 2PL5A 3KR0A 4MUMA 4UFNA 1G1MA 3EXG1 1KJNA 4GECA 2YIJA 2WPNA 4PHTA 2CWDA 4I9NA 4RK5A 4TVBA 4YCBA 1ZMOA 4QGGA 3EPPA 5I9NA 3PX7A 2HK6A 3CJTA 1U04A 3QXCA 5EPUA 3ICEA 2C8KA 1OD6A 4Y6GB 2ONJA 3ZXYA 2OO5C 2WU0A 3LUFA 2BJHA 3W6OA 2CL0X 3G2OA 1A2BA 3G85A 3KSZO 3WLKX 1T4GA 1W76A 4K7JA 1W9MA 2YW2A 2VXYA 1Q0SA 1JTVA 3WL3A 4WKNA 4JT4A 4PGMA 2PH7A 4HOYA 2WW8A 3CCCA 3B3FA 5M5BA 4P4SB 1RVDA 4LOLA 5CW2A 2KI5A 2IHNA 3THYB 4QPDA 1M0WA 1TF2A 3IAUA 5AW2A 1R0LA 3A1VA 1E69A 2WWWA 3GN1A 2VH5R 4K9LA 5H83A 2CWWA 3NHRA 2FMHA 1M75A 2QL9A 2LIPA 1YDEA 5FPKA 5C8YF 2GCOB 3D1JA 4FFOA 3X1YA 4Z9XA 3WGMA 1RHRA 4YB8A 2O8NA 3EZYA 4FW8A 4N76A 4AMGA 1V6AA 1KU6A 2ZUBA 4KRXA 1E9AA 1XQYA 2PMCA 1NA5A 2GZ3A 1A4UA 1U5AA 1UMCA 1HT2E 2Y1WA 3PUXA 4PANA 4CMGA 8ABPA 4WK6A 2Z2JA 2Q4BA 4FFSA 5I01A 1KARA 4C6TB 1SG6A 1RHUA 3C6MA 3KXLA 2O8VA 2B83A 3HNRA 1KI9A 5I7AA 3ZOZA 5AW3A 5JJKA 3LV8A 3MT7A 4F1WA 2Q2NA 4C78A 1JHVA 2GO1A 2I4IA 4JGGA 4ZGBA 1CJSA 1TLLA 2QOEA 3FX2A 4JUIA 5J58A 1XTBA 3IYLW 1NAIA 2RMKA 3LT4A 4LY0A 4EKNB 1JFFB 2CFTA 2P9TA 4E1VA 1GG8A 2QSUA 3AYXB 3CWZA 3EGEA 3AHFA 1L7MA 4G23A 4NYIR 1Z2PX 4X9XA 3GYGA 1TGVA 4LX0A 2ZBEA 1HQKA 4GKJB 1HG1A 3LTNC 3KWJA 2AOWA 3AR8A 3IE0A 3GVXA 3OF5A 4NATA 2RAVA 1O3YA 2QL6A 5H02A 1NKVA 4R0MA 4AQYB 4WK4B 2PFKA 2J7KA 2GFQA 5EWLB 2I4LA 4DFDA 4ED9A 2ACKA 3NBYC 4F5YA 1RRVA 3NHPA 1KRWA 1L7RA 1DJPA 2C9YA 3K9QO 3NZEA 4MITA 4X95A 3LFHA 3HK2A 4QQ8A 3LOPA 1DEKA 2AV6A 3R9WA 4CIBA 4ARUA 1LB1B 4YP0A 2QTLA 1KF0A 4CLRA 1PEYA 1U6JA 1DWOA 2CUTA 2EVWX 4X84A 5FTWA 3PXBA 4M0KA 4PTYA 2LCQA 5IF9A 3BB3A 1T9ZA 3GA7A 3LA6A 3X3HA 1UXOA 3Q15C 2QAGC 3BD8A 3ETGA 2IZ7A 2IHBA 2XKJE 4U63A 3F3SA 1XXHB 1C29B 1N2OA 4UPDA 2ECPA 1N7IA 2HIMA 1DO0A 1QFSA 5FI1B 1FLNA 2X1LA 4ZAWA 1HL7A 4BGVA 2XHEA 3U17A 2ODEA 2WZCA 3ZHOA 5LDHA 4GP6A 1PGOA 4OK6A 5T3YA 1U9IA 2QZJA 2WFLB 4B4KA 3K9LA 1CX9B 1AQUA 2O5EA 4F45A 1AMOA 2JBWA 2P67A 2IUYA 2WIFA 3NT5A 3WNVA 2OHFA 3BWXA 2W2KB 4RKWA 2XB9A 1LI5A 2YKGA 1FJ2A 4U5XA 4EHAA 2DFLA 1G3RA 4LF5B 3J7TA 3F6YA 3O93A 2AEFA 4PINA 2G6BA 2AN9A 2Z95A 3SBXA 5JNVA 2M6KA 3P32A 3VYSB 1FFGA 3ASVA 4HDOB 4UARA 4CUZA 2C54A 3SBDA 3U26A 1WBDA 4PZPA 2OGUA 3AJRA 2EARA 3EY9A 4F93B 3GJ7A 1DXHA 2V6MA 1RXUA 5I8PA 4MKRA 4J7CA 1DQNA 4DR5B 2X0IA 1NVFA 2P3OA 3M4NA 2BKLA 1SCDA 4L0QA 1T1IA 3SX0A 4D81A 2CK3A 3PZRA 4FBLA 4EGJA 3I0ZA 4FN5A 2IPNA 4BE7B 3N7AA 1JHXA 4BOYA 2JFUA 1W0KA 1HPLA 3O6VA 4FUQA 1OXMA 3A10A 3TZLA 4X1KB 3OWOA 3IEVA 1TPYA 1Y3FE 2JZCA 2W43A 2JGAA 2E48A 5JXIA 3I01M 3CNBA 5KSYA 1A8IA 5JS7A 3EF1A 2OO3A 1RWQA 5DCLA 3EVGA 1PQWA 2XEDA 1OMOA 2YN2A 2X13A 1KZGB 3AERB 2N42A 3CISA 1IOLA 3IT3A 4P22A 2QXYA 3WMEA 1LDNA 3RTAA 1GD1O 1XOIA 4B6FA 4P82A 3H17A 1CUZA 4HMOA 5DNEA 4GPEA 3RASA 3V7WA 1G5QA 3OJLA 2QRJA 3QG5A 4X1IB 3ZWMA 3LRTA 1NWHA 5J23A 1WCXA 2IYRA 5DTRA 1JJ7A 3F97A 3JQ9A 3O8OA 2J4CA 1BROA 2QX8A 2CMFA 2C9MA 3U09A 4DUGD 4UQPA 3E1GA 4DABA 2H1VA 4MP8A 3BTOA 1ZWKA 1ZUIA 1MV5A 5ALZA 3WBKA 3NKVA 2C1ZA 3S5JA 1QBKC 3IX7A 2A0FA 5EWMB 3RSCA 1Y9EA 1F3OA 3C5EA 3JU3A 2JIZA 2X9NA 2RC6A 4KKXB 1FVFA 3I05A 5H3HA 4MUNA 5ALHA 4Q4JB 6Q21A 2JFXA 2ZS8A 1ZINA 3MWYW 4P7KA 2BSAA 5JC8A 3ZLJA 1G8KA 3W77A 1ZR4A 2FRXA 4MI3A 3EEYA 4JC5A 1WQ4A 4QOSA 4AKHA 5JCJA 4O0LA 4WFIA 1RFGE 2VHTA 2ID4A 3OC6A 4NFYA 1MDBA 4WKOA 4XTRA 3RJMA 1BE6A 4CG0A 3HY4A 1ZD8A 2PBLA 3EXAA 2GTPA 5A05A 1FTNA 2NM0A 3JR3A 2AVNA 4RVGA 1E2FA 3H3FA 3SKYA 1UINA 3GLUA 2VRNA 2QP3A 1O6CA 4HCJA 5CFNA 1T1GA 1WUHS 2GM9A 3DMFA 2ZJ2A 4O2RA 4L9SA 2CMGA 3HUEA 4Y6OA 5LBUA 3WOHA 3W5AA 1SCUA 3PGKA 4Q4LA 3K7EA 1W4ZA 4C5BA 2R6GA 2GEFA 4Y18A 1C4KA 1HTBA 1QGAA 2FMIA 1B4DA 5AIAA 5TMBA 1LDMA 1YA4A 2YJGA 1FFAA 4JHXA 1JHZA 4YMIA 5L4LA 1IRXA 2JLUA 3ZNPA 3IHKA 4GICA 5SICE 3DLBA 3G0IA 4XGRA 3W8EA 4IP0A 2JBHA 3C3WA 1Z29A 4X44A 4KRYA 1FUKA 4F91B 5C52B 3AR2A 1KI6B 3KX2A 1Y7HA 2ERYA 1WU8A 5BORA 1H2HA 3AXSA 1O95D 3EGIA 3MUNA 2YNMA 3E1KA 5KQRA 4XFKA 4EG4A 1G6OA 5E2AA 3EDRA 1O96B 2ZWVA 1OAOA 3OQNA 4ZYWA 4LMBA 3ROEA 3SQMA 3JPWA 1A9RA 4IRUB 5DOVA 1TTTA 1W5BA 1H69A 1WCWA 2AHOA 2PWBA 2XWJI 1NXPA 4P4GA 1JR3A 1T6BY 4MA4A 4TKLA 5ECWA 2UXCB 1PBNA 1R9NA 3I5MA 4QPZA 4DA8A 1RRGA 4XM0A 5CA1A 2XTMA 1D4FA 2BEVB 4ZPJA 4JENA 4KH1A 1AV6A 4ZD6A 1TZ2A 1YU9A 3CIFA 2BHTA 3H5NA 4PNHA 5AYVA 1B0AA 3UJAA 3MTDA 2FEXA 3QZUA 4JX9A 4BUZA 1V11B 3U4IA 2PGNA 4NQRA 2B25A 4U2KA 1U0LA 3O4JA 3WHIA 3GVIA 2PHZA 4J2OA 2HRBA 1WZCA 1X1EA 5IUJC 3THXB 3RUIA 1LBEA 4EPVA 4CQNA 3FYHA 4ER7A 1LNZA 1NM5A 4LRTB 4HGYA 3AY0A 2BFPA 2I4OA 4H6PA 4GS5A 4CMIB 5K4GA 2A8YA 1V8OA 4LXQA 4TTTS 5ERYA 3LZDA 4ZV7A 4EBBA 3JARA 4QYIA 1YS9A 2GYWA 2HJHA 3GUHA 1U7WA 1KMHB 2C4KA 2J5BA 4X61A 5FADA 1FUEA 3U4HA 5A2QA 4HEQA 1FY2A 2ZW9A 2A3NA 1QQ7A 3OTIA 3ZE7A 5DXFA 1MQSA 3MJCA 2ACWA 4RE6A 4YRZA 3H3XA 1E59A 1KA9H 2F3UA 3HWRA 2PO7A 4A82A 4DTIA 2EZ9A 2OXCA 2CXSA 4MW7A 4QU9A 4BFVA 5FX2A 1P61B 1A5ZA 1NYQA 5FOWA 1L5ZA 2Y1FA 3OPYA 2GNOA 3E9ZA 3PQ8A 4B6JA 1VGQA 3VO2A 1J0EA 1L4HA 1OH8A 3PTAA 1CJTC 5CGQB 1DAGA 2VUIB 3MVEA 5JXHA 3EGXB 3TLYA 1MQAA 3ZR4B 1DS6A 3D5TA 4OU5A 2OXEA 5EMMA 5C3MA 3I32A 4DBLE 2QIOA 2FZ5A 4H17A 1LC3A 1KY3A 4ZCIA 2WWFA 2R3SA 2TSYB 4QDKA 1WHTA 3LSYA 3HP4A 3SPXA 3UJHA 2XE7A 3PHIA 3B13B 3E58A 4YO7A 4S1TA 4L7VA 2PZKA 3RF7A 3TZ6A 3PG5A 4H7JA 3AF2A 1YJBA 2CSXA 5HW0A 4D0GA 5HGJA 1H9BA 1C9KA 3H1PA 4NEHB 4E33A 2F1HA 3VR3D 4IHJA 4PHGA 5D8DA 1UOEA 1EDZA 4X8OA 4QDZA 4FB5A 4JI0B 1NSFA 3QUQA 1HYBA 3SSMA 5AW1A 4JP3A 3OMXA 4XYGA 3AZPA 2PQ0A 1O08A 3IAS6 3E48A 3K9WA 5FOVA 1F1BA 3BXFA 2EZUA 4JI2B 1YBMA 2CYAA 1PZEA 1RCFA 1XN1A 2HH9A 3RW9A 1XZHA 1BHQ1 1DPFA 1MDFA 2YZMA 2I6FA 1SQ6A 2O5RA 2VFAA 1MG0A 3KZXA 2RAUA 2VTDA 3KHSA 3NAZA 3P71T 4JLJA 3R7SA 1IY0A 3I1IA 3ZIDA 4NZNA 4TXMA 3PS9A 3NGLA 1KY5A 1BEUB 2PBZA 2ZANA 4GZ5A 1KVRA 2ZSFA 5CA1B 5B3JA 1I4EB 4TMXA 5DHSA 5JJCA 3OX1A 4XOIA 1OX4A 3PRJA 4WESB 1P9WA 3EEFA 4Z9BA 3EDMA 1ZSYA 2ZBRA 3B48A 5JH7F 4NPAA 1Q14A 5AJVB 1IIBA 2L17A 2VDMB 4ZOCA 4ME6A 5IMBA 4LX8A 3QWHA 1V0JA 1YZVA 3LPCA 5ENZA 4TV9A 3ZDAA 1UDAA 1YFKA 3HUDA 4FMCF 4IKEA 1USWA 2J5RA 2YR0A 4XKJA 5JVDF 5KYWB 1J5PA 4BU0A 4X60A 3ZE2B 1MOSA 1F2TB 2OV2A 2MINA 1GEGA 1NIPA 4LMAA 2J3LA 1SQ5A 2Q6VA 1QUFA 3MS2A 1KK2A 3AJDA 1QGZA 2I80A 1OV4A 3ESZA 1NP6A 3HFRA 3LGSA 3I04M 3E3OA 5FWAA 3ZNNA 3KJFA 3OZIA 1AO0A 5T4BA 4ZCQA 3VPDA 4AAYA 2AS0A 2I2XB 5CJPA 2Z30A 3CYFA 3HR7A 2AIRA 1BKYA 2VSYA 3DPIA 3EDYA 2M98A 5ALXA 4AZTA 4KXNA 2HY7A 3VNUA 1Z2AA 3QJ5A 2DOKA 3BXPA 4X1IA 3GI1A 3T1VA 1O0CA 4F12A 4HAUA 3RQSA 3KT0A 2B69A 3BD7A 4PZYA 4HGNA 5C1BA 3ENNA 2PJRA 1ZUNA 2Z9DA 2R7LA 3EGWA 5JQWA 5CDFA 2YJTD 2D1QA 4GMGA 4M0PA 2BFWA 1JIVA 2P0AA 2F17A 4DG5A 4JI4B 3SG0A 4D9MA 3N0WA 1ZL2A 3DXZA 4N5MA 5I3CA 2GAIA 1XRSB 2Z09A 3ZK8A 3WOVA 3JQBC 4YWJA 2ORWA 4OTZA 3ME5A 4RDIA 4A8JB 4FGUA 1SBNE 4WZAA 1ELOA 1Y4ZA 4FC6A 1M6WA 1MV8A 1YBHA 2FOIA 1TMYA 1Z6AA 2O1XA 2P27A 3CY6A 4N8EA 4OK3A 2NVUB 4C07A 3G7UA 3HU3A 4BEVA 3HYSA 3GNTA 4DMFA 4YGXB 2VDWB 3GGCA 3ROXA 4BVJA 1TJ3A 4H7HA 4L28A 4LHVA 5AJUA 2WVGA 5EXDA 4E5DA 5B5SA 2GHIA 1K89A 3DT9A 5FLKA 5EWMA 4N3NA 2H29A 4ZT5A 4P33A 4CI0B 3BH6A 3OLQA 1SJ9A 3SAJA 4DEYA 3OX3A 4B32A 3HCRA 3HL4A 2ID7A 2VHQA 1U2DC 4WNYA 4AF6A 4KO4S 4GEKA 2PUBA 5BW4A 3KPUA 2AX3A 3X2FA 3C6QA 3KG2A 1EDBA 3J7AC 2H7CA 4MVXA 5AVOA 3BFJA 3C1AA 4UDXX 4ZCSA 1K0FA 3W9YA 5ILGA 4RVUA 3BL5A 2QDXA 4PC2A 4RA9B 3VI3B 2VF8A 3T9AA 5EG5A 3K32A 2BM9A 4JITA 3HCDA 3U16A 3K1AA 2QD5A 3DXYA 3R9IA 5EXPA 1BD4A 3NBXX 5ITSA 4FVTA 1U2GC 3TF5A 2BZSA 1OYWA 3KZKA 4ECEA 3PNLA 2JBAA 3ZZNA 4XAQA 1GG9A 1UM8A 1W4BA 1OBVA 1VL8A 2C42A 1QGUA 1JHMA 3IB6A 3GGDA 4BXOB 5A3JA 4A03A 4DXHA 2BTEA 5D7NA 4UMDA 4D25A 1MT0A 4HNGA 1YK0A 2FSVA 1L7EA 4PXYA 5DJ5A 3OKPA 2VWQA 2XWPA 3THSA 1R4NB 1UP6A 1DC8A 1SOWA 1UC4B 4V38A 4XI9A 4BLPA 5KVVA 3Q85A 1CG6A 3H0CA 5CMLA 4RZHA 4ZEXA 3ZD8A 1N6IA 1ORWA 4UHKA 3RPEA 4Q9NA 1B8PA 1EBFA 1TL7C 4MHSA 4YP7A 1Z75A 3HEAA 1WEHA 3IXQA 2BKXA 4UEQA 4P2BA 5INTA 4M9QA 5DI3B 1CEYA 2X5OA 2Y76A 1T9HA 4MRPA 3WGGA 4D6PA 3WZMA 2RGNA 5J63A 4OJMX 4BKRA 3TTVA 3SXUB 2PUJA 3VR6D 1T9DA 3TD9A 3VNBA 2G9ZA 3DULA 2Q0HA 3KLBA 2W9XA 3Q11A 3R0VA 4BP8A 1NW9B 4C2TA 2OUIA 4IXNA 1OBCA 3SXPA 1W88A 3UC5A 4LY6A 2CJWA 2CNLA 4B81A 4E09A 4YRQA 5JECA 2OFPA 4S1OA 1CDEA 5LJIA 4Q3EA 3SVLA 3IJ5A 3A9SA 2A7QA 5D85A 1M5TA 3SZUA 2EKZA 5DM0A 1LK5A 1NNUA 3VC3A 4RM3A 2I4NA 1WWKA 3TPZA 4QXRA 3D1VA 4RHTA 4RIGA 1T4BA 1K3TA 1Q77A 3AR3A 2PVCA 4M8SA 2DKFA 3DVSX 4FYJA 4M6WA 5LQSA 4EJFA 2ZRPA 4JODA 3JALB 2FG5A 5B58T 4EDFA 5I9IA 2H4ZA 3TUZC 3H3JA 1BDHA 2H85A 4G67A 4HLNA 3QWIA 2W8BB 3KDPA 3MPOA 2GUWA 3VO8A 5K3CA 2CL7X 1HOTA 5LQNA 2PKCA 4URFA 5IKEA 1GKUB 3F4KA 2XB2A 3A6ZA 4Z6KA 4Y9TA 1KYXA 1BDMA 4N7RA 4RKRA 2Y6VA 3GLFA 4HWPA 2KMLA 4DUYB 2MSKA 5AI4A 2N1MA 2HJGA 4LJSA 1PJLA 1UKCA 3CUYA 4IJ6A 2IYOA 3E22A 5FYDA 4YRFA 4LCJA 3IMCA 1NQWA 4TTJA 3PCXA 3Q40A 1GTG1 4H7EA 4W7HA 5K3BA 3IE2A 2RJOA 4FGSA 5ADHA 1ZD3A 1TU3A 2V45A 3FBGA 4BDTA 5LLSA 2PKQO 4GI1A 1V5FA 3AXTA 3LY5A 4WZAB 1OZAA 2BFEB 4MWOA 5H4HA 4C5CA 3C7DB 3IODA 4GOOD 4GZLA 1Z7BA 5DTEA 1IOZA 4X63A 2HFJA 5EIBC 4ZVVA 3P26A 3FTEA 2CNBA 5HIIA 4RY0A 2XIQA 1YIDA 1JDSA 1SXIA 1ZEMA 2CBGA 2D8MA 2RGWA 3HRIA 4YJGB 3PPVA 4Y2GA 5MN5A 1E2BA 2ZJ6A 4PN7A 1H66A 5D1HA 1JT2A 4MP6A 3ZWBA 1ZUWA 4NTZA 2BI8A 2FPGB 3DSRA 3PSHA 4J9UE 3L7IA 1BA2A 4RTMA 5HJ2A 3MELA 4DZTA 1F3LA 4AB1A 2P6NA 5KVAA 5FTJA 4OAOA 4IV8A 1INLA 3V48A 1E63A 4RD2A 4WLNA 3LM8A 1SCKA 3CEHA 3HA7A 5CURA 3RH0A 1EWKA 1N0VC 4CMKA 2GEDA 3D59A 3Q10A 2VZEA 1L4MA 4JJAA 1E61A 4LJ7A 4KNWA 2Q7DA 3URMA 4BX3A 3TGLA 1FEZA 3FYUB 4GUAA 1ISRA 5B58C 3NYWA 2Q6LA 4RLSA 3JQ7B 3MB8A 1WP9A 1LJLA 1OPRA 2P6OA 3NHMA 5IUKC 4CKXA 3G7NA 4M4SA 1TMOA 2AI3A 4AJOA 4XA8A 4MWEA 1XPUA 1GGNA 1N6PA 3D5QA 4MRRA 1TUBA 5COQA 3D6HA 1GZSA 1S7CA 4WIAA 1R0BA 1QHEA 2YIDA 4HRAA 3OEWA 4RSMA 4RBNA 4X24A 3TL3A 4C3OB 3B12A 1FFXA 4G8BA 2QM3A 1D07A