1RWPB

Crystal structure of human caspase-1 in complex with 3-{6-[(8-hydroxy-quinoline-2-carbonyl)-amino]-2-thiophen-2-yl-hexanoylamino}-4-oxo-butyric acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwpB00
3R6LB 1RWOB 2C1EB 4JB8B 4ZVOB 4DCJB 2QLJB 1RWNB 2P2CB 2QL7B 4ZVTB 2H65B 3IBFB 2CNOB 3EDQB 3IBCB 1RWXB 3GJTB 1QDUB 1ICEB 2CDRB 1BMQB 2C2OB 5IC6B 2XYGB 1RHRB 2H51B 2HBQB 3D6FB 2C2KB 2CJXB 1QTNB 4DCOB 3R7NB 3KJNB 2XZTB 1SC3B 2DKOB 2QL9B 2H5IB 3GJSB 5K20B 1RWKB 1RHUB 1NMEB 3GJQB 4ZVPB 4LSZB 3P4UB 1PYOB 2QLFB 1RWVB 1RE1B 2H48B 3QNWB 3SIPB 1RHMB 2CNKB 2HBYB 2C2MB 2XYHB 3D6HB 2CNNB 4ZVRB 1F9EB 1I3OB 1I51B 3R6GB 1RHJB 2C2ZB 1RWMB 3R5JB 2H4WB 1PAUB 2Y0BB 3D6MB 2QLBB 1GFWB 5IC4B 2FQQB 1RHKB 4ZVSB 3P45B 2Y1LB 2QL5B 2H54B 3R7BB 2H5JB 2HBZB 3R7SB 4DCPB 1RHQB 2H4YB 3GJRB 1SC4B 3KJQB 1SC1B 3KJFB 1RWPB 2XYPB 4ZVQB 1IBCB 1RWWB 3RJMB 2CNLB 4ZVUB 2HBRB 3NS7B 3EDRB 2XZDB 2CJYB
chains in the Genus database with same CATH superfamily
1N5TA 1WG1A 1FRKA 2FHKA 4FPRA 3PRVA 7AT1B 2W2NP 3KLEB 2BV3A 4IOBA 1TKXB 4HH1A 2C2OB 5F3TA 3KK3A 2P5VA 1SJFA 1FCAA 2UUCF 3KUHA 2MEWA 4USWA 4PQUA 4J9QA 3NCRA 2EXUA 2E1RA 1FT8A 4YN3B 2MZ1A 1RSCA 1X4HA 1XN9A 2VV5A 2LA4A 5L1KA 4DV2J 4YDXA 2CWXA 1RAIB 2G0CA 3W2VA 2ADCA 1FK9B 1PJ7A 2QLXA 1QJHA 4EYHB 3AHPA 3NS5A 2XNQA 3FK4A 2JDJA 4F8RA 2LVWA 5IT9U 1RAGB 1U0SA 1XNQF 1Q16B 3WIVA 2ZVSA 4ZVQB 5F8NA 1WC4A 5J2QB 3GCWP 1W7WA 2V4JA 4KC5A 1S1TB 1FEEA 3EYZA 4WCEQ 1ZPWX 4KAIA 1SUQA 4KTQA 1FNOA 4M8LA 5BJRA 4DL3A 4RR5A 4DS5A 1VBZA 5IT0A 1OWXA 1ZOTA 4IOAQ 3AD8C 2VFRA 4HT5A 3BSOA 1QAIA 2YWGA 5KFJA 2A2DA 4MKAA 4YMEA 2IJRA 1NKCA 5HAOA 4Y0FA 4Y28C 1T9YA 1P9YA 1O8BA 2FLPA 4UT4A 2Y1IA 1NZ8A 2KHCA 1TAQA 4IO9Q 3QWUA 2W7AA 2CQ4A 2M9KA 2J7KA 2MY8A 1UJ5A 2Y9HA 3CNQP 2KG1A 4ETXA 4JI7J 1PAEX 2JWNA 3MTKA 2HS0A 2QZ8A 2NXEA 2I38A 2HHVA 4B3OB 2OPSB 3IBWA 2PE8A 4NLRA 2YKQA 2K1RB 2R8KA 1Y5IB 2B4VA 1FNXH 2CQGA 1C4AA 1VR6A 2HRYA 2AKWB 3OR1B 4WE1B 1PBUA 2HNYB 2DXEA 2AWZA 4DFKA 2Z57B 1N88A 5B7WA 3PXGa 1VC6A 3OTCA 5K8PA 5KG6A 1YI2S 1RLCL 2BJEA 3PR4A 5HP1B 4DZDA 5L9XA 4PXEA 2V2ZA 3UQSA 4ECRA 3OHBA 4ZJLA 4CLSA 3A8EA 4V19J 5KAKA 1RISA 1TR0A 2VFVA 2R42A 3DU5A 4ZLLA 2AJ0A 3LP0A 1YJ9S 4RWXA 1O5JA 4USUA 5HI7A 3NY0A 1G4CA 4ED1A 1UW4A 3P96A 3VWSA 1F1BB 1S1XB 3GFZA 2WOMB 3V5RA 3LQVA 5KT5A 4X4PA 4FYWB 3D2WA 3SIPB 2H1YA 5K8OA 4DUTA 2XO7A 1BQXA 4Y3CA 3EM1A 3JSMB 2DIVA 1F9EB 1DQAA 1I1GA 3QAEA 1ELOA 1YJVA 4F4YA 2GAHC 5CHCB 1VQLS 3CJSA 3QBCA 1IBLF 1XMOJ 2LLZA 4RW7A 1YRTA 3TW0A 3HO1A 4F50A 2WHOA 2OPRB 2CQ3A 2A3JA 2DITA 3X1LB 4DQSA 4O4GB 2MZQA 2NS1B 2DNOA 4CYUA 2WRMA 2D3UA 1OPIA 4MTPA 4DHVA 3TAMA 1OYEA 2C28A 2MHEA 4CLWA 3IP0A 3M2UB 1RCXB 1DJ0A 3EPIA 2ZJPQ 5D4LA 4YEAA 4NYPA 4CZCA 1YZ7A 3R8YA 3HSGA 3EE3A 1S97A 4XPEA 1M1GA 4JI6J 2OHDA 2PMHA 2JL9A 4J9KA 2BRLA 2HVZA 3AD7C 1NCLA 1WHVA 3PFOA 3UI3A 1RABB 1YTYA 1S49A 3PX0A 4ALZA 3TRGA 2JH3A 2BJ1A 1M0SA 2ZBIA 2GJFA 3GFYA 4USMA 1SQFA 2GA7A 4RO0A 1FKOA 2CAJA 4ILRA 1D8ZA 4WXOA 1NK5A 3MMAB 2CJYB 1TAUA 1EB0A 4DUYJ 4LF5J 3WZ0A 1KQKA 1S48A 3QT8A 2R8HA 2CADA 1HNVA 3GCXP 1S6QA 5J2NB 2NXUA 3PM9A 2FTRA 1FF2A 2LMIA 4LSLB 1L3VA 4TLQA 2EFVA 2I5JA 3WC2A 1WTBA 3Q2TC 5HBMA 4DLEA 3VALA 1A0OB 2HVEA 3RRKA 4F7VA 1RBOB 4K50A 1ZPVA 3DYAB 1VQ8S 1ZAWA 3KLVA 4F4ZA 2ASDA 1R0AB 3QPIA 2YWKA 4F26A 1PGZA 4X64F 3UN5A 1QM9A 3FRYA 2R7UA 2MSTA 3WBZA 4DV5F 7FDRA 2DPIA 1VGYA 4C0OC 5F9NA 1P6TA 2MQMA 2P9CA 4N8NA 4OQJA 1WC3A 3BSCA 1CSJA 4NZ7A 1X4FA 1BLUA 2PI4A 1D3WA 2OEMA 4NXMJ 3TJ9A 5IS2A 4RNFA 5K5MA 1U1PA 4I7FB 4P74A 5JVHQ 2V9WA 2O3DA 3J80U 3N5BA 4LMZA 3G8QA 2ZH5A 1GQEA 5KFBA 1RHRB 2GQCA 2BKOA 3T19A 3HHEA 4DV3F 4JI1F 4A8MP 4DBQA 5AJ3J 3E01B 2VA2A 1WWHA 5GMDA 1RTJA 3I9ZA 2QTWA 3DXBA 1RE1B 3PX4A 4WZMA 3C6TB 4WFXA 3DM2B 3RRGA 2JC1A 4Z2XA 2UUWA 3S1TA 4S0MA 4FZVA 2D69A 3I56S 2CZ4A 4RLEA 3VVTA 1RTDA 4NLXA 4PYAA 5E0OA 1X4CA 3LA0A 1X8DA 4WP3A 2F8HA 1MWQA 3W2WB 2ROPA 4H4KA 1L5UA 1X60A 5ETQA 2IRYA 2LXFA 1Q0NA 4AQYF 3HPOA 1ZZFA 1HBUB 1QUVA 2G0JA 3W9IA 4J9RA 2OMLA 4RW6A 1DFDA 2A10A 3DOKA 1LQ9A 3PV8A 1PYSB 1WF0A 4IRCA 1LOUA 2L08A 1IKYB 3HP6A 2VU5A 2D41A 3UDVA 2V8HA 1VBYA 3IS9A 2H65B 4Z7CA 4DWIA 3BGOP 1D0EA 1N8RT 3CW2C 3VGVA 4ZPWR 2KJVA 2R7TA 3M32A 4Q8FA 4P10A 4O0NA 4YQWA 1UAWA 4UQTA 3C19A 5DLFA 2JFKA 5A6PA 2DH8A 1UTAA 4LRCA 1KDNA 1WTFA 2WBMA 5G0RA 2QL9B 1DURA 1Q79A 3IC1A 3PIOQ 2OEJA 2R2RA 2GVZA 5HMZA 3P4UB 2W9BB 4MIAA 2LQJA 4KT0C 4J9OA 1X0FA 2DXDA 1XQIA 1LWFB 2D1CA 2CNKB 4XDCA 1RHJB 1WD6A 1YRUA 1FWKA 4OZ0A 2MQPA 2FHOB 5KFGA 2VG5A 2XQCA 1CJTA 4LRBA 1CQNA 1YRXA 4TU8A 2H54B 2E1PA 2VBZA 4W98A 2GQ2A 2H4YB 1OYDA 3LO3A 3Q0AA 2O1PA 3D6TB 2HS4A 1FJGF 4ZVHA 1E6YB 3KJVA 2O66A 5HL7Q 4NXNJ 3GIRA 2HWTA 3BEGB 3LANA 2IA0A 1NNDA 2AEMA 2RVJA 1WACA 4QPXA 4B9VA 2GFFA 1D9DA 2B56A 3QT6A 2UUAF 4Z7YA 4C8KA 1AFIA 3A3OB 1HQEB 3UW1A 5ETTA 4B9SA 1RACB 2AF6A 5CA5A 3PO5A 1B70B 4MKVA 4ED5A 5SUHA 1BY9A 5B0EA 3MAQA 5AXNA 1TL3A 4RJVA 5I4MA 1UL3A 2IDLA 3NMAA 3M8RA 1C0UA 2IY5B 1JKHB 1KLMB 3N6MA 2HSEB 1HW9A 4LVOP 1HNWF 2XSFA 4R5PB 4NL5A 3SV3A 4DG1B 2MQNA 1QSLA 2DR7A 4KGZB 4KV8A 1CEZA 1G6BA 3DLEA 4LFBF 1J5OA 3MEGA 5L38A 3O5TB 4DR1J 4NLSA 3CCTA 2QYGA 3ZTOA 4JUZA 3Q8QB 3FCVA 4A8YA 3KJQB 4GKKF 2VA3A 3QT7A 5A0YB 1NJWA 1HFEL 2CVIA 4LBIA 4RL1A 2I6WA 1RWOB 3BGLA 1L3SA 2CJKA 2LDIA 4LF8F 3J81U 2YX7A 2VQEF 4IQMA 2AW0A 1DZ5A 4OX9J 1HKAA 4X62F 4OI1A 1RT2A 3AQPA 4ZIVA 4YR3A 2HEKA 1VJWA 4NI2B 4P9SA 3H20A 4DL0C 4M63A 4WKYA 2GC8A 3R5BA 2FUG9 4ELTA 4NRTA 3B6BA 4PG4A 1XIQA 1CC7A 4J9NA 2CA9A 5HJYA 2G13A 1OO0B 2HQCA 5EX3A 2X1FA 2NXCA 6AT1B 2DT9A 3D28A 1F9FA 2CG4A 1BUXA 3J7YI 2GHWA 3D6MB 3DLGA 1VLYA 2NPIA 2V0NA 4GKJJ 3IXQA 5IM0A 1HWKA 2GQQA 2U1AA 3R7BB 4DV0F 2V8PA 2VICA 3UDCA 2XHWA 4A8QA 1FJGJ 2F3JA 1BQNA 1WORA 5E5NA 1HIYA 2E5HA 3TOQA 4DV6J 2BJ9A 4B3SJ 1JLGB 4DSFA 3EGZA 3ZZ0A 4PZVA 2CPXA 2AV5A 3SI8A 2XMTA 2BACA 5E3RA 1LW2A 3VAKA 3L9ZA 1S9EA 1WHXA 4NYOA 2CJBA 4CWBA 1WEZA 3D1OA 5CZVA 2C3YA 1HPZB 2U2FA 3EGWB 3TEGA 2HKEA 2GO9A 1FDBA 1J2VA 5EUHA 5A8RB 4BCAA 4IYQA 2VQFJ 1M1HA 2HFSA 1YSJA 4QYRA 4FP9A 2M70A 2FY1A 4AUKA 2ZD1A 1VQ7S 1IN0A 3NBPA 4Q0BA 3H8YA 1YVFA 4P6QA 3FSXA 4OHZA 4ES1A 1FTRA 3IM8A 4NLYA 4LFBJ 1I51B 5L46A 4PXDA 2AYGA 3GB0A 2BA9A 1ZA1B 1H98A 5C24A 1MMNA 1V3RA 4ZVFA 4I67A 1SC4B 3QLHB 4C8YA 3KG4A 3KJFB 4DPYA 2YKNA 2CJQA 3ISND 2E7XA 1T03A 2J5AA 1JX4A 4BLGA 4BC7A 4XIUA 4QWBA 3NCPA 4CQ1A 4DLGA 5AE2A 3EX7B 3SQGB 3QWPA 3IBFB 4RX6A 3MPWA 2HW3A 3HVTB 3M30B 4JI5J 1XMBA 1RT7A 3CJKA 2A0FB 3I6PA 4P75A 3C2PA 3ZNUA 1U1OA 4M1KA 3C66A 2JSXA 3ET6A 3OVSA 2IHR1 4C7QA 1R7IA 2ZFHA 4HHUA 1NSAA 1MN7A 4LSZB 3RR8A 1MW7A 1P9QC 4CH0S 3TANA 1FFGB 3MFIA 4OI2A 2W1BA 3K7RA 2QV6A 2DRAA 1RHKB 5HO4A 1WI8A 2NCKL 3GIMA 1PKUA 3I96A 2A6MA 1LWEA 4M5DA 2LEPA 2UUTA 4WWSA 5CYQA 2FHMA 4WIQA 2CNLB 3M2VA 2IA6A 4EO8A 4ZMMA 1G3OA 1WNEA 5LSRA 2F40A 1DHMA 3IO1A 3TI0A 4DF4A 2E1CA 2K7KA 3BR9A 3HX9A 4IR1A 2GZOA 3C3LA 1KHVA 1F3VA 2O01C 3HVAA 4C8NA 2BW7A 1WOPA 4WPAA 4KHPF 1WEYA 1RAOA 1VK3A 1P27B 1RWKB 3EWGA 4OYBA 1UPPA 2DCUB 3I0SA 5KFYA 3T6BA 3JB9k 3I0RA 1R0CB 3QGPA 3TO8A 2EW9A 1TMMA 4UOHA 3KK2B 4F67A 4GC7A 1FJCA 1VRUB 4CLLA 3O1LA 3J81j 5CD4A 1HWJA 2DD8S 2AU0A 2FLOA 1RKJA 4PYDA 1HARA 1UZDA 5D0RA 1ZTTA 4AL6A 4J9UE 2BX6A 2IPOB 1N0UA 2BR0A 1X4BA 3PVXA 3KLEA 2KYZA 5LSLA 1Y5LB 2HQGA 2FJWA 2CQ1A 1TKXA 1HWUA 1ZM9A 1RA6A 1CJVB 5G4DA 3OL7A 2GIRA 2NXNA 3MECB 3WQPA 1N5YA 1BMQB 4PQAA 3NGSA 3TQEA 1YKWA 3OL9A 3KXDA 3V2UC 2D9PA 3HLUA 3HHKA 2F4VJ 1FK9A 1UWBA 3GP9A 4TXSA 5LJ5Y 3IM9A 5IFMA 4MYTA 4KKOA 5H9EK 5M2PA 1GXUA 3GFXA 2HK2A 4X4TA 1F0XA 2DNPA 1SJ3P 3GYGA 5HLFA 4DR2F 1W26A 4OLPA 3CJ2A 3AA8A 5J2QA 2JLEA 3RW6A 1IM6A 1S1TA 4JV5F 2BE2B 3I9V9 1DARA 1PJ6A 1FDNA 4HDGA 2RDIA 4ECXA 3G4SS 4USVA 2HHQA 1U47A 3SCKE 3SZ2A 4X4SA 2RHQB 1D8YA 3MM8A 4QIGA 2NSCA 2HZAA 5A8WB 1S6PB 4IG3A 2B5JB 1KS2A 2CKWA 3AT1B 4FYDA 2ILYA 5ETMA 1JLFB 3RAXA 2EPIA 1TKTB 4IH7A 1LWXA 1N52B 1S0OA 3NOCA 5BXIA 4P7TA 5GMKa 2K1RA 3MDFA 4OZNA 1XWLA 5FLXY 4ED7A 1SKRA 2Z2YB 2HNYA 4FKYA 4YB6A 3N01A 3VF0B 2XLJA 2HMIB 3VGSA 1JJHA 2ZUGA 1KTVA 2ACMA 3IG1B 4NLGA 2YY3A 3M8QA 4QIFA 2C3MA 4KHRA 2OH2A 2UU9J 2V2QA 1UZHA 2SXLA 1Y10A 4DV1J 4QCLA 1VBKA 4UOGA 2BANB 1UJ4A 2NPFA 4ECWA 3KNGA 1KVJA 3DLKA 2MTLA 1SH0A 2CIMA 4KGMA 5DJBA 2RD5C 2PO4A 3JYTA 4OZJA 1EP4B 4OZLA 2VPWB 2WOMA 1FWPA 1S1UB 5CYMA 5KFLA 2IMOA 1VQYA 3M4XA 2LFVA 4YOEA 2DKOB 5KFHA 3JSMA 1MMDA 2OJ3A 3OTEA 4DSIA 2FJBB 3R1LA 3T1AA 3HHDA 3L4BC 3JXOA 1DY3A 2FYXA 4LF9J 3RZAA 3D66A 3CJTA 3BS9A 2DNHA 4QYZJ 4RZRA 4DR2J 4E8UA 1UVNA 2FB0A 3QGGA 5KG2A 2CZVC 4LSNA 1VHIA 5KFMA 5F8HA 2OP5A 1Y00A 3RTVA 2LYVA 3KHHA 3DRSA 4LREA 3KUEA 4WBFA 3FBFA 2UXDJ 5L1JA 4JI3F 3TUZC 1M5PC 5IQQA 2YNHB 5D77A 2QO3A 5L8RC 4C2MA 1X5OA 2EG2A 1WSVA 4FXWA 1VQNS 2QSWA 1RA7A 3ZTRA 5F9LA 4NEYA 1WC5A 3T9NA 4QIVA 4OL8A 3JSYA 3C14A 3FEZA 3VHQA 3ZZPA 3MEEB 1H74A 4FF2A 1LXJA 2HBQB 2JVRA 2FPHX 3D6FB 3GTYX 2XGPA 4KQZA 4YB5A 3FBEA 3MFHA 4RW8B 2DVIA 3CO0P 2UVRA 2HG4A 4LQ3A 3KNAA 2KKHA 4JI4J 4NA3A 4DPTA 1TK8A 1VJQA 3TR5A 1TL1B 1ZM4A 5C2GA 3W62A 3RRHA 3DOMA 4A8KA 3OJUA 1LW0A 4ZP8A 2RQCA 4K0KJ 2GMJA 2JRSA 4OIXA 3BR8A 2DR6A 1Q78A 3MMAA 5H9FK 4RW4B 1MROB 3H2UB 2OGUA 3PRDA 5LL6d 2G2ZA 5AXKA 3TAQA 4KHMA 3RB0A 4MT1A 2I9SA 3MMBB 2RUGA 1C1CB 3IWXA 2IJNA 3IAM9 3MPUB 3PW0A 5CCLA 3BV8A 2R2SA 8RUCA 1H0HB 5FD1A 3NAHA 1VQ9S 3GJTB 1YIJS 1JLBB 3W8GA 3P8BB 1SH2A 1HYSA 4ED4A 3M6VA 1U02A 1KQFB 3R7NB 5KFNA 3ZNJ1 2W9CA 3I87A 3M6UA 1K73T 2Z0GA 5DLGA 5KFIA 3X3UA 4DR3F 5BR8F 1RU2A 3MEKA 3MCNA 1NLKL 2A1BA 3SFGA 3B8HA 3PFEA 1X4GA 4FXDA 1S79A 3OPKA 1GNKA 1RHMB 1B4SA 4LQ9A 4JV0A 4DUZF 1VC5A 2FVRA 3HJFA 1TVRB 4F0KA 4LF4J 4IFVA 5D78A 3MM7B 1EIYB 4Q5VA 2HPUA 4ANDA 3PACA 4U7UK 2MKCA 4PWDB 5F8LA 1YX2A 4PG6A 1KVKA 3H4BA 2N3OA 1FKAF 4DPXA 2N7CA 4M5NA 3H7HB 2G2OA 1LWCB 1NK7A 2KT3A 1X31C 4B9NA 3JQMA 1RZMA 3H59A 4LFCJ 2DGXA 3K57A 1OSDA 2CJAA 3KG1A 2UUBF 3W5YA 4AE5A 3E01A 2BQUA 1LFWA 2RMLA 3LAMA 2E66A 2C3OA 2B4PA 3GIIA 3VQSA 3BGFA 2NUUG 2RIJA 1NSQA 5JJBA 3DM2A 1QE1A 2YKMA 4C48A 2Y1RI 5C25B 2KFYA 2XWYA 3LWLA 3K2YA 4OHWA 2KRBA 2IC3B 1AA1B 1NHVA 4TLRA 4QZVB 4PXCA 4UQGA 1IKYA 1R0BG 2MKIA 3TZYA 5AT1B 2ZDPA 4PG5A 4UUWA 4Y2CA 1HI8A 3MM9A 3ZTPA 2OI2A 2OIHA 4B9LA 1PJ5A 3CCSS 3Q83A 4E0DA 5KG3A 3CCWA 4CO2A 1S1VA 3U1MA 3MCMA 3HCXA 5EWGA 2BZ2A 1U2RA 2YWHA 1FI4A 4JYAJ 4X4RA 3JSBA 5D4OA 3W66A 1X5SA 1I6JA 3MMJA 1A7GE 1IUJA 4OYZA 2W9BA 2RE1A 5M2UA 1VQSA 4LR7A 1HR0F 1LWFA 2CQHA 4R0JA 5D15A 2D3ZA 4URQU 2XGQA 4HLBA 3QRQA 4FYVB 2VPZB 3M7VA 3UCZP 2ZC4A 4NLOA 4AXJA 3UWTA 2GS8A 3R6GB 2B9YA 2HIQA 4LVNP 1PAUB 3UD5A 5LT5A 5ADZA 2AEJA 3RBXA 2CPFA 3NL0A 3IA0A 4OJ1A 5KTQA 4LF1A 2XBPA 3KLIB 4KJIA 3CT9A 2HHTA 2K2PA 4ZPTR 3M2RB 4UOCA 1HQEA 4TY8A 4H54A 4N41A 3POTB 4EFAC 3W1YC 2IAJB 4C8OA 1D09B 3D7SB 2GGPB 2UUBJ 4I4BA 3D1QA 2E5JA 4DX8H 2HGLA 1EQMA 2CQ2A 2APOA 5DZ6A 3THPA 2HAFA 3T5HA 4A8XA 1YBUA 4ELUA 4DG1A 3DI6B 2MDAA 2HLTA 2ZM6F 2QLFB 4NCGB 3LGHA 2EK6A 5T7LB 2GCFA 4ECTA 4X65F 1E6VB 4FXVA 4MK9A 2Z2LA 2QE5A 1W25A 5KFFA 3QGIA 2XO6A 3TARA 1MU2B 3HT0A 2CPJA 5KFKA 2QIFA 4B3TF 3HVRA 1UFWA 5HVHA 1HWIA 1CC8A 2XMJA 5E33A 2QFIA 3ICLA 2UVWA 1UJ6A 1S12A 3SDEA 1T9TA 4N56A 1ZYQA 2AJ4A 2VH7A 4F4WA 4LJMA 1L3UA 1H7WA 4KGXB 1RYSA 1SPBP 1H3DA 4ZVOB 4QPTA 4CH7A 1F6TA 2XMUA 5GADU 2B8QA 2QLWA 4DZ6A 2B6AB 3EZUA 3BGRB 1D1UA 2XYGB 1RP5A 4OHVA 1O51A 8ATCB 5D0GA 4W92B 4DQQA 5DZ7A 1F5AA 1RJJA 3HULA 1HI1A 1U09A 2CPIA 1IKXB 1VIXA 3SV4A 4L3NA 1IBMJ 4OYPA 1XEZA 1PILA 1TL7B 5A2QY 3ENVA 1OS5A 1ITPA 3D9BA 1SH3A 4DQIA 4FVMA 4RBUA 2AGOA 2A6OA 2OFGX 3EJMA 5KFPA 3TQ1A 1IM4A 3I5CA 1JLGA 1VBXA 2VFSA 5A6WA 5K14B 2QL5B 4NLWA 4DU7A 1KOOA 1F60B 4M94A 3U1LA 4FS1A 2GIQA 1C0TA 3BKTA 4C11B 2AEFA 1C1BB 5HMXA 2DNGA 4I1TA 4DX7A 4Y34A 2F4FA 1KOHA 2YQ0A 2IM1A 3V6HA 1V6HA 2XY5A 1HNZJ 2HYIB 5A8RA 4Y00A 1TZ0A 1BC6A 1JIHA 3R5GA 4IQXA 1NK9A 3BDPA 3DRRA 4XAKA 5DDPC 3TAPA 1FKPB 3CB4A 4NLQA 1YJUA 1IQTA 1VQ6S 3CJRA 3KLGA 3C16B 3R5DA 4DCOB 3P6YC 4ICLB 4I2PB 4MMOA 3LWMA 1U4BA 2D74B 4J90A 3BQ1A 3JSRA 4X65J 3OTDA 4LR8A 2RF2A 3I5BA 1FVSA 1XTZA 2EFNA 2BM1A 2I1RA 3RGIA 1NPKA 2QMUB 3HD2A 2JJ4D 4ZDNA 1GT8A 2HIYA 2DHSA 3HHLD 4XK8C 2R7SA 1XBWA 2DNZA 2WB4A 4DSLA 5F8GA 2GVDA 5KG7A 2R7VA 3CULA 4USHA 2BYCA 2ZKUA 1WJ9A 2IJFA 4DMZA 5KFWA 3U02A 1NK6A 4JI0F 3OFGA 4HDHA 1K44A 3OW2R 1S0MA 1FD8A 3V4IB 1YDLA 2FJVA 4ZLNA 3TA2A 4Y2AA 2PFDA 1PIEA 4FPIA 3A3NB 4ZOSA 3V6JA 1T11A 4OYAA 3PR5B 5B08A 1EARA 3EMTA 4KH0B 4H4MA 2MJNA 2HQ3A 4Q44A 4DQRA 3HT3A 4JI2F 1G1XA 1VRQC 3RU0A 1N36F 3ENAA 5ITHA 3G82A 3NAIA 3NEKA 4DI6A 1FFSB 2Y1LB 1KONA 4G1QA 4UTGA 5FJ4A 5IWAF 3D54A 2BOPA 2UXBJ 3FCWA 2YNIA 4OYXA 1WI6A 3QIPB 3PYDA 2YKOA 1U1LA 4KSEB 1GTHA 2RT3A 3OR2A 4O44B 5C5JA 1S0VA 1N32F 3H25A 4ZS6A 4BWMA 2VJVA 5CQGA 3H2LA 1SJQA 1FRLA 2ALZA 2NYHA 4IDKA 4CO1A 4ZVGA 5GAGU 4K5SA 1FA0A 2WCXA 4NLUA 3A12A 1U2FA 1XMQJ 3O44A 2IM3A 1URRA 3KK2A 2BJ7A 5I3QA 2FZKB 1MNEA 2LQ5A 3TP2A 4XO0A 2PMWA 4OHYA 2ZH4A 1HBOB 4EGLA 4CTAB 2CPYA 4KY3A 1U1RA 1WHYA 1CQMA 2M5YA 2C22A 1WKJA 5LXYA 4NPOA 3AD9C 3T1HF 1C2PA 2V6AA 1UETA 2K8GA 4AD6A 1WC6A 2FLLA 2YNFB 1JLCA 4ED6A 3E3XA 4OHXA 3V81B 1CJVA 4W4MA 5KT6A 2EBEA 5F8IA 1HHSA 2YTCA 2RU3A 2MGZB 2N82B 2PN6A 1JJ4A 3UO0A 2LQ8A 2CQDA 3MECA 4ZP9A 4C97A 3MMCB 4P72A 2PFFB 1ZAXA 2VG7A 2CYYA 4GRSA 3Q8VA 3AH6A 1H2VZ 3CE8A 4JI0J 4ETZA 5K9FA 5GAHI 2DHHA 2R7RA 2FZGB 2PC6A 4RNNA 1U6FA 1U1NA 3MR3A 1YLXA 2RU9A 3QO9B 1U48A 3D4JA 3HHLB 3KLHA 3B78A 3F44A 1RT6B 3TVYA 1JB0C 1RT4B 4U9RA 3FCHA 1M5HA 4M5JA 4X4NA 4ER8A 2KRRA 3OXFA 1ZS6A 2J9DA 5M2RA 4YP3A 2EI5A 1KKHA 2DCLA 1IBKJ 2BE2A 4IRDA 1ZTWA 1Y4ZB 4WK1A 4CLPA 4CO5A 2ZE2B 2C2ZB 3RYLA 1LKZA 4KE5A 3H5SA 4F4XA 2QA4G 2XNRA 1WKLA 2YWFA 2VF3A 3AOAA 5AXLA 4H4OB 2Q79A 3NKYA 4IO1A 4NMLA 1RWPB 2FJAB 2CDQA 2ALYB 4HHHA 1IBCB 3PYGA 3B4DA 4I64A 3BJYA 3W5XA 5E3PA 5A8WA 1S6PA 2ZBQA 3G86A 2K06A 4MFBB 1U1MA 1NO8A 2IIHA 4W90B 1AUDA 2XWXA 3MAAA 4ENOA 3CC2S 4JP8A 2RRAA 4F3OA 1N56A 1RU1A 2BXJA 4MYUA 1NU4A 4WFYA 1H38A 4FF3A 1KHWA 2VIHA 4ECZA 1NHKL 2B8PA 2JC0A 5KFQA 2N4DA 3N28A 3B82A 2AT1B 2HFUA 4CT8A 1B64A 1AFJA 4M5HA 3GG0A 3KK3B 1FE0A 4PQUB 2H9ZA 2BANA 2DJWA 4JI8J 2UP1A 1HQ2A 2GMLA 1CLFA 3NGTA 2M52A 2JLGA 4HHJA 3KKFA 1M90T 2RAQA 3Q22A 3CC4S 3PJXA 3W2VB 3OQ2A 3GZ7A 2RJZA 2LECA 1RCOB 4Q2MA 3EVWA 5CZXA 3W5ZA 2ZWPA 3QJLA 3W64A 2VDHA 2BABA 1M5KC 2KG0A 3QIDA 1JMTA 4CNZA 3CDEA 1K47A 3M05A 3PEJA 4Y2KA 4OI3A 3ZO7A 2Q1LA 3C15A 4JI7F 1MN9A 1OY6A 1VYAA 2ZUAA 1TELA 2XI2A 4OJHA 2IVFB 3R9LA 2OD4A 2GJIA 3CDAA 3FFIA 2XEXA 1HBMB 3HKWA 2YNHA 2AIRB 4PPDA 1T9UA 1DTQB 1U0HA 5JVGQ 4DFMA 4B3RJ 3A8JA 5ETPA 5CYJA 2MKHA 4YR0A 2RSQA 1HNIA 4PABA 3LGMA 3KYLA 1R6VA 1K0VA 2DY1A 3MEEA 2FJDB 2W2QP 2V67A 4DCJB 1B7YB 4N76A 2XS7A 5FDLB 4ZKAA 3OLAA 2MLXA 1NJZA 2PIIA 3OL6A 2LQ9A 2PI5A 1SJ4P 2LDYA 3LALA 4PRFA 5D4NA 6FDRA 1NKEA 2YPZA 3IWNC 1UEUA 4DX5A 4K4WA 3AODA 3FBBA 2NZCA 4F4KA 2Q6CA 2G9OA 3R27A 2DHXA 1PYOB 1REVA 3DXSX 5LMNF 3RAMA 2QN6B 2KXHA 3CD7A 3EGVA 4WYWA 1XMOF 4WJBA 4ZIWA 1JNRB 3B54A 3LP0B 1MSWD 1S77D 5CAAA 2CPEA 3RBEA 3MMBA 2ZHAA 1WC0A 1O0PA 1C1CA 4QYZK 1TL5A 1JXEA 2KH9A 1KRPA 3HK2A 1Y5NB 3TEHB 3OHAA 1YJNS 1TKZA 5LM7E 3PZPA 5HQLA 5DDOC 2XS5A 3CD5A 3NS7B 2IVYA 1JLBA 4LBPA 2J8SA 2F9JA 1KTQA 2DXFA 2XSJA 3Q86A 3NOGA 1N5SA 4O4RA 4LF6J 2MKKA 1VCTA 5IOLA 2EBGA 2W24A 3DDIA 3Q8YA 4JI6F 2DH9A 4QR2A 1VQMS 2MKYA 2AYMA 2G4BA 3M1VA 2HVIA 1GMVA 3PW5A 1XR5A 3HFKA 1SIZA 2DNQA 2W9AA 1Y3JA 4WU2A 1X5TA 2VDIA 3BKFA 4J9VA 3W7BA 1HL6A 4KO0B 1K8AT 1TVRA 3GYXB 3D68A 2W4CA 4KPCA 2AX1A 4CYUB 3NWRA 5E3QA 3TAMB 3WX4A 5KFVA 2F1FA 2OEKA 4PWDA 4EZ6A 1S0NA 3MR5A 3UDEA 1CULA 4DUYF 4LF5F 1X4EA 1SQGA 4ZN3A 3V6DB 2MQLA 3G8SA 4GO5X 2CRLA 1Z2LA 2HAIA 2VL1A 4K4TA 4RBTA 4Q7AA 4L3KA 3C6UA 1KEKA 3ULHA 9RUBA 4ECUA 3GPAA 1X4DA 5J2PB 3K0JA 2XY7A 5H9FJ 1TUVA 1DLOB 3GMGA 3W61A 4NZ6A 4ZPDA 2NR0A 2PD1A 4GVLA 3EVOA 5KG1A 1FKOB 4V19X 3G6ES 3FEYB 1YITS 1WSRA 1NMEB 1NJYA 2HNZA 5C7PA 5LMNJ 3ISZA 3FZBA 1HNVB 4RUBA 4NEZA 2MZJA 1CS4B 2IBOA 3HDSA 2OLWA 2WW8A 1GFWB 1FERA 4CRJA 2I5JB 4XDDA 4ZCKA 5DQGA 2XMAA 5HBMB 4NXMF 2CFXA 5HATA 3OVAA 4DR4J 5KFZA 1IR1A 1GEHA 3RBDA 1QLNA 4HL9A 1R43A 4F3MA 4DJBA 2KM8C 2J6UA 2DGUA 1RWUA 1FE4A 3K5LA 1QY7A 1PO6A 2B9WA 3BO4A 1X0PA 3Q23A 4RNOA 5AJ3F 2HFZA 3HSJA 4C98A 3D1HA 2ROGA 2H3EB 5DO2A 3R3TA 2DO4A 3UNGC 1KQGB 2OO4A 4ZVPB 2DBBA 3ITHA 3SSSA 3G6XA 1R8HA 3JAMU 2MJUA 4WFNQ 3GIKA 5DG7A 1RTIB 4DR7J 3KDNA 3ZZRA 2WVFA 4ZVRB 2DRBA 3IRXB 1LXNA 3KLIA 3LUYA 3VVUA 3CJ4A 2DNKA 1B99A 4B3MJ 2I8EA 4X66J 5DM6Q 4YY3J 1A6LA 5EHHA 1UVJA 2DGTA 4B08A 1VI7A 2GGPA 4ED2A 1RTJB 4J9PA 3LOUA 2BEFA 4KIAA 4YS2A 3DRYA 4AL7A 4TYBA 4WF9Q 2V94A 1YHQS 3T1YJ 3L3CA 5LMUJ 2OPPA 5A8KA 1FNMA 3DI6A 5J1NA 2WONA 2J9DE 3MAHA 3KLFB 2AYBA 1E6VA 3A3PB 2X1GA 3PKMA 3PHEA 4U7CA 1UKUA 3CEDA 3VAIA 3NNAA 1IJFB 4LF7J 2HVDA 3DOKB 3US5A 1RGVA 1MU2A 4IG0A 2RDDA 4ECQA 3OD2A 2AJFE 1WHWA 2BJDA 4QW9A 3OUYA 1XK8A 4EUVA 5KFAA 3WIUA 3CJ3A 3LAKA 2Z2MA 4P73A 3MTJA 1M5VC 1RT5B 3BGUA 2KL8A 4NXNF 1S9FA 5G0RB 1JLEA 2WVBA 5CD4H 2DYAA 2GVZB 4BHQA 2DNRA 2B6AA 4HVZA 3BGRA 4O3RA 4HI1A 4A8WA 3DCAA 2P9EA 1IKVB 1LEOA 3W60A 2MB0B 2XHCA 3TA0A 5DDQC 5IT9Y 3G87A 3H98A 2CQCA 2F8MA 3UN2A 1TL4A 2FGOA 1IKXA 4DL2A 3RG6A 1TL7A 4A46A 3RB6A 5U47A 2HHWA 3KJVB 1NDCA 3ONQA 4MKBA 4U95A 1AROP 2QMXA 4RW9A 2VKZG 3CF5Q 3CC7S 4HACB 2FZCB 4ID8A 4DR1F 4PXBA 3U7JA 2BQ3A 5DGAA 1RWMB 3IGNA 5LSOA 4USKA 1NJXA 5E7OB 1AB8A 4C11A 5GVQA 3D0IE 1TL3B 3C46A 3VQTA 5KT3A 3CDUA 4OX9F 2EFGA 4USTA 5HMWA 4CLKA 1SXLA 4I2QB 3CSKA 3C16A 2HGMA 4KV8B 3DLEB 1R6YA 3HZEA 2E5LJ 2H5EA 2FHJD 1J5OB 3MEGB 3D5MA 4G1IA 2GHPA 2XCPA 1LK5A 1TU0B 2QA4S 1UVMA 2HNDB 4NLVA 4DR5F 3H42A 2W4PA 2Z4PA 1N5VA 4DL6A 3TYTA 1SC6A 1PC4A 2K3IA 1NJIT 2C2NA 4U6PA 4CDIA 3HKZD 3THVA 5KFTA 4GKJF 4PUOA 4I6YA 2KN4A 4CO0A 1EJ7L 4NE9C 4ECVA 1Q86T 4DV6F 1SV5B 2DHAA 4B3SF 2BJ8A 4DCPB 1QSYA 2D7SA 4KGKA 4ZPVR 1N48A 1TV6B 5CCMA 1Z2ZA 3EDRB 4GVBA 2YX1A 1I94J 2E1MC 4WZQA 2O67A 5GAHU 1SL1A 3CPWR 4YDDB 3V4IA 3KK1B 2QL7B 3K5MA 4C8MA 2VQFF 4OJ3A 1OY9A 1PG5B 1YWXA 2GV1A 3D0HE 1T05B 2E29A 3K59A 1DRZA 2ABYA 1VMBA 4UW2A 1BQNB 1DBDA 3W3SA 2Y0SD 4R0EA 4AL5A 3PYEA 2MHNA 2GMHA 3ZZUA 3GG1A 3ZTQA 4PWWA 2ZH2A 3DOLB 1LW2B 1S9EB 2XG8A 3GONA 5F8JA 3WHIA 3I4PA 3R2CJ 4M5MA 3PDNA 2M8HA 4RKUC 4HEA9 3CCRS 2B0GA 3QIPA 2KXNB 2J0XA 2RILA 1FEHA 2H5JB 1KLNA 1FRHA 1SBRA 3GJRB 2V50A 3DRPB 2ZZTA 3BBCA 1XNRJ 5CABA 2VG6A 4JI5F 3NBPB 4Q0BB 4USIA 2CXEA 3DLHA 4WXWA 4EYIB 2OSQA 2X7IA 4F36A 4KBIA 5HROB 1FXDA 5C24B 1YJTA 5D4PA 4DR5J 1RT3B 1VQ5S 1N6QA 2GO8A 5KOXA 4CTAA 2YKNB 4TU7A 1T03B 1GXTA 2WB1D 4LRAA 1SCJB 4OX7A 2XMKA 1FWLA 2V8DA 2B4UA 1SB6A 3OTOF 4I68A 2W4DA 3V81A 2RS2A 4C3MA 1RT7B 4OV6A 1RYRA 4IH6A 2FY8A 5IC4B 3H4DA 1NH7A 4IRKA 1OPZA 2G0IA 2QJ3A 2OMOA 3HSDA 1U2CA 4TN2A 2E9RX 4Y2MA 4R8UB 1RWWB 4TQRA 2CJ9A 3EXYA 1S4FA 2OAUA 3LP1A 2KZZA 1GX5A 4FNHA 3Q8RB 2WW4A 3EDQB 3GR1A 3HHLA 1SL2A 2CZ9A 2WSEC 2MMYA 4BDPA 2KI2A 3MURP 1VIOA 4ZP6A 1RT4A 1EZZB 3LP2B 4C4WA 3I5AA 3MEDA 1LWEB 3N79A 2ZJQQ 5CYQB 3EZOA 4RPFA 1HNXF 3ZZOA 3M2VB 3OT9A 4F04B 3PX6A 4G1PA 2H48B 3J80Y 4MJKA 1EETB 4H4OA 4U96A 5THWA 1W2IA 5KFEA 1F9HA 1SJ1A 2P6TA 2Z56B 4OZ1A 1TUGB 5I3UA 4DSEA 2YPYA 4C3LA 1U7LA 1TMJA 4C0HA 4KGVB 4ES3A 2Q43A 5L39A 1WUUA 4DR6F 3DGVA 1KN6A 3I0SB 8AT1B 2OTJS 4MFBA 5GADI 4GC6A 4PG8A 1RADB 4D3GA 2E5GA 4F2SA 1JXLA 4RNHA 2C2DA 2QRRA 2AP6A 2PMZD 3A1YG 2F4VF 2DGQA 3IR6B 2EFQA 3MD1A 1S10A 2M7SA 2JZ5A 1NSPA 1IQZA 3IFEA 2FC9A 2L9WA 2C2KB 3PIPQ 3EICA 1N33J 3UD4P 4LFAJ 1IJEB 2H5IB 4OI0A 4BS2A 3OJSA 2YBVA 4DV4F 4F4AA 3OTOJ 2EK1A 3RUBL 5IZHA 1REGX 3EUNA 2A18A 1JQGA 5KG5A 3L95X 3AJDA 3HHLC 1HQUB 2E1AA 1N5YB 1WF2A 3F0NA 3N9UC 1N34J 2HK3A 3TVZA 4JOUA 4N47A 4KPYA 2IVMA 3HMJG 1T3NA 4HI2A 1ZA2B 2KU7A 1UWBB 1YBTA 3R97A 3BPDA 1NB2A 3TJ8A 3CMAS 2DEJA 3GV8B 2KT5A 4O23A 1X4AA 2W7PA 1IKWA 4KKOB 1FDDA 2UVUA 4K59A 5DG8A 1U24A 2M0GB 2P2CB 1BWVA 5HLFB 2W25A 5HSPA 2CQPA 2ZC3A 1W2BR 2EC0A 3UVJA 5ETRA 1JWWA 4WK3A 3QSYB 3DHXA 2DR9A 2AX0A 2LEBA 1RAHB 1XC9A 1HNXJ 5D3GA 2MZRA 4CO3A 4NOHA 2ZZMA 5K20B 2WZ1A 3GIJA 3CIMA 1HBMA 4DS4A 3BYRA 3IR5B 3MM5A 2AZ1A 1CJUA 3CDWA 2PT0A 1DTQA 4ITSA 1OQ3A 3MM8B 4ZPBA 4CLFA 2HRUA 3MWBA 1S9GB 3OSPA 1KWMA 2GIFA 3ZZZA 1V3ZA 3UE2A 2AQ4A 2UU9F 2HGNA 5B09A 4IG3B 2EG1A 4FBTA 3VGUA 1FTCA 4CT9A 5LJ3Y 4DV1F 2IFXA 4DR6J 2YXLA 5C42B 4O3PA 4AYBD 2OSRA 2UXCJ 1OJ4A 3M9NB 3CCZA 5FDLA 3CCES 2HZVA 4O3SA 1UVLA 4CI0B 4U7UD 5HJXA 3RW7A 2GHVC 2GAGC 3UNYA 2RKIB 2NSBA 2XLIA 5F8MA 2UV8G 1NK4A 4ZPAA 2HURA 4NWBA 2KZMA 3C8YA 5IQ6A 3M8QB 2Y8WA 2EWHA 4OZ5A 4LF9F 3DFEA 1VISA 4EMDA 1NPPA 2XZTB 5I42B 4DV4J 1Q1KA 2UUCJ 4IFYB 3J81Y 4J9LA 3DLKB 3UD3P 3QZ7A 1A9NB 2YVSA 3DGPB 3KDOA 2AZ3A 2V4RA 3MPVA 2UXDF 3JYTB 2RRNA 1Q5YA 1B0PA 5AXMA 2Y0BB 2X1BA 3OTBA 3M9OB 4ZVSB 1K1SA 5CYMB 3KHGA 4FN5A 2ZH6A 1LK7A 1CJKB 1MG7A 2PEBA 3BSNA 2DNNA 1SKWA 3A8IA 1OY8A 3BM7A 1RAJA 1XNQJ 3AB2B 3JTPA 5HQ8A 1AZSB 3DLLQ 3D3BJ 4DOZA 3CCLS 2R8GA 1NB7A 1RKIA 4DF8A 3ADAC 4LSNB 1BWEA 4ED0A 5GAGI 2HHXA 1V3SA 2BOAA 3CO9A 3HFVA 4WFZA 1RT1B 3GFHA 3NWGA 3DLBA 3K5OA 2K3KA 1ICEB 5E3AA 2P6SA 2E9TA 1KP6A 3DRSB 4TVAB 2AYEA 5L1IA 1UA0A 4B3OA 2OPSA 3K89A 4LRFA 5F3ZA 4KO0A 4JI4F 1QTNB 1DAXA 4ID5B 1TTHB 2ILZA 2WSFC 3OR1A 4WE1A 5D0HA 2VBYA 1VC0A 3DU6A 1BXNA 3PYFA 3HI9A 4MKYA 1ZBTA 1KC8T 3N4WA 4K0KF 2PDAA 3RB3A 5HP1A 4HH0A 2C2MB 3TUIC 2CNNB 1QTMA 5D6GA 1VS3A 3C14B 1T9WA 1J27A 4YB1P 2DIUA 2ASLA 3FEXB 4OYMA 2KXFA 3OXGA 3V6DA 2FQQB 2RQ4A 4NA1A 4OFZA 2R2TA 2V69A 3WX8A 2XLKA 4DL7A 2YQ3A 1NDKA 2NZ4A 1NDPA 4MH8A 4WTOB 4LF2A 5HVGA 1NSKL 5J2PA 2Y1JA 1S1XA 4HTIA 4F02A 1NHUA 1KD1T 1ACMB 2RUSA 3TX0A 3WC0A 3DOMB 2MQOA 1DLOA 2CPDA 1R3NA 3T5LA 3FC9A 1LW0B 2HQFA 4DSKA 2EEYA 5RUBA 3KWMA 5IC6B 1JLQB 1FRMA 4WYLA 1QUPA 2MKJA 1Z4UA 4I6AA 4WFBQ 1CS4A 4CLZA 2QFJA 2OPRA 3FQKA 4PAAA 3CCMS 2FD2A 4A47A 4O4GA 4ES2A 4LF4F 1GH8A 3W9HA 3F56A 3PNIA 1TFWA 2VOPA 1U25A 1H2TZ 2PSZA 1HYSB 4KR0B 3FKBA 2V2KA 2LCWA 3M2UA 2A2CA 3CMQA 2W9CB 5T14A 2ZNYA 3FBCA 1PC5A 2RNEA 4LFCF 4RU2A 4PKDB 2HHUA 4FBUA 2M8DB 1S5ZA 4D3HA 2R7QA 2DO0A 1IBLJ 4DV7F 3O8WA 3MPDA 1FXLA 1GMWD 1JJ2R 4EBEA 2IRXA 2ACYA 3L7OA 2VONA 4IFVB 3FDSA 3QQCD 1RDRA 3KHRA 2W8LA 1Q8LA 1FX4A 2JOQA 1RTIA 5HMYA 2VHGA 1P1TA 4URGA 3AA9A 3IRXA 3ILJA 4FS2A 4K2JA 5CXTA 4CO4A 3MM6B 3ZZYA 4K4UA 2BRKA 4E98A 1CBKA 1AXQA 3P3DA 1R27B 3JTNA 5HK4A 5J2NA 2F8EX 5B0CA 3OLBA 2AGPA 1Q4RA 1NAQA 1BGXT 3M8PB 2QLBB 4UF4A 1BQMB 1FXRA 4LSLA 3PW7A 2OTLS 4URSA 3FJ2A 3FNNA 1RAEB 2XYPB 1QE1B 2YKMB 3PRBA 4OYOA 4L72B 4JYAF 3B4MA 1NKBA 2KJWA 3FGVA 1U8SA 3MCOA 3DYAA 3DKDA 3GWCA 1R8BA 3KLFA 1R0AA 4PPZA 1BE4A 3I31A 2XCAA 2AMCB 4C8LA 3EXCX 2J9CA 3M6XA 3PEHA 1JJCB 2V63A 4L73A 1RK8A 2B9EA 2JEJA 4NA2A 2E9ZA 3CCQS 4WTYA 3MM9B 1IXKA 3OXLA 1RHUB 3N6NA 4DL5A 1QD1A 2KM8B 3KG0A 3ENWA 2I0XA 2LA6A 1S1VB 2ADBA 1RT5A 4KB7A 4HT7A 2DEIA 3R5AA 4I7FA 4M95A 2J0SD 2Z30B 4LBHA 1PBAA 4DX6A 4X64J 5K8MA 4TY9A 1NPRA 3DMJB 1IKVA 2DGSA 4DV7J 1YK9A 4DV5J 2XZDB 2HVHA 2DRDA 2VBWA 3M6WA 4ZITA 2OPQB 5EX0A 1H73A 2Q6BA 3C6TA 5GAEU 3TJAA 4MIBA 2M4MA 3QGHA 3CJQA 3LF0A 1EQ0A 4CIOA 3NMRA 4QIWD 4QBUA 3I32A 1G7CB 1RBAA 3W2WA 2EVZA 2R7WA 3CJ5A 1D9AA 2V8VA 4HACA 2GX8A 2WAQD 2L9NA 1VQKS 1WC1A 3SEOA 2ATCB 5KFDA 4TU9A 1URNA 3Q8SB 3WDOA 1HBUA 1HHQA 4TY8B 3LW5C 4H4KC 3MPYA 1S1WB 4LUBA 1T9XA 4DV3J 4JI1J 1DTTB 2F63A 3UR3C 5ETNA 1S72S 2NQPA 3K17A 3TVKA 4QWDA 1EX8A 3K8WA 3NNHA 4WFAQ 3EPGA 4OZ3A 2NREA 2XMVA 3QZ8A 1WG5A 2CQ0A 2V68A 3KHLA 4DFPA 2EFOA 1OQ6A 4X4OA 3NNCA 4I2QA 1S99A 3SFUA 4IUFA 3ETOA 2W2PP 2ZH3A 3CTRA 3OL8A 2CG8A 2ZOMA 3PY8A 2OUGA 1HI0P 3P5TL 4AQYJ 1T3OA 3OVBA 2BMBA 4USJC 4TNOA 4UUXA 2HNDA 3Q8PB 1IWGA 1VQOS 1U45A 4Y2IA 2J7WA 2B9XA 3LGNA 3AQOA 4CNYA 1UCNA 2ZKTA 3SDEB 1IBMF 4EO6A 2X3GA 4EI2A 5J1PA 1X9WA 3ZXWA 3T5JA 4QWAA 3MR7A 3GJSB 3JQJA 1HMVB 3KTQA 3GSIA 3Q24A 1E6YA 1SV5A 2VPYB 2DNMA 4K4YA 2BVZA 2V8GA 1IVZA 2Z2ZA 1TV6A 2VFUA 2DK2A 1F5BA 2E7VA 5KG4A 1NXIA 1FRJA 2BUNA 3I82A 1RI7A 2E5IA 5SZTA 1HNZF 3A8KA 3CDBA 3KK1A 4OJGA 5KFRA 3ELHA 1X7VA 5DRKA 4CLYA 1T05A 1XERA 1V5VA 3MOJB 1JKHA 3G96A 1KLMA 4CM0A 2ZWOA 3E2EA 2DISA 4R5PA 1RUSA 1NRKA 5FLXU 2IRUA 3SYZA 2HS3A 1RTZA 2L9DA 2LQBA 4PWUA 2C2RA 2YWWA 2UUAJ 3DOLA 1FJ7A 2B7BB 4QU7A 2L41A 4J5OA 1C0TB 1SC3B 1TFYA 2FIUA 3ILLA 2B3TB 2E7WA 2P8IA 5KT7A 4U67Q 1YGYA 4DPWA 4NLDA 3NS6A 2R9LA 5A0YA 3L09A 2YWEA 2D3O1 3LPYA 4NCBA 5MAOA 2V2VA 4DPOA 5J1EB 2IDEA 3M8ZA 3F41A 4L76A 3DRRB 4DN0A 3DRPA 4B02A 2HFVA 3G6YA 2JHEA 1XR7A 5KT2A 3KLGB 1HNWJ 2KYXA 1S76D 4LRDA 2IBKA 4NI2A 3BF4A 4ECYA 2XI3A 2XY6A 2G1HA 3QSIA 3RAQA 3NLCA 5HROA 2D3OR 2RF2B 4FDFA 3OFEA 5IT4A 2L3MA 1RT3A 2HRTA 3VTIA 3GR0A 3CMES 4GKKJ 4ZVTB 5B0DA 2ZBPA 3AXMA 3BYPA 1SI9A 1U26A 4N8OA 3VZIA 4LF8J 1TQLA 5B0BA 2HFNA 2VQEJ 1AW0A 1UEKA 3G6VA 1YJRA 4HYKA 4DXLA 2ERRA 4Y65A 3D0GE 2JNJA 2GVDB 2LXUA 3NG8A 3ILOA 4X62J 3FUYA 4UZCA 2QX0A 2PA3A 1JXVA 1MWYA 2B7CB 3ETMA 5CH7B 2R7XA 2BKNA 2OKQA 3AOCA 3QMQA 2LKZA 2J76E 1N4LA 1GMUA 2FHJA 3NGUA 2UXBF 4HTJA 3CXCR 2C3PA 4R8UA 3R2DJ 1HPZA 1WEXA 2VZ9A 4IOCQ 3GU0A 3PKYA 2ATLA 2EKYA 1JNZB 6FD1A 3IR7B 4DPUA 2COLA 2F7VA 2ZJRQ 5DS7A 1HHTP 3MHYA 3IN5A 3SSQA 1S6OA 2Y3YA 4O3QA 1FRXA 4H4MB 4DV0J 4MK8A 3LP2A 2MLZA 1G2EA 1XMQF 3CD6S 3VZHA 3G82B 1QDUB 4DSJA 4G1QB 4OX6A 1UW9A 4CP5A 3KJNB 1TKDA 2YNIB 5B0GA 2YQ1A 1EETA 3BDEA 3QLHA 5HQMA 1ZH5A 3BN7A 1U1QA 5BYSA 3OR2B 4QR1A 1MWZA 2WTFA 4HKQA 2DR5A 4ILMA 1KR4A 4TQSA 2ZH8A 3TZXA 4ZJOA 4IDKB 3SQGA 3V6KA 2H4WB 4F0HA 3JS9A 3AFGA 3HVTA 3M30A 2BJ3A 4FYYB 5T41A 3VR1A 3VGTA 1KSPA 3PO4A 1Z1ZA 2RRBA 3JQKA 2J8AA 1X9MA 3TUPA 3HFZB 3FMWA 1K9MT 3CVKA 2L48A 2GW8A 2QSFA 3T6JA 4ZHRB 3RR7A 1R89A 2CNOB 4ZN1A 1QAJA 1F2HA 1HBNB 3TZZA 1ZAVA 2WBRA 2Q66A 3CCUS 1JLCB 4RUAA 1CVJA 2VODA 3GYNA 3GSDA 5DETA 3J7ZT 5K8NA 2ZBRA 1IBKF 4KFBB 1UEVA 2C3UA 4CLUA 1HQUA 3GJQB 5A76A 3QAUA 2OFHX 2VG7B 1Y0HA 3QRRA 1XJWB 2M88A 2M3DA 5ETKA 1RTHB 3FRZA 3PJWA 3LTOA 4QIEA 2E44A 5HVFA 3CD0A 4M5LA 1HLWA 4ZP7A 1U6BA 3TZWA 2ROEA 3P45B 1ZETA 2AJ1A 1SL0A 2RDJA 3FQLA 2ZEJA 1ULRA 5IV4A 3KLHB 4KH1B 5LXRA 3HXMA 2KFZA 1KFDA 5GMEA 2VC1A 1IWAA 9ATCB 1VRTB 2WVDA 2MQQA 1H2UX 1RQ0A 3UR0A 2R4FA 3H5XA 1SJRA 3VAMA 2DY9A 5AE3A 2VBXA 4O3NA 2B4OA 1YQHA 3NGDA 3V4MA 1VRUA 4YHHF 2XC9A 3UPFA 2MYFA 3MUMP 3N5FA 4OV1A 1VOMA 3H2VE 2B43A 1YZ6A 4FF4A 2ZOGA 3SCJE 1S9GA 3D3CJ 1F2GA 5E3CA 2R7OA 2HQIA 3QNWB 2P9GA 5DQIA 4KHPJ 2ASJA 5KFUA 5DQHA 3OSNA 4JI8F 5C42A 5J2MB 3HF5A 2FVSA 4M5KA 4ZA1A 1UP1A 1H6KX 3PW4A 3MAAB 2M2BA 3VV2B 1X5PA 2DR8A 3DLJA 2EC2A 1M5SA 3SQOP 4KYZA 1NUEA 3W65A 3TA1A 3CCJS 2RKIA 2DGOA 2VPXB 4Q43A 2F9DA 1ZZNA 3BH6B 3LH2S 1JLAB 4C9DA 1RWNB 2YNGB 2HWHA 5I42A 4JBCA 3M8YA 4IFYA 1OIAA 1P1LA 2RHSB 2F65A 1GAOA 4G3IA 1NZAA 3DGPA 1Y9OA 5KFSA 4F25A 2ZHOA 5DG9A 1NH8A 2HFOA 4OYWA 2J6SA 3MCSA 1S7HA 3N6LA 2BE7D 4I0WA 4B3RF 1OSCA 3EZ5A 1CJKA 1P8GA 1YJ7A 2I2YA 2VUGA 4BC9A 1NM2A 3CJ0A 2ZHBA 3BSAA 3MR2A 2DGWA 3J7AN 3HVWA 3EVMA 1Y7PA 4AFFA 1SKSA 2PA8D 1AZSA 2B5JA 3CJ8A 1BHNA 3E8OA 1VHFA 2RB7A 1JLFA 4ELVA 3C15B 1B0VA 1TKTA 4JV5J 1RT1A 1UMJA 3A13A 4Q45A 1BD6A 1U49A 3NP5A 4YHHJ 3OBIA 3GILA 4ID5A 3FFIB 3BQ2A 2JEIA 1U0HB 2K7JA 2DHGA 2HMIA 1KNZA 3IG1A 4NYZA 1C4CA 3BO3A 3QFWA 1HNIB 4I56A 5KOWA 3FMBA 3P49B 3SBMA 1YG0A 1EHWA 1HWLA 2NYIA 5FIIA 1CPZA 3QFHA 5IV3A 2FC8A 2J7UA 1KBRA 3H5YA 3MR6A 3KFWX 3DN9A 1TK5A 3PCOB 2W2MP 1UFLA 3CCVS 4JV2A 4K4VA 1T0TV 3DDKA 5E2QA 2R8IA 3LPEA 5JUMA 1EP4A 1PCAA 3QATA 1KVIA 1SKUB 1Q5VA 1S1UA 2MLYA 3BKUA 4O0IA 2ZDOA 1NK8A 2C2EA 4LF6F 4J7CA 2QG9B 2X3DA 4OLOA 4C8ZA 1REVB 2MKSA 3H90A 2BDPA 4JB8B 1JLQA 2QLJB 4ZJQA 4N77A 3HSZA 3S8SA 3GV5B 2UVVA 4LT6A 1YBAA 2V4JB 1QSSA 2FVQA 5A2QU 4QWCA 3PG9A 2O5DA 2J6TA 2BE9B 1U6ZA 1HD0A 1NEEA 2QMWA 3DC2A 3NGKA 4HR2A 3O3LA 1SUQB 4FVCA 4ZLPA 1WF1A 2CJXB 4FNIA 4ANCA 1TKZB 2GNKA 1VFJA 4OI6A 5B0FA 3NCQA 1T02A 3FZ2A 3KMQA 5AE1A 3THTA 1WKKA 2XSJB 2ZH9A 2XYHB 4YFUA 1I3OB 3G9CA 4QR0A 3ZZTA 4ILLA 4WKRA 4IR9A 2HHSA 4B9UA 5IXUA 3M1VB 3PHTA 5MLCV 1M5OC 4RU9A 2FLNA 4ED8A 4AXIA 1UA1A 4NASA 4RW8A 2QEXS 1VK8A 3J7Z5 4WP8A 2IMWP 4RBVA 4DFJA 4WP9A 3R1HA 4JI3J 2C1EB 4I69A 1TL1A 3N0VA 4MIWA 3T9ZA 2AD9A 1RBLA 3QRPA 4MAKA 3UDLA 1NDLA 2RQMA 3U27A 3S7RA 4I6WA 2W8KA 2X51A 1CULB 1F5CA 2YKPA 1SQEA 2LU2A 4RW4A 2AJ2A 1MROA 3MM6A 1SVDA 3W8PA 2XM3A 2OD6A 2KB2A 3HZGA 2NLWA 1WDDA 3PTWA 3T41A 3C6UB 2DB1A 2FJXA 3T3FA 4F2RA 3M8PA 4NX9A 1AUSL 3DDNA 1Q95G 1BQMA 2W2OP 5ETLA 2HWIA 2X1AA 1HA1A 4DR4F 4CCHA 3AAWB 4CH1A 3O2IA 3U1NA 5DDRC 4UZBA 1T9VA 3BPSP 1S59A 2VKRA 1H72C 3TNVA 4O3OA 3BQ0A 1RXOB 2HNZB 3M8WA 3CGIA 2XZWA 3SSRA 4A8OA 3BREA 1MLAA 4BWJA 4RW7B 1WG4A 4OYIA 1I5OB 2KVIA 3ZTSA 3W63A 2CPZA 3AY0A 2CUYA 3FSIA 3SXLA 3MM7A 2YH0A 2IYGA 4K4SA 2FVCA 3D67A 4YUDA 4DR7F 1ZM2A 2KVQE 3QJPA 2AHOB 3FVYA 2N3LA 4N5SA 3UCGA 2MQ8A 1LWCA 1FO1A 5JMNA 4B3MF 5I3PA 4X4VA 2IM0A 2MSSA 2EFPA 4X66F 1UVIA 1VDHA 4YY3F 3DMJA 4DR3J 3G71S 5BR8J 2XB2D 1ROFA 2VC0A 3DNCA 5DGBA 5LOQA 4B9TA 2RH3A 3J7YU 2HLUA 2MZSA 4DUZJ 4ZVEA 2ZVIA 1TP7A 2DNYA 2OPQA 2WK4A 5KG0A 3MXHP 3RJMB 3HHNB 3T1YF 4YR2A 5LMUF 3ITHB 5F41A 4XPCA 3IRWP 5C25A 4UOFA 4CLTA 4ERDA 5F0WA 3AB4B 3E51A 1FHTA 4LIRA 5EDWA 1U1KA 1FESA 1RWXB 3O6QA 4ED3A 2CDRB 2IC3A 4LF7F 1FVQA 1PSDA 1LNQA 1S1WA 4P71A 1S6QB 2ZOFA 2RS8A 1DTTA 4C0BA 2ZITA 3BO2A 4QW8A 2MXYA 4ATNA 5HN0A 2DPJA 1Y3KA 1S57A 4Q2LA 1GMWA 4GO7X 1VQ4S 1KFSA 2OPPB 5A8KB 5KFOA 2QA1A 2VB6A 1QAYA 4K5RA 1RAAB 3OFFA 4EBDA 2WONB 1UFKA 2JFDA 3SCLE 2J0QD 1IR2A 4B9MA 2AJQA 2HBZB 4EEYA 1FD2A 1T94A 2WVEA 3BB5A 2BM0A 4UY8T 4ZPCA 2NUHA 4IG0B 4OX8A 2KHDA 1UWAA 2VD3A 5DM7Q 3OUYB 3TWZA 2EKNA 1XR6A 4AT1B 3AOBA 2ZNZA 2KT2A 5F0UA 4A48A 3KMSA 2IM2A 4E2FB 2MZTA 2VJUA 3QT5A 1HMVA 5EGYA 3AJ2A 1JLEB 2ASYA 2BQRA 1DQ8A 4Z37A 1L3TA 2VOOA 3ZFVA 3M2RA 4A8SA 1QVGR 1UVKA 3GE9A 4L6V3 1HR0J 3POTA 2KDOA 2DH7A 2IAJA 3FSYA 1IR0A 4LIWA 4RWWA 3JTOA 3MOZA 2HHPA 4EU0A 4OMFG 4P2FA 4ZCMA 2DNLA 4K8RA 2MY7A 1H7XA 1RTDB 1Q7YT 3K5PA 4QWEA 2CPHA 3IMQJ 3CUNA 2XS2A 1FX2A 1B0TA 4ZVUB 2E5LF 4RW9B 4X4UA 3CIZA 3Q89A 1UPMB 4NCGA 2JX2A 5T7LA 4M5GA 4CM2A 3IBCB 1R8PA 4RW6B 2ZH1A 3W9JA 2J9EA 3IS9B 4K4XA 3MGJA 5J1EA 3BZQA 2FGCA 1S4EA 1JK9B 4NRUA 4FF1A 4FYXB 3M32B 1LV5A 2ZBCA 3J7A1 3Q8UA 1B3TA 3AXKA 4U8VA 3RB4A 2BKPA 1QAXA 5JXSA 2AGQA 2ZM6J 3L7PA 5L9NA 3R5JB 4C6AA 1AYEA 4P52A 3T5KA 1HW8A 1D9FA 1N0VC 3R7SB 1I94F 4J37A 2R2UA 1K1QA 2YKAA 1LFPA 1Y11A 4WIIA 5D0EA 2C42A 4B3TJ 3AJ1A 2VG5B 4DL4A 1CJTB 1FRIA 4G6VB 4PUOB 2CQIA 4RUCA 1M1KT 2N7YA 4ZCIA 4QJVA 3SCIE 3HD1A 3P5BP 2JEFA 1WDTA 2G1DA 3I4HX 1R31A 1Q8IA 1TUWA 3L7UA 2H51B 4L75A 2IYIA 1PYTA 5K14A 4PR6A 3VAFA 4KRWA 3KUGA 4RNMA 5EWFA 4J9MA 2Q3PA 1O6XA 2POKA 1AT1B 4GVBB 1U8WA 3RBZA 2BW2A 2KTQA 2GJ2A 1RWVB 1C1BA 3H0PA 5D8HB 2QA2A 2DGVA 1VQPS 4FKXA 2RQKA 3NXZA 1C0UB 3MUVP 2PGCA 2J0WA 1XNRF 4A8FA 1V9OA 2W7OA 4F3QA 1HD1A 1FKPA 3TX8A 4TYAA 3PW2A 4P2MA 5KT4A 5KFCA 4A4JA 2W01A 4ICLA 4I2PA 1OMSA 2WSCC 3M8SA 1QVFR 1GXLA 1NK0A 2FJEB 4XTTA 3OV7A 4YB7A 1Q81T 1L3KA 4LR9A 2QT7A 3BBFA 5E41A 3BH7B 5BYQA 4DDFA 5L1LA 1Q53A 2VG6B 4P2XA 1N54B 1RT2B 1Q8KA 1APSA 3VAJA 1X9SA 1T95A 5HANA 3NRBA 4NCAA 3MZIA 4ZLJA 1FDAA 3R5CA 1RLDA 2LU1A 3NGRA 2XTJP 3MF5A 4MK7A 5ETSA 2V9KA 2CQBA 1J5EF 1N6QB 1WOOA 4DEZA 2NXJA 3VCDA 2JVOA 1TK0A 1N5QA 1NBEB 4ZHRA 3DLGB 4F0MA 3VAHA 4OZ2A 5IM0B 1HBNA 3BBBA 5GAEI 3GV7B 3F73A 4P2SA 5KFXA 1SIWB 1FJEB 4EWTA 2N4CA 3G8TA 2R3VA 3K5NA 1WOSA 3ILIA 1ZM3A 4KFBA 3ENQA 4ZK7M 1GK8A 4X84A 4PG7A 2DTJA 4DN9A 1GTEA 2HHHF 2HQDA 3Q2SC 3H40A 5EN1A 1RTHA 4K7QA 3UFCX 2F5GA 2XMWA 3DRXA 2Y8YA 4Y6IA 3LP1B 3S01A 3MD3A 3HJVA 5BYRA 3K58A 1Q7LB 4O44A 4NZ0A 4UY85 1VLOA 4NMXA 2KO1A 2HBYB 3D6HB 3SMZA 2YX4A 2V5HG 3M9MB 5B0AA 1VRTA 2ZD1B 4QU6A 4G65A 3MEDB 1RHQB 4JI2J 1N36J 2MPUA 1B7FA 2QC3A 2CWKA 4B17A 1SC1B 2Z58B 2WVCA 1DQ9A 2HBRB 5EWEA 3JAMY 3I55S 5IWAJ 4L74A 1R8AA 3IAS9 3HM9A 1HBOA 4OI4A 4Q8EA 4EZ9A 1N33F 2LXIA 2VASA 2FVPA 4LFAF 5I3UB 1R8CA 1YJWS 2HZCA 4BBYA 4N7TA 1N32J 2V4QA 2YNFA 4K4ZA 4RUHA 3EGNA 3BN4A 4TKTA 3OFHA 2OELA 4M5IA 3CJKB 2FDNA 1S7IA 5J2MA 2MGZA 3MUTP 4NLTA 1N34F 3MMCA 1V5IB 2BBEA 2QYCA 3IWLA 4DV2F 1KQSR 3ET6B 3IGVA 1J5EJ 3K8VA 2ZH7A 1Q82T 5C2CA 4J9SA 2XMMA 3ZC4A 4PEOA 4U8YA 1Q8BA 3QJJA 3PJ9A 4C3KA 1MMLA 3VAGA 4IKAA 1S6UA 4GMKA 3H5UA 1JLAA 3QO9A 3T1HJ 3CWJA 2YNGA 4EBCA 2QGFB 1RT6A 2G2YA 2YH1A 4J91A 3R6LB 4K2XA 4NLPA 2JEGA 5ETVA 3ISNC 4M5DB 7FD1A 4DQPA 4ECSA 2CVEA 3UCUP 4P7VA 3KOAA 1GX6A 2UV8A 2LEAA 3QYYA 3MI7X 3TUJC 1F3FA 2LP4A 2ZE2A 1T8EA 4EK2A 5H9EJ 2HHHJ 4R25A 1K0TA 3DHWC 5ETOA 5H1SV 1EKSA 4X4QA 4QOTA 2XULA 2VFTA 2R8JA 4ANEA 4WU3A 1IKWB 3UN3A 4QQBA 2Z8QA 4X2BA 1T7PA 3S6EA 4ZCLA 1RAFB 2B51A 4JV1A 3G2XA 1CG2A 3UVJB 2ZZNA 2UXCF 1RB0A 4IH5A 3I0RB 2KFNA 1EAYC 2V34A 1FFWB 2D9OA 3A4TA 4PCQA 5D3GB 2PEHA 3GLJA 2JLFA 4DU8A 3GQCA 1WELA 1EKRA 2UZAA 3MM5B 1CJUB 4V1Ak
chains in the Genus database with same CATH topology
3R6LB 1RWOB 2C1EB 4JB8B 4ZVOB 4DCJB 2QLJB 1RWNB 2P2CB 2QL7B 4ZVTB 2H65B 3IBFB 2CNOB 3EDQB 3IBCB 1RWXB 3GJTB 1QDUB 1ICEB 2CDRB 1BMQB 2C2OB 5IC6B 2XYGB 1RHRB 2H51B 2HBQB 3D6FB 2C2KB 2CJXB 1QTNB 4DCOB 3R7NB 3KJNB 2XZTB 1SC3B 2DKOB 2QL9B 2H5IB 3GJSB 5K20B 1RWKB 1RHUB 1NMEB 3GJQB 4ZVPB 4LSZB 3P4UB 1PYOB 2QLFB 1RWVB 1RE1B 2H48B 3QNWB 3SIPB 1RHMB 2CNKB 2HBYB 2C2MB 2XYHB 3D6HB 2CNNB 4ZVRB 1F9EB 1I3OB 1I51B 3R6GB 1RHJB 2C2ZB 1RWMB 3R5JB 2H4WB 1PAUB 2Y0BB 3D6MB 2QLBB 1GFWB 5IC4B 2FQQB 1RHKB 4ZVSB 3P45B 2Y1LB 2QL5B 2H54B 3R7BB 2H5JB 2HBZB 3R7SB 4DCPB 1RHQB 2H4YB 3GJRB 1SC4B 3KJQB 1SC1B 3KJFB 1RWPB 2XYPB 4ZVQB 1IBCB 1RWWB 3RJMB 2CNLB 4ZVUB 2HBRB 3NS7B 3EDRB 2XZDB 2CJYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6L B;  1RWO B;  2C1E B;  4JB8 B;  4ZVO B;  4DCJ B;  2QLJ B;  1RWN B;  2P2C B;  2QL7 B;  4ZVT B;  2H65 B;  3IBF B;  2CNO B;  3EDQ B;  3IBC B;  1RWX B;  3GJT B;  1QDU B;  1ICE B;  2CDR B;  1BMQ B;  2C2O B;  5IC6 B;  2XYG B;  1RHR B;  2H51 B;  2HBQ B;  3D6F B;  2C2K B;  2CJX B;  1QTN B;  4DCO B;  3R7N B;  3KJN B;  2XZT B;  1SC3 B;  2DKO B;  2QL9 B;  2H5I B;  3GJS B;  5K20 B;  1RWK B;  1RHU B;  1NME B;  3GJQ B;  4ZVP B;  4LSZ B;  3P4U B;  1PYO B;  2QLF B;  1RWV B;  1RE1 B;  2H48 B;  3QNW B;  3SIP B;  1RHM B;  2CNK B;  2HBY B;  2C2M B;  2XYH B;  3D6H B;  2CNN B;  4ZVR B;  1F9E B;  1I3O B;  1I51 B;  3R6G B;  1RHJ B;  2C2Z B;  1RWM B;  3R5J B;  2H4W B;  1PAU B;  2Y0B B;  3D6M B;  2QLB B;  1GFW B;  5IC4 B;  2FQQ B;  1RHK B;  4ZVS B;  3P45 B;  2Y1L B;  2QL5 B;  2H54 B;  3R7B B;  2H5J B;  2HBZ B;  3R7S B;  4DCP B;  1RHQ B;  2H4Y B;  3GJR B;  1SC4 B;  3KJQ B;  1SC1 B;  3KJF B;  1RWP B;  2XYP B;  4ZVQ B;  1IBC B;  1RWW B;  3RJM B;  2CNL B;  4ZVU B;  2HBR B;  3NS7 B;  3EDR B;  2XZD B;  2CJY B; 
#chains in the Genus database with same CATH topology
 1N5T A;  1WG1 A;  1FRK A;  2FHK A;  4FPR A;  3PRV A;  7AT1 B;  2W2N P;  3KLE B;  2BV3 A;  4IOB A;  1TKX B;  4HH1 A;  2C2O B;  5F3T A;  3KK3 A;  2P5V A;  1SJF A;  1FCA A;  2UUC F;  3KUH A;  2MEW A;  4USW A;  4PQU A;  4J9Q A;  3NCR A;  2EXU A;  2E1R A;  1FT8 A;  4YN3 B;  2MZ1 A;  1RSC A;  1X4H A;  1XN9 A;  2VV5 A;  2LA4 A;  5L1K A;  4DV2 J;  4YDX A;  2CWX A;  1RAI B;  2G0C A;  3W2V A;  2ADC A;  1FK9 B;  1PJ7 A;  2QLX A;  1QJH A;  4EYH B;  3AHP A;  3NS5 A;  2XNQ A;  3FK4 A;  2JDJ A;  4F8R A;  2LVW A;  5IT9 U;  1RAG B;  1U0S A;  1XNQ F;  1Q16 B;  3WIV A;  2ZVS A;  4ZVQ B;  5F8N A;  1WC4 A;  5J2Q B;  3GCW P;  1W7W A;  2V4J A;  4KC5 A;  1S1T B;  1FEE A;  3EYZ A;  4WCE Q;  1ZPW X;  4KAI A;  1SUQ A;  4KTQ A;  1FNO A;  4M8L A;  5BJR A;  4DL3 A;  4RR5 A;  4DS5 A;  1VBZ A;  5IT0 A;  1OWX A;  1ZOT A;  4IOA Q;  3AD8 C;  2VFR A;  4HT5 A;  3BSO A;  1QAI A;  2YWG A;  5KFJ A;  2A2D A;  4MKA A;  4YME A;  2IJR A;  1NKC A;  5HAO A;  4Y0F A;  4Y28 C;  1T9Y A;  1P9Y A;  1O8B A;  2FLP A;  4UT4 A;  2Y1I A;  1NZ8 A;  2KHC A;  1TAQ A;  4IO9 Q;  3QWU A;  2W7A A;  2CQ4 A;  2M9K A;  2J7K A;  2MY8 A;  1UJ5 A;  2Y9H A;  3CNQ P;  2KG1 A;  4ETX A;  4JI7 J;  1PAE X;  2JWN A;  3MTK A;  2HS0 A;  2QZ8 A;  2NXE A;  2I38 A;  2HHV A;  4B3O B;  2OPS B;  3IBW A;  2PE8 A;  4NLR A;  2YKQ A;  2K1R B;  2R8K A;  1Y5I B;  2B4V A;  1FNX H;  2CQG A;  1C4A A;  1VR6 A;  2HRY A;  2AKW B;  3OR1 B;  4WE1 B;  1PBU A;  2HNY B;  2DXE A;  2AWZ A;  4DFK A;  2Z57 B;  1N88 A;  5B7W A;  3PXG a;  1VC6 A;  3OTC A;  5K8P A;  5KG6 A;  1YI2 S;  1RLC L;  2BJE A;  3PR4 A;  5HP1 B;  4DZD A;  5L9X A;  4PXE A;  2V2Z A;  3UQS A;  4ECR A;  3OHB A;  4ZJL A;  4CLS A;  3A8E A;  4V19 J;  5KAK A;  1RIS A;  1TR0 A;  2VFV A;  2R42 A;  3DU5 A;  4ZLL A;  2AJ0 A;  3LP0 A;  1YJ9 S;  4RWX A;  1O5J A;  4USU A;  5HI7 A;  3NY0 A;  1G4C A;  4ED1 A;  1UW4 A;  3P96 A;  3VWS A;  1F1B B;  1S1X B;  3GFZ A;  2WOM B;  3V5R A;  3LQV A;  5KT5 A;  4X4P A;  4FYW B;  3D2W A;  3SIP B;  2H1Y A;  5K8O A;  4DUT A;  2XO7 A;  1BQX A;  4Y3C A;  3EM1 A;  3JSM B;  2DIV A;  1F9E B;  1DQA A;  1I1G A;  3QAE A;  1ELO A;  1YJV A;  4F4Y A;  2GAH C;  5CHC B;  1VQL S;  3CJS A;  3QBC A;  1IBL F;  1XMO J;  2LLZ A;  4RW7 A;  1YRT A;  3TW0 A;  3HO1 A;  4F50 A;  2WHO A;  2OPR B;  2CQ3 A;  2A3J A;  2DIT A;  3X1L B;  4DQS A;  4O4G B;  2MZQ A;  2NS1 B;  2DNO A;  4CYU A;  2WRM A;  2D3U A;  1OPI A;  4MTP A;  4DHV A;  3TAM A;  1OYE A;  2C28 A;  2MHE A;  4CLW A;  3IP0 A;  3M2U B;  1RCX B;  1DJ0 A;  3EPI A;  2ZJP Q;  5D4L A;  4YEA A;  4NYP A;  4CZC A;  1YZ7 A;  3R8Y A;  3HSG A;  3EE3 A;  1S97 A;  4XPE A;  1M1G A;  4JI6 J;  2OHD A;  2PMH A;  2JL9 A;  4J9K A;  2BRL A;  2HVZ A;  3AD7 C;  1NCL A;  1WHV A;  3PFO A;  3UI3 A;  1RAB B;  1YTY A;  1S49 A;  3PX0 A;  4ALZ A;  3TRG A;  2JH3 A;  2BJ1 A;  1M0S A;  2ZBI A;  2GJF A;  3GFY A;  4USM A;  1SQF A;  2GA7 A;  4RO0 A;  1FKO A;  2CAJ A;  4ILR A;  1D8Z A;  4WXO A;  1NK5 A;  3MMA B;  2CJY B;  1TAU A;  1EB0 A;  4DUY J;  4LF5 J;  3WZ0 A;  1KQK A;  1S48 A;  3QT8 A;  2R8H A;  2CAD A;  1HNV A;  3GCX P;  1S6Q A;  5J2N B;  2NXU A;  3PM9 A;  2FTR A;  1FF2 A;  2LMI A;  4LSL B;  1L3V A;  4TLQ A;  2EFV A;  2I5J A;  3WC2 A;  1WTB A;  3Q2T C;  5HBM A;  4DLE A;  3VAL A;  1A0O B;  2HVE A;  3RRK A;  4F7V A;  1RBO B;  4K50 A;  1ZPV A;  3DYA B;  1VQ8 S;  1ZAW A;  3KLV A;  4F4Z A;  2ASD A;  1R0A B;  3QPI A;  2YWK A;  4F26 A;  1PGZ A;  4X64 F;  3UN5 A;  1QM9 A;  3FRY A;  2R7U A;  2MST A;  3WBZ A;  4DV5 F;  7FDR A;  2DPI A;  1VGY A;  4C0O C;  5F9N A;  1P6T A;  2MQM A;  2P9C A;  4N8N A;  4OQJ A;  1WC3 A;  3BSC A;  1CSJ A;  4NZ7 A;  1X4F A;  1BLU A;  2PI4 A;  1D3W A;  2OEM A;  4NXM J;  3TJ9 A;  5IS2 A;  4RNF A;  5K5M A;  1U1P A;  4I7F B;  4P74 A;  5JVH Q;  2V9W A;  2O3D A;  3J80 U;  3N5B A;  4LMZ A;  3G8Q A;  2ZH5 A;  1GQE A;  5KFB A;  1RHR B;  2GQC A;  2BKO A;  3T19 A;  3HHE A;  4DV3 F;  4JI1 F;  4A8M P;  4DBQ A;  5AJ3 J;  3E01 B;  2VA2 A;  1WWH A;  5GMD A;  1RTJ A;  3I9Z A;  2QTW A;  3DXB A;  1RE1 B;  3PX4 A;  4WZM A;  3C6T B;  4WFX A;  3DM2 B;  3RRG A;  2JC1 A;  4Z2X A;  2UUW A;  3S1T A;  4S0M A;  4FZV A;  2D69 A;  3I56 S;  2CZ4 A;  4RLE A;  3VVT A;  1RTD A;  4NLX A;  4PYA A;  5E0O A;  1X4C A;  3LA0 A;  1X8D A;  4WP3 A;  2F8H A;  1MWQ A;  3W2W B;  2ROP A;  4H4K A;  1L5U A;  1X60 A;  5ETQ A;  2IRY A;  2LXF A;  1Q0N A;  4AQY F;  3HPO A;  1ZZF A;  1HBU B;  1QUV A;  2G0J A;  3W9I A;  4J9R A;  2OML A;  4RW6 A;  1DFD A;  2A10 A;  3DOK A;  1LQ9 A;  3PV8 A;  1PYS B;  1WF0 A;  4IRC A;  1LOU A;  2L08 A;  1IKY B;  3HP6 A;  2VU5 A;  2D41 A;  3UDV A;  2V8H A;  1VBY A;  3IS9 A;  2H65 B;  4Z7C A;  4DWI A;  3BGO P;  1D0E A;  1N8R T;  3CW2 C;  3VGV A;  4ZPW R;  2KJV A;  2R7T A;  3M32 A;  4Q8F A;  4P10 A;  4O0N A;  4YQW A;  1UAW A;  4UQT A;  3C19 A;  5DLF A;  2JFK A;  5A6P A;  2DH8 A;  1UTA A;  4LRC A;  1KDN A;  1WTF A;  2WBM A;  5G0R A;  2QL9 B;  1DUR A;  1Q79 A;  3IC1 A;  3PIO Q;  2OEJ A;  2R2R A;  2GVZ A;  5HMZ A;  3P4U B;  2W9B B;  4MIA A;  2LQJ A;  4KT0 C;  4J9O A;  1X0F A;  2DXD A;  1XQI A;  1LWF B;  2D1C A;  2CNK B;  4XDC A;  1RHJ B;  1WD6 A;  1YRU A;  1FWK A;  4OZ0 A;  2MQP A;  2FHO B;  5KFG A;  2VG5 A;  2XQC A;  1CJT A;  4LRB A;  1CQN A;  1YRX A;  4TU8 A;  2H54 B;  2E1P A;  2VBZ A;  4W98 A;  2GQ2 A;  2H4Y B;  1OYD A;  3LO3 A;  3Q0A A;  2O1P A;  3D6T B;  2HS4 A;  1FJG F;  4ZVH A;  1E6Y B;  3KJV A;  2O66 A;  5HL7 Q;  4NXN J;  3GIR A;  2HWT A;  3BEG B;  3LAN A;  2IA0 A;  1NND A;  2AEM A;  2RVJ A;  1WAC A;  4QPX A;  4B9V A;  2GFF A;  1D9D A;  2B56 A;  3QT6 A;  2UUA F;  4Z7Y A;  4C8K A;  1AFI A;  3A3O B;  1HQE B;  3UW1 A;  5ETT A;  4B9S A;  1RAC B;  2AF6 A;  5CA5 A;  3PO5 A;  1B70 B;  4MKV A;  4ED5 A;  5SUH A;  1BY9 A;  5B0E A;  3MAQ A;  5AXN A;  1TL3 A;  4RJV A;  5I4M A;  1UL3 A;  2IDL A;  3NMA A;  3M8R A;  1C0U A;  2IY5 B;  1JKH B;  1KLM B;  3N6M A;  2HSE B;  1HW9 A;  4LVO P;  1HNW F;  2XSF A;  4R5P B;  4NL5 A;  3SV3 A;  4DG1 B;  2MQN A;  1QSL A;  2DR7 A;  4KGZ B;  4KV8 A;  1CEZ A;  1G6B A;  3DLE A;  4LFB F;  1J5O A;  3MEG A;  5L38 A;  3O5T B;  4DR1 J;  4NLS A;  3CCT A;  2QYG A;  3ZTO A;  4JUZ A;  3Q8Q B;  3FCV A;  4A8Y A;  3KJQ B;  4GKK F;  2VA3 A;  3QT7 A;  5A0Y B;  1NJW A;  1HFE L;  2CVI A;  4LBI A;  4RL1 A;  2I6W A;  1RWO B;  3BGL A;  1L3S A;  2CJK A;  2LDI A;  4LF8 F;  3J81 U;  2YX7 A;  2VQE F;  4IQM A;  2AW0 A;  1DZ5 A;  4OX9 J;  1HKA A;  4X62 F;  4OI1 A;  1RT2 A;  3AQP A;  4ZIV A;  4YR3 A;  2HEK A;  1VJW A;  4NI2 B;  4P9S A;  3H20 A;  4DL0 C;  4M63 A;  4WKY A;  2GC8 A;  3R5B A;  2FUG 9;  4ELT A;  4NRT A;  3B6B A;  4PG4 A;  1XIQ A;  1CC7 A;  4J9N A;  2CA9 A;  5HJY A;  2G13 A;  1OO0 B;  2HQC A;  5EX3 A;  2X1F A;  2NXC A;  6AT1 B;  2DT9 A;  3D28 A;  1F9F A;  2CG4 A;  1BUX A;  3J7Y I;  2GHW A;  3D6M B;  3DLG A;  1VLY A;  2NPI A;  2V0N A;  4GKJ J;  3IXQ A;  5IM0 A;  1HWK A;  2GQQ A;  2U1A A;  3R7B B;  4DV0 F;  2V8P A;  2VIC A;  3UDC A;  2XHW A;  4A8Q A;  1FJG J;  2F3J A;  1BQN A;  1WOR A;  5E5N A;  1HIY A;  2E5H A;  3TOQ A;  4DV6 J;  2BJ9 A;  4B3S J;  1JLG B;  4DSF A;  3EGZ A;  3ZZ0 A;  4PZV A;  2CPX A;  2AV5 A;  3SI8 A;  2XMT A;  2BAC A;  5E3R A;  1LW2 A;  3VAK A;  3L9Z A;  1S9E A;  1WHX A;  4NYO A;  2CJB A;  4CWB A;  1WEZ A;  3D1O A;  5CZV A;  2C3Y A;  1HPZ B;  2U2F A;  3EGW B;  3TEG A;  2HKE A;  2GO9 A;  1FDB A;  1J2V A;  5EUH A;  5A8R B;  4BCA A;  4IYQ A;  2VQF J;  1M1H A;  2HFS A;  1YSJ A;  4QYR A;  4FP9 A;  2M70 A;  2FY1 A;  4AUK A;  2ZD1 A;  1VQ7 S;  1IN0 A;  3NBP A;  4Q0B A;  3H8Y A;  1YVF A;  4P6Q A;  3FSX A;  4OHZ A;  4ES1 A;  1FTR A;  3IM8 A;  4NLY A;  4LFB J;  1I51 B;  5L46 A;  4PXD A;  2AYG A;  3GB0 A;  2BA9 A;  1ZA1 B;  1H98 A;  5C24 A;  1MMN A;  1V3R A;  4ZVF A;  4I67 A;  1SC4 B;  3QLH B;  4C8Y A;  3KG4 A;  3KJF B;  4DPY A;  2YKN A;  2CJQ A;  3ISN D;  2E7X A;  1T03 A;  2J5A A;  1JX4 A;  4BLG A;  4BC7 A;  4XIU A;  4QWB A;  3NCP A;  4CQ1 A;  4DLG A;  5AE2 A;  3EX7 B;  3SQG B;  3QWP A;  3IBF B;  4RX6 A;  3MPW A;  2HW3 A;  3HVT B;  3M30 B;  4JI5 J;  1XMB A;  1RT7 A;  3CJK A;  2A0F B;  3I6P A;  4P75 A;  3C2P A;  3ZNU A;  1U1O A;  4M1K A;  3C66 A;  2JSX A;  3ET6 A;  3OVS A;  2IHR 1;  4C7Q A;  1R7I A;  2ZFH A;  4HHU A;  1NSA A;  1MN7 A;  4LSZ B;  3RR8 A;  1MW7 A;  1P9Q C;  4CH0 S;  3TAN A;  1FFG B;  3MFI A;  4OI2 A;  2W1B A;  3K7R A;  2QV6 A;  2DRA A;  1RHK B;  5HO4 A;  1WI8 A;  2NCK L;  3GIM A;  1PKU A;  3I96 A;  2A6M A;  1LWE A;  4M5D A;  2LEP A;  2UUT A;  4WWS A;  5CYQ A;  2FHM A;  4WIQ A;  2CNL B;  3M2V A;  2IA6 A;  4EO8 A;  4ZMM A;  1G3O A;  1WNE A;  5LSR A;  2F40 A;  1DHM A;  3IO1 A;  3TI0 A;  4DF4 A;  2E1C A;  2K7K A;  3BR9 A;  3HX9 A;  4IR1 A;  2GZO A;  3C3L A;  1KHV A;  1F3V A;  2O01 C;  3HVA A;  4C8N A;  2BW7 A;  1WOP A;  4WPA A;  4KHP F;  1WEY A;  1RAO A;  1VK3 A;  1P27 B;  1RWK B;  3EWG A;  4OYB A;  1UPP A;  2DCU B;  3I0S A;  5KFY A;  3T6B A;  3JB9 k;  3I0R A;  1R0C B;  3QGP A;  3TO8 A;  2EW9 A;  1TMM A;  4UOH A;  3KK2 B;  4F67 A;  4GC7 A;  1FJC A;  1VRU B;  4CLL A;  3O1L A;  3J81 j;  5CD4 A;  1HWJ A;  2DD8 S;  2AU0 A;  2FLO A;  1RKJ A;  4PYD A;  1HAR A;  1UZD A;  5D0R A;  1ZTT A;  4AL6 A;  4J9U E;  2BX6 A;  2IPO B;  1N0U A;  2BR0 A;  1X4B A;  3PVX A;  3KLE A;  2KYZ A;  5LSL A;  1Y5L B;  2HQG A;  2FJW A;  2CQ1 A;  1TKX A;  1HWU A;  1ZM9 A;  1RA6 A;  1CJV B;  5G4D A;  3OL7 A;  2GIR A;  2NXN A;  3MEC B;  3WQP A;  1N5Y A;  1BMQ B;  4PQA A;  3NGS A;  3TQE A;  1YKW A;  3OL9 A;  3KXD A;  3V2U C;  2D9P A;  3HLU A;  3HHK A;  2F4V J;  1FK9 A;  1UWB A;  3GP9 A;  4TXS A;  5LJ5 Y;  3IM9 A;  5IFM A;  4MYT A;  4KKO A;  5H9E K;  5M2P A;  1GXU A;  3GFX A;  2HK2 A;  4X4T A;  1F0X A;  2DNP A;  1SJ3 P;  3GYG A;  5HLF A;  4DR2 F;  1W26 A;  4OLP A;  3CJ2 A;  3AA8 A;  5J2Q A;  2JLE A;  3RW6 A;  1IM6 A;  1S1T A;  4JV5 F;  2BE2 B;  3I9V 9;  1DAR A;  1PJ6 A;  1FDN A;  4HDG A;  2RDI A;  4ECX A;  3G4S S;  4USV A;  2HHQ A;  1U47 A;  3SCK E;  3SZ2 A;  4X4S A;  2RHQ B;  1D8Y A;  3MM8 A;  4QIG A;  2NSC A;  2HZA A;  5A8W B;  1S6P B;  4IG3 A;  2B5J B;  1KS2 A;  2CKW A;  3AT1 B;  4FYD A;  2ILY A;  5ETM A;  1JLF B;  3RAX A;  2EPI A;  1TKT B;  4IH7 A;  1LWX A;  1N52 B;  1S0O A;  3NOC A;  5BXI A;  4P7T A;  5GMK a;  2K1R A;  3MDF A;  4OZN A;  1XWL A;  5FLX Y;  4ED7 A;  1SKR A;  2Z2Y B;  2HNY A;  4FKY A;  4YB6 A;  3N01 A;  3VF0 B;  2XLJ A;  2HMI B;  3VGS A;  1JJH A;  2ZUG A;  1KTV A;  2ACM A;  3IG1 B;  4NLG A;  2YY3 A;  3M8Q A;  4QIF A;  2C3M A;  4KHR A;  2OH2 A;  2UU9 J;  2V2Q A;  1UZH A;  2SXL A;  1Y10 A;  4DV1 J;  4QCL A;  1VBK A;  4UOG A;  2BAN B;  1UJ4 A;  2NPF A;  4ECW A;  3KNG A;  1KVJ A;  3DLK A;  2MTL A;  1SH0 A;  2CIM A;  4KGM A;  5DJB A;  2RD5 C;  2PO4 A;  3JYT A;  4OZJ A;  1EP4 B;  4OZL A;  2VPW B;  2WOM A;  1FWP A;  1S1U B;  5CYM A;  5KFL A;  2IMO A;  1VQY A;  3M4X A;  2LFV A;  4YOE A;  2DKO B;  5KFH A;  3JSM A;  1MMD A;  2OJ3 A;  3OTE A;  4DSI A;  2FJB B;  3R1L A;  3T1A A;  3HHD A;  3L4B C;  3JXO A;  1DY3 A;  2FYX A;  4LF9 J;  3RZA A;  3D66 A;  3CJT A;  3BS9 A;  2DNH A;  4QYZ J;  4RZR A;  4DR2 J;  4E8U A;  1UVN A;  2FB0 A;  3QGG A;  5KG2 A;  2CZV C;  4LSN A;  1VHI A;  5KFM A;  5F8H A;  2OP5 A;  1Y00 A;  3RTV A;  2LYV A;  3KHH A;  3DRS A;  4LRE A;  3KUE A;  4WBF A;  3FBF A;  2UXD J;  5L1J A;  4JI3 F;  3TUZ C;  1M5P C;  5IQQ A;  2YNH B;  5D77 A;  2QO3 A;  5L8R C;  4C2M A;  1X5O A;  2EG2 A;  1WSV A;  4FXW A;  1VQN S;  2QSW A;  1RA7 A;  3ZTR A;  5F9L A;  4NEY A;  1WC5 A;  3T9N A;  4QIV A;  4OL8 A;  3JSY A;  3C14 A;  3FEZ A;  3VHQ A;  3ZZP A;  3MEE B;  1H74 A;  4FF2 A;  1LXJ A;  2HBQ B;  2JVR A;  2FPH X;  3D6F B;  3GTY X;  2XGP A;  4KQZ A;  4YB5 A;  3FBE A;  3MFH A;  4RW8 B;  2DVI A;  3CO0 P;  2UVR A;  2HG4 A;  4LQ3 A;  3KNA A;  2KKH A;  4JI4 J;  4NA3 A;  4DPT A;  1TK8 A;  1VJQ A;  3TR5 A;  1TL1 B;  1ZM4 A;  5C2G A;  3W62 A;  3RRH A;  3DOM A;  4A8K A;  3OJU A;  1LW0 A;  4ZP8 A;  2RQC A;  4K0K J;  2GMJ A;  2JRS A;  4OIX A;  3BR8 A;  2DR6 A;  1Q78 A;  3MMA A;  5H9F K;  4RW4 B;  1MRO B;  3H2U B;  2OGU A;  3PRD A;  5LL6 d;  2G2Z A;  5AXK A;  3TAQ A;  4KHM A;  3RB0 A;  4MT1 A;  2I9S A;  3MMB B;  2RUG A;  1C1C B;  3IWX A;  2IJN A;  3IAM 9;  3MPU B;  3PW0 A;  5CCL A;  3BV8 A;  2R2S A;  8RUC A;  1H0H B;  5FD1 A;  3NAH A;  1VQ9 S;  3GJT B;  1YIJ S;  1JLB B;  3W8G A;  3P8B B;  1SH2 A;  1HYS A;  4ED4 A;  3M6V A;  1U02 A;  1KQF B;  3R7N B;  5KFN A;  3ZNJ 1;  2W9C A;  3I87 A;  3M6U A;  1K73 T;  2Z0G A;  5DLG A;  5KFI A;  3X3U A;  4DR3 F;  5BR8 F;  1RU2 A;  3MEK A;  3MCN A;  1NLK L;  2A1B A;  3SFG A;  3B8H A;  3PFE A;  1X4G A;  4FXD A;  1S79 A;  3OPK A;  1GNK A;  1RHM B;  1B4S A;  4LQ9 A;  4JV0 A;  4DUZ F;  1VC5 A;  2FVR A;  3HJF A;  1TVR B;  4F0K A;  4LF4 J;  4IFV A;  5D78 A;  3MM7 B;  1EIY B;  4Q5V A;  2HPU A;  4AND A;  3PAC A;  4U7U K;  2MKC A;  4PWD B;  5F8L A;  1YX2 A;  4PG6 A;  1KVK A;  3H4B A;  2N3O A;  1FKA F;  4DPX A;  2N7C A;  4M5N A;  3H7H B;  2G2O A;  1LWC B;  1NK7 A;  2KT3 A;  1X31 C;  4B9N A;  3JQM A;  1RZM A;  3H59 A;  4LFC J;  2DGX A;  3K57 A;  1OSD A;  2CJA A;  3KG1 A;  2UUB F;  3W5Y A;  4AE5 A;  3E01 A;  2BQU A;  1LFW A;  2RML A;  3LAM A;  2E66 A;  2C3O A;  2B4P A;  3GII A;  3VQS A;  3BGF A;  2NUU G;  2RIJ A;  1NSQ A;  5JJB A;  3DM2 A;  1QE1 A;  2YKM A;  4C48 A;  2Y1R I;  5C25 B;  2KFY A;  2XWY A;  3LWL A;  3K2Y A;  4OHW A;  2KRB A;  2IC3 B;  1AA1 B;  1NHV A;  4TLR A;  4QZV B;  4PXC A;  4UQG A;  1IKY A;  1R0B G;  2MKI A;  3TZY A;  5AT1 B;  2ZDP A;  4PG5 A;  4UUW A;  4Y2C A;  1HI8 A;  3MM9 A;  3ZTP A;  2OI2 A;  2OIH A;  4B9L A;  1PJ5 A;  3CCS S;  3Q83 A;  4E0D A;  5KG3 A;  3CCW A;  4CO2 A;  1S1V A;  3U1M A;  3MCM A;  3HCX A;  5EWG A;  2BZ2 A;  1U2R A;  2YWH A;  1FI4 A;  4JYA J;  4X4R A;  3JSB A;  5D4O A;  3W66 A;  1X5S A;  1I6J A;  3MMJ A;  1A7G E;  1IUJ A;  4OYZ A;  2W9B A;  2RE1 A;  5M2U A;  1VQS A;  4LR7 A;  1HR0 F;  1LWF A;  2CQH A;  4R0J A;  5D15 A;  2D3Z A;  4URQ U;  2XGQ A;  4HLB A;  3QRQ A;  4FYV B;  2VPZ B;  3M7V A;  3UCZ P;  2ZC4 A;  4NLO A;  4AXJ A;  3UWT A;  2GS8 A;  3R6G B;  2B9Y A;  2HIQ A;  4LVN P;  1PAU B;  3UD5 A;  5LT5 A;  5ADZ A;  2AEJ A;  3RBX A;  2CPF A;  3NL0 A;  3IA0 A;  4OJ1 A;  5KTQ A;  4LF1 A;  2XBP A;  3KLI B;  4KJI A;  3CT9 A;  2HHT A;  2K2P A;  4ZPT R;  3M2R B;  4UOC A;  1HQE A;  4TY8 A;  4H54 A;  4N41 A;  3POT B;  4EFA C;  3W1Y C;  2IAJ B;  4C8O A;  1D09 B;  3D7S B;  2GGP B;  2UUB J;  4I4B A;  3D1Q A;  2E5J A;  4DX8 H;  2HGL A;  1EQM A;  2CQ2 A;  2APO A;  5DZ6 A;  3THP A;  2HAF A;  3T5H A;  4A8X A;  1YBU A;  4ELU A;  4DG1 A;  3DI6 B;  2MDA A;  2HLT A;  2ZM6 F;  2QLF B;  4NCG B;  3LGH A;  2EK6 A;  5T7L B;  2GCF A;  4ECT A;  4X65 F;  1E6V B;  4FXV A;  4MK9 A;  2Z2L A;  2QE5 A;  1W25 A;  5KFF A;  3QGI A;  2XO6 A;  3TAR A;  1MU2 B;  3HT0 A;  2CPJ A;  5KFK A;  2QIF A;  4B3T F;  3HVR A;  1UFW A;  5HVH A;  1HWI A;  1CC8 A;  2XMJ A;  5E33 A;  2QFI A;  3ICL A;  2UVW A;  1UJ6 A;  1S12 A;  3SDE A;  1T9T A;  4N56 A;  1ZYQ A;  2AJ4 A;  2VH7 A;  4F4W A;  4LJM A;  1L3U A;  1H7W A;  4KGX B;  1RYS A;  1SPB P;  1H3D A;  4ZVO B;  4QPT A;  4CH7 A;  1F6T A;  2XMU A;  5GAD U;  2B8Q A;  2QLW A;  4DZ6 A;  2B6A B;  3EZU A;  3BGR B;  1D1U A;  2XYG B;  1RP5 A;  4OHV A;  1O51 A;  8ATC B;  5D0G A;  4W92 B;  4DQQ A;  5DZ7 A;  1F5A A;  1RJJ A;  3HUL A;  1HI1 A;  1U09 A;  2CPI A;  1IKX B;  1VIX A;  3SV4 A;  4L3N A;  1IBM J;  4OYP A;  1XEZ A;  1PIL A;  1TL7 B;  5A2Q Y;  3ENV A;  1OS5 A;  1ITP A;  3D9B A;  1SH3 A;  4DQI A;  4FVM A;  4RBU A;  2AGO A;  2A6O A;  2OFG X;  3EJM A;  5KFP A;  3TQ1 A;  1IM4 A;  3I5C A;  1JLG A;  1VBX A;  2VFS A;  5A6W A;  5K14 B;  2QL5 B;  4NLW A;  4DU7 A;  1KOO A;  1F60 B;  4M94 A;  3U1L A;  4FS1 A;  2GIQ A;  1C0T A;  3BKT A;  4C11 B;  2AEF A;  1C1B B;  5HMX A;  2DNG A;  4I1T A;  4DX7 A;  4Y34 A;  2F4F A;  1KOH A;  2YQ0 A;  2IM1 A;  3V6H A;  1V6H A;  2XY5 A;  1HNZ J;  2HYI B;  5A8R A;  4Y00 A;  1TZ0 A;  1BC6 A;  1JIH A;  3R5G A;  4IQX A;  1NK9 A;  3BDP A;  3DRR A;  4XAK A;  5DDP C;  3TAP A;  1FKP B;  3CB4 A;  4NLQ A;  1YJU A;  1IQT A;  1VQ6 S;  3CJR A;  3KLG A;  3C16 B;  3R5D A;  4DCO B;  3P6Y C;  4ICL B;  4I2P B;  4MMO A;  3LWM A;  1U4B A;  2D74 B;  4J90 A;  3BQ1 A;  3JSR A;  4X65 J;  3OTD A;  4LR8 A;  2RF2 A;  3I5B A;  1FVS A;  1XTZ A;  2EFN A;  2BM1 A;  2I1R A;  3RGI A;  1NPK A;  2QMU B;  3HD2 A;  2JJ4 D;  4ZDN A;  1GT8 A;  2HIY A;  2DHS A;  3HHL D;  4XK8 C;  2R7S A;  1XBW A;  2DNZ A;  2WB4 A;  4DSL A;  5F8G A;  2GVD A;  5KG7 A;  2R7V A;  3CUL A;  4USH A;  2BYC A;  2ZKU A;  1WJ9 A;  2IJF A;  4DMZ A;  5KFW A;  3U02 A;  1NK6 A;  4JI0 F;  3OFG A;  4HDH A;  1K44 A;  3OW2 R;  1S0M A;  1FD8 A;  3V4I B;  1YDL A;  2FJV A;  4ZLN A;  3TA2 A;  4Y2A A;  2PFD A;  1PIE A;  4FPI A;  3A3N B;  4ZOS A;  3V6J A;  1T11 A;  4OYA A;  3PR5 B;  5B08 A;  1EAR A;  3EMT A;  4KH0 B;  4H4M A;  2MJN A;  2HQ3 A;  4Q44 A;  4DQR A;  3HT3 A;  4JI2 F;  1G1X A;  1VRQ C;  3RU0 A;  1N36 F;  3ENA A;  5ITH A;  3G82 A;  3NAI A;  3NEK A;  4DI6 A;  1FFS B;  2Y1L B;  1KON A;  4G1Q A;  4UTG A;  5FJ4 A;  5IWA F;  3D54 A;  2BOP A;  2UXB J;  3FCW A;  2YNI A;  4OYX A;  1WI6 A;  3QIP B;  3PYD A;  2YKO A;  1U1L A;  4KSE B;  1GTH A;  2RT3 A;  3OR2 A;  4O44 B;  5C5J A;  1S0V A;  1N32 F;  3H25 A;  4ZS6 A;  4BWM A;  2VJV A;  5CQG A;  3H2L A;  1SJQ A;  1FRL A;  2ALZ A;  2NYH A;  4IDK A;  4CO1 A;  4ZVG A;  5GAG U;  4K5S A;  1FA0 A;  2WCX A;  4NLU A;  3A12 A;  1U2F A;  1XMQ J;  3O44 A;  2IM3 A;  1URR A;  3KK2 A;  2BJ7 A;  5I3Q A;  2FZK B;  1MNE A;  2LQ5 A;  3TP2 A;  4XO0 A;  2PMW A;  4OHY A;  2ZH4 A;  1HBO B;  4EGL A;  4CTA B;  2CPY A;  4KY3 A;  1U1R A;  1WHY A;  1CQM A;  2M5Y A;  2C22 A;  1WKJ A;  5LXY A;  4NPO A;  3AD9 C;  3T1H F;  1C2P A;  2V6A A;  1UET A;  2K8G A;  4AD6 A;  1WC6 A;  2FLL A;  2YNF B;  1JLC A;  4ED6 A;  3E3X A;  4OHX A;  3V81 B;  1CJV A;  4W4M A;  5KT6 A;  2EBE A;  5F8I A;  1HHS A;  2YTC A;  2RU3 A;  2MGZ B;  2N82 B;  2PN6 A;  1JJ4 A;  3UO0 A;  2LQ8 A;  2CQD A;  3MEC A;  4ZP9 A;  4C97 A;  3MMC B;  4P72 A;  2PFF B;  1ZAX A;  2VG7 A;  2CYY A;  4GRS A;  3Q8V A;  3AH6 A;  1H2V Z;  3CE8 A;  4JI0 J;  4ETZ A;  5K9F A;  5GAH I;  2DHH A;  2R7R A;  2FZG B;  2PC6 A;  4RNN A;  1U6F A;  1U1N A;  3MR3 A;  1YLX A;  2RU9 A;  3QO9 B;  1U48 A;  3D4J A;  3HHL B;  3KLH A;  3B78 A;  3F44 A;  1RT6 B;  3TVY A;  1JB0 C;  1RT4 B;  4U9R A;  3FCH A;  1M5H A;  4M5J A;  4X4N A;  4ER8 A;  2KRR A;  3OXF A;  1ZS6 A;  2J9D A;  5M2R A;  4YP3 A;  2EI5 A;  1KKH A;  2DCL A;  1IBK J;  2BE2 A;  4IRD A;  1ZTW A;  1Y4Z B;  4WK1 A;  4CLP A;  4CO5 A;  2ZE2 B;  2C2Z B;  3RYL A;  1LKZ A;  4KE5 A;  3H5S A;  4F4X A;  2QA4 G;  2XNR A;  1WKL A;  2YWF A;  2VF3 A;  3AOA A;  5AXL A;  4H4O B;  2Q79 A;  3NKY A;  4IO1 A;  4NML A;  1RWP B;  2FJA B;  2CDQ A;  2ALY B;  4HHH A;  1IBC B;  3PYG A;  3B4D A;  4I64 A;  3BJY A;  3W5X A;  5E3P A;  5A8W A;  1S6P A;  2ZBQ A;  3G86 A;  2K06 A;  4MFB B;  1U1M A;  1NO8 A;  2IIH A;  4W90 B;  1AUD A;  2XWX A;  3MAA A;  4ENO A;  3CC2 S;  4JP8 A;  2RRA A;  4F3O A;  1N56 A;  1RU1 A;  2BXJ A;  4MYU A;  1NU4 A;  4WFY A;  1H38 A;  4FF3 A;  1KHW A;  2VIH A;  4ECZ A;  1NHK L;  2B8P A;  2JC0 A;  5KFQ A;  2N4D A;  3N28 A;  3B82 A;  2AT1 B;  2HFU A;  4CT8 A;  1B64 A;  1AFJ A;  4M5H A;  3GG0 A;  3KK3 B;  1FE0 A;  4PQU B;  2H9Z A;  2BAN A;  2DJW A;  4JI8 J;  2UP1 A;  1HQ2 A;  2GML A;  1CLF A;  3NGT A;  2M52 A;  2JLG A;  4HHJ A;  3KKF A;  1M90 T;  2RAQ A;  3Q22 A;  3CC4 S;  3PJX A;  3W2V B;  3OQ2 A;  3GZ7 A;  2RJZ A;  2LEC A;  1RCO B;  4Q2M A;  3EVW A;  5CZX A;  3W5Z A;  2ZWP A;  3QJL A;  3W64 A;  2VDH A;  2BAB A;  1M5K C;  2KG0 A;  3QID A;  1JMT A;  4CNZ A;  3CDE A;  1K47 A;  3M05 A;  3PEJ A;  4Y2K A;  4OI3 A;  3ZO7 A;  2Q1L A;  3C15 A;  4JI7 F;  1MN9 A;  1OY6 A;  1VYA A;  2ZUA A;  1TEL A;  2XI2 A;  4OJH A;  2IVF B;  3R9L A;  2OD4 A;  2GJI A;  3CDA A;  3FFI A;  2XEX A;  1HBM B;  3HKW A;  2YNH A;  2AIR B;  4PPD A;  1T9U A;  1DTQ B;  1U0H A;  5JVG Q;  4DFM A;  4B3R J;  3A8J A;  5ETP A;  5CYJ A;  2MKH A;  4YR0 A;  2RSQ A;  1HNI A;  4PAB A;  3LGM A;  3KYL A;  1R6V A;  1K0V A;  2DY1 A;  3MEE A;  2FJD B;  2W2Q P;  2V67 A;  4DCJ B;  1B7Y B;  4N76 A;  2XS7 A;  5FDL B;  4ZKA A;  3OLA A;  2MLX A;  1NJZ A;  2PII A;  3OL6 A;  2LQ9 A;  2PI5 A;  1SJ4 P;  2LDY A;  3LAL A;  4PRF A;  5D4N A;  6FDR A;  1NKE A;  2YPZ A;  3IWN C;  1UEU A;  4DX5 A;  4K4W A;  3AOD A;  3FBB A;  2NZC A;  4F4K A;  2Q6C A;  2G9O A;  3R27 A;  2DHX A;  1PYO B;  1REV A;  3DXS X;  5LMN F;  3RAM A;  2QN6 B;  2KXH A;  3CD7 A;  3EGV A;  4WYW A;  1XMO F;  4WJB A;  4ZIW A;  1JNR B;  3B54 A;  3LP0 B;  1MSW D;  1S77 D;  5CAA A;  2CPE A;  3RBE A;  3MMB A;  2ZHA A;  1WC0 A;  1O0P A;  1C1C A;  4QYZ K;  1TL5 A;  1JXE A;  2KH9 A;  1KRP A;  3HK2 A;  1Y5N B;  3TEH B;  3OHA A;  1YJN S;  1TKZ A;  5LM7 E;  3PZP A;  5HQL A;  5DDO C;  2XS5 A;  3CD5 A;  3NS7 B;  2IVY A;  1JLB A;  4LBP A;  2J8S A;  2F9J A;  1KTQ A;  2DXF A;  2XSJ A;  3Q86 A;  3NOG A;  1N5S A;  4O4R A;  4LF6 J;  2MKK A;  1VCT A;  5IOL A;  2EBG A;  2W24 A;  3DDI A;  3Q8Y A;  4JI6 F;  2DH9 A;  4QR2 A;  1VQM S;  2MKY A;  2AYM A;  2G4B A;  3M1V A;  2HVI A;  1GMV A;  3PW5 A;  1XR5 A;  3HFK A;  1SIZ A;  2DNQ A;  2W9A A;  1Y3J A;  4WU2 A;  1X5T A;  2VDI A;  3BKF A;  4J9V A;  3W7B A;  1HL6 A;  4KO0 B;  1K8A T;  1TVR A;  3GYX B;  3D68 A;  2W4C A;  4KPC A;  2AX1 A;  4CYU B;  3NWR A;  5E3Q A;  3TAM B;  3WX4 A;  5KFV A;  2F1F A;  2OEK A;  4PWD A;  4EZ6 A;  1S0N A;  3MR5 A;  3UDE A;  1CUL A;  4DUY F;  4LF5 F;  1X4E A;  1SQG A;  4ZN3 A;  3V6D B;  2MQL A;  3G8S A;  4GO5 X;  2CRL A;  1Z2L A;  2HAI A;  2VL1 A;  4K4T A;  4RBT A;  4Q7A A;  4L3K A;  3C6U A;  1KEK A;  3ULH A;  9RUB A;  4ECU A;  3GPA A;  1X4D A;  5J2P B;  3K0J A;  2XY7 A;  5H9F J;  1TUV A;  1DLO B;  3GMG A;  3W61 A;  4NZ6 A;  4ZPD A;  2NR0 A;  2PD1 A;  4GVL A;  3EVO A;  5KG1 A;  1FKO B;  4V19 X;  3G6E S;  3FEY B;  1YIT S;  1WSR A;  1NME B;  1NJY A;  2HNZ A;  5C7P A;  5LMN J;  3ISZ A;  3FZB A;  1HNV B;  4RUB A;  4NEZ A;  2MZJ A;  1CS4 B;  2IBO A;  3HDS A;  2OLW A;  2WW8 A;  1GFW B;  1FER A;  4CRJ A;  2I5J B;  4XDD A;  4ZCK A;  5DQG A;  2XMA A;  5HBM B;  4NXM F;  2CFX A;  5HAT A;  3OVA A;  4DR4 J;  5KFZ A;  1IR1 A;  1GEH A;  3RBD A;  1QLN A;  4HL9 A;  1R43 A;  4F3M A;  4DJB A;  2KM8 C;  2J6U A;  2DGU A;  1RWU A;  1FE4 A;  3K5L A;  1QY7 A;  1PO6 A;  2B9W A;  3BO4 A;  1X0P A;  3Q23 A;  4RNO A;  5AJ3 F;  2HFZ A;  3HSJ A;  4C98 A;  3D1H A;  2ROG A;  2H3E B;  5DO2 A;  3R3T A;  2DO4 A;  3UNG C;  1KQG B;  2OO4 A;  4ZVP B;  2DBB A;  3ITH A;  3SSS A;  3G6X A;  1R8H A;  3JAM U;  2MJU A;  4WFN Q;  3GIK A;  5DG7 A;  1RTI B;  4DR7 J;  3KDN A;  3ZZR A;  2WVF A;  4ZVR B;  2DRB A;  3IRX B;  1LXN A;  3KLI A;  3LUY A;  3VVU A;  3CJ4 A;  2DNK A;  1B99 A;  4B3M J;  2I8E A;  4X66 J;  5DM6 Q;  4YY3 J;  1A6L A;  5EHH A;  1UVJ A;  2DGT A;  4B08 A;  1VI7 A;  2GGP A;  4ED2 A;  1RTJ B;  4J9P A;  3LOU A;  2BEF A;  4KIA A;  4YS2 A;  3DRY A;  4AL7 A;  4TYB A;  4WF9 Q;  2V94 A;  1YHQ S;  3T1Y J;  3L3C A;  5LMU J;  2OPP A;  5A8K A;  1FNM A;  3DI6 A;  5J1N A;  2WON A;  2J9D E;  3MAH A;  3KLF B;  2AYB A;  1E6V A;  3A3P B;  2X1G A;  3PKM A;  3PHE A;  4U7C A;  1UKU A;  3CED A;  3VAI A;  3NNA A;  1IJF B;  4LF7 J;  2HVD A;  3DOK B;  3US5 A;  1RGV A;  1MU2 A;  4IG0 A;  2RDD A;  4ECQ A;  3OD2 A;  2AJF E;  1WHW A;  2BJD A;  4QW9 A;  3OUY A;  1XK8 A;  4EUV A;  5KFA A;  3WIU A;  3CJ3 A;  3LAK A;  2Z2M A;  4P73 A;  3MTJ A;  1M5V C;  1RT5 B;  3BGU A;  2KL8 A;  4NXN F;  1S9F A;  5G0R B;  1JLE A;  2WVB A;  5CD4 H;  2DYA A;  2GVZ B;  4BHQ A;  2DNR A;  2B6A A;  4HVZ A;  3BGR A;  4O3R A;  4HI1 A;  4A8W A;  3DCA A;  2P9E A;  1IKV B;  1LEO A;  3W60 A;  2MB0 B;  2XHC A;  3TA0 A;  5DDQ C;  5IT9 Y;  3G87 A;  3H98 A;  2CQC A;  2F8M A;  3UN2 A;  1TL4 A;  2FGO A;  1IKX A;  4DL2 A;  3RG6 A;  1TL7 A;  4A46 A;  3RB6 A;  5U47 A;  2HHW A;  3KJV B;  1NDC A;  3ONQ A;  4MKB A;  4U95 A;  1ARO P;  2QMX A;  4RW9 A;  2VKZ G;  3CF5 Q;  3CC7 S;  4HAC B;  2FZC B;  4ID8 A;  4DR1 F;  4PXB A;  3U7J A;  2BQ3 A;  5DGA A;  1RWM B;  3IGN A;  5LSO A;  4USK A;  1NJX A;  5E7O B;  1AB8 A;  4C11 A;  5GVQ A;  3D0I E;  1TL3 B;  3C46 A;  3VQT A;  5KT3 A;  3CDU A;  4OX9 F;  2EFG A;  4UST A;  5HMW A;  4CLK A;  1SXL A;  4I2Q B;  3CSK A;  3C16 A;  2HGM A;  4KV8 B;  3DLE B;  1R6Y A;  3HZE A;  2E5L J;  2H5E A;  2FHJ D;  1J5O B;  3MEG B;  3D5M A;  4G1I A;  2GHP A;  2XCP A;  1LK5 A;  1TU0 B;  2QA4 S;  1UVM A;  2HND B;  4NLV A;  4DR5 F;  3H42 A;  2W4P A;  2Z4P A;  1N5V A;  4DL6 A;  3TYT A;  1SC6 A;  1PC4 A;  2K3I A;  1NJI T;  2C2N A;  4U6P A;  4CDI A;  3HKZ D;  3THV A;  5KFT A;  4GKJ F;  4PUO A;  4I6Y A;  2KN4 A;  4CO0 A;  1EJ7 L;  4NE9 C;  4ECV A;  1Q86 T;  4DV6 F;  1SV5 B;  2DHA A;  4B3S F;  2BJ8 A;  4DCP B;  1QSY A;  2D7S A;  4KGK A;  4ZPV R;  1N48 A;  1TV6 B;  5CCM A;  1Z2Z A;  3EDR B;  4GVB A;  2YX1 A;  1I94 J;  2E1M C;  4WZQ A;  2O67 A;  5GAH U;  1SL1 A;  3CPW R;  4YDD B;  3V4I A;  3KK1 B;  2QL7 B;  3K5M A;  4C8M A;  2VQF F;  4OJ3 A;  1OY9 A;  1PG5 B;  1YWX A;  2GV1 A;  3D0H E;  1T05 B;  2E29 A;  3K59 A;  1DRZ A;  2ABY A;  1VMB A;  4UW2 A;  1BQN B;  1DBD A;  3W3S A;  2Y0S D;  4R0E A;  4AL5 A;  3PYE A;  2MHN A;  2GMH A;  3ZZU A;  3GG1 A;  3ZTQ A;  4PWW A;  2ZH2 A;  3DOL B;  1LW2 B;  1S9E B;  2XG8 A;  3GON A;  5F8J A;  3WHI A;  3I4P A;  3R2C J;  4M5M A;  3PDN A;  2M8H A;  4RKU C;  4HEA 9;  3CCR S;  2B0G A;  3QIP A;  2KXN B;  2J0X A;  2RIL A;  1FEH A;  2H5J B;  1KLN A;  1FRH A;  1SBR A;  3GJR B;  2V50 A;  3DRP B;  2ZZT A;  3BBC A;  1XNR J;  5CAB A;  2VG6 A;  4JI5 F;  3NBP B;  4Q0B B;  4USI A;  2CXE A;  3DLH A;  4WXW A;  4EYI B;  2OSQ A;  2X7I A;  4F36 A;  4KBI A;  5HRO B;  1FXD A;  5C24 B;  1YJT A;  5D4P A;  4DR5 J;  1RT3 B;  1VQ5 S;  1N6Q A;  2GO8 A;  5KOX A;  4CTA A;  2YKN B;  4TU7 A;  1T03 B;  1GXT A;  2WB1 D;  4LRA A;  1SCJ B;  4OX7 A;  2XMK A;  1FWL A;  2V8D A;  2B4U A;  1SB6 A;  3OTO F;  4I68 A;  2W4D A;  3V81 A;  2RS2 A;  4C3M A;  1RT7 B;  4OV6 A;  1RYR A;  4IH6 A;  2FY8 A;  5IC4 B;  3H4D A;  1NH7 A;  4IRK A;  1OPZ A;  2G0I A;  2QJ3 A;  2OMO A;  3HSD A;  1U2C A;  4TN2 A;  2E9R X;  4Y2M A;  4R8U B;  1RWW B;  4TQR A;  2CJ9 A;  3EXY A;  1S4F A;  2OAU A;  3LP1 A;  2KZZ A;  1GX5 A;  4FNH A;  3Q8R B;  2WW4 A;  3EDQ B;  3GR1 A;  3HHL A;  1SL2 A;  2CZ9 A;  2WSE C;  2MMY A;  4BDP A;  2KI2 A;  3MUR P;  1VIO A;  4ZP6 A;  1RT4 A;  1EZZ B;  3LP2 B;  4C4W A;  3I5A A;  3MED A;  1LWE B;  3N79 A;  2ZJQ Q;  5CYQ B;  3EZO A;  4RPF A;  1HNX F;  3ZZO A;  3M2V B;  3OT9 A;  4F04 B;  3PX6 A;  4G1P A;  2H48 B;  3J80 Y;  4MJK A;  1EET B;  4H4O A;  4U96 A;  5THW A;  1W2I A;  5KFE A;  1F9H A;  1SJ1 A;  2P6T A;  2Z56 B;  4OZ1 A;  1TUG B;  5I3U A;  4DSE A;  2YPY A;  4C3L A;  1U7L A;  1TMJ A;  4C0H A;  4KGV B;  4ES3 A;  2Q43 A;  5L39 A;  1WUU A;  4DR6 F;  3DGV A;  1KN6 A;  3I0S B;  8AT1 B;  2OTJ S;  4MFB A;  5GAD I;  4GC6 A;  4PG8 A;  1RAD B;  4D3G A;  2E5G A;  4F2S A;  1JXL A;  4RNH A;  2C2D A;  2QRR A;  2AP6 A;  2PMZ D;  3A1Y G;  2F4V F;  2DGQ A;  3IR6 B;  2EFQ A;  3MD1 A;  1S10 A;  2M7S A;  2JZ5 A;  1NSP A;  1IQZ A;  3IFE A;  2FC9 A;  2L9W A;  2C2K B;  3PIP Q;  3EIC A;  1N33 J;  3UD4 P;  4LFA J;  1IJE B;  2H5I B;  4OI0 A;  4BS2 A;  3OJS A;  2YBV A;  4DV4 F;  4F4A A;  3OTO J;  2EK1 A;  3RUB L;  5IZH A;  1REG X;  3EUN A;  2A18 A;  1JQG A;  5KG5 A;  3L95 X;  3AJD A;  3HHL C;  1HQU B;  2E1A A;  1N5Y B;  1WF2 A;  3F0N A;  3N9U C;  1N34 J;  2HK3 A;  3TVZ A;  4JOU A;  4N47 A;  4KPY A;  2IVM A;  3HMJ G;  1T3N A;  4HI2 A;  1ZA2 B;  2KU7 A;  1UWB B;  1YBT A;  3R97 A;  3BPD A;  1NB2 A;  3TJ8 A;  3CMA S;  2DEJ A;  3GV8 B;  2KT5 A;  4O23 A;  1X4A A;  2W7P A;  1IKW A;  4KKO B;  1FDD A;  2UVU A;  4K59 A;  5DG8 A;  1U24 A;  2M0G B;  2P2C B;  1BWV A;  5HLF B;  2W25 A;  5HSP A;  2CQP A;  2ZC3 A;  1W2B R;  2EC0 A;  3UVJ A;  5ETR A;  1JWW A;  4WK3 A;  3QSY B;  3DHX A;  2DR9 A;  2AX0 A;  2LEB A;  1RAH B;  1XC9 A;  1HNX J;  5D3G A;  2MZR A;  4CO3 A;  4NOH A;  2ZZM A;  5K20 B;  2WZ1 A;  3GIJ A;  3CIM A;  1HBM A;  4DS4 A;  3BYR A;  3IR5 B;  3MM5 A;  2AZ1 A;  1CJU A;  3CDW A;  2PT0 A;  1DTQ A;  4ITS A;  1OQ3 A;  3MM8 B;  4ZPB A;  4CLF A;  2HRU A;  3MWB A;  1S9G B;  3OSP A;  1KWM A;  2GIF A;  3ZZZ A;  1V3Z A;  3UE2 A;  2AQ4 A;  2UU9 F;  2HGN A;  5B09 A;  4IG3 B;  2EG1 A;  4FBT A;  3VGU A;  1FTC A;  4CT9 A;  5LJ3 Y;  4DV1 F;  2IFX A;  4DR6 J;  2YXL A;  5C42 B;  4O3P A;  4AYB D;  2OSR A;  2UXC J;  1OJ4 A;  3M9N B;  3CCZ A;  5FDL A;  3CCE S;  2HZV A;  4O3S A;  1UVL A;  4CI0 B;  4U7U D;  5HJX A;  3RW7 A;  2GHV C;  2GAG C;  3UNY A;  2RKI B;  2NSB A;  2XLI A;  5F8M A;  2UV8 G;  1NK4 A;  4ZPA A;  2HUR A;  4NWB A;  2KZM A;  3C8Y A;  5IQ6 A;  3M8Q B;  2Y8W A;  2EWH A;  4OZ5 A;  4LF9 F;  3DFE A;  1VIS A;  4EMD A;  1NPP A;  2XZT B;  5I42 B;  4DV4 J;  1Q1K A;  2UUC J;  4IFY B;  3J81 Y;  4J9L A;  3DLK B;  3UD3 P;  3QZ7 A;  1A9N B;  2YVS A;  3DGP B;  3KDO A;  2AZ3 A;  2V4R A;  3MPV A;  2UXD F;  3JYT B;  2RRN A;  1Q5Y A;  1B0P A;  5AXM A;  2Y0B B;  2X1B A;  3OTB A;  3M9O B;  4ZVS B;  1K1S A;  5CYM B;  3KHG A;  4FN5 A;  2ZH6 A;  1LK7 A;  1CJK B;  1MG7 A;  2PEB A;  3BSN A;  2DNN A;  1SKW A;  3A8I A;  1OY8 A;  3BM7 A;  1RAJ A;  1XNQ J;  3AB2 B;  3JTP A;  5HQ8 A;  1AZS B;  3DLL Q;  3D3B J;  4DOZ A;  3CCL S;  2R8G A;  1NB7 A;  1RKI A;  4DF8 A;  3ADA C;  4LSN B;  1BWE A;  4ED0 A;  5GAG I;  2HHX A;  1V3S A;  2BOA A;  3CO9 A;  3HFV A;  4WFZ A;  1RT1 B;  3GFH A;  3NWG A;  3DLB A;  3K5O A;  2K3K A;  1ICE B;  5E3A A;  2P6S A;  2E9T A;  1KP6 A;  3DRS B;  4TVA B;  2AYE A;  5L1I A;  1UA0 A;  4B3O A;  2OPS A;  3K89 A;  4LRF A;  5F3Z A;  4KO0 A;  4JI4 F;  1QTN B;  1DAX A;  4ID5 B;  1TTH B;  2ILZ A;  2WSF C;  3OR1 A;  4WE1 A;  5D0H A;  2VBY A;  1VC0 A;  3DU6 A;  1BXN A;  3PYF A;  3HI9 A;  4MKY A;  1ZBT A;  1KC8 T;  3N4W A;  4K0K F;  2PDA A;  3RB3 A;  5HP1 A;  4HH0 A;  2C2M B;  3TUI C;  2CNN B;  1QTM A;  5D6G A;  1VS3 A;  3C14 B;  1T9W A;  1J27 A;  4YB1 P;  2DIU A;  2ASL A;  3FEX B;  4OYM A;  2KXF A;  3OXG A;  3V6D A;  2FQQ B;  2RQ4 A;  4NA1 A;  4OFZ A;  2R2T A;  2V69 A;  3WX8 A;  2XLK A;  4DL7 A;  2YQ3 A;  1NDK A;  2NZ4 A;  1NDP A;  4MH8 A;  4WTO B;  4LF2 A;  5HVG A;  1NSK L;  5J2P A;  2Y1J A;  1S1X A;  4HTI A;  4F02 A;  1NHU A;  1KD1 T;  1ACM B;  2RUS A;  3TX0 A;  3WC0 A;  3DOM B;  2MQO A;  1DLO A;  2CPD A;  1R3N A;  3T5L A;  3FC9 A;  1LW0 B;  2HQF A;  4DSK A;  2EEY A;  5RUB A;  3KWM A;  5IC6 B;  1JLQ B;  1FRM A;  4WYL A;  1QUP A;  2MKJ A;  1Z4U A;  4I6A A;  4WFB Q;  1CS4 A;  4CLZ A;  2QFJ A;  2OPR A;  3FQK A;  4PAA A;  3CCM S;  2FD2 A;  4A47 A;  4O4G A;  4ES2 A;  4LF4 F;  1GH8 A;  3W9H A;  3F56 A;  3PNI A;  1TFW A;  2VOP A;  1U25 A;  1H2T Z;  2PSZ A;  1HYS B;  4KR0 B;  3FKB A;  2V2K A;  2LCW A;  3M2U A;  2A2C A;  3CMQ A;  2W9C B;  5T14 A;  2ZNY A;  3FBC A;  1PC5 A;  2RNE A;  4LFC F;  4RU2 A;  4PKD B;  2HHU A;  4FBU A;  2M8D B;  1S5Z A;  4D3H A;  2R7Q A;  2DO0 A;  1IBL J;  4DV7 F;  3O8W A;  3MPD A;  1FXL A;  1GMW D;  1JJ2 R;  4EBE A;  2IRX A;  2ACY A;  3L7O A;  2VON A;  4IFV B;  3FDS A;  3QQC D;  1RDR A;  3KHR A;  2W8L A;  1Q8L A;  1FX4 A;  2JOQ A;  1RTI A;  5HMY A;  2VHG A;  1P1T A;  4URG A;  3AA9 A;  3IRX A;  3ILJ A;  4FS2 A;  4K2J A;  5CXT A;  4CO4 A;  3MM6 B;  3ZZY A;  4K4U A;  2BRK A;  4E98 A;  1CBK A;  1AXQ A;  3P3D A;  1R27 B;  3JTN A;  5HK4 A;  5J2N A;  2F8E X;  5B0C A;  3OLB A;  2AGP A;  1Q4R A;  1NAQ A;  1BGX T;  3M8P B;  2QLB B;  4UF4 A;  1BQM B;  1FXR A;  4LSL A;  3PW7 A;  2OTL S;  4URS A;  3FJ2 A;  3FNN A;  1RAE B;  2XYP B;  1QE1 B;  2YKM B;  3PRB A;  4OYO A;  4L72 B;  4JYA F;  3B4M A;  1NKB A;  2KJW A;  3FGV A;  1U8S A;  3MCO A;  3DYA A;  3DKD A;  3GWC A;  1R8B A;  3KLF A;  1R0A A;  4PPZ A;  1BE4 A;  3I31 A;  2XCA A;  2AMC B;  4C8L A;  3EXC X;  2J9C A;  3M6X A;  3PEH A;  1JJC B;  2V63 A;  4L73 A;  1RK8 A;  2B9E A;  2JEJ A;  4NA2 A;  2E9Z A;  3CCQ S;  4WTY A;  3MM9 B;  1IXK A;  3OXL A;  1RHU B;  3N6N A;  4DL5 A;  1QD1 A;  2KM8 B;  3KG0 A;  3ENW A;  2I0X A;  2LA6 A;  1S1V B;  2ADB A;  1RT5 A;  4KB7 A;  4HT7 A;  2DEI A;  3R5A A;  4I7F A;  4M95 A;  2J0S D;  2Z30 B;  4LBH A;  1PBA A;  4DX6 A;  4X64 J;  5K8M A;  4TY9 A;  1NPR A;  3DMJ B;  1IKV A;  2DGS A;  4DV7 J;  1YK9 A;  4DV5 J;  2XZD B;  2HVH A;  2DRD A;  2VBW A;  3M6W A;  4ZIT A;  2OPQ B;  5EX0 A;  1H73 A;  2Q6B A;  3C6T A;  5GAE U;  3TJA A;  4MIB A;  2M4M A;  3QGH A;  3CJQ A;  3LF0 A;  1EQ0 A;  4CIO A;  3NMR A;  4QIW D;  4QBU A;  3I32 A;  1G7C B;  1RBA A;  3W2W A;  2EVZ A;  2R7W A;  3CJ5 A;  1D9A A;  2V8V A;  4HAC A;  2GX8 A;  2WAQ D;  2L9N A;  1VQK S;  1WC1 A;  3SEO A;  2ATC B;  5KFD A;  4TU9 A;  1URN A;  3Q8S B;  3WDO A;  1HBU A;  1HHQ A;  4TY8 B;  3LW5 C;  4H4K C;  3MPY A;  1S1W B;  4LUB A;  1T9X A;  4DV3 J;  4JI1 J;  1DTT B;  2F63 A;  3UR3 C;  5ETN A;  1S72 S;  2NQP A;  3K17 A;  3TVK A;  4QWD A;  1EX8 A;  3K8W A;  3NNH A;  4WFA Q;  3EPG A;  4OZ3 A;  2NRE A;  2XMV A;  3QZ8 A;  1WG5 A;  2CQ0 A;  2V68 A;  3KHL A;  4DFP A;  2EFO A;  1OQ6 A;  4X4O A;  3NNC A;  4I2Q A;  1S99 A;  3SFU A;  4IUF A;  3ETO A;  2W2P P;  2ZH3 A;  3CTR A;  3OL8 A;  2CG8 A;  2ZOM A;  3PY8 A;  2OUG A;  1HI0 P;  3P5T L;  4AQY J;  1T3O A;  3OVB A;  2BMB A;  4USJ C;  4TNO A;  4UUX A;  2HND A;  3Q8P B;  1IWG A;  1VQO S;  1U45 A;  4Y2I A;  2J7W A;  2B9X A;  3LGN A;  3AQO A;  4CNY A;  1UCN A;  2ZKT A;  3SDE B;  1IBM F;  4EO6 A;  2X3G A;  4EI2 A;  5J1P A;  1X9W A;  3ZXW A;  3T5J A;  4QWA A;  3MR7 A;  3GJS B;  3JQJ A;  1HMV B;  3KTQ A;  3GSI A;  3Q24 A;  1E6Y A;  1SV5 A;  2VPY B;  2DNM A;  4K4Y A;  2BVZ A;  2V8G A;  1IVZ A;  2Z2Z A;  1TV6 A;  2VFU A;  2DK2 A;  1F5B A;  2E7V A;  5KG4 A;  1NXI A;  1FRJ A;  2BUN A;  3I82 A;  1RI7 A;  2E5I A;  5SZT A;  1HNZ F;  3A8K A;  3CDB A;  3KK1 A;  4OJG A;  5KFR A;  3ELH A;  1X7V A;  5DRK A;  4CLY A;  1T05 A;  1XER A;  1V5V A;  3MOJ B;  1JKH A;  3G96 A;  1KLM A;  4CM0 A;  2ZWO A;  3E2E A;  2DIS A;  4R5P A;  1RUS A;  1NRK A;  5FLX U;  2IRU A;  3SYZ A;  2HS3 A;  1RTZ A;  2L9D A;  2LQB A;  4PWU A;  2C2R A;  2YWW A;  2UUA J;  3DOL A;  1FJ7 A;  2B7B B;  4QU7 A;  2L41 A;  4J5O A;  1C0T B;  1SC3 B;  1TFY A;  2FIU A;  3ILL A;  2B3T B;  2E7W A;  2P8I A;  5KT7 A;  4U67 Q;  1YGY A;  4DPW A;  4NLD A;  3NS6 A;  2R9L A;  5A0Y A;  3L09 A;  2YWE A;  2D3O 1;  3LPY A;  4NCB A;  5MAO A;  2V2V A;  4DPO A;  5J1E B;  2IDE A;  3M8Z A;  3F41 A;  4L76 A;  3DRR B;  4DN0 A;  3DRP A;  4B02 A;  2HFV A;  3G6Y A;  2JHE A;  1XR7 A;  5KT2 A;  3KLG B;  1HNW J;  2KYX A;  1S76 D;  4LRD A;  2IBK A;  4NI2 A;  3BF4 A;  4ECY A;  2XI3 A;  2XY6 A;  2G1H A;  3QSI A;  3RAQ A;  3NLC A;  5HRO A;  2D3O R;  2RF2 B;  4FDF A;  3OFE A;  5IT4 A;  2L3M A;  1RT3 A;  2HRT A;  3VTI A;  3GR0 A;  3CME S;  4GKK J;  4ZVT B;  5B0D A;  2ZBP A;  3AXM A;  3BYP A;  1SI9 A;  1U26 A;  4N8O A;  3VZI A;  4LF8 J;  1TQL A;  5B0B A;  2HFN A;  2VQE J;  1AW0 A;  1UEK A;  3G6V A;  1YJR A;  4HYK A;  4DXL A;  2ERR A;  4Y65 A;  3D0G E;  2JNJ A;  2GVD B;  2LXU A;  3NG8 A;  3ILO A;  4X62 J;  3FUY A;  4UZC A;  2QX0 A;  2PA3 A;  1JXV A;  1MWY A;  2B7C B;  3ETM A;  5CH7 B;  2R7X A;  2BKN A;  2OKQ A;  3AOC A;  3QMQ A;  2LKZ A;  2J76 E;  1N4L A;  1GMU A;  2FHJ A;  3NGU A;  2UXB F;  4HTJ A;  3CXC R;  2C3P A;  4R8U A;  3R2D J;  1HPZ A;  1WEX A;  2VZ9 A;  4IOC Q;  3GU0 A;  3PKY A;  2ATL A;  2EKY A;  1JNZ B;  6FD1 A;  3IR7 B;  4DPU A;  2COL A;  2F7V A;  2ZJR Q;  5DS7 A;  1HHT P;  3MHY A;  3IN5 A;  3SSQ A;  1S6O A;  2Y3Y A;  4O3Q A;  1FRX A;  4H4M B;  4DV0 J;  4MK8 A;  3LP2 A;  2MLZ A;  1G2E A;  1XMQ F;  3CD6 S;  3VZH A;  3G82 B;  1QDU B;  4DSJ A;  4G1Q B;  4OX6 A;  1UW9 A;  4CP5 A;  3KJN B;  1TKD A;  2YNI B;  5B0G A;  2YQ1 A;  1EET A;  3BDE A;  3QLH A;  5HQM A;  1ZH5 A;  3BN7 A;  1U1Q A;  5BYS A;  3OR2 B;  4QR1 A;  1MWZ A;  2WTF A;  4HKQ A;  2DR5 A;  4ILM A;  1KR4 A;  4TQS A;  2ZH8 A;  3TZX A;  4ZJO A;  4IDK B;  3SQG A;  3V6K A;  2H4W B;  4F0H A;  3JS9 A;  3AFG A;  3HVT A;  3M30 A;  2BJ3 A;  4FYY B;  5T41 A;  3VR1 A;  3VGT A;  1KSP A;  3PO4 A;  1Z1Z A;  2RRB A;  3JQK A;  2J8A A;  1X9M A;  3TUP A;  3HFZ B;  3FMW A;  1K9M T;  3CVK A;  2L48 A;  2GW8 A;  2QSF A;  3T6J A;  4ZHR B;  3RR7 A;  1R89 A;  2CNO B;  4ZN1 A;  1QAJ A;  1F2H A;  1HBN B;  3TZZ A;  1ZAV A;  2WBR A;  2Q66 A;  3CCU S;  1JLC B;  4RUA A;  1CVJ A;  2VOD A;  3GYN A;  3GSD A;  5DET A;  3J7Z T;  5K8N A;  2ZBR A;  1IBK F;  4KFB B;  1UEV A;  2C3U A;  4CLU A;  1HQU A;  3GJQ B;  5A76 A;  3QAU A;  2OFH X;  2VG7 B;  1Y0H A;  3QRR A;  1XJW B;  2M88 A;  2M3D A;  5ETK A;  1RTH B;  3FRZ A;  3PJW A;  3LTO A;  4QIE A;  2E44 A;  5HVF A;  3CD0 A;  4M5L A;  1HLW A;  4ZP7 A;  1U6B A;  3TZW A;  2ROE A;  3P45 B;  1ZET A;  2AJ1 A;  1SL0 A;  2RDJ A;  3FQL A;  2ZEJ A;  1ULR A;  5IV4 A;  3KLH B;  4KH1 B;  5LXR A;  3HXM A;  2KFZ A;  1KFD A;  5GME A;  2VC1 A;  1IWA A;  9ATC B;  1VRT B;  2WVD A;  2MQQ A;  1H2U X;  1RQ0 A;  3UR0 A;  2R4F A;  3H5X A;  1SJR A;  3VAM A;  2DY9 A;  5AE3 A;  2VBX A;  4O3N A;  2B4O A;  1YQH A;  3NGD A;  3V4M A;  1VRU A;  4YHH F;  2XC9 A;  3UPF A;  2MYF A;  3MUM P;  3N5F A;  4OV1 A;  1VOM A;  3H2V E;  2B43 A;  1YZ6 A;  4FF4 A;  2ZOG A;  3SCJ E;  1S9G A;  3D3C J;  1F2G A;  5E3C A;  2R7O A;  2HQI A;  3QNW B;  2P9G A;  5DQI A;  4KHP J;  2ASJ A;  5KFU A;  5DQH A;  3OSN A;  4JI8 F;  5C42 A;  5J2M B;  3HF5 A;  2FVS A;  4M5K A;  4ZA1 A;  1UP1 A;  1H6K X;  3PW4 A;  3MAA B;  2M2B A;  3VV2 B;  1X5P A;  2DR8 A;  3DLJ A;  2EC2 A;  1M5S A;  3SQO P;  4KYZ A;  1NUE A;  3W65 A;  3TA1 A;  3CCJ S;  2RKI A;  2DGO A;  2VPX B;  4Q43 A;  2F9D A;  1ZZN A;  3BH6 B;  3LH2 S;  1JLA B;  4C9D A;  1RWN B;  2YNG B;  2HWH A;  5I42 A;  4JBC A;  3M8Y A;  4IFY A;  1OIA A;  1P1L A;  2RHS B;  2F65 A;  1GAO A;  4G3I A;  1NZA A;  3DGP A;  1Y9O A;  5KFS A;  4F25 A;  2ZHO A;  5DG9 A;  1NH8 A;  2HFO A;  4OYW A;  2J6S A;  3MCS A;  1S7H A;  3N6L A;  2BE7 D;  4I0W A;  4B3R F;  1OSC A;  3EZ5 A;  1CJK A;  1P8G A;  1YJ7 A;  2I2Y A;  2VUG A;  4BC9 A;  1NM2 A;  3CJ0 A;  2ZHB A;  3BSA A;  3MR2 A;  2DGW A;  3J7A N;  3HVW A;  3EVM A;  1Y7P A;  4AFF A;  1SKS A;  2PA8 D;  1AZS A;  2B5J A;  3CJ8 A;  1BHN A;  3E8O A;  1VHF A;  2RB7 A;  1JLF A;  4ELV A;  3C15 B;  1B0V A;  1TKT A;  4JV5 J;  1RT1 A;  1UMJ A;  3A13 A;  4Q45 A;  1BD6 A;  1U49 A;  3NP5 A;  4YHH J;  3OBI A;  3GIL A;  4ID5 A;  3FFI B;  3BQ2 A;  2JEI A;  1U0H B;  2K7J A;  2DHG A;  2HMI A;  1KNZ A;  3IG1 A;  4NYZ A;  1C4C A;  3BO3 A;  3QFW A;  1HNI B;  4I56 A;  5KOW A;  3FMB A;  3P49 B;  3SBM A;  1YG0 A;  1EHW A;  1HWL A;  2NYI A;  5FII A;  1CPZ A;  3QFH A;  5IV3 A;  2FC8 A;  2J7U A;  1KBR A;  3H5Y A;  3MR6 A;  3KFW X;  3DN9 A;  1TK5 A;  3PCO B;  2W2M P;  1UFL A;  3CCV S;  4JV2 A;  4K4V A;  1T0T V;  3DDK A;  5E2Q A;  2R8I A;  3LPE A;  5JUM A;  1EP4 A;  1PCA A;  3QAT A;  1KVI A;  1SKU B;  1Q5V A;  1S1U A;  2MLY A;  3BKU A;  4O0I A;  2ZDO A;  1NK8 A;  2C2E A;  4LF6 F;  4J7C A;  2QG9 B;  2X3D A;  4OLO A;  4C8Z A;  1REV B;  2MKS A;  3H90 A;  2BDP A;  4JB8 B;  1JLQ A;  2QLJ B;  4ZJQ A;  4N77 A;  3HSZ A;  3S8S A;  3GV5 B;  2UVV A;  4LT6 A;  1YBA A;  2V4J B;  1QSS A;  2FVQ A;  5A2Q U;  4QWC A;  3PG9 A;  2O5D A;  2J6T A;  2BE9 B;  1U6Z A;  1HD0 A;  1NEE A;  2QMW A;  3DC2 A;  3NGK A;  4HR2 A;  3O3L A;  1SUQ B;  4FVC A;  4ZLP A;  1WF1 A;  2CJX B;  4FNI A;  4ANC A;  1TKZ B;  2GNK A;  1VFJ A;  4OI6 A;  5B0F A;  3NCQ A;  1T02 A;  3FZ2 A;  3KMQ A;  5AE1 A;  3THT A;  1WKK A;  2XSJ B;  2ZH9 A;  2XYH B;  4YFU A;  1I3O B;  3G9C A;  4QR0 A;  3ZZT A;  4ILL A;  4WKR A;  4IR9 A;  2HHS A;  4B9U A;  5IXU A;  3M1V B;  3PHT A;  5MLC V;  1M5O C;  4RU9 A;  2FLN A;  4ED8 A;  4AXI A;  1UA1 A;  4NAS A;  4RW8 A;  2QEX S;  1VK8 A;  3J7Z 5;  4WP8 A;  2IMW P;  4RBV A;  4DFJ A;  4WP9 A;  3R1H A;  4JI3 J;  2C1E B;  4I69 A;  1TL1 A;  3N0V A;  4MIW A;  3T9Z A;  2AD9 A;  1RBL A;  3QRP A;  4MAK A;  3UDL A;  1NDL A;  2RQM A;  3U27 A;  3S7R A;  4I6W A;  2W8K A;  2X51 A;  1CUL B;  1F5C A;  2YKP A;  1SQE A;  2LU2 A;  4RW4 A;  2AJ2 A;  1MRO A;  3MM6 A;  1SVD A;  3W8P A;  2XM3 A;  2OD6 A;  2KB2 A;  3HZG A;  2NLW A;  1WDD A;  3PTW A;  3T41 A;  3C6U B;  2DB1 A;  2FJX A;  3T3F A;  4F2R A;  3M8P A;  4NX9 A;  1AUS L;  3DDN A;  1Q95 G;  1BQM A;  2W2O P;  5ETL A;  2HWI A;  2X1A A;  1HA1 A;  4DR4 F;  4CCH A;  3AAW B;  4CH1 A;  3O2I A;  3U1N A;  5DDR C;  4UZB A;  1T9V A;  3BPS P;  1S59 A;  2VKR A;  1H72 C;  3TNV A;  4O3O A;  3BQ0 A;  1RXO B;  2HNZ B;  3M8W A;  3CGI A;  2XZW A;  3SSR A;  4A8O A;  3BRE A;  1MLA A;  4BWJ A;  4RW7 B;  1WG4 A;  4OYI A;  1I5O B;  2KVI A;  3ZTS A;  3W63 A;  2CPZ A;  3AY0 A;  2CUY A;  3FSI A;  3SXL A;  3MM7 A;  2YH0 A;  2IYG A;  4K4S A;  2FVC A;  3D67 A;  4YUD A;  4DR7 F;  1ZM2 A;  2KVQ E;  3QJP A;  2AHO B;  3FVY A;  2N3L A;  4N5S A;  3UCG A;  2MQ8 A;  1LWC A;  1FO1 A;  5JMN A;  4B3M F;  5I3P A;  4X4V A;  2IM0 A;  2MSS A;  2EFP A;  4X66 F;  1UVI A;  1VDH A;  4YY3 F;  3DMJ A;  4DR3 J;  3G71 S;  5BR8 J;  2XB2 D;  1ROF A;  2VC0 A;  3DNC A;  5DGB A;  5LOQ A;  4B9T A;  2RH3 A;  3J7Y U;  2HLU A;  2MZS A;  4DUZ J;  4ZVE A;  2ZVI A;  1TP7 A;  2DNY A;  2OPQ A;  2WK4 A;  5KG0 A;  3MXH P;  3RJM B;  3HHN B;  3T1Y F;  4YR2 A;  5LMU F;  3ITH B;  5F41 A;  4XPC A;  3IRW P;  5C25 A;  4UOF A;  4CLT A;  4ERD A;  5F0W A;  3AB4 B;  3E51 A;  1FHT A;  4LIR A;  5EDW A;  1U1K A;  1FES A;  1RWX B;  3O6Q A;  4ED3 A;  2CDR B;  2IC3 A;  4LF7 F;  1FVQ A;  1PSD A;  1LNQ A;  1S1W A;  4P71 A;  1S6Q B;  2ZOF A;  2RS8 A;  1DTT A;  4C0B A;  2ZIT A;  3BO2 A;  4QW8 A;  2MXY A;  4ATN A;  5HN0 A;  2DPJ A;  1Y3K A;  1S57 A;  4Q2L A;  1GMW A;  4GO7 X;  1VQ4 S;  1KFS A;  2OPP B;  5A8K B;  5KFO A;  2QA1 A;  2VB6 A;  1QAY A;  4K5R A;  1RAA B;  3OFF A;  4EBD A;  2WON B;  1UFK A;  2JFD A;  3SCL E;  2J0Q D;  1IR2 A;  4B9M A;  2AJQ A;  2HBZ B;  4EEY A;  1FD2 A;  1T94 A;  2WVE A;  3BB5 A;  2BM0 A;  4UY8 T;  4ZPC A;  2NUH A;  4IG0 B;  4OX8 A;  2KHD A;  1UWA A;  2VD3 A;  5DM7 Q;  3OUY B;  3TWZ A;  2EKN A;  1XR6 A;  4AT1 B;  3AOB A;  2ZNZ A;  2KT2 A;  5F0U A;  4A48 A;  3KMS A;  2IM2 A;  4E2F B;  2MZT A;  2VJU A;  3QT5 A;  1HMV A;  5EGY A;  3AJ2 A;  1JLE B;  2ASY A;  2BQR A;  1DQ8 A;  4Z37 A;  1L3T A;  2VOO A;  3ZFV A;  3M2R A;  4A8S A;  1QVG R;  1UVK A;  3GE9 A;  4L6V 3;  1HR0 J;  3POT A;  2KDO A;  2DH7 A;  2IAJ A;  3FSY A;  1IR0 A;  4LIW A;  4RWW A;  3JTO A;  3MOZ A;  2HHP A;  4EU0 A;  4OMF G;  4P2F A;  4ZCM A;  2DNL A;  4K8R A;  2MY7 A;  1H7X A;  1RTD B;  1Q7Y T;  3K5P A;  4QWE A;  2CPH A;  3IMQ J;  3CUN A;  2XS2 A;  1FX2 A;  1B0T A;  4ZVU B;  2E5L F;  4RW9 B;  4X4U A;  3CIZ A;  3Q89 A;  1UPM B;  4NCG A;  2JX2 A;  5T7L A;  4M5G A;  4CM2 A;  3IBC B;  1R8P A;  4RW6 B;  2ZH1 A;  3W9J A;  2J9E A;  3IS9 B;  4K4X A;  3MGJ A;  5J1E A;  3BZQ A;  2FGC A;  1S4E A;  1JK9 B;  4NRU A;  4FF1 A;  4FYX B;  3M32 B;  1LV5 A;  2ZBC A;  3J7A 1;  3Q8U A;  1B3T A;  3AXK A;  4U8V A;  3RB4 A;  2BKP A;  1QAX A;  5JXS A;  2AGQ A;  2ZM6 J;  3L7P A;  5L9N A;  3R5J B;  4C6A A;  1AYE A;  4P52 A;  3T5K A;  1HW8 A;  1D9F A;  1N0V C;  3R7S B;  1I94 F;  4J37 A;  2R2U A;  1K1Q A;  2YKA A;  1LFP A;  1Y11 A;  4WII A;  5D0E A;  2C42 A;  4B3T J;  3AJ1 A;  2VG5 B;  4DL4 A;  1CJT B;  1FRI A;  4G6V B;  4PUO B;  2CQI A;  4RUC A;  1M1K T;  2N7Y A;  4ZCI A;  4QJV A;  3SCI E;  3HD1 A;  3P5B P;  2JEF A;  1WDT A;  2G1D A;  3I4H X;  1R31 A;  1Q8I A;  1TUW A;  3L7U A;  2H51 B;  4L75 A;  2IYI A;  1PYT A;  5K14 A;  4PR6 A;  3VAF A;  4KRW A;  3KUG A;  4RNM A;  5EWF A;  4J9M A;  2Q3P A;  1O6X A;  2POK A;  1AT1 B;  4GVB B;  1U8W A;  3RBZ A;  2BW2 A;  2KTQ A;  2GJ2 A;  1RWV B;  1C1B A;  3H0P A;  5D8H B;  2QA2 A;  2DGV A;  1VQP S;  4FKX A;  2RQK A;  3NXZ A;  1C0U B;  3MUV P;  2PGC A;  2J0W A;  1XNR F;  4A8F A;  1V9O A;  2W7O A;  4F3Q A;  1HD1 A;  1FKP A;  3TX8 A;  4TYA A;  3PW2 A;  4P2M A;  5KT4 A;  5KFC A;  4A4J A;  2W01 A;  4ICL A;  4I2P A;  1OMS A;  2WSC C;  3M8S A;  1QVF R;  1GXL A;  1NK0 A;  2FJE B;  4XTT A;  3OV7 A;  4YB7 A;  1Q81 T;  1L3K A;  4LR9 A;  2QT7 A;  3BBF A;  5E41 A;  3BH7 B;  5BYQ A;  4DDF A;  5L1L A;  1Q53 A;  2VG6 B;  4P2X A;  1N54 B;  1RT2 B;  1Q8K A;  1APS A;  3VAJ A;  1X9S A;  1T95 A;  5HAN A;  3NRB A;  4NCA A;  3MZI A;  4ZLJ A;  1FDA A;  3R5C A;  1RLD A;  2LU1 A;  3NGR A;  2XTJ P;  3MF5 A;  4MK7 A;  5ETS A;  2V9K A;  2CQB A;  1J5E F;  1N6Q B;  1WOO A;  4DEZ A;  2NXJ A;  3VCD A;  2JVO A;  1TK0 A;  1N5Q A;  1NBE B;  4ZHR A;  3DLG B;  4F0M A;  3VAH A;  4OZ2 A;  5IM0 B;  1HBN A;  3BBB A;  5GAE I;  3GV7 B;  3F73 A;  4P2S A;  5KFX A;  1SIW B;  1FJE B;  4EWT A;  2N4C A;  3G8T A;  2R3V A;  3K5N A;  1WOS A;  3ILI A;  1ZM3 A;  4KFB A;  3ENQ A;  4ZK7 M;  1GK8 A;  4X84 A;  4PG7 A;  2DTJ A;  4DN9 A;  1GTE A;  2HHH F;  2HQD A;  3Q2S C;  3H40 A;  5EN1 A;  1RTH A;  4K7Q A;  3UFC X;  2F5G A;  2XMW A;  3DRX A;  2Y8Y A;  4Y6I A;  3LP1 B;  3S01 A;  3MD3 A;  3HJV A;  5BYR A;  3K58 A;  1Q7L B;  4O44 A;  4NZ0 A;  4UY8 5;  1VLO A;  4NMX A;  2KO1 A;  2HBY B;  3D6H B;  3SMZ A;  2YX4 A;  2V5H G;  3M9M B;  5B0A A;  1VRT A;  2ZD1 B;  4QU6 A;  4G65 A;  3MED B;  1RHQ B;  4JI2 J;  1N36 J;  2MPU A;  1B7F A;  2QC3 A;  2CWK A;  4B17 A;  1SC1 B;  2Z58 B;  2WVC A;  1DQ9 A;  2HBR B;  5EWE A;  3JAM Y;  3I55 S;  5IWA J;  4L74 A;  1R8A A;  3IAS 9;  3HM9 A;  1HBO A;  4OI4 A;  4Q8E A;  4EZ9 A;  1N33 F;  2LXI A;  2VAS A;  2FVP A;  4LFA F;  5I3U B;  1R8C A;  1YJW S;  2HZC A;  4BBY A;  4N7T A;  1N32 J;  2V4Q A;  2YNF A;  4K4Z A;  4RUH A;  3EGN A;  3BN4 A;  4TKT A;  3OFH A;  2OEL A;  4M5I A;  3CJK B;  2FDN A;  1S7I A;  5J2M A;  2MGZ A;  3MUT P;  4NLT A;  1N34 F;  3MMC A;  1V5I B;  2BBE A;  2QYC A;  3IWL A;  4DV2 F;  1KQS R;  3ET6 B;  3IGV A;  1J5E J;  3K8V A;  2ZH7 A;  1Q82 T;  5C2C A;  4J9S A;  2XMM A;  3ZC4 A;  4PEO A;  4U8Y A;  1Q8B A;  3QJJ A;  3PJ9 A;  4C3K A;  1MML A;  3VAG A;  4IKA A;  1S6U A;  4GMK A;  3H5U A;  1JLA A;  3QO9 A;  3T1H J;  3CWJ A;  2YNG A;  4EBC A;  2QGF B;  1RT6 A;  2G2Y A;  2YH1 A;  4J91 A;  3R6L B;  4K2X A;  4NLP A;  2JEG A;  5ETV A;  3ISN C;  4M5D B;  7FD1 A;  4DQP A;  4ECS A;  2CVE A;  3UCU P;  4P7V A;  3KOA A;  1GX6 A;  2UV8 A;  2LEA A;  3QYY A;  3MI7 X;  3TUJ C;  1F3F A;  2LP4 A;  2ZE2 A;  1T8E A;  4EK2 A;  5H9E J;  2HHH J;  4R25 A;  1K0T A;  3DHW C;  5ETO A;  5H1S V;  1EKS A;  4X4Q A;  4QOT A;  2XUL A;  2VFT A;  2R8J A;  4ANE A;  4WU3 A;  1IKW B;  3UN3 A;  4QQB A;  2Z8Q A;  4X2B A;  1T7P A;  3S6E A;  4ZCL A;  1RAF B;  2B51 A;  4JV1 A;  3G2X A;  1CG2 A;  3UVJ B;  2ZZN A;  2UXC F;  1RB0 A;  4IH5 A;  3I0R B;  2KFN A;  1EAY C;  2V34 A;  1FFW B;  2D9O A;  3A4T A;  4PCQ A;  5D3G B;  2PEH A;  3GLJ A;  2JLF A;  4DU8 A;  3GQC A;  1WEL A;  1EKR A;  2UZA A;  3MM5 B;  1CJU B;  4V1A k; 
#chains in the Genus database with same CATH homology
 3R6L B;  1RWO B;  2C1E B;  4JB8 B;  4ZVO B;  4DCJ B;  2QLJ B;  1RWN B;  2P2C B;  2QL7 B;  4ZVT B;  2H65 B;  3IBF B;  2CNO B;  3EDQ B;  3IBC B;  1RWX B;  3GJT B;  1QDU B;  1ICE B;  2CDR B;  1BMQ B;  2C2O B;  5IC6 B;  2XYG B;  1RHR B;  2H51 B;  2HBQ B;  3D6F B;  2C2K B;  2CJX B;  1QTN B;  4DCO B;  3R7N B;  3KJN B;  2XZT B;  1SC3 B;  2DKO B;  2QL9 B;  2H5I B;  3GJS B;  5K20 B;  1RWK B;  1RHU B;  1NME B;  3GJQ B;  4ZVP B;  4LSZ B;  3P4U B;  1PYO B;  2QLF B;  1RWV B;  1RE1 B;  2H48 B;  3QNW B;  3SIP B;  1RHM B;  2CNK B;  2HBY B;  2C2M B;  2XYH B;  3D6H B;  2CNN B;  4ZVR B;  1F9E B;  1I3O B;  1I51 B;  3R6G B;  1RHJ B;  2C2Z B;  1RWM B;  3R5J B;  2H4W B;  1PAU B;  2Y0B B;  3D6M B;  2QLB B;  1GFW B;  5IC4 B;  2FQQ B;  1RHK B;  4ZVS B;  3P45 B;  2Y1L B;  2QL5 B;  2H54 B;  3R7B B;  2H5J B;  2HBZ B;  3R7S B;  4DCP B;  1RHQ B;  2H4Y B;  3GJR B;  1SC4 B;  3KJQ B;  1SC1 B;  3KJF B;  1RWP B;  2XYP B;  4ZVQ B;  1IBC B;  1RWW B;  3RJM B;  2CNL B;  4ZVU B;  2HBR B;  3NS7 B;  3EDR B;  2XZD B;  2CJY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...