1RWVB

Crystal structure of human caspase-1 in complex with 5-[5-(1-carboxymethyl-2-oxo-propylcarbamoyl)-5-phenyl-pentylsulfamoyl]-2-hydroxy-benzoic acid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Caspase-1 Inhibitors Discovered Using Tethering(SM) with Extenders
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwvB00
1SC3B 1PAUB 1RWVB 4ZVUB 2HBQB 3KJFB 1RHJB 4ZVTB 2Y0BB 3EDRB 2CNLB 2QL7B 2XYHB 2XYGB 3R7BB 2H5JB 4LSZB 2HBYB 2HBZB 1RE1B 2H65B 2H48B 1RHQB 1RHRB 2CDRB 3P45B 3R6GB 1I3OB 4ZVPB 2QLJB 2H54B 4JB8B 1RHKB 2DKOB 1RHUB 1F9EB 3R7NB 1NMEB 2H51B 1RWPB 1IBCB 4DCJB 4ZVSB 2QL9B 3KJNB 2XZDB 1SC4B 3GJTB 3IBCB 3R7SB 2C2MB 2C2KB 1RWNB 3GJRB 2QLFB 3D6FB 3R5JB 1RWXB 3NS7B 2H5IB 1SC1B 1RHMB 2CNNB 1RWWB 3D6HB 1GFWB 3EDQB 5IC6B 3SIPB 3IBFB 1RWOB 3QNWB 1RWMB 1BMQB 2H4WB 2C2ZB 2XZTB 3KJQB 2P2CB 1QTNB 2CNKB 4DCPB 2H4YB 3P4UB 2CNOB 2CJYB 2Y1LB 2C1EB 1PYOB 3R6LB 3RJMB 3GJQB 3GJSB 1ICEB 2QLBB 1I51B 1QDUB 5IC4B 2HBRB 2QL5B 3D6MB 2C2OB 1RWKB 4DCOB 5K20B 4ZVRB 4ZVOB 2XYPB 4ZVQB 2FQQB 2CJXB
chains in the Genus database with same CATH superfamily
3UFCX 9RUBA 3SCIE 5CZVA 2HQDA 4LRAA 4ERDA 1HNXJ 4USUA 4KC5A 2R2UA 2K7JA 2KT5A 3JSYA 1GK8A 5B0GA 3V4IA 3CJTA 4OMFG 4QR1A 4ZVTB 3OTDA 3PY8A 5LL6d 1SH2A 2LYVA 2QLXA 5J1EA 4F4YA 4K0KJ 2NCKL 4OYXA 1Q95G 1FKPA 3PKYA 4LSZB 4DU7A 3V6DB 3BF4A 3HFVA 2P6SA 2QT7A 2V2VA 2X51A 3EGVA 3MM7A 4LRBA 2VG6A 2PFDA 2YH1A 1S9FA 3LWLA 4KFBB 1QUVA 1NK9A 1VRTA 1YHQS 5HVFA 3W61A 2BZ2A 2D41A 1KOOA 1JLFA 2GAHC 3QGGA 6AT1B 5DQGA 3BO3A 1FRIA 3I0RA 3QWUA 1T03B 3SZ2A 3U7JA 1RSCA 5HJYA 1V5IB 2IMWP 2DEJA 5KFSA 3N6LA 2HRYA 4BC9A 1HPZB 3FMBA 4DSFA 2ATCB 2XNQA 3NMAA 3PW0A 1L3TA 1CG2A 4X4UA 5D4PA 4CTAA 2E1PA 4I7FB 5F0WA 3OTOJ 3OR2B 2B9XA 4NLYA 3OPKA 3MTJA 1JLAB 2OEKA 2RU9A 1D3WA 4RW8B 3CPWR 5FD1A 4CT9A 4K0KF 1S7HA 3IBCB 5HO4A 1QSSA 4FS2A 4OI4A 2UV8A 4GC7A 1VQNS 3GJRB 4DQSA 2DHAA 4RW4B 3HX9A 4USJC 1U45A 1DFDA 1FFWB 1JLBB 2EK6A 1SC1B 3FVYA 4J9NA 2J6SA 2ACYA 2DGWA 5KT3A 4LF8J 1EB0A 3PRVA 4Q0BB 1MMLA 2QA2A 2CQ4A 1XWLA 1JLEB 1KDNA 2N4CA 2IYGA 2KZZA 4M8LA 4CZCA 3SV4A 1N52B 1SQEA 1JNZB 1TL1B 1TQLA 2MJUA 4I6YA 2ZH8A 3FK4A 2OJ3A 2ILZA 2HVIA 2A6OA 3OFHA 1LW2B 5I3UA 4IFVB 3X3UA 1REGX 1FF2A 2GQCA 2W24A 3CD0A 3GIIA 1RTDA 1LKZA 1RJJA 3NLCA 1GXTA 4F8RA 1M5OC 4KFBA 2AMCB 4QWAA 1FJEB 1VRTB 1X5TA 2EPIA 1LXJA 4LT6A 3EUNA 5DJBA 4CRJA 1AXQA 4DCPB 4JI7F 1PAEX 5B0BA 3BS9A 3OD2A 4LFCF 3CC7S 2V94A 2XHWA 3AB2B 4NI2A 2KHCA 3ZTOA 4IO9Q 3Q23A 2RSQA 2Q66A 3ZC4A 1KVKA 4TXSA 2IAJA 1AB8A 1QLNA 1JB0C 1Q8IA 4GKKJ 1YBUA 2JWNA 2KG1A 3M8QB 4LBIA 2HHQA 3C66A 2AHOB 1QDUB 1UJ4A 2WVEA 2VQEF 1AT1B 1OYEA 3OUYA 3FCHA 2XO7A 3MR5A 4ZP8A 1B0VA 3TZYA 3NWGA 4GO5X 1TZ0A 3W9JA 5HMWA 3OT9A 4QR0A 2R3VA 2Z0GA 4ZJOA 4NZ0A 2RQCA 1KLMA 1ROFA 2GQQA 2FD2A 4IKAA 4RW7B 4ZVRB 2RS2A 3PX4A 1WTFA 4JOUA 2VFSA 3ET6B 4OJ1A 2YPYA 5HLFA 2XYPB 4IOAQ 4EZ6A 1R3NA 2AT1B 4C8ZA 3LO3A 3E51A 1REVB 1G7CB 3HSGA 3CCUS 2R8HA 1UL3A 1EQMA 1OY6A 3Q8SB 1ZPVA 2HNDA 1R0AA 3C14B 2DY1A 2ZUAA 2VBWA 1IKXA 3DOKB 1NJIT 1FEEA 1S76D 3DM2B 3TEGA 1VQ4S 4TN2A 1Q5YA 2BJ1A 2F4VJ 5AE1A 3IAM9 4FF2A 3RZAA 4LF6F 3TX8A 4ZN3A 2B4VA 2Q3PA 3SCJE 3OFEA 1DJ0A 3BSCA 3R7BB 5KG3A 4W4MA 1WEYA 3GONA 5KFMA 3MOZA 2GQ2A 2GIQA 4KGVB 4KO0A 3ZTSA 3QQCD 3HO1A 1PCAA 1X5OA 2B3TB 2BBEA 2EG2A 1ZM4A 3FQKA 2KXFA 4HI1A 3TA2A 3KMSA 3EX7B 3BGRA 4ED3A 5IT4A 2HQIA 2NLWA 1MU2A 2IM0A 1UVKA 1NDLA 2YWHA 2D3UA 1S48A 2V8PA 3JTNA 3MEGB 3R5AA 5LJ3Y 3MPYA 3HVTB 1GXUA 3PDNA 3CJ8A 3LUYA 4H4OB 4IG3A 5KFUA 3PW5A 3N28A 3VV2B 4YDXA 3VGVA 1U2FA 1GMWD 3Q8VA 4CLSA 2J0WA 3SQGB 1HHSA 1RBOB 1TL5A 4OZ2A 4USKA 1WI8A 3W64A 1JIHA 4PG6A 3JSRA 5E3AA 2FJEB 1FWPA 3NP5A 4OZ5A 3W65A 4PYDA 3AA8A 1IBCB 3TOQA 4D3GA 3AHPA 1N5TA 2IVYA 1RK8A 3AD7C 3B54A 5B0FA 1HYSA 2W8KA 3MPWA 4R5PA 1NCLA 4ZVGA 2ZZTA 3M6XA 4RBVA 2R7XA 3KHRA 1NH8A 2C2MB 2R42A 3PKMA 3TARA 1P9YA 4F4WA 3AB4B 2XLIA 3MCMA 1NSQA 4R25A 4ED5A 3D6FB 4O3SA 1I5OB 2UZAA 1FCAA 3I4HX 4RKUC 1KQFB 3W2WA 4NZ7A 4K4XA 1OO0B 4I67A 2IPOB 2JRSA 3C46A 2DIVA 4OLPA 4TU8A 3R2CJ 1L3UA 1TAQA 3UR0A 2F7VA 4EEYA 1RTHA 3VAJA 3QZ8A 5K5MA 2DVIA 2XMVA 2YWEA 3BB5A 4HHHA 4NLOA 1B99A 3PW4A 5F8NA 3RG6A 3IWLA 5K8OA 3ONQA 5KFCA 4Q5VA 1CVJA 1NHVA 1T11A 1KQKA 1WSRA 4M5GA 2KFYA 1GTEA 1TVRB 1J5EJ 4DUYJ 4C8LA 2H3EB 1JLQA 1DTTB 1LW2A 2DNLA 3CGIA 3IBFB 5I3UB 1MMNA 2ADBA 3VQTA 2XGQA 3RR7A 4LIWA 4L76A 1RAAB 3EVOA 4PWUA 2HGLA 5T7LB 5KFTA 1XMOJ 1H73A 5F8HA 2CZ9A 3QFWA 4RW9A 1R8BA 3BBBA 2GX8A 1TL1A 5HMYA 4ILLA 4KHPJ 5J2QA 4OYPA 5BYSA 8ATCB 4F50A 5B0EA 4PPDA 3UVJA 3IFEA 5KG7A 2QA1A 4U95A 2VBZA 3AXMA 4N47A 1Y4ZB 4A47A 2RDJA 4CYUB 2VHGA 3CMES 4V19X 3FDSA 1TL4A 4IDKA 3VHQA 4C98A 1PYOB 3VAIA 8AT1B 2M0GB 5C7PA 4WKYA 2V34A 3NRBA 1H2VZ 3M32A 3MFHA 2B9EA 1IBLF 4IR1A 4KGZB 1F3FA 5A0YA 1PG5B 3MUMP 1RT7B 1HWLA 5HI7A 1NKEA 4P52A 3G8QA 4EZ9A 3KOAA 3C3LA 5HMZA 2ZKUA 4X65J 2BQRA 2AYBA 2BE2A 5KT6A 3K58A 4K2XA 5E3CA 4F25A 4J91A 4URGA 5GMDA 5E41A 2ZZMA 2VFUA 1KLMB 4FYXB 2M2BA 1HPZA 2OPQA 4ZVOB 4J90A 4J9UE 4RW9B 3G6VA 2YQ3A 2DJWA 2F8MA 5FDLB 3R27A 3OFFA 4P75A 3HKWA 3SDEA 2W9BA 2IA6A 1PAUB 2HVEA 4P72A 3MOJB 1HFEL 3UDLA 2OTLS 1B0PA 2BA9A 1SKUB 4ZA1A 2GW8A 2J6UA 1LEOA 1S79A 4QQBA 2AGQA 1TK5A 1UVJA 3SFUA 3HI9A 3FEYB 2MDAA 2NPIA 3NBPB 3F56A 4USMA 5DQHA 4Y0FA 2U2FA 2W2NP 3E01A 2R7TA 1AFIA 1RKJA 2A0FB 1OMSA 3TZXA 1D8YA 4LRFA 2W2MP 3JAMU 1N6QB 3LPYA 2LXFA 4Q8EA 1FVQA 1WHXA 1WORA 2HFOA 2VICA 1QJHA 5CYJA 2DITA 4H4MA 1EETA 1YWXA 3IR7B 2H48B 2A2CA 4MIWA 3M8SA 4TY8A 2BJEA 2F63A 4MKBA 1F60B 1RHRB 3QGPA 4ECVA 4L74A 1FJCA 3P49B 1S1WA 1YLXA 1KTQA 1U0HB 4JB8B 4P9SA 4G3IA 1N56A 2J0QD 2HURA 3GYNA 4DPOA 1C1BB 1A6LA 1RTIB 3UD5A 2CPJA 4LR8A 1WOSA 2HMIA 2X1FA 5EN1A 1WF0A 3WC2A 3KNAA 2BEFA 1R31A 3EVMA 5HVHA 3H25A 2BJ3A 2ZHAA 4C97A 3OL9A 2LKZA 4WP9A 4DV2F 2HFVA 2R9LA 5LMUJ 3CJ0A 3GMGA 4Y00A 4QWEA 1X4AA 5DM7Q 3W2VA 3GJTB 4ZP6A 4JV0A 4X4RA 1U1LA 1FNXH 5HSPA 1D9DA 1K1QA 3B82A 4G1QA 4DPWA 1SH0A 2FHMA 1SIWB 5KFLA 1HNXF 2OIHA 3BSNA 4ZJLA 1PC4A 4X4NA 1NM2A 4FPIA 4ILMA 4B17A 3G4SS 2WCXA 5IV4A 1X31C 3BR8A 4DBQA 1U6BA 1F1BB 3V6JA 3TW0A 3C15B 4P7TA 1HMVB 1LWEB 3HHLD 2LP4A 3SFGA 4A8WA 2V8HA 2IRXA 2QYCA 3DOLB 2PI5A 2AW0A 3E01B 2OFHX 3GIKA 1O6XA 2DO4A 4M5DB 4OX6A 4I56A 1UKUA 1SVDA 1AUDA 3X1LB 2KH9A 3PIOQ 4TKTA 2VH7A 3W9HA 2KN4A 1NDKA 4CH1A 3G8SA 3E2EA 3M4XA 1YG0A 2CG4A 1YRUA 2P2CB 1VJQA 4TY8B 3K7RA 2MJNA 1IKWA 4OYOA 4J9PA 2R8JA 2UXBJ 4ZIWA 2B5JB 4ZPWR 1Q79A 1FDDA 2B9WA 3HHDA 4CTAB 2B51A 2DHHA 2RKIA 1G2EA 1PJ7A 3J81Y 4ED0A 4ITSA 2Z58B 1TUWA 9ATCB 2GHPA 3VZHA 5IWAF 5MAOA 4Z7CA 1DTQB 1NDCA 2IJFA 2B7CB 2EW9A 1IKXB 4Y2MA 2G2YA 4DLGA 1NAQA 3AD9C 1X4EA 5AE3A 1M5SA 2W7OA 5CZXA 4MIBA 4F4ZA 4KSEB 1F6TA 4NLWA 2OMLA 2KTQA 2ZE2B 4RLEA 3CEDA 3Q8RB 2HK3A 5IC4B 2UU9F 1H2UX 3H5XA 4M5DA 2QL5B 3TZZA 4MMOA 2V4JB 4C8MA 1CLFA 4UUWA 2HK2A 3M32B 3I87A 5LSOA 1RWKB 5D77A 3CD7A 2UVWA 3W66A 4JI3F 1Q7LB 5DZ7A 2B43A 3QFHA 4Y2KA 5CYQB 5CH7B 2UUCF 3N79A 1XNQF 4ED6A 5IM0B 4O3QA 3GYGA 4B3TF 4KPCA 3HZGA 3HLUA 3P5BP 2DR7A 1JJCB 2FLLA 3VAKA 3EM1A 4CLKA 3M9MB 3A8EA 2HWHA 3B6BA 4ZPDA 2PGCA 1AZSA 5AXKA 2ZJRQ 3TX0A 1YK9A 3N9UC 1K73T 3CC2S 2Y0BB 2J7UA 1ZM3A 2Z57B 4G65A 5IQ6A 2VOOA 4PPZA 4WWSA 3KK3A 4WFBQ 1T9TA 3QYYA 2L9DA 4KY3A 2JC1A 4K5SA 4I6AA 4HI2A 2V8VA 4B9SA 3CCJS 1VGYA 2AP6A 3DU6A 4ED1A 3Q8QB 3CNQP 5DGAA 2E1CA 2RH3A 3MECA 3ZFVA 4Y2IA 3WHIA 2YH0A 2R8GA 3MCOA 1ZTWA 2W4PA 1UVNA 1S5ZA 1N5SA 4UOCA 4MTPA 4QZVB 4KPYA 1YSJA 3KLFA 1KS2A 4LQ3A 4DXLA 1NBEB 3K89A 1Z1ZA 2M70A 2VASA 2R7VA 4RO0A 4DR5F 2KL8A 1FO1A 1YQHA 2QEXS 2DGVA 1BXNA 1SV5A 2B9YA 1VDHA 4RNMA 4GC6A 3NS5A 3TUZC 2YKMB 4XTTA 3LP1B 4DR3J 3MGJA 4LF9F 4FF4A 2E7VA 4UF4A 2B4PA 2VUGA 4QIGA 5A8WB 3F73A 2VJUA 4IQXA 4ZPAA 2K1RB 3TQEA 2R8KA 3HD1A 3R5DA 1APSA 1T94A 2GHVC 3DYAB 4I2PB 2QA4G 1R6YA 2U1AA 4MIAA 1M5VC 3JTPA 3EVWA 4DJBA 1QSLA 6FDRA 3I56S 1OPZA 5JXSA 4N8NA 5ETLA 1SH3A 5HBMB 3RU0A 4UOHA 2YWWA 3W2WB 2DCLA 2BW7A 2DNQA 2R2TA 3QIPA 1RWXB 4PYAA 2ERRA 2JHEA 3DLGA 2CQ1A 2E5LF 2G4BA 1MROA 3CJKB 2ZM6F 4K4WA 4ES1A 4M5NA 4AXJA 2LCWA 4AXIA 2OEJA 2PA8D 4HVZA 2C2EA 2AJ2A 5ETOA 4J9RA 1RADB 4ES3A 2CNNB 2G2OA 1ULRA 3A3NB 2KYXA 3JQKA 2CQ3A 4ANCA 1HNWJ 2MLZA 5ETSA 4PWWA 1M5HA 1XNQJ 1JKHB 5KG2A 4DR7F 1XR6A 4LF1A 3EDQB 4RL1A 1UZHA 1S12A 1BLUA 4OJ3A 5ITHA 4E2FB 4NX9A 3DLLQ 2XM3A 3W5XA 3MAHA 4M63A 1RAHB 4X4PA 3NL0A 1Z2ZA 2Z2MA 2KT2A 4ECSA 2NUHA 2RF2A 3R5CA 4PABA 2YX4A 4NLQA 2OP5A 2W01A 2HAIA 4ZJQA 1CULA 1R6VA 3J80Y 3BKFA 3G86A 2FVPA 4QWDA 1MU2B 3ZZPA 1FERA 3NWRA 1FWKA 2V2KA 4RJVA 4OYIA 1ACMB 2MQQA 4CYUA 4DL5A 1WTBA 4KR0B 3ILOA 2ASDA 2A6MA 1TFWA 1FA0A 3R6LB 4YHHF 2MKIA 4CQ1A 3DHWC 4M5LA 3H40A 4JI4F 3VAHA 1ICEB 3WZ0A 3D1HA 4J9MA 1Y3JA 4X4SA 1VC6A 4Q2MA 2HHPA 1SCJB 4WK1A 3ZNUA 3M7VA 1I51B 1FXRA 1VFJA 3OLBA 5CCMA 3BR9A 1QVGR 1HNZF 1BQNB 2WOMA 4M95A 1LWFA 3UD3P 1FRKA 1OJ4A 3RRKA 5DDRC 2UVUA 1AFJA 1GX5A 1Q82T 2IYIA 4P6QA 4DG1A 3HMJG 4ENOA 2EBGA 4PQAA 3VAFA 1N33F 2E1MC 2ZZNA 1K44A 1VYAA 1H98A 4A8XA 2KG0A 3MEEA 2L9NA 2R7OA 2X3GA 1CJVA 2MZTA 3DOMB 3QBCA 2W2QP 4FP9A 4ZS6A 4A8QA 3DCAA 4QW8A 4DR2F 3MPVA 2YNFA 1JWWA 3R9LA 4ELVA 3IRWP 1EZZB 3DN9A 5E3RA 5GAGI 3O8WA 4NASA 4NLVA 5D3GA 3MMCA 2BQ3A 3AQPA 5LSLA 5L1LA 1S0MA 4B3OA 2EK1A 4R0JA 4JI2F 2FJBB 4YY3J 1Q0NA 3H5YA 2JVOA 3I55S 2E7XA 4FXVA 1KOHA 2AJ0A 2G1DA 2VC0A 2Y1RI 5MLCV 2CRLA 1XMBA 3FFIB 4DR7J 2NXNA 2Z4PA 3CWJA 1CBKA 4RWWA 3J7ZT 3K8VA 3HJVA 4N56A 1I1GA 4R0EA 1L3VA 1HW8A 1R0CB 3AJ1A 3P45B 4IFYB 4OHXA 1X7VA 3EPIA 3HFZB 1H38A 4X66J 4RUAA 2WSEC 3OR2A 4M5IA 2MHEA 3MM8A 4ALZA 3MEEB 3HSZA 3QGHA 3FBCA 1JJHA 2OO4A 3R7NB 2YNIA 1TKZA 3NOGA 3C15A 1RWPB 3LP1A 3GFZA 3TEHB 2ZUGA 4ANEA 4B3RJ 1NLKL 2HQGA 2D3OR 1E6YB 3N4WA 1Y10A 5B08A 4DV1J 1LWFB 3UCZP 1N32F 3C6UB 1VR6A 3HVWA 4OYMA 3W5YA 3HT3A 1Y0HA 3KDOA 3W63A 2I6WA 2HIQA 3UI3A 5B09A 5HL7Q 2XLKA 4X4QA 4CH7A 1FRJA 4A8OA 4PRFA 4N7TA 5KFYA 3KWMA 3SBMA 2XY5A 4ZCLA 4DL2A 2X1GA 2EC2A 2IJNA 2ZWPA 2KJVA 4OZJA 1LXNA 3C16A 2JNJA 3CJ4A 4RUBA 2WAQD 2AEJA 1WC1A 4NWBA 3Q0AA 2JJ4D 1IR0A 2OPPB 4LFCJ 3LGHA 2I5JB 4F26A 2CFXA 4O44A 3KLGA 2XY6A 3LP0B 2KM8C 4JI5J 3MR6A 1ZOTA 3DXBA 1PKUA 1JK9B 1FT8A 1DARA 2GIFA 2MZJA 2HLTA 3TA0A 4TQRA 3OW2R 2E5JA 2CJQA 3CCZA 3OR1B 3SDEB 2W9BB 1NK7A 2DH9A 4RX6A 4OZNA 4KE5A 4DX6A 3OHAA 2VQFF 1S1WB 3Q2SC 5FLXY 2W8LA 4LF4F 2ZKTA 5ADZA 3QPIA 1F5BA 3TVYA 2VBYA 3UN2A 2DTJA 1UA0A 3QT6A 1JKHA 3KK2A 3ZZTA 1CJKA 1RAIB 3VZIA 1HHQA 2QTWA 5DG7A 1T05A 4EK2A 2E5LJ 2H4YB 3GIMA 2XS2A 1S6QB 4IQMA 1VIXA 1T3OA 3CE8A 2KT3A 1FD8A 1RA6A 2G0CA 2I2YA 1UVMA 4DZDA 4WZMA 3BPSP 3GTYX 1F9HA 1YRXA 3FEZA 3OQ2A 1VJWA 4V1Ak 2HQFA 3RJMB 2RE1A 1C1BA 1EP4B 1RTIA 3BQ2A 1Q86T 1IBMJ 3DRPA 4O4RA 3V5RA 3I4PA 1UFLA 1X4GA 3UDCA 4DFJA 3HK2A 3RTVA 5K8NA 3QT5A 4J9VA 2DNYA 2QLBB 2NR0A 3ISZA 2ZH3A 3CB4A 2AJFE 5C25A 4F0HA 1XEZA 2DH8A 1NPPA 2XI3A 4ZPBA 4WU3A 2KU7A 2MKCA 3Q8YA 4OI2A 2R2RA 3RB0A 3LOUA 3S8SA 4QPXA 5KFNA 2E5HA 2NQPA 1ZM9A 1AW0A 3ZNJ1 1Y00A 1FFGB 5GAGU 1U7LA 1NK5A 2RUGA 3CDEA 1HQ2A 1JLFB 2JDJA 1JLQB 1X4FA 1HQEB 2V8GA 3LQVA 4HL9A 4M1KA 4KGXB 5IV3A 2BJ8A 2HVDA 4YHHJ 2Z30B 1HI8A 1CJVB 1NH7A 2CG8A 3DOMA 3MCSA 1WF1A 3VVUA 3KHHA 3K0JA 2PD1A 1HI1A 3BSAA 1NUEA 1RT3B 2AQ4A 4KTQA 3PEHA 3FSIA 2GV1A 3EDRB 1SXLA 2D9OA 3M8PB 4OIXA 3EMTA 3O2IA 4ZLPA 1NRKA 1PBUA 2J7WA 2XYHB 3D1OA 5A8WA 2XMTA 1SKSA 4LF5J 5H9FJ 4CLLA 4QBUA 1YRTA 1JXLA 4TYBA 4J9SA 4FBUA 3JS9A 3BKUA 2HYIB 5HQMA 3W3SA 1CJUB 4NCBA 5FJ4A 2HZAA 3IM8A 1GMWA 2VFVA 1X0PA 1KNZA 3FSXA 4RNHA 5HROB 1Y7PA 2ZH1A 5C42A 4I69A 3TP2A 3EZ5A 4CM0A 4DV5F 1RT6B 5AE2A 3AJ2A 2QZ8A 1JLGA 2NXCA 4PQUA 4R8UA 3FSYA 3H4DA 3DGPA 1NMEB 5DZ6A 1U1NA 4HT7A 1OWXA 4LQ9A 5G4DA 3MMBB 4DCJB 5KFFA 2GO8A 4TU9A 3HT0A 3G71S 4JI1F 2J0SD 3NCQA 3PEJA 3TAMB 5HBMA 4EGLA 3HP6A 2ZJQQ 2UUCJ 5ETQA 3HHLB 4LFBJ 3GP9A 3AA9A 1RACB 1ZPWX 2D9PA 4PAAA 3SQOP 4URQU 4JI6F 5KFZA 2LECA 1OS5A 3RBDA 1T95A 2XMKA 1W7WA 3GU0A 4ZHRB 4OX9F 2JEFA 4JI0J 1TFYA 2OPRB 5A6PA 2ADCA 1EETB 2MY7A 1B7YB 3BKTA 4F4AA 5KT4A 3OL6A 1IBKF 1E6YA 2Y8YA 4NXMJ 1GQEA 2P9EA 2AWZA 2MPUA 5CYMA 4AE5A 2CQIA 2QSFA 1MW7A 2KRBA 4S0MA 2QGFB 2X1BA 2RUSA 2YNIB 2PSZA 1RT3A 3FEXB 3I0SB 1IUJA 1QD1A 3MWBA 4DQPA 4YB6A 2EVZA 2CPDA 2PMZD 3P5TL 5IC6B 1VBKA 3MR3A 2CKWA 3PW7A 1NZ8A 4OZ0A 1IKVB 3RRHA 2WSCC 2CA9A 3M8RA 3E8OA 1YJUA 3FZBA 2V5HG 4DPUA 2WBRA 4RW7A 1KQSR 2DHGA 2ZH7A 5DLFA 2OD6A 2CZVC 1M1KT 1LK7A 1S7IA 4ZITA 3WIUA 1HBUA 2IA0A 2EBEA 4AL5A 3OUYB 2EG1A 3V4MA 3P4UB 2IVMA 2VDIA 1X9WA 2HHSA 5EWFA 2XMJA 5L1JA 3UDEA 1MWZA 2EFGA 1W2IA 1H72C 2DYAA 4H4KA 3OXGA 4DS4A 2ZFHA 1M90T 1VI7A 4D3HA 3T19A 1GH8A 4C7QA 3KLFB 3IRXB 3G8TA 3VAMA 2MZ1A 4EO8A 4DUYF 2NXUA 3HHNB 3UW1A 3MTKA 3M05A 2VB6A 3TAMA 1SL0A 2DPJA 3VVTA 3NY0A 2M4MA 4IDKB 1S1XB 5I4MA 2HHHF 1SUQB 1VOMA 3NCPA 2QX0A 4DR6J 4O3RA 2WVFA 3KK2B 1KFSA 3MM9A 3IP0A 1FX4A 3LH2S 1S0NA 3OFGA 2IM1A 3BJYA 3NCRA 1NSKL 4DV7F 3RAQA 3LALA 3IGVA 1IXKA 3BBCA 1IKYB 2UUTA 2IC3A 3DLKB 4KV8A 5E2QA 5DG9A 4CO3A 3MEDA 4DN9A 1IBMF 1PBAA 2CPEA 1TL7B 1C1CA 3PCOB 2DXEA 4KKOB 2ZITA 1HNVA 4UT4A 1S9GB 4FPRA 2VF3A 4F3MA 2VJVA 1VHIA 1RHJB 1S10A 2O3DA 3OVAA 1QTMA 1FK9B 1S1UA 1UVLA 4UOFA 4RUHA 3PRBA 2XGPA 2XMMA 5JJBA 1NK4A 3OL7A 2LXUA 3IWXA 4LR9A 4ZVEA 4R5PB 2BDPA 3QJPA 4PG4A 3HSJA 3BGUA 1VIOA 4CM2A 2Y8WA 1VCTA 2XB2D 1NU4A 2JLFA 2V4JA 4NI2B 3G6ES 4EBEA 2RHSB 5I3QA 2YTCA 3PO4A 1W25A 2BRLA 2CPIA 3MF5A 5CD4H 1KONA 4JP8A 1RHQB 2ZE2A 3V4IB 2DNGA 4EMDA 2H54B 5KFHA 1D1UA 1HQUA 5C42B 1RTDB 3PYFA 3P96A 3BDEA 4LFAF 4J7CA 1S6OA 1TKZB 1N34F 1RQ0A 1RAJA 2RAQA 4B08A 5M2RA 2GS8A 2QFJA 3UR3C 3LGNA 5EWEA 3QRQA 5GADU 4NYZA 5IT9Y 4DL6A 2UUBF 4CNYA 1R8CA 2NXEA 1RU1A 4NLUA 4PZVA 4BWMA 3MMAB 2DIUA 4B9TA 2IJRA 1SUQA 4NLGA 4X4VA 3SSSA 3BQ0A 4P2MA 4OX8A 4J9KA 3BM7A 2YX7A 5EDWA 3JYTA 3CD6S 3CSKA 2UV8G 5B7WA 3KNGA 1EP4A 4K4ZA 3JSBA 2V9WA 2K06A 5I42A 3EJMA 1VQ7S 3R5JB 1VMBA 1UP1A 1HBNB 2OUGA 4C8KA 4I4BA 3CIMA 1S6QA 1X8DA 2I1RA 2J0XA 4OI0A 4B3OB 2HKEA 1FRMA 3S1TA 1U2RA 3WQPA 3C6TB 4AQYF 5U47A 2UVVA 2HLUA 3K5NA 4DV7J 4H4KC 3D6HB 3EZOA 4NLXA 2XSFA 2MZSA 3TAPA 1FJ7A 1U1PA 1N5QA 2OI2A 3IS9A 4CCHA 2R7SA 3HULA 4DV0F 2QO3A 4WYLA 1FHTA 3MMCB 1X9MA 5THWA 3QT8A 1RWOB 1FDAA 3DOKA 3MM8B 2LEPA 2WSFC 3IM9A 2C3UA 4OZLA 4F4XA 2AD9A 4OYBA 3BPDA 4ZHRA 2KYZA 3PR5B 3FKBA 1OY9A 3M2UB 3QLHB 3QSIA 1NK6A 1WHWA 2ABYA 1RCXB 2J9DA 4Z37A 4KJIA 3HKZD 3P3DA 1ZA2B 1UCNA 1U0SA 2I8EA 1MLAA 2OFGX 3IWNC 4XIUA 2FB0A 4DV6F 2JEIA 3O44A 3MM5A 1PO6A 1DRZA 2J6TA 4F4KA 2D74B 3H98A 3RBEA 2HGMA 1S9EA 5T41A 1ELOA 4LREA 5KG4A 3T1YJ 2AGOA 5K9FA 5HANA 2CPXA 1UFKA 3QMQA 3MUVP 4QYZK 2WHOA 2HHVA 4DEZA 2E5GA 2FVQA 2Z2YB 1PJ5A 4IFVA 4N77A 5HROA 5FLXU 4DFKA 3DI6A 4F0KA 1NSPA 1CQMA 2C3OA 4WFNQ 3PR4A 2CQGA 4WYWA 4RU9A 3NAHA 1N6QA 3FRYA 1RWUA 2C2OB 1RP5A 2KXHA 3FQLA 3RB3A 3F44A 1E6VB 3ETMA 3VAGA 1O51A 2UUBJ 2XS5A 4F67A 4NMXA 2DY9A 3MM9B 1U2CA 1D09B 4N76A 2NZ4A 2KFNA 1SJ4P 1UW9A 2ZH4A 4ZVQB 1NJXA 1NPKA 3WX4A 3CCQS 1S99A 2V4RA 1S1XA 2LEBA 1RAOA 4DQQA 1HI0P 2CIMA 2DGTA 1QY7A 2MTLA 3MFIA 1BQNA 4DUTA 2PDAA 3KLEA 2ZVSA 3DLJA 3HD2A 3KJFB 2MMYA 1S9EB 2Q1LA 3G82B 5L9NA 2MB0B 3KLIB 1ZM2A 4M5KA 1JMTA 1G6BA 4CLPA 4RUCA 3CIZA 2E5IA 2K3KA 2YKPA 3KMQA 3POTB 4AQYJ 2BM1A 2CUYA 3HHLC 3UNGC 5KT2A 4PUOB 4DS5A 2XI2A 2FJVA 2BQUA 1KVJA 3T5LA 4CT8A 3IC1A 2UVRA 2N3LA 1WEZA 1X4CA 2VD3A 4KYZA 3OSNA 4UY8T 2LQ5A 4C3MA 4ZK7M 4N5SA 3RW6A 4I6WA 3CCES 3Q8UA 1N88A 4LIRA 5T14A 2PA3A 2VBXA 2W25A 2HQ3A 2IBOA 3CXCR 3ENVA 3EE3A 2GO9A 3W2VB 1SQGA 2CQCA 4ELUA 1JLAA 3IGNA 1LWCA 3GILA 1N36J 1WJ9A 2NYIA 1KTVA 3IO1A 2ZBCA 4C3LA 1NJZA 2DNKA 5L46A 3ET6A 3JTOA 5HQ8A 1KEKA 3M9OB 1X0FA 3Q22A 3ENQA 1WSVA 4I7FA 4CI0B 1YJ9S 2PMWA 4LR7A 1MSWD 4U6PA 4FXDA 1YDLA 1UVIA 1N8RT 2EC0A 1D8ZA 3J7YU 4B3MJ 2XY7A 1FE4A 4I1TA 4C8OA 2D69A 2PO4A 3BGLA 1KLNA 2BE9B 3KUHA 3K5OA 1B70B 1QSYA 1NEEA 4PG8A 3M2VA 2P9CA 2M3DA 3GV8B 2OPRA 4MKAA 5KFKA 3OSPA 1GTHA 2W4CA 4ICLB 4LF7J 3QJLA 1ZAVA 2R2SA 3IR5B 4AD6A 2OGUA 4JI7J 3IAS9 1U48A 1HR0J 1TMMA 2JOQA 1NDPA 1RT4A 3QJJA 4DU8A 2HW3A 1SL2A 1EHWA 2B7BB 3R5BA 5KG6A 2BABA 1S1TB 3FCWA 2RU3A 3DRSB 4WIQA 3TNVA 5M2UA 3CVKA 3DLEA 3H0PA 4ER8A 2UP1A 2E9RX 4G1IA 5J2PA 1RT2A 3N5FA 3CW2C 3VGSA 4X4TA 4TY9A 2DNOA 3LTOA 4DI6A 1I94F 3EYZA 4WXOA 2VQEJ 2H4WB 2XSJA 3TVKA 5JMNA 4AT1B 2FVCA 3QAUA 3IMQJ 2HWTA 2P9GA 4C48A 1C4AA 3GE9A 3WDOA 3R2DJ 3T9ZA 1LOUA 3JQMA 3P8BB 2R7QA 5FIIA 1ZAXA 4QIWD 4I2QB 2RD5C 1LWCB 3O1LA 3C16B 3PHTA 4DV3J 5D8HB 2RRAA 3NG8A 2ASYA 1Q4RA 3EXYA 2HAFA 5A8KA 1H2TZ 4IUFA 2E7WA 1ZYQA 2BX6A 2AX0A 2VZ9A 3NGTA 1BQMA 5D0RA 2D7SA 2JFDA 2JEGA 2IFXA 1YJ7A 4OYWA 1TU0B 4OX9J 3PRDA 4KV8B 1U0HA 2GJ2A 4TNOA 4LF6J 4FYVB 1XIQA 1YX2A 7FDRA 3G6XA 1XERA 2Y3YA 4U7UK 4YDDB 2YKNB 3U1MA 3D66A 4P10A 3W8PA 5HP1B 4HH1A 3MEKA 3GZ7A 5LMUF 2GVDB 1KBRA 3D0GE 4P74A 3ILJA 5CD4A 3RBXA 1DQ8A 2W7PA 4ECYA 4NA1A 3TR5A 3I0RB 2XC9A 1T03A 1SC3B 1SQFA 1R0AB 4WF9Q 3W60A 1FI4A 4NPOA 3HJFA 2YBVA 3T6BA 2QYGA 2V68A 5F8GA 4ZVUB 5KG5A 2ASLA 2BACA 2V9KA 3OXFA 4KGKA 3ZTPA 4CNZA 5D6GA 3MAQA 1ZA1B 4QPTA 2ZVIA 1D0EA 4DL7A 4LF7F 2WVDA 2CXEA 1TUGB 3DYAA 4I2PA 4ES2A 2AJQA 2CQHA 4WP8A 1EARA 1RT1A 1Y5LB 2C22A 1XNRJ 2ZBRA 3BYRA 5EX0A 2X1AA 1NB7A 3QO9B 2PE8A 3UCGA 1N32J 3K2YA 5D4NA 1FXDA 1VRUB 1K8AT 3U1LA 3I96A 3MXHP 2IDLA 3GCXP 1WACA 4MK9A 2CWXA 4NLDA 3GSDA 1GEHA 2ZNYA 3ISNC 4M5HA 5LM7E 4DFPA 1YJWS 5GMEA 1M5PC 3VALA 1RT5B 2KB2A 4AFFA 3HFKA 4KHMA 4LMZA 2DXDA 1UPPA 1U47A 4HR2A 5L1IA 3W62A 3CTRA 3DRRB 3AAWB 4DX7A 2AU0A 1BQMB 2ZH5A 2HHHJ 3BSOA 4O4GA 3M30A 4HT5A 1PGZA 4B9VA 1N0UA 1FRXA 3ENWA 4FYWB 2F4FA 3VQSA 4E98A 2ZOMA 3PYGA 3CCSS 3M2RB 1CSJA 3MMAA 2QG9B 3ILIA 3R1LA 4YMEA 1LV5A 3FBBA 5IWAJ 1U1MA 1FESA 3I32A 2LQ8A 2KXNB 2EFOA 3UN5A 3BQ1A 5JUMA 1C1CB 1RTZA 1RT6A 1RUSA 2EKYA 3CJ3A 1CULB 3D68A 4H4MB 4ILRA 4O0IA 3CT9A 4P7VA 5H9EK 4GO7X 2BRKA 2CPYA 3RGIA 4BLGA 2J5AA 2JLGA 3CCWA 3G96A 1S0OA 2FY1A 4M5JA 3D28A 5AJ3F 3OTCA 1GAOA 2V8DA 3VR1A 1CS4B 2JFKA 5E7OB 1NJWA 4O0NA 4B9MA 2MKKA 3QLHA 3K59A 4MKVA 3UD4P 4CO5A 4KT0C 3GPAA 3FZ2A 4OI6A 3I5BA 2B6AB 5DDPC 3CUNA 1N54B 2ACMA 2VC1A 2WW4A 1SBRA 3HCXA 4WJBA 2JZ5A 5CQGA 1KHVA 5C24B 4ECZA 2P8IA 2AYMA 2KO1A 1CC7A 5KTQA 3W7BA 2GHWA 3Q24A 4YR3A 4PWDB 3CJQA 1JQGA 1WDDA 2B8PA 3BGFA 1YKWA 2LXIA 2DBBA 3NGKA 2W9CB 1N34J 3MM6B 1UJ6A 1VRQC 1YJTA 3ADAC 3AXKA 3NS6A 4MAKA 2N4DA 1FNOA 1XR7A 2MQLA 4CH0S 5FDLA 4TQSA 1OSDA 2K1RA 3MPDA 1DZ5A 2Y1LB 4F0MA 5LXRA 2WW8A 4C11A 1RYRA 1M1GA 1S4FA 3DM2A 3GJQB 4CP5A 4DLEA 2VA3A 4ELTA 2LQJA 1W26A 5HVGA 4ED2A 5BR8J 4JV2A 3D2WA 3B4MA 3GG0A 3AJDA 5CXTA 4MYTA 1HW9A 2XMWA 1T9WA 3GFHA 1L5UA 1H7WA 1H74A 4DSLA 1RT7A 3CDAA 2BW2A 5AXLA 1SJ3P 1I94J 2KDOA 2FC8A 2L41A 3KYLA 5C24A 2HNYB 4WE1B 2Y9HA 2EWHA 1R0BG 2RRBA 3PZPA 1LQ9A 3JSMB 1NK0A 3QSYB 4LF5F 2CQDA 2W9AA 1ITPA 1HMVA 1JLCB 1LWEA 1QE1B 1UETA 2O66A 3VGUA 1CPZA 4MJKA 1MWYA 2Y0SD 3UWTA 4EI2A 3IR6B 3K5LA 3NXZA 3FC9A 2QMXA 5H1SV 5F0UA 2E66A 1HBUB 1UAWA 1RZMA 1P1LA 2HNZA 5ETRA 2OPSA 5KFBA 1J5EF 4CLFA 2DXFA 3HSDA 2YKOA 3L7PA 1SKRA 1EJ7L 1S4EA 2HFUA 2JH3A 1QAXA 2MQ8A 4GVLA 4RNFA 2MGZB 4P2FA 1CJUA 1HL6A 1HYSB 4DHVA 5AJ3J 3BN4A 1VBZA 4Y28C 5CA5A 2FDNA 2QL7B 1T9YA 3QWPA 4WK3A 4U96A 1S77D 3CULA 2VG7B 3W9IA 2FVRA 4FZVA 1HNWF 4WBFA 5L8RC 2IMOA 3KUGA 2DNRA 2C42A 3I82A 2HHXA 2HVZA 2HVHA 2DHXA 2NUUG 2OPPA 4UUXA 3K57A 1EQ0A 1JLGB 1S72S 1X5SA 3I6PA 1HNVB 2V2QA 1PC5A 2H65B 2BKNA 2DNZA 4KBIA 5L39A 1KRPA 4JUZA 5A2QY 1X4HA 2ZH2A 3R6GB 3UDVA 3ELHA 1DLOB 1IKYA 4LSNA 5A76A 2COLA 3GFXA 3PHEA 4NEZA 2JSXA 3TYTA 2R7WA 2VA2A 2DKOB 4O23A 1T02A 4OQJA 3NGSA 3FRZA 3BH7B 3D0HE 2ZEJA 4Y65A 3RBZA 4ZMMA 3V81B 2JX2A 1Y3KA 3NAIA 5CYQA 4CLTA 4OV6A 4Q44A 4U8YA 2OSRA 4NLPA 4BDPA 1V9OA 1OIAA 2F9JA 1RAEB 5A0YB 4B02A 3LWMA 2ASJA 2AGPA 3A1YG 4DQIA 3JSMA 2YNHA 3G87A 1KR4A 1T7PA 1X9SA 3J80U 2MEWA 2QSWA 1N48A 3BDPA 4F02A 2C2KB 3SSQA 1U24A 2V67A 5HK4A 2JC0A 1U02A 3J7AN 2VFRA 2L9WA 2CJ9A 4DOZA 3QZ7A 2UXCF 2QN6B 4XDDA 4AYBD 4CIOA 1HIYA 3NS7B 4J5OA 1K0VA 2H5IB 2ZBIA 1WHVA 5KOXA 3N01A 2MLXA 1KWMA 3M6VA 2DNMA 3A13A 2RQ4A 4ZLLA 2BV3A 4LFAJ 4UOGA 1UWBB 1RDRA 5KFRA 1DHMA 2QFIA 2C28A 2AIRB 3OBIA 2OEMA 1JLEA 1CJKB 3SI8A 2QRRA 2O01C 2ZC4A 1VBXA 3DRXA 1Q53A 2JL9A 1YVFA 4TLRA 1J2VA 4DL4A 2FVSA 3FJ2A 2W1BA 2R8IA 2RDDA 2DNNA 2ZC3A 4IFYA 3NNHA 2WONA 4LVOP 3PVXA 3MDFA 3RAXA 1VQPS 3RYLA 3OVBA 5E33A 2YNFB 3FUYA 3QNWB 3PFOA 5DLGA 1UZDA 3I0SA 4ED4A 2DT9A 4RNNA 4WFXA 5LMNJ 5CHCB 4DSJA 5KFWA 4DR6F 4USIA 4ECQA 4L72B 2CJKA 1Q16B 1Q8BA 2VV5A 2LVWA 5LSRA 4BS2A 1CS4A 2OHDA 3EXCX 3KUEA 2AX1A 3ISND 1GXLA 4WP3A 1UTAA 4IOCQ 4K5RA 5DETA 4PWDA 5J2MA 1MG7A 1R8PA 2I9SA 2MQNA 2N7YA 2BM0A 4GVBB 4K59A 1GMUA 4CLUA 2VOPA 2MY8A 2FHJA 5LOQA 1TV6B 5J2NA 3MHYA 1V3RA 3CDUA 4ZPCA 3LW5C 2BANB 2L08A 1X4BA 3C8YA 2ZDPA 1XBWA 3I5AA 5KT7A 1F5CA 4RBUA 3FCVA 4OV1A 2HBRB 4X62F 4DF4A 2IM2A 3AODA 2Y1IA 1RAFB 5DDQC 2XWYA 4HACA 2XCPA 3THTA 2I5JA 2LMIA 3R5GA 5K20B 3KLGB 3QATA 5C2GA 3N0VA 3H4BA 3TANA 3VCDA 4QCLA 2Z2LA 3M30B 2K7KA 1NHKL 1C0UA 5EUHA 4ID5A 3KK1A 4CO2A 2MXYA 3ZZ0A 4A8MP 2L3MA 3OV7A 2W2PP 3QAEA 1NK8A 3DI6B 4IH5A 4ZOSA 3AY0A 1WOOA 2HRUA 3L95X 3M2UA 2FJWA 1NKBA 3D9BA 1TMJA 2PMHA 4DPXA 1C2PA 1U4BA 3M8QA 1RCOB 3DNCA 3KG4A 3MD1A 1FKOB 1MN9A 4YB1P 1TTHB 1LWXA 3GV5B 3BYPA 1CQNA 2W7AA 3DHXA 3AT1B 4Z7YA 2H9ZA 1BHNA 2XHCA 2XYGB 2C3PA 3MM5B 4NRTA 2ZBPA 5ETNA 2DGXA 3QO9A 1FFSB 4DDFA 2UUAF 4LRDA 3HF5A 2HHTA 3ZXWA 4KRWA 5F8LA 3IBWA 3PM9A 5F41A 4BCAA 1JJ2R 5EX3A 4DR1F 4Q8FA 1TR0A 1WDTA 3AH6A 2RVJA 2NPFA 4WFZA 4I68A 1J5OB 2BJ9A 1GMVA 1F2HA 1OY8A 2KI2A 1NNDA 2BKOA 2WB1D 3HPOA 2F5GA 2ZM6J 3N6NA 5BXIA 4Y34A 2RNEA 1N5YA 1F9EB 2WZ1A 5F3TA 3JYTB 3DLBA 4LBPA 4NA3A 2Z2ZA 5K14A 4F2RA 4A4JA 4AUKA 4OHWA 3WIVA 1LFPA 1Q1KA 1FKOA 2RS8A 5CYMB 1XTZA 4Q43A 4JI3J 4NXNJ 1DY3A 1HQUB 2CJAA 4FS1A 3PX6A 2XMUA 2W2OP 3CJSA 4Q0BA 2DGQA 3GIRA 3SQGA 1LW0A 2ILYA 1PYSB 1KC8T 1UEKA 2RIJA 2HS3A 2WBMA 2FLPA 4RWXA 4DSIA 2XULA 1WI6A 2GJFA 4ID5B 3KK1B 2HFSA 2Q6CA 4EYHB 2OKQA 3IRXA 4X62J 4K4SA 1FDNA 3TRGA 1HD1A 5GAHI 4EBDA 2YQ1A 5J1EB 2YKAA 5D4OA 5SZTA 2B56A 3RAMA 4DV6J 1RB0A 1VC0A 3NGDA 1WEXA 5IQQA 4Q2LA 3DC2A 1HBMB 2HG4A 2M5YA 3O6QA 5C2CA 2ZJPQ 4OX7A 5K14B 4NYOA 1SI9A 3EGNA 1Q81T 3L7OA 2Q6BA 2FYXA 3LAMA 3PYDA 3D5MA 2GZOA 2IC3B 3DLKA 2MLYA 2ROEA 2PT0A 3MD3A 3NOCA 3V6HA 2J9CA 4DSEA 5D78A 1HNZJ 1WG5A 2HNDB 1BMQB 2VKZG 4NRUA 2CYYA 2C2ZB 2WRMA 3KJQB 3KKFA 4KKOA 1MMDA 1VRUA 5CAAA 1S1TA 2M7SA 3OLAA 5HLFB 3AD8C 2DISA 4YS2A 1DQ9A 1Q8LA 1FKPB 2GAGC 4KGMA 2OELA 5KFPA 1DURA 3PFEA 3H42A 3OTOF 3T5HA 1RT4B 3CDWA 1V6HA 4LF9J 2F3JA 1FK9A 2EXUA 4DX8H 4DV0J 3ZTQA 2BJDA 1H3DA 3DMJB 1FWLA 1G4CA 4EUVA 4UW2A 2ZHOA 4RPFA 4RZRA 5B0CA 3DLEB 4J9QA 3KG1A 2FZKB 2GMJA 4H4OA 1TL3B 4JV5J 3L4BC 1UJ5A 3EGWB 4RW6B 5IFMA 3BBFA 1JXVA 4WFAQ 2R7UA 1JLCA 1QE1A 3L7UA 4LF8F 3CMQA 1S1VA 2XS7A 4B3SF 4IR9A 4ECXA 4NXNF 2GNKA 2C3YA 3ZZZA 4J9LA 5KFDA 2WVBA 5KG1A 2CJXB 4USHA 3KTQA 1QM9A 4RR5A 4A8YA 5LJ5Y 4ECUA 4WKRA 1V3SA 1XQIA 4F2SA 3U1NA 1WC3A 4WTYA 3KLVA 4FXWA 3GSIA 3DRPB 4CLYA 1UPMB 1B7FA 3NGUA 4KH0B 1FNMA 4B9LA 2F1FA 2CPZA 1WG4A 1IN0A 1U1KA 1RXOB 3R97A 2FUG9 2GVDA 4EO6A 5HQLA 3U27A 2E1RA 2FC9A 2A10A 4Y6IA 4DV4F 3N6MA 4HACB 2DO0A 1R8AA 4ED7A 1Y9OA 1D9AA 2BE2B 3C6TA 4DWIA 1VQMS 1CEZA 1HARA 2HBZB 4HDHA 4ZP7A 1ZZNA 1YJNS 3A8KA 3CJ2A 4U7UD 2WK4A 1HBNA 4P71A 2GVZA 3A3OB 4PEOA 4CO4A 1DLOA 1IWAA 2E29A 5BR8F 2XQCA 3IA0A 3M8YA 4ZVPB 2ZD1A 5C25B 3KJVB 2D1CA 2QLJB 3WX8A 4FF1A 4C4WA 3QT7A 1XMQF 4C9DA 1G3OA 3F0NA 2MSSA 1YGYA 2G0JA 1GX6A 3OL8A 3PYEA 2YWFA 1VS3A 3V81A 4O44B 2H51B 1S57A 1HWKA 4B9UA 2LA6A 3DDNA 4C0OC 4YR2A 3AFGA 3M8PA 1VLOA 4OHVA 4ZVSB 2V69A 1WKKA 3THVA 1B4SA 2C3MA 3H20A 5KFJA 5J2QB 1K47A 2J8SA 2RT3A 3O3LA 1BD6A 3SXLA 1U6FA 1TELA 2I38A 4LRCA 2FZGB 3FBFA 2NSBA 2BXJA 4NL5A 4K2JA 1K1SA 2OPSB 3R7SB 3UE2A 3CC4S 2V50A 4DR4F 4UY85 2RRNA 2HS4A 4R8UB 1RWNB 4B9NA 1IJEB 1QUPA 2QJ3A 5E0OA 3T1HF 2Y1JA 1S49A 1K0TA 4YEAA 5IM0A 4AL7A 5DDOC 4WIIA 5HMXA 4WXWA 4DL3A 3MEDB 3M2RA 1U1QA 3OR1A 3LGMA 4PXEA 4HHUA 2O1PA 2EFPA 1UWBA 2HQCA 5A6WA 2HHUA 1NXIA 3ZZUA 3PTWA 1WWHA 2M8DB 4RBTA 1AUSL 1RWWB 3BEGB 4BBYA 4A8KA 3DRRA 2AJ4A 3ZTRA 3UPFA 3TUPA 5GMKa 1KN6A 5A8RA 3BO2A 3BGOP 4B3MF 1RT5A 1IVZA 2WONB 7FD1A 2VIHA 2LDIA 4IH7A 3TQ1A 1MN7A 3HXMA 2F8EX 4DN0A 4MK7A 1NB2A 4C0HA 2DCUB 2YWGA 2UXDF 1Q78A 3KG0A 2FIUA 3PNIA 4L75A 1IM6A 2CDQA 2KRRA 3H5SA 1HWJA 2MHNA 2GVZB 3BGRB 2N3OA 2UU9J 1RU2A 3SCKE 2YNGA 1IKWB 1F0XA 4OLOA 2BYCA 3I31A 2B5JA 4RNOA 1J27A 3TVZA 3DLGB 5ETMA 1M0SA 1EX8A 2CJYB 3ZO7A 5CABA 4PKDB 3JB9k 2LQ9A 3PG9A 2FGOA 1ZZFA 2H5EA 1PYTA 2PEBA 1WC6A 3ILLA 5G0RB 3TJ8A 4ZKAA 8RUCA 3KLIA 4YFUA 3DKDA 2GC8A 4U9RA 1K9MT 1FTRA 3UCUP 2HZVA 3I9V9 3J7A1 3RR8A 1O5JA 1XMQJ 3GR1A 2UXCJ 1V3ZA 2B6AA 4NOHA 1IKVA 3DXSX 3SSRA 2Q43A 4TYAA 2KHDA 4DR5J 5DQIA 1S97A 1CJTB 3D6MB 2FGCA 2QIFA 3C6UA 5KG0A 1X4DA 1NZAA 3PO5A 1XNRF 4L73A 2HS0A 5KOWA 5A2QU 2UXBF 3GV7B 1TKTA 4CLWA 4X2BA 4JI5F 2RMLA 3POTA 1BC6A 1TK8A 5RUBA 4DV3F 1OSCA 3BH6B 1SPBP 2DRAA 2XCAA 3Q86A 3M1VB 1I6JA 4OZ3A 1URNA 1RWVB 2HNYA 4WE1A 4U8VA 3HDSA 1X60A 2HBQB 2GMHA 3T5KA 1Y5IB 3LP0A 4IG0B 5A8RB 4O3OA 2VG6B 3NMRA 2CQ0A 2G1HA 3T6JA 4NE9C 4WTOB 4TU7A 4K4UA 4I0WA 3ITHA 4HDGA 3MURP 1EKSA 3D3CJ 4F3QA 4C11B 3M6UA 2F40A 1ZH5A 2P6TA 1RTHB 3IG1B 3D67A 4YUDA 2HMIB 2M52A 2HBYB 3LP2B 4B3SJ 1AZSB 1PILA 2YQ0A 3N5BA 4DMZA 4KAIA 1UW4A 3ETOA 1AA1B 1RE1B 5HJXA 2H1YA 2K8GA 4U7CA 4ED8A 3MR7A 3G9CA 1IJFB 3Q89A 4K8RA 2V4QA 2CDRB 1TVRA 1VQSA 4IO1A 1VQ5S 3B8HA 4C8YA 1TL7A 2LU1A 2EFQA 2NYHA 3HVAA 2G9OA 4NMLA 2OH2A 1F2GA 2FPHX 2G0IA 3HHLA 4UQTA 3T9NA 2ZWOA 1RABB 4HEA9 4HTJA 4K4YA 2GFFA 2RB7A 2LQBA 4PG5A 4U67Q 4MFBB 3CCRS 2ATLA 3M6WA 2VG5B 2OLWA 3PX0A 4ZDNA 2XZWA 4MYUA 1FKAF 3TO8A 4EBCA 1VQYA 1O8BA 3LPEA 4C8NA 4DZ6A 4HKQA 1V5VA 2DGSA 2AV5A 2IRYA 2VG7A 3BZQA 3GG1A 3R3TA 3HM9A 4JV5F 2M9KA 4ETZA 2PC6A 1S9GA 2AKWB 3S6EA 2DNPA 4O4GB 1YZ7A 1DTQA 1C0TB 1ZS6A 3FFIA 3PJ9A 2ZH9A 3DOLA 2KM8B 1YZ6A 4TLQA 3KJVA 4WPAA 2OPQB 2ROGA 4J9OA 4DUZF 4Q7AA 2YX1A 5L38A 2VPXB 4RW8A 3S7RA 1YIJS 4NCGA 1URRA 2HEKA 1VISA 5LXYA 4LUBA 5GVQA 5BYRA 1HNIA 1WC4A 5ETTA 2LLZA 4HYKA 2UUAJ 1SIZA 4OJGA 3WC0A 1S6UA 2IHR1 1B3TA 5I42B 1HKAA 1WKLA 3D6TB 3IXQA 2XO6A 2VONA 1LFWA 4F7VA 2HPUA 3FGVA 3NBPA 4O3PA 2GGPA 1VQLS 3P6YC 2R7RA 4OYAA 1FVSA 3FMWA 4HHJA 4CO1A 5A8KB 5KAKA 4DR4J 4BC7A 3GIJA 4OHYA 5EGYA 4QU6A 4DV5J 4K4VA 3K5MA 2DRDA 4MT1A 5DGBA 2GCFA 4E0DA 4MH8A 5DRKA 2CNKB 5ETVA 2AYGA 1B64A 2OAUA 2YNGB 3SMZA 4DPYA 2OTJS 2LU2A 5E5NA 1RI7A 2J8AA 2FZCB 4X4OA 1WELA 2RF2B 3VWSA 4V19J 1RT1B 3CO0P 3GCWP 1R89A 5HP1A 4XK8C 2PEHA 1JNRB 3T3FA 3CO9A 5KFGA 2FHOB 2KFZA 3CCVS 3DMJA 1VLYA 4JI6J 4USTA 4NEYA 4YB7A 3US5A 2DRBA 4CWBA 5GAEI 2BE7D 2F65A 3A3PB 2X7IA 2DR5A 3QRPA 4BWJA 2UXDJ 2AF6A 4NLSA 5DM6Q 1W2BR 3RB6A 3A4TA 4HTIA 5ETPA 3BV8A 1WUUA 5IT9U 2V6AA 1C4CA 1TKXA 1SJFA 1MNEA 1XN9A 5AXMA 4YB5A 5KT5A 1YTYA 3H2LA 1SJ1A 3KLHA 4X64J 2RHQB 1S1UB 3D7SB 1UA1A 1T05B 2A2DA 3DDKA 2QA4S 1QAJA 2JLEA 2PI4A 2WOMB 1JX4A 1RT2B 4M5MA 4JI4J 3NNAA 1DAXA 4PQUB 3CJRA 1HBOA 2O67A 3M1VA 2AJ1A 3M2VB 4J37A 2J9DE 1ZAWA 2YVSA 4GKKF 4OYZA 1P1TA 2M88A 2E9TA 1A9NB 3BO4A 1IR2A 1H6KX 1MWQA 3HHEA 2BVZA 4NYPA 5E3PA 1TV6A 4KB7A 2EFVA 4Q45A 1NHUA 1VQ6S 1C0UB 2Z56B 2O5DA 3T41A 3HVRA 1RLCL 4W92B 4XPCA 1SV5B 2POKA 3ENAA 4I2QA 1N0VC 2H5JB 1IQTA 2FY8A 1NKCA 4IRDA 4FKXA 4BHQA 1RBLA 2BKPA 3GYXB 3D1QA 2MQPA 2KVQE 4L3NA 4P73A 4QR2A 1R43A 2HFZA 1N33J 4W90B 2CADA 2ZD1B 2FLOA 3AQOA 3VGTA 2IM3A 3TI0A 4LF4J 4DR2J 5H9FK 3T1AA 4CO0A 1IM4A 4L6V3 5DS7A 2KJWA 4Y2CA 5D4LA 1HD0A 4OHZA 2F4VF 1S6PB 1GNKA 2EI5A 2QE5A 1FE0A 4YN3B 4WU2A 1KFDA 1B0TA 1BE4A 1IQZA 2YKMA 5D15A 5HATA 4C3KA 4F04B 2IY5B 4Y3CA 3W8GA 3AOCA 3Q2TC 3NEKA 4MFBA 1HLWA 2MZRA 2QL9B 4PUOA 4C2MA 4LSNB 4A8SA 1FJGF 3JQJA 4LFBF 2BMBA 2XWXA 3BREA 1SC4B 1TL3A 1S59A 3MI7X 2EKNA 1U6ZA 1SC6A 3GWCA 5JVGQ 5F9LA 5SUHA 4IOBA 2CVEA 1HWIA 3DU5A 2GIRA 1ZTTA 3GQCA 2ZBQA 1YJVA 4QIFA 3LA0A 4X66F 5D3GB 3KHLA 1F3VA 1FDBA 1YITS 1T0TV 3OTBA 1EKRA 3CD5A 4OJHA 4PG7A 4KIAA 2XG8A 2VU5A 3MMJA 1U25A 4OFZA 3D4JA 4YP3A 3J7Z5 4C0BA 2BUNA 2MZQA 2WTFA 3PW2A 4M94A 1RHMB 1S1VB 1RKIA 5F9NA 5EWGA 4DV4J 1RAGB 2CVIA 2VPZB 4EU0A 3MM6A 2FHKA 2MKYA 4ECTA 2XMAA 2ZOFA 1IR1A 1PIEA 3TWZA 1IBLJ 3E3XA 3KK3B 3UNYA 3IN5A 4P2SA 4ZVHA 4FBTA 1PJ6A 2Z8QA 3GLJA 1RWMB 1C0TA 2B8QA 4QIVA 5D0GA 1WNEA 4GVBA 5GAEU 4DUZJ 2X3DA 3KXDA 2FTRA 1TKTB 2OD4A 4HLBA 3CF5Q 4GKJF 1Q8KA 3TA1A 1VQKS 2V0NA 2IVFB 3QRRA 1X5PA 2RJZA 2DD8S 3VF0B 2CNOB 4RU2A 2D3ZA 3SCLE 3KHGA 2NS1B 4JI8J 2RQKA 1XR5A 1XJWB 2WVCA 3GJSB 4ZPVR 5IXUA 2NSCA 2MKHA 4W98A 3F41A 1GT8A 5LT5A 1XC9A 1FRHA 2VQFJ 1T9XA 4O3NA 4DQRA 3C2PA 5F8MA 1JJ4A 1P9QC 2RKIB 4ZIVA 5D0HA 5KFAA 5J2MB 5LMNF 1LK5A 3OTEA 4KHPF 4XDCA 4ZP9A 4UZBA 1T8EA 4DCOB 3LAKA 4LSLA 5KFEA 2ZHBA 2PN6A 2VKRA 4UZCA 3SEOA 5J1NA 4ATNA 1U1OA 1UEVA 2M8HA 3ZZRA 4FNIA 3ZZYA 1G1XA 1A0OB 1JLBA 3OHBA 1HA1A 4XO0A 3PIPQ 2BOPA 1Q5VA 4DL0C 3A12A 2C2RA 5BYQA 1WC0A 4IH6A 1MROB 3MAAB 4GMKA 2HGNA 3CJKA 2AEMA 3K8WA 3KLEB 1TK0A 2D3O1 2FLNA 3A8IA 3MCNA 1NO8A 3EPGA 1N4LA 2IRUA 1VC5A 4PXCA 4NXMF 3W5ZA 2VPWB 2MGZA 4AL6A 2VG5A 4FDFA 5AXNA 3AOAA 1UFWA 1M5KC 3K5PA 3CCMS 1QAYA 6FD1A 4ZLJA 4K50A 4NA2A 3GR0A 4RW6A 4MK8A 4LJMA 3M8WA 1HNIB 4ECRA 3D54A 3VTIA 1R8HA 4WCEQ 3T1YF 2MYFA 4ZN1A 1I3OB 4YQWA 2QLWA 2FJXA 1TP7A 2VODA 3WBZA 1WOPA 1VQOS 3PXGa 3NNCA 1RHKB 3D0IE 3S01A 1UWAA 4CLZA 1DQAA 1O0PA 3B78A 1RA7A 2CWKA 2VDHA 2BJ7A 3H90A 4DF8A 3OXLA 3V6DA 1M1HA 4IYQA 3OJSA 3DGVA 3IS9B 3EGZA 4TVAB 4DG1B 1RTJB 3TZWA 2BOAA 1CC8A 4PCQA 3A8JA 1H0HB 3KJNB 2A18A 4K4TA 2RDIA 5F8IA 5HN0A 1SKWA 1EIYB 4HH0A 1U8WA 5L1KA 3PJWA 1KP6A 4DFMA 2XZDB 1YI2S 1T9UA 5IT0A 2ZH6A 1S6PA 1FX2A 1KD1T 4ETXA 2IAJB 4NZ6A 1F5AA 2XLJA 2JEJA 3J81j 2ALZA 2GJIA 2J76E 2KZMA 2JVRA 4NCAA 4A8FA 4FNHA 2MQOA 4EFAC 1Q7YT 3H2VE 4FYDA 2HNZB 1F9FA 5J2PB 2DH7A 1YBAA 1Y5NB 2B0GA 3U02A 4FVMA 1XMOF 1VQ9S 3Q83A 3DGPB 3MM7B 5KFQA 3PACA 5GAHU 1VHFA 1LNQA 2DEIA 2APOA 2HWIA 2MQMA 1WHYA 5KFVA 4NLRA 1TKXB 3TJAA 5DG8A 5C5JA 2L48A 4JI1J 4DV2J 3M9NB 3EZUA 4OL8A 4QYZJ 1TAUA 1OQ3A 4I64A 4N8OA 1ZETA 2GGPB 2PFFB 1SJQA 3HVTA 3OJUA 3H59A 1WF2A 3SIPB 2V2ZA 1T3NA 4N41A 3CDBA 2DR9A 2B4OA 1VQ8S 3QGIA 3BN7A 5IZHA 1HBOB 1KVIA 2QMUB 4NLTA 1HBMA 4EWTA 2XZTB 4YOEA 2OSQA 3H8YA 2LDYA 2LA4A 2MKSA 2YKNA 1IBKJ 3ULHA 1QTNB 3CCTA 1S0VA 4USWA 3KLHB 1KKHA 2HHWA 5IS2A 4FVCA 3R1HA 2NREA 1SB6A 4EYIB 3IG1A 2IIHA 3I9ZA 4L3KA 1Z2LA 4DV1F 2DHSA 4B3TJ 1OQ6A 1P8GA 1R27B 1RISA 3ICLA 2HZCA 5DO2A 4JV1A 2IDEA 4ZCIA 1YJRA 4WZQA 3SV3A 3KDNA 1NSAA 2YWKA 3QIPB 5KFIA 4CDIA 1HQEA 3SYZA 1WC5A 2ROPA 2YY3A 3DDIA 3C19A 2YNHB 1SJRA 5KFXA 5BJRA 2QMWA 4JYAJ 3THPA 2W4DA 2EEYA 1HR0F 4A48A 2YKQA 4XPEA 3OVSA 7AT1B 2CQ2A 4QWCA 4F36A 3CCLS 1N5YB 2W9CA 2VPYB 4LSLB 5K8MA 4XAKA 3HHKA 3UO0A 2GMLA 3G2XA 2FQQB 4DPTA 1HHTP 1KSPA 4MKYA 4JI0F 2OMOA 4JI8F 2R4FA 5J1PA 1D9FA 2CPFA 3L9ZA 2WB4A 2NZCA 2E1AA 1CJTA 4IRKA 3QIDA 3DFEA 4ZPTR 1BUXA 5ETKA 1SL1A 2FHJD 2LEAA 4OI3A 2HIYA 5T7LA 3D3BJ 1IWGA 1RGVA 5GADI 1FD2A 4PXBA 1XK8A 2CNLB 4FKYA 3MMBA 1BWVA 3DRYA 1HWUA 5JVHQ 1UEUA 3T5JA 2EFNA 3NKYA 4QYRA 2CAJA 3EICA 2G2ZA 4H54A 2RQMA 3CJ5A 4USVA 4F3OA 3W1YC 3GB0A 4ICLA 4X84A 1JXEA 2P5VA 2C2DA 1VBYA 1RYSA 2E44A 4KHRA 5IOLA 1N5VA 2DB1A 2PIIA 1U49A 3H7HB 2KVIA 3MEGA 3ZZOA 1L3SA 2BANA 1NPRA 2G13A 2VL1A 3MPUB 4UQGA 3T1HJ 1DTTA 1BQXA 2DR6A 1LW0B 4DX5A 3C14A 4G1PA 3RB4A 2ZNZA 2DR8A 2SXLA 4KO0B 1RHUB 3PJXA 4QOTA 1BY9A 2A3JA 2FJAB 3Q8PB 3MR2A 4KQZA 3DRSA 1FXLA 2AYEA 4E8UA 2CJBA 2J9EA 1OPIA 1WKJA 2MKJA 1RTJA 2UUWA 1YBTA 3JXOA 4P2XA 5EHHA 2HFNA 1Z4UA 3RUBL 4C6AA 4PXDA 2MSTA 3JAMY 4X64F 4IG3B 3ITHB 4IRCA 1U8SA 3LF0A 2HSEB 1TKDA 2NXJA 1RBAA 2QC3A 2XSJB 2DNHA 4FN5A 3B4DA 5I3PA 5B0AA 4PR6A 4QW9A 2FJDB 1T9VA 1Y11A 1FRLA 2XBPA 2B4UA 1KHWA 3H5UA 4IG0A 4A46A 5M2PA 4KH1B 1AROP 2V63A 2CZ4A 2DPIA 2QLFB 4QIEA 4YR0A 3G6YA 2XNRA 4OI1A 4QWBA 4JYAF 3CMAS 2AZ3A 3TJ9A 1H7XA 1VK3A 3L09A 2VFTA 3LANA 3TUIC 3J81U 3UN3A 1FEHA 1U1RA 4X65F 1BGXT 2XTJP 3MZIA 1A7GE 1P6TA 3LP2A 3V6KA 2N82B 2C2NA 4DR3F 3PV8A 3J7YI 2Q79A 3UQSA 3G82A 3L3CA 1GFWB 2BR0A 3K17A 2DGUA 2K3IA 3O5TB 3RRGA 5E3QA 1AYEA 3NGRA 1VK8A 1R7IA 4K7QA 4ZCKA 2AEFA 2ZOGA 4FYYB 2F8HA 4B3RF 1QVFR 1TUVA 2I0XA 1KQGB 5AT1B 3I5CA 2RILA 2QV6A 3GFYA 3MAAA 4QU7A 2YPZA 1FTCA 4Y2AA 4ZLNA 1DBDA 4ECWA 1U26A 4ZVFA 5KFOA 1BWEA 5B0DA 2ALYB 4ZCMA 1U09A 1L3KA 3TAQA 2E9ZA 2ZDOA 4LF2A 1P27B 1EAYC 1WD6A 2LFVA 4WFYA 3TUJC 2J7KA 3HZEA 5F8JA 5F3ZA 2A1BA 4FF3A 1UMJA 2C1EB 3KFWX 4NCGB 2DK2A 1FJGJ 2CPHA 3DLHA 3AOBA 3H2UB 4GRSA 2AZ1A 4Z2XA 4DR1J 2K2PA 4QJVA 3V2UC 1WG1A 4DSKA 4G1QB 5HAOA 5J2NB 4LVNP 4JBCA 2IBKA 3EWGA 1OYDA 3MUTP 2KKHA 1PSDA 1J5OA 2F9DA 4URSA 2XEXA 2N7CA 5L9XA 4UTGA 4ID8A 1N36F 1REVA 4OZ1A 2HRTA 4GKJJ 5G0RA 3MECB 4YY3F 4JI2J 3FBEA 4ANDA 2YXLA 2CQBA 4LBHA 2DGOA 2GA7A 1NJYA 1E6VA 3UVJB 4G6VB 5D0EA 3R8YA 3M8ZA 5K8PA 5CCLA 4RW4A 5H9EJ 1QAIA 2CQPA 3FNNA 3RW7A 1ZBTA 1RLDA
chains in the Genus database with same CATH topology
1SC3B 1PAUB 1RWVB 4ZVUB 2HBQB 3KJFB 1RHJB 4ZVTB 2Y0BB 3EDRB 2CNLB 2QL7B 2XYHB 2XYGB 3R7BB 2H5JB 4LSZB 2HBYB 2HBZB 1RE1B 2H65B 2H48B 1RHQB 1RHRB 2CDRB 3P45B 3R6GB 1I3OB 4ZVPB 2QLJB 2H54B 4JB8B 1RHKB 2DKOB 1RHUB 1F9EB 3R7NB 1NMEB 2H51B 1RWPB 1IBCB 4DCJB 4ZVSB 2QL9B 3KJNB 2XZDB 1SC4B 3GJTB 3IBCB 3R7SB 2C2MB 2C2KB 1RWNB 3GJRB 2QLFB 3D6FB 3R5JB 1RWXB 3NS7B 2H5IB 1SC1B 1RHMB 2CNNB 1RWWB 3D6HB 1GFWB 3EDQB 5IC6B 3SIPB 3IBFB 1RWOB 3QNWB 1RWMB 1BMQB 2H4WB 2C2ZB 2XZTB 3KJQB 2P2CB 1QTNB 2CNKB 4DCPB 2H4YB 3P4UB 2CNOB 2CJYB 2Y1LB 2C1EB 1PYOB 3R6LB 3RJMB 3GJQB 3GJSB 1ICEB 2QLBB 1I51B 1QDUB 5IC4B 2HBRB 2QL5B 3D6MB 2C2OB 1RWKB 4DCOB 5K20B 4ZVRB 4ZVOB 2XYPB 4ZVQB 2FQQB 2CJXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC3 B;  1PAU B;  1RWV B;  4ZVU B;  2HBQ B;  3KJF B;  1RHJ B;  4ZVT B;  2Y0B B;  3EDR B;  2CNL B;  2QL7 B;  2XYH B;  2XYG B;  3R7B B;  2H5J B;  4LSZ B;  2HBY B;  2HBZ B;  1RE1 B;  2H65 B;  2H48 B;  1RHQ B;  1RHR B;  2CDR B;  3P45 B;  3R6G B;  1I3O B;  4ZVP B;  2QLJ B;  2H54 B;  4JB8 B;  1RHK B;  2DKO B;  1RHU B;  1F9E B;  3R7N B;  1NME B;  2H51 B;  1RWP B;  1IBC B;  4DCJ B;  4ZVS B;  2QL9 B;  3KJN B;  2XZD B;  1SC4 B;  3GJT B;  3IBC B;  3R7S B;  2C2M B;  2C2K B;  1RWN B;  3GJR B;  2QLF B;  3D6F B;  3R5J B;  1RWX B;  3NS7 B;  2H5I B;  1SC1 B;  1RHM B;  2CNN B;  1RWW B;  3D6H B;  1GFW B;  3EDQ B;  5IC6 B;  3SIP B;  3IBF B;  1RWO B;  3QNW B;  1RWM B;  1BMQ B;  2H4W B;  2C2Z B;  2XZT B;  3KJQ B;  2P2C B;  1QTN B;  2CNK B;  4DCP B;  2H4Y B;  3P4U B;  2CNO B;  2CJY B;  2Y1L B;  2C1E B;  1PYO B;  3R6L B;  3RJM B;  3GJQ B;  3GJS B;  1ICE B;  2QLB B;  1I51 B;  1QDU B;  5IC4 B;  2HBR B;  2QL5 B;  3D6M B;  2C2O B;  1RWK B;  4DCO B;  5K20 B;  4ZVR B;  4ZVO B;  2XYP B;  4ZVQ B;  2FQQ B;  2CJX B; 
#chains in the Genus database with same CATH topology
 3UFC X;  9RUB A;  3SCI E;  5CZV A;  2HQD A;  4LRA A;  4ERD A;  1HNX J;  4USU A;  4KC5 A;  2R2U A;  2K7J A;  2KT5 A;  3JSY A;  1GK8 A;  5B0G A;  3V4I A;  3CJT A;  4OMF G;  4QR1 A;  4ZVT B;  3OTD A;  3PY8 A;  5LL6 d;  1SH2 A;  2LYV A;  2QLX A;  5J1E A;  4F4Y A;  4K0K J;  2NCK L;  4OYX A;  1Q95 G;  1FKP A;  3PKY A;  4LSZ B;  4DU7 A;  3V6D B;  3BF4 A;  3HFV A;  2P6S A;  2QT7 A;  2V2V A;  2X51 A;  3EGV A;  3MM7 A;  4LRB A;  2VG6 A;  2PFD A;  2YH1 A;  1S9F A;  3LWL A;  4KFB B;  1QUV A;  1NK9 A;  1VRT A;  1YHQ S;  5HVF A;  3W61 A;  2BZ2 A;  2D41 A;  1KOO A;  1JLF A;  2GAH C;  3QGG A;  6AT1 B;  5DQG A;  3BO3 A;  1FRI A;  3I0R A;  3QWU A;  1T03 B;  3SZ2 A;  3U7J A;  1RSC A;  5HJY A;  1V5I B;  2IMW P;  2DEJ A;  5KFS A;  3N6L A;  2HRY A;  4BC9 A;  1HPZ B;  3FMB A;  4DSF A;  2ATC B;  2XNQ A;  3NMA A;  3PW0 A;  1L3T A;  1CG2 A;  4X4U A;  5D4P A;  4CTA A;  2E1P A;  4I7F B;  5F0W A;  3OTO J;  3OR2 B;  2B9X A;  4NLY A;  3OPK A;  3MTJ A;  1JLA B;  2OEK A;  2RU9 A;  1D3W A;  4RW8 B;  3CPW R;  5FD1 A;  4CT9 A;  4K0K F;  1S7H A;  3IBC B;  5HO4 A;  1QSS A;  4FS2 A;  4OI4 A;  2UV8 A;  4GC7 A;  1VQN S;  3GJR B;  4DQS A;  2DHA A;  4RW4 B;  3HX9 A;  4USJ C;  1U45 A;  1DFD A;  1FFW B;  1JLB B;  2EK6 A;  1SC1 B;  3FVY A;  4J9N A;  2J6S A;  2ACY A;  2DGW A;  5KT3 A;  4LF8 J;  1EB0 A;  3PRV A;  4Q0B B;  1MML A;  2QA2 A;  2CQ4 A;  1XWL A;  1JLE B;  1KDN A;  2N4C A;  2IYG A;  2KZZ A;  4M8L A;  4CZC A;  3SV4 A;  1N52 B;  1SQE A;  1JNZ B;  1TL1 B;  1TQL A;  2MJU A;  4I6Y A;  2ZH8 A;  3FK4 A;  2OJ3 A;  2ILZ A;  2HVI A;  2A6O A;  3OFH A;  1LW2 B;  5I3U A;  4IFV B;  3X3U A;  1REG X;  1FF2 A;  2GQC A;  2W24 A;  3CD0 A;  3GII A;  1RTD A;  1LKZ A;  1RJJ A;  3NLC A;  1GXT A;  4F8R A;  1M5O C;  4KFB A;  2AMC B;  4QWA A;  1FJE B;  1VRT B;  1X5T A;  2EPI A;  1LXJ A;  4LT6 A;  3EUN A;  5DJB A;  4CRJ A;  1AXQ A;  4DCP B;  4JI7 F;  1PAE X;  5B0B A;  3BS9 A;  3OD2 A;  4LFC F;  3CC7 S;  2V94 A;  2XHW A;  3AB2 B;  4NI2 A;  2KHC A;  3ZTO A;  4IO9 Q;  3Q23 A;  2RSQ A;  2Q66 A;  3ZC4 A;  1KVK A;  4TXS A;  2IAJ A;  1AB8 A;  1QLN A;  1JB0 C;  1Q8I A;  4GKK J;  1YBU A;  2JWN A;  2KG1 A;  3M8Q B;  4LBI A;  2HHQ A;  3C66 A;  2AHO B;  1QDU B;  1UJ4 A;  2WVE A;  2VQE F;  1AT1 B;  1OYE A;  3OUY A;  3FCH A;  2XO7 A;  3MR5 A;  4ZP8 A;  1B0V A;  3TZY A;  3NWG A;  4GO5 X;  1TZ0 A;  3W9J A;  5HMW A;  3OT9 A;  4QR0 A;  2R3V A;  2Z0G A;  4ZJO A;  4NZ0 A;  2RQC A;  1KLM A;  1ROF A;  2GQQ A;  2FD2 A;  4IKA A;  4RW7 B;  4ZVR B;  2RS2 A;  3PX4 A;  1WTF A;  4JOU A;  2VFS A;  3ET6 B;  4OJ1 A;  2YPY A;  5HLF A;  2XYP B;  4IOA Q;  4EZ6 A;  1R3N A;  2AT1 B;  4C8Z A;  3LO3 A;  3E51 A;  1REV B;  1G7C B;  3HSG A;  3CCU S;  2R8H A;  1UL3 A;  1EQM A;  1OY6 A;  3Q8S B;  1ZPV A;  2HND A;  1R0A A;  3C14 B;  2DY1 A;  2ZUA A;  2VBW A;  1IKX A;  3DOK B;  1NJI T;  1FEE A;  1S76 D;  3DM2 B;  3TEG A;  1VQ4 S;  4TN2 A;  1Q5Y A;  2BJ1 A;  2F4V J;  5AE1 A;  3IAM 9;  4FF2 A;  3RZA A;  4LF6 F;  3TX8 A;  4ZN3 A;  2B4V A;  2Q3P A;  3SCJ E;  3OFE A;  1DJ0 A;  3BSC A;  3R7B B;  5KG3 A;  4W4M A;  1WEY A;  3GON A;  5KFM A;  3MOZ A;  2GQ2 A;  2GIQ A;  4KGV B;  4KO0 A;  3ZTS A;  3QQC D;  3HO1 A;  1PCA A;  1X5O A;  2B3T B;  2BBE A;  2EG2 A;  1ZM4 A;  3FQK A;  2KXF A;  4HI1 A;  3TA2 A;  3KMS A;  3EX7 B;  3BGR A;  4ED3 A;  5IT4 A;  2HQI A;  2NLW A;  1MU2 A;  2IM0 A;  1UVK A;  1NDL A;  2YWH A;  2D3U A;  1S48 A;  2V8P A;  3JTN A;  3MEG B;  3R5A A;  5LJ3 Y;  3MPY A;  3HVT B;  1GXU A;  3PDN A;  3CJ8 A;  3LUY A;  4H4O B;  4IG3 A;  5KFU A;  3PW5 A;  3N28 A;  3VV2 B;  4YDX A;  3VGV A;  1U2F A;  1GMW D;  3Q8V A;  4CLS A;  2J0W A;  3SQG B;  1HHS A;  1RBO B;  1TL5 A;  4OZ2 A;  4USK A;  1WI8 A;  3W64 A;  1JIH A;  4PG6 A;  3JSR A;  5E3A A;  2FJE B;  1FWP A;  3NP5 A;  4OZ5 A;  3W65 A;  4PYD A;  3AA8 A;  1IBC B;  3TOQ A;  4D3G A;  3AHP A;  1N5T A;  2IVY A;  1RK8 A;  3AD7 C;  3B54 A;  5B0F A;  1HYS A;  2W8K A;  3MPW A;  4R5P A;  1NCL A;  4ZVG A;  2ZZT A;  3M6X A;  4RBV A;  2R7X A;  3KHR A;  1NH8 A;  2C2M B;  2R42 A;  3PKM A;  3TAR A;  1P9Y A;  4F4W A;  3AB4 B;  2XLI A;  3MCM A;  1NSQ A;  4R25 A;  4ED5 A;  3D6F B;  4O3S A;  1I5O B;  2UZA A;  1FCA A;  3I4H X;  4RKU C;  1KQF B;  3W2W A;  4NZ7 A;  4K4X A;  1OO0 B;  4I67 A;  2IPO B;  2JRS A;  3C46 A;  2DIV A;  4OLP A;  4TU8 A;  3R2C J;  1L3U A;  1TAQ A;  3UR0 A;  2F7V A;  4EEY A;  1RTH A;  3VAJ A;  3QZ8 A;  5K5M A;  2DVI A;  2XMV A;  2YWE A;  3BB5 A;  4HHH A;  4NLO A;  1B99 A;  3PW4 A;  5F8N A;  3RG6 A;  3IWL A;  5K8O A;  3ONQ A;  5KFC A;  4Q5V A;  1CVJ A;  1NHV A;  1T11 A;  1KQK A;  1WSR A;  4M5G A;  2KFY A;  1GTE A;  1TVR B;  1J5E J;  4DUY J;  4C8L A;  2H3E B;  1JLQ A;  1DTT B;  1LW2 A;  2DNL A;  3CGI A;  3IBF B;  5I3U B;  1MMN A;  2ADB A;  3VQT A;  2XGQ A;  3RR7 A;  4LIW A;  4L76 A;  1RAA B;  3EVO A;  4PWU A;  2HGL A;  5T7L B;  5KFT A;  1XMO J;  1H73 A;  5F8H A;  2CZ9 A;  3QFW A;  4RW9 A;  1R8B A;  3BBB A;  2GX8 A;  1TL1 A;  5HMY A;  4ILL A;  4KHP J;  5J2Q A;  4OYP A;  5BYS A;  8ATC B;  4F50 A;  5B0E A;  4PPD A;  3UVJ A;  3IFE A;  5KG7 A;  2QA1 A;  4U95 A;  2VBZ A;  3AXM A;  4N47 A;  1Y4Z B;  4A47 A;  2RDJ A;  4CYU B;  2VHG A;  3CME S;  4V19 X;  3FDS A;  1TL4 A;  4IDK A;  3VHQ A;  4C98 A;  1PYO B;  3VAI A;  8AT1 B;  2M0G B;  5C7P A;  4WKY A;  2V34 A;  3NRB A;  1H2V Z;  3M32 A;  3MFH A;  2B9E A;  1IBL F;  4IR1 A;  4KGZ B;  1F3F A;  5A0Y A;  1PG5 B;  3MUM P;  1RT7 B;  1HWL A;  5HI7 A;  1NKE A;  4P52 A;  3G8Q A;  4EZ9 A;  3KOA A;  3C3L A;  5HMZ A;  2ZKU A;  4X65 J;  2BQR A;  2AYB A;  2BE2 A;  5KT6 A;  3K58 A;  4K2X A;  5E3C A;  4F25 A;  4J91 A;  4URG A;  5GMD A;  5E41 A;  2ZZM A;  2VFU A;  1KLM B;  4FYX B;  2M2B A;  1HPZ A;  2OPQ A;  4ZVO B;  4J90 A;  4J9U E;  4RW9 B;  3G6V A;  2YQ3 A;  2DJW A;  2F8M A;  5FDL B;  3R27 A;  3OFF A;  4P75 A;  3HKW A;  3SDE A;  2W9B A;  2IA6 A;  1PAU B;  2HVE A;  4P72 A;  3MOJ B;  1HFE L;  3UDL A;  2OTL S;  1B0P A;  2BA9 A;  1SKU B;  4ZA1 A;  2GW8 A;  2J6U A;  1LEO A;  1S79 A;  4QQB A;  2AGQ A;  1TK5 A;  1UVJ A;  3SFU A;  3HI9 A;  3FEY B;  2MDA A;  2NPI A;  3NBP B;  3F56 A;  4USM A;  5DQH A;  4Y0F A;  2U2F A;  2W2N P;  3E01 A;  2R7T A;  1AFI A;  1RKJ A;  2A0F B;  1OMS A;  3TZX A;  1D8Y A;  4LRF A;  2W2M P;  3JAM U;  1N6Q B;  3LPY A;  2LXF A;  4Q8E A;  1FVQ A;  1WHX A;  1WOR A;  2HFO A;  2VIC A;  1QJH A;  5CYJ A;  2DIT A;  4H4M A;  1EET A;  1YWX A;  3IR7 B;  2H48 B;  2A2C A;  4MIW A;  3M8S A;  4TY8 A;  2BJE A;  2F63 A;  4MKB A;  1F60 B;  1RHR B;  3QGP A;  4ECV A;  4L74 A;  1FJC A;  3P49 B;  1S1W A;  1YLX A;  1KTQ A;  1U0H B;  4JB8 B;  4P9S A;  4G3I A;  1N56 A;  2J0Q D;  2HUR A;  3GYN A;  4DPO A;  1C1B B;  1A6L A;  1RTI B;  3UD5 A;  2CPJ A;  4LR8 A;  1WOS A;  2HMI A;  2X1F A;  5EN1 A;  1WF0 A;  3WC2 A;  3KNA A;  2BEF A;  1R31 A;  3EVM A;  5HVH A;  3H25 A;  2BJ3 A;  2ZHA A;  4C97 A;  3OL9 A;  2LKZ A;  4WP9 A;  4DV2 F;  2HFV A;  2R9L A;  5LMU J;  3CJ0 A;  3GMG A;  4Y00 A;  4QWE A;  1X4A A;  5DM7 Q;  3W2V A;  3GJT B;  4ZP6 A;  4JV0 A;  4X4R A;  1U1L A;  1FNX H;  5HSP A;  1D9D A;  1K1Q A;  3B82 A;  4G1Q A;  4DPW A;  1SH0 A;  2FHM A;  1SIW B;  5KFL A;  1HNX F;  2OIH A;  3BSN A;  4ZJL A;  1PC4 A;  4X4N A;  1NM2 A;  4FPI A;  4ILM A;  4B17 A;  3G4S S;  2WCX A;  5IV4 A;  1X31 C;  3BR8 A;  4DBQ A;  1U6B A;  1F1B B;  3V6J A;  3TW0 A;  3C15 B;  4P7T A;  1HMV B;  1LWE B;  3HHL D;  2LP4 A;  3SFG A;  4A8W A;  2V8H A;  2IRX A;  2QYC A;  3DOL B;  2PI5 A;  2AW0 A;  3E01 B;  2OFH X;  3GIK A;  1O6X A;  2DO4 A;  4M5D B;  4OX6 A;  4I56 A;  1UKU A;  1SVD A;  1AUD A;  3X1L B;  2KH9 A;  3PIO Q;  4TKT A;  2VH7 A;  3W9H A;  2KN4 A;  1NDK A;  4CH1 A;  3G8S A;  3E2E A;  3M4X A;  1YG0 A;  2CG4 A;  1YRU A;  2P2C B;  1VJQ A;  4TY8 B;  3K7R A;  2MJN A;  1IKW A;  4OYO A;  4J9P A;  2R8J A;  2UXB J;  4ZIW A;  2B5J B;  4ZPW R;  1Q79 A;  1FDD A;  2B9W A;  3HHD A;  4CTA B;  2B51 A;  2DHH A;  2RKI A;  1G2E A;  1PJ7 A;  3J81 Y;  4ED0 A;  4ITS A;  2Z58 B;  1TUW A;  9ATC B;  2GHP A;  3VZH A;  5IWA F;  5MAO A;  4Z7C A;  1DTQ B;  1NDC A;  2IJF A;  2B7C B;  2EW9 A;  1IKX B;  4Y2M A;  2G2Y A;  4DLG A;  1NAQ A;  3AD9 C;  1X4E A;  5AE3 A;  1M5S A;  2W7O A;  5CZX A;  4MIB A;  4F4Z A;  4KSE B;  1F6T A;  4NLW A;  2OML A;  2KTQ A;  2ZE2 B;  4RLE A;  3CED A;  3Q8R B;  2HK3 A;  5IC4 B;  2UU9 F;  1H2U X;  3H5X A;  4M5D A;  2QL5 B;  3TZZ A;  4MMO A;  2V4J B;  4C8M A;  1CLF A;  4UUW A;  2HK2 A;  3M32 B;  3I87 A;  5LSO A;  1RWK B;  5D77 A;  3CD7 A;  2UVW A;  3W66 A;  4JI3 F;  1Q7L B;  5DZ7 A;  2B43 A;  3QFH A;  4Y2K A;  5CYQ B;  5CH7 B;  2UUC F;  3N79 A;  1XNQ F;  4ED6 A;  5IM0 B;  4O3Q A;  3GYG A;  4B3T F;  4KPC A;  3HZG A;  3HLU A;  3P5B P;  2DR7 A;  1JJC B;  2FLL A;  3VAK A;  3EM1 A;  4CLK A;  3M9M B;  3A8E A;  2HWH A;  3B6B A;  4ZPD A;  2PGC A;  1AZS A;  5AXK A;  2ZJR Q;  3TX0 A;  1YK9 A;  3N9U C;  1K73 T;  3CC2 S;  2Y0B B;  2J7U A;  1ZM3 A;  2Z57 B;  4G65 A;  5IQ6 A;  2VOO A;  4PPZ A;  4WWS A;  3KK3 A;  4WFB Q;  1T9T A;  3QYY A;  2L9D A;  4KY3 A;  2JC1 A;  4K5S A;  4I6A A;  4HI2 A;  2V8V A;  4B9S A;  3CCJ S;  1VGY A;  2AP6 A;  3DU6 A;  4ED1 A;  3Q8Q B;  3CNQ P;  5DGA A;  2E1C A;  2RH3 A;  3MEC A;  3ZFV A;  4Y2I A;  3WHI A;  2YH0 A;  2R8G A;  3MCO A;  1ZTW A;  2W4P A;  1UVN A;  1S5Z A;  1N5S A;  4UOC A;  4MTP A;  4QZV B;  4KPY A;  1YSJ A;  3KLF A;  1KS2 A;  4LQ3 A;  4DXL A;  1NBE B;  3K89 A;  1Z1Z A;  2M70 A;  2VAS A;  2R7V A;  4RO0 A;  4DR5 F;  2KL8 A;  1FO1 A;  1YQH A;  2QEX S;  2DGV A;  1BXN A;  1SV5 A;  2B9Y A;  1VDH A;  4RNM A;  4GC6 A;  3NS5 A;  3TUZ C;  2YKM B;  4XTT A;  3LP1 B;  4DR3 J;  3MGJ A;  4LF9 F;  4FF4 A;  2E7V A;  4UF4 A;  2B4P A;  2VUG A;  4QIG A;  5A8W B;  3F73 A;  2VJU A;  4IQX A;  4ZPA A;  2K1R B;  3TQE A;  2R8K A;  3HD1 A;  3R5D A;  1APS A;  1T94 A;  2GHV C;  3DYA B;  4I2P B;  2QA4 G;  1R6Y A;  2U1A A;  4MIA A;  1M5V C;  3JTP A;  3EVW A;  4DJB A;  1QSL A;  6FDR A;  3I56 S;  1OPZ A;  5JXS A;  4N8N A;  5ETL A;  1SH3 A;  5HBM B;  3RU0 A;  4UOH A;  2YWW A;  3W2W B;  2DCL A;  2BW7 A;  2DNQ A;  2R2T A;  3QIP A;  1RWX B;  4PYA A;  2ERR A;  2JHE A;  3DLG A;  2CQ1 A;  2E5L F;  2G4B A;  1MRO A;  3CJK B;  2ZM6 F;  4K4W A;  4ES1 A;  4M5N A;  4AXJ A;  2LCW A;  4AXI A;  2OEJ A;  2PA8 D;  4HVZ A;  2C2E A;  2AJ2 A;  5ETO A;  4J9R A;  1RAD B;  4ES3 A;  2CNN B;  2G2O A;  1ULR A;  3A3N B;  2KYX A;  3JQK A;  2CQ3 A;  4ANC A;  1HNW J;  2MLZ A;  5ETS A;  4PWW A;  1M5H A;  1XNQ J;  1JKH B;  5KG2 A;  4DR7 F;  1XR6 A;  4LF1 A;  3EDQ B;  4RL1 A;  1UZH A;  1S12 A;  1BLU A;  4OJ3 A;  5ITH A;  4E2F B;  4NX9 A;  3DLL Q;  2XM3 A;  3W5X A;  3MAH A;  4M63 A;  1RAH B;  4X4P A;  3NL0 A;  1Z2Z A;  2Z2M A;  2KT2 A;  4ECS A;  2NUH A;  2RF2 A;  3R5C A;  4PAB A;  2YX4 A;  4NLQ A;  2OP5 A;  2W01 A;  2HAI A;  4ZJQ A;  1CUL A;  1R6V A;  3J80 Y;  3BKF A;  3G86 A;  2FVP A;  4QWD A;  1MU2 B;  3ZZP A;  1FER A;  3NWR A;  1FWK A;  2V2K A;  4RJV A;  4OYI A;  1ACM B;  2MQQ A;  4CYU A;  4DL5 A;  1WTB A;  4KR0 B;  3ILO A;  2ASD A;  2A6M A;  1TFW A;  1FA0 A;  3R6L B;  4YHH F;  2MKI A;  4CQ1 A;  3DHW C;  4M5L A;  3H40 A;  4JI4 F;  3VAH A;  1ICE B;  3WZ0 A;  3D1H A;  4J9M A;  1Y3J A;  4X4S A;  1VC6 A;  4Q2M A;  2HHP A;  1SCJ B;  4WK1 A;  3ZNU A;  3M7V A;  1I51 B;  1FXR A;  1VFJ A;  3OLB A;  5CCM A;  3BR9 A;  1QVG R;  1HNZ F;  1BQN B;  2WOM A;  4M95 A;  1LWF A;  3UD3 P;  1FRK A;  1OJ4 A;  3RRK A;  5DDR C;  2UVU A;  1AFJ A;  1GX5 A;  1Q82 T;  2IYI A;  4P6Q A;  4DG1 A;  3HMJ G;  4ENO A;  2EBG A;  4PQA A;  3VAF A;  1N33 F;  2E1M C;  2ZZN A;  1K44 A;  1VYA A;  1H98 A;  4A8X A;  2KG0 A;  3MEE A;  2L9N A;  2R7O A;  2X3G A;  1CJV A;  2MZT A;  3DOM B;  3QBC A;  2W2Q P;  4FP9 A;  4ZS6 A;  4A8Q A;  3DCA A;  4QW8 A;  4DR2 F;  3MPV A;  2YNF A;  1JWW A;  3R9L A;  4ELV A;  3IRW P;  1EZZ B;  3DN9 A;  5E3R A;  5GAG I;  3O8W A;  4NAS A;  4NLV A;  5D3G A;  3MMC A;  2BQ3 A;  3AQP A;  5LSL A;  5L1L A;  1S0M A;  4B3O A;  2EK1 A;  4R0J A;  4JI2 F;  2FJB B;  4YY3 J;  1Q0N A;  3H5Y A;  2JVO A;  3I55 S;  2E7X A;  4FXV A;  1KOH A;  2AJ0 A;  2G1D A;  2VC0 A;  2Y1R I;  5MLC V;  2CRL A;  1XMB A;  3FFI B;  4DR7 J;  2NXN A;  2Z4P A;  3CWJ A;  1CBK A;  4RWW A;  3J7Z T;  3K8V A;  3HJV A;  4N56 A;  1I1G A;  4R0E A;  1L3V A;  1HW8 A;  1R0C B;  3AJ1 A;  3P45 B;  4IFY B;  4OHX A;  1X7V A;  3EPI A;  3HFZ B;  1H38 A;  4X66 J;  4RUA A;  2WSE C;  3OR2 A;  4M5I A;  2MHE A;  3MM8 A;  4ALZ A;  3MEE B;  3HSZ A;  3QGH A;  3FBC A;  1JJH A;  2OO4 A;  3R7N B;  2YNI A;  1TKZ A;  3NOG A;  3C15 A;  1RWP B;  3LP1 A;  3GFZ A;  3TEH B;  2ZUG A;  4ANE A;  4B3R J;  1NLK L;  2HQG A;  2D3O R;  1E6Y B;  3N4W A;  1Y10 A;  5B08 A;  4DV1 J;  1LWF B;  3UCZ P;  1N32 F;  3C6U B;  1VR6 A;  3HVW A;  4OYM A;  3W5Y A;  3HT3 A;  1Y0H A;  3KDO A;  3W63 A;  2I6W A;  2HIQ A;  3UI3 A;  5B09 A;  5HL7 Q;  2XLK A;  4X4Q A;  4CH7 A;  1FRJ A;  4A8O A;  4PRF A;  4N7T A;  5KFY A;  3KWM A;  3SBM A;  2XY5 A;  4ZCL A;  4DL2 A;  2X1G A;  2EC2 A;  2IJN A;  2ZWP A;  2KJV A;  4OZJ A;  1LXN A;  3C16 A;  2JNJ A;  3CJ4 A;  4RUB A;  2WAQ D;  2AEJ A;  1WC1 A;  4NWB A;  3Q0A A;  2JJ4 D;  1IR0 A;  2OPP B;  4LFC J;  3LGH A;  2I5J B;  4F26 A;  2CFX A;  4O44 A;  3KLG A;  2XY6 A;  3LP0 B;  2KM8 C;  4JI5 J;  3MR6 A;  1ZOT A;  3DXB A;  1PKU A;  1JK9 B;  1FT8 A;  1DAR A;  2GIF A;  2MZJ A;  2HLT A;  3TA0 A;  4TQR A;  3OW2 R;  2E5J A;  2CJQ A;  3CCZ A;  3OR1 B;  3SDE B;  2W9B B;  1NK7 A;  2DH9 A;  4RX6 A;  4OZN A;  4KE5 A;  4DX6 A;  3OHA A;  2VQF F;  1S1W B;  3Q2S C;  5FLX Y;  2W8L A;  4LF4 F;  2ZKT A;  5ADZ A;  3QPI A;  1F5B A;  3TVY A;  2VBY A;  3UN2 A;  2DTJ A;  1UA0 A;  3QT6 A;  1JKH A;  3KK2 A;  3ZZT A;  1CJK A;  1RAI B;  3VZI A;  1HHQ A;  2QTW A;  5DG7 A;  1T05 A;  4EK2 A;  2E5L J;  2H4Y B;  3GIM A;  2XS2 A;  1S6Q B;  4IQM A;  1VIX A;  1T3O A;  3CE8 A;  2KT3 A;  1FD8 A;  1RA6 A;  2G0C A;  2I2Y A;  1UVM A;  4DZD A;  4WZM A;  3BPS P;  3GTY X;  1F9H A;  1YRX A;  3FEZ A;  3OQ2 A;  1VJW A;  4V1A k;  2HQF A;  3RJM B;  2RE1 A;  1C1B A;  1EP4 B;  1RTI A;  3BQ2 A;  1Q86 T;  1IBM J;  3DRP A;  4O4R A;  3V5R A;  3I4P A;  1UFL A;  1X4G A;  3UDC A;  4DFJ A;  3HK2 A;  3RTV A;  5K8N A;  3QT5 A;  4J9V A;  2DNY A;  2QLB B;  2NR0 A;  3ISZ A;  2ZH3 A;  3CB4 A;  2AJF E;  5C25 A;  4F0H A;  1XEZ A;  2DH8 A;  1NPP A;  2XI3 A;  4ZPB A;  4WU3 A;  2KU7 A;  2MKC A;  3Q8Y A;  4OI2 A;  2R2R A;  3RB0 A;  3LOU A;  3S8S A;  4QPX A;  5KFN A;  2E5H A;  2NQP A;  1ZM9 A;  1AW0 A;  3ZNJ 1;  1Y00 A;  1FFG B;  5GAG U;  1U7L A;  1NK5 A;  2RUG A;  3CDE A;  1HQ2 A;  1JLF B;  2JDJ A;  1JLQ B;  1X4F A;  1HQE B;  2V8G A;  3LQV A;  4HL9 A;  4M1K A;  4KGX B;  5IV3 A;  2BJ8 A;  2HVD A;  4YHH J;  2Z30 B;  1HI8 A;  1CJV B;  1NH7 A;  2CG8 A;  3DOM A;  3MCS A;  1WF1 A;  3VVU A;  3KHH A;  3K0J A;  2PD1 A;  1HI1 A;  3BSA A;  1NUE A;  1RT3 B;  2AQ4 A;  4KTQ A;  3PEH A;  3FSI A;  2GV1 A;  3EDR B;  1SXL A;  2D9O A;  3M8P B;  4OIX A;  3EMT A;  3O2I A;  4ZLP A;  1NRK A;  1PBU A;  2J7W A;  2XYH B;  3D1O A;  5A8W A;  2XMT A;  1SKS A;  4LF5 J;  5H9F J;  4CLL A;  4QBU A;  1YRT A;  1JXL A;  4TYB A;  4J9S A;  4FBU A;  3JS9 A;  3BKU A;  2HYI B;  5HQM A;  3W3S A;  1CJU B;  4NCB A;  5FJ4 A;  2HZA A;  3IM8 A;  1GMW A;  2VFV A;  1X0P A;  1KNZ A;  3FSX A;  4RNH A;  5HRO B;  1Y7P A;  2ZH1 A;  5C42 A;  4I69 A;  3TP2 A;  3EZ5 A;  4CM0 A;  4DV5 F;  1RT6 B;  5AE2 A;  3AJ2 A;  2QZ8 A;  1JLG A;  2NXC A;  4PQU A;  4R8U A;  3FSY A;  3H4D A;  3DGP A;  1NME B;  5DZ6 A;  1U1N A;  4HT7 A;  1OWX A;  4LQ9 A;  5G4D A;  3MMB B;  4DCJ B;  5KFF A;  2GO8 A;  4TU9 A;  3HT0 A;  3G71 S;  4JI1 F;  2J0S D;  3NCQ A;  3PEJ A;  3TAM B;  5HBM A;  4EGL A;  3HP6 A;  2ZJQ Q;  2UUC J;  5ETQ A;  3HHL B;  4LFB J;  3GP9 A;  3AA9 A;  1RAC B;  1ZPW X;  2D9P A;  4PAA A;  3SQO P;  4URQ U;  4JI6 F;  5KFZ A;  2LEC A;  1OS5 A;  3RBD A;  1T95 A;  2XMK A;  1W7W A;  3GU0 A;  4ZHR B;  4OX9 F;  2JEF A;  4JI0 J;  1TFY A;  2OPR B;  5A6P A;  2ADC A;  1EET B;  2MY7 A;  1B7Y B;  3BKT A;  4F4A A;  5KT4 A;  3OL6 A;  1IBK F;  1E6Y A;  2Y8Y A;  4NXM J;  1GQE A;  2P9E A;  2AWZ A;  2MPU A;  5CYM A;  4AE5 A;  2CQI A;  2QSF A;  1MW7 A;  2KRB A;  4S0M A;  2QGF B;  2X1B A;  2RUS A;  2YNI B;  2PSZ A;  1RT3 A;  3FEX B;  3I0S B;  1IUJ A;  1QD1 A;  3MWB A;  4DQP A;  4YB6 A;  2EVZ A;  2CPD A;  2PMZ D;  3P5T L;  5IC6 B;  1VBK A;  3MR3 A;  2CKW A;  3PW7 A;  1NZ8 A;  4OZ0 A;  1IKV B;  3RRH A;  2WSC C;  2CA9 A;  3M8R A;  3E8O A;  1YJU A;  3FZB A;  2V5H G;  4DPU A;  2WBR A;  4RW7 A;  1KQS R;  2DHG A;  2ZH7 A;  5DLF A;  2OD6 A;  2CZV C;  1M1K T;  1LK7 A;  1S7I A;  4ZIT A;  3WIU A;  1HBU A;  2IA0 A;  2EBE A;  4AL5 A;  3OUY B;  2EG1 A;  3V4M A;  3P4U B;  2IVM A;  2VDI A;  1X9W A;  2HHS A;  5EWF A;  2XMJ A;  5L1J A;  3UDE A;  1MWZ A;  2EFG A;  1W2I A;  1H72 C;  2DYA A;  4H4K A;  3OXG A;  4DS4 A;  2ZFH A;  1M90 T;  1VI7 A;  4D3H A;  3T19 A;  1GH8 A;  4C7Q A;  3KLF B;  3IRX B;  3G8T A;  3VAM A;  2MZ1 A;  4EO8 A;  4DUY F;  2NXU A;  3HHN B;  3UW1 A;  3MTK A;  3M05 A;  2VB6 A;  3TAM A;  1SL0 A;  2DPJ A;  3VVT A;  3NY0 A;  2M4M A;  4IDK B;  1S1X B;  5I4M A;  2HHH F;  1SUQ B;  1VOM A;  3NCP A;  2QX0 A;  4DR6 J;  4O3R A;  2WVF A;  3KK2 B;  1KFS A;  3MM9 A;  3IP0 A;  1FX4 A;  3LH2 S;  1S0N A;  3OFG A;  2IM1 A;  3BJY A;  3NCR A;  1NSK L;  4DV7 F;  3RAQ A;  3LAL A;  3IGV A;  1IXK A;  3BBC A;  1IKY B;  2UUT A;  2IC3 A;  3DLK B;  4KV8 A;  5E2Q A;  5DG9 A;  4CO3 A;  3MED A;  4DN9 A;  1IBM F;  1PBA A;  2CPE A;  1TL7 B;  1C1C A;  3PCO B;  2DXE A;  4KKO B;  2ZIT A;  1HNV A;  4UT4 A;  1S9G B;  4FPR A;  2VF3 A;  4F3M A;  2VJV A;  1VHI A;  1RHJ B;  1S10 A;  2O3D A;  3OVA A;  1QTM A;  1FK9 B;  1S1U A;  1UVL A;  4UOF A;  4RUH A;  3PRB A;  2XGP A;  2XMM A;  5JJB A;  1NK4 A;  3OL7 A;  2LXU A;  3IWX A;  4LR9 A;  4ZVE A;  4R5P B;  2BDP A;  3QJP A;  4PG4 A;  3HSJ A;  3BGU A;  1VIO A;  4CM2 A;  2Y8W A;  1VCT A;  2XB2 D;  1NU4 A;  2JLF A;  2V4J A;  4NI2 B;  3G6E S;  4EBE A;  2RHS B;  5I3Q A;  2YTC A;  3PO4 A;  1W25 A;  2BRL A;  2CPI A;  3MF5 A;  5CD4 H;  1KON A;  4JP8 A;  1RHQ B;  2ZE2 A;  3V4I B;  2DNG A;  4EMD A;  2H54 B;  5KFH A;  1D1U A;  1HQU A;  5C42 B;  1RTD B;  3PYF A;  3P96 A;  3BDE A;  4LFA F;  4J7C A;  1S6O A;  1TKZ B;  1N34 F;  1RQ0 A;  1RAJ A;  2RAQ A;  4B08 A;  5M2R A;  2GS8 A;  2QFJ A;  3UR3 C;  3LGN A;  5EWE A;  3QRQ A;  5GAD U;  4NYZ A;  5IT9 Y;  4DL6 A;  2UUB F;  4CNY A;  1R8C A;  2NXE A;  1RU1 A;  4NLU A;  4PZV A;  4BWM A;  3MMA B;  2DIU A;  4B9T A;  2IJR A;  1SUQ A;  4NLG A;  4X4V A;  3SSS A;  3BQ0 A;  4P2M A;  4OX8 A;  4J9K A;  3BM7 A;  2YX7 A;  5EDW A;  3JYT A;  3CD6 S;  3CSK A;  2UV8 G;  5B7W A;  3KNG A;  1EP4 A;  4K4Z A;  3JSB A;  2V9W A;  2K06 A;  5I42 A;  3EJM A;  1VQ7 S;  3R5J B;  1VMB A;  1UP1 A;  1HBN B;  2OUG A;  4C8K A;  4I4B A;  3CIM A;  1S6Q A;  1X8D A;  2I1R A;  2J0X A;  4OI0 A;  4B3O B;  2HKE A;  1FRM A;  3S1T A;  1U2R A;  3WQP A;  3C6T B;  4AQY F;  5U47 A;  2UVV A;  2HLU A;  3K5N A;  4DV7 J;  4H4K C;  3D6H B;  3EZO A;  4NLX A;  2XSF A;  2MZS A;  3TAP A;  1FJ7 A;  1U1P A;  1N5Q A;  2OI2 A;  3IS9 A;  4CCH A;  2R7S A;  3HUL A;  4DV0 F;  2QO3 A;  4WYL A;  1FHT A;  3MMC B;  1X9M A;  5THW A;  3QT8 A;  1RWO B;  1FDA A;  3DOK A;  3MM8 B;  2LEP A;  2WSF C;  3IM9 A;  2C3U A;  4OZL A;  4F4X A;  2AD9 A;  4OYB A;  3BPD A;  4ZHR A;  2KYZ A;  3PR5 B;  3FKB A;  1OY9 A;  3M2U B;  3QLH B;  3QSI A;  1NK6 A;  1WHW A;  2ABY A;  1RCX B;  2J9D A;  4Z37 A;  4KJI A;  3HKZ D;  3P3D A;  1ZA2 B;  1UCN A;  1U0S A;  2I8E A;  1MLA A;  2OFG X;  3IWN C;  4XIU A;  2FB0 A;  4DV6 F;  2JEI A;  3O44 A;  3MM5 A;  1PO6 A;  1DRZ A;  2J6T A;  4F4K A;  2D74 B;  3H98 A;  3RBE A;  2HGM A;  1S9E A;  5T41 A;  1ELO A;  4LRE A;  5KG4 A;  3T1Y J;  2AGO A;  5K9F A;  5HAN A;  2CPX A;  1UFK A;  3QMQ A;  3MUV P;  4QYZ K;  2WHO A;  2HHV A;  4DEZ A;  2E5G A;  2FVQ A;  2Z2Y B;  1PJ5 A;  4IFV A;  4N77 A;  5HRO A;  5FLX U;  4DFK A;  3DI6 A;  4F0K A;  1NSP A;  1CQM A;  2C3O A;  4WFN Q;  3PR4 A;  2CQG A;  4WYW A;  4RU9 A;  3NAH A;  1N6Q A;  3FRY A;  1RWU A;  2C2O B;  1RP5 A;  2KXH A;  3FQL A;  3RB3 A;  3F44 A;  1E6V B;  3ETM A;  3VAG A;  1O51 A;  2UUB J;  2XS5 A;  4F67 A;  4NMX A;  2DY9 A;  3MM9 B;  1U2C A;  1D09 B;  4N76 A;  2NZ4 A;  2KFN A;  1SJ4 P;  1UW9 A;  2ZH4 A;  4ZVQ B;  1NJX A;  1NPK A;  3WX4 A;  3CCQ S;  1S99 A;  2V4R A;  1S1X A;  2LEB A;  1RAO A;  4DQQ A;  1HI0 P;  2CIM A;  2DGT A;  1QY7 A;  2MTL A;  3MFI A;  1BQN A;  4DUT A;  2PDA A;  3KLE A;  2ZVS A;  3DLJ A;  3HD2 A;  3KJF B;  2MMY A;  1S9E B;  2Q1L A;  3G82 B;  5L9N A;  2MB0 B;  3KLI B;  1ZM2 A;  4M5K A;  1JMT A;  1G6B A;  4CLP A;  4RUC A;  3CIZ A;  2E5I A;  2K3K A;  2YKP A;  3KMQ A;  3POT B;  4AQY J;  2BM1 A;  2CUY A;  3HHL C;  3UNG C;  5KT2 A;  4PUO B;  4DS5 A;  2XI2 A;  2FJV A;  2BQU A;  1KVJ A;  3T5L A;  4CT8 A;  3IC1 A;  2UVR A;  2N3L A;  1WEZ A;  1X4C A;  2VD3 A;  4KYZ A;  3OSN A;  4UY8 T;  2LQ5 A;  4C3M A;  4ZK7 M;  4N5S A;  3RW6 A;  4I6W A;  3CCE S;  3Q8U A;  1N88 A;  4LIR A;  5T14 A;  2PA3 A;  2VBX A;  2W25 A;  2HQ3 A;  2IBO A;  3CXC R;  3ENV A;  3EE3 A;  2GO9 A;  3W2V B;  1SQG A;  2CQC A;  4ELU A;  1JLA A;  3IGN A;  1LWC A;  3GIL A;  1N36 J;  1WJ9 A;  2NYI A;  1KTV A;  3IO1 A;  2ZBC A;  4C3L A;  1NJZ A;  2DNK A;  5L46 A;  3ET6 A;  3JTO A;  5HQ8 A;  1KEK A;  3M9O B;  1X0F A;  3Q22 A;  3ENQ A;  1WSV A;  4I7F A;  4CI0 B;  1YJ9 S;  2PMW A;  4LR7 A;  1MSW D;  4U6P A;  4FXD A;  1YDL A;  1UVI A;  1N8R T;  2EC0 A;  1D8Z A;  3J7Y U;  4B3M J;  2XY7 A;  1FE4 A;  4I1T A;  4C8O A;  2D69 A;  2PO4 A;  3BGL A;  1KLN A;  2BE9 B;  3KUH A;  3K5O A;  1B70 B;  1QSY A;  1NEE A;  4PG8 A;  3M2V A;  2P9C A;  2M3D A;  3GV8 B;  2OPR A;  4MKA A;  5KFK A;  3OSP A;  1GTH A;  2W4C A;  4ICL B;  4LF7 J;  3QJL A;  1ZAV A;  2R2S A;  3IR5 B;  4AD6 A;  2OGU A;  4JI7 J;  3IAS 9;  1U48 A;  1HR0 J;  1TMM A;  2JOQ A;  1NDP A;  1RT4 A;  3QJJ A;  4DU8 A;  2HW3 A;  1SL2 A;  1EHW A;  2B7B B;  3R5B A;  5KG6 A;  2BAB A;  1S1T B;  3FCW A;  2RU3 A;  3DRS B;  4WIQ A;  3TNV A;  5M2U A;  3CVK A;  3DLE A;  3H0P A;  4ER8 A;  2UP1 A;  2E9R X;  4G1I A;  5J2P A;  1RT2 A;  3N5F A;  3CW2 C;  3VGS A;  4X4T A;  4TY9 A;  2DNO A;  3LTO A;  4DI6 A;  1I94 F;  3EYZ A;  4WXO A;  2VQE J;  2H4W B;  2XSJ A;  3TVK A;  5JMN A;  4AT1 B;  2FVC A;  3QAU A;  3IMQ J;  2HWT A;  2P9G A;  4C48 A;  1C4A A;  3GE9 A;  3WDO A;  3R2D J;  3T9Z A;  1LOU A;  3JQM A;  3P8B B;  2R7Q A;  5FII A;  1ZAX A;  4QIW D;  4I2Q B;  2RD5 C;  1LWC B;  3O1L A;  3C16 B;  3PHT A;  4DV3 J;  5D8H B;  2RRA A;  3NG8 A;  2ASY A;  1Q4R A;  3EXY A;  2HAF A;  5A8K A;  1H2T Z;  4IUF A;  2E7W A;  1ZYQ A;  2BX6 A;  2AX0 A;  2VZ9 A;  3NGT A;  1BQM A;  5D0R A;  2D7S A;  2JFD A;  2JEG A;  2IFX A;  1YJ7 A;  4OYW A;  1TU0 B;  4OX9 J;  3PRD A;  4KV8 B;  1U0H A;  2GJ2 A;  4TNO A;  4LF6 J;  4FYV B;  1XIQ A;  1YX2 A;  7FDR A;  3G6X A;  1XER A;  2Y3Y A;  4U7U K;  4YDD B;  2YKN B;  3U1M A;  3D66 A;  4P10 A;  3W8P A;  5HP1 B;  4HH1 A;  3MEK A;  3GZ7 A;  5LMU F;  2GVD B;  1KBR A;  3D0G E;  4P74 A;  3ILJ A;  5CD4 A;  3RBX A;  1DQ8 A;  2W7P A;  4ECY A;  4NA1 A;  3TR5 A;  3I0R B;  2XC9 A;  1T03 A;  1SC3 B;  1SQF A;  1R0A B;  4WF9 Q;  3W60 A;  1FI4 A;  4NPO A;  3HJF A;  2YBV A;  3T6B A;  2QYG A;  2V68 A;  5F8G A;  4ZVU B;  5KG5 A;  2ASL A;  2BAC A;  2V9K A;  3OXF A;  4KGK A;  3ZTP A;  4CNZ A;  5D6G A;  3MAQ A;  1ZA1 B;  4QPT A;  2ZVI A;  1D0E A;  4DL7 A;  4LF7 F;  2WVD A;  2CXE A;  1TUG B;  3DYA A;  4I2P A;  4ES2 A;  2AJQ A;  2CQH A;  4WP8 A;  1EAR A;  1RT1 A;  1Y5L B;  2C22 A;  1XNR J;  2ZBR A;  3BYR A;  5EX0 A;  2X1A A;  1NB7 A;  3QO9 B;  2PE8 A;  3UCG A;  1N32 J;  3K2Y A;  5D4N A;  1FXD A;  1VRU B;  1K8A T;  3U1L A;  3I96 A;  3MXH P;  2IDL A;  3GCX P;  1WAC A;  4MK9 A;  2CWX A;  4NLD A;  3GSD A;  1GEH A;  2ZNY A;  3ISN C;  4M5H A;  5LM7 E;  4DFP A;  1YJW S;  5GME A;  1M5P C;  3VAL A;  1RT5 B;  2KB2 A;  4AFF A;  3HFK A;  4KHM A;  4LMZ A;  2DXD A;  1UPP A;  1U47 A;  4HR2 A;  5L1I A;  3W62 A;  3CTR A;  3DRR B;  3AAW B;  4DX7 A;  2AU0 A;  1BQM B;  2ZH5 A;  2HHH J;  3BSO A;  4O4G A;  3M30 A;  4HT5 A;  1PGZ A;  4B9V A;  1N0U A;  1FRX A;  3ENW A;  4FYW B;  2F4F A;  3VQS A;  4E98 A;  2ZOM A;  3PYG A;  3CCS S;  3M2R B;  1CSJ A;  3MMA A;  2QG9 B;  3ILI A;  3R1L A;  4YME A;  1LV5 A;  3FBB A;  5IWA J;  1U1M A;  1FES A;  3I32 A;  2LQ8 A;  2KXN B;  2EFO A;  3UN5 A;  3BQ1 A;  5JUM A;  1C1C B;  1RTZ A;  1RT6 A;  1RUS A;  2EKY A;  3CJ3 A;  1CUL B;  3D68 A;  4H4M B;  4ILR A;  4O0I A;  3CT9 A;  4P7V A;  5H9E K;  4GO7 X;  2BRK A;  2CPY A;  3RGI A;  4BLG A;  2J5A A;  2JLG A;  3CCW A;  3G96 A;  1S0O A;  2FY1 A;  4M5J A;  3D28 A;  5AJ3 F;  3OTC A;  1GAO A;  2V8D A;  3VR1 A;  1CS4 B;  2JFK A;  5E7O B;  1NJW A;  4O0N A;  4B9M A;  2MKK A;  3QLH A;  3K59 A;  4MKV A;  3UD4 P;  4CO5 A;  4KT0 C;  3GPA A;  3FZ2 A;  4OI6 A;  3I5B A;  2B6A B;  5DDP C;  3CUN A;  1N54 B;  2ACM A;  2VC1 A;  2WW4 A;  1SBR A;  3HCX A;  4WJB A;  2JZ5 A;  5CQG A;  1KHV A;  5C24 B;  4ECZ A;  2P8I A;  2AYM A;  2KO1 A;  1CC7 A;  5KTQ A;  3W7B A;  2GHW A;  3Q24 A;  4YR3 A;  4PWD B;  3CJQ A;  1JQG A;  1WDD A;  2B8P A;  3BGF A;  1YKW A;  2LXI A;  2DBB A;  3NGK A;  2W9C B;  1N34 J;  3MM6 B;  1UJ6 A;  1VRQ C;  1YJT A;  3ADA C;  3AXK A;  3NS6 A;  4MAK A;  2N4D A;  1FNO A;  1XR7 A;  2MQL A;  4CH0 S;  5FDL A;  4TQS A;  1OSD A;  2K1R A;  3MPD A;  1DZ5 A;  2Y1L B;  4F0M A;  5LXR A;  2WW8 A;  4C11 A;  1RYR A;  1M1G A;  1S4F A;  3DM2 A;  3GJQ B;  4CP5 A;  4DLE A;  2VA3 A;  4ELT A;  2LQJ A;  1W26 A;  5HVG A;  4ED2 A;  5BR8 J;  4JV2 A;  3D2W A;  3B4M A;  3GG0 A;  3AJD A;  5CXT A;  4MYT A;  1HW9 A;  2XMW A;  1T9W A;  3GFH A;  1L5U A;  1H7W A;  1H74 A;  4DSL A;  1RT7 A;  3CDA A;  2BW2 A;  5AXL A;  1SJ3 P;  1I94 J;  2KDO A;  2FC8 A;  2L41 A;  3KYL A;  5C24 A;  2HNY B;  4WE1 B;  2Y9H A;  2EWH A;  1R0B G;  2RRB A;  3PZP A;  1LQ9 A;  3JSM B;  1NK0 A;  3QSY B;  4LF5 F;  2CQD A;  2W9A A;  1ITP A;  1HMV A;  1JLC B;  1LWE A;  1QE1 B;  1UET A;  2O66 A;  3VGU A;  1CPZ A;  4MJK A;  1MWY A;  2Y0S D;  3UWT A;  4EI2 A;  3IR6 B;  3K5L A;  3NXZ A;  3FC9 A;  2QMX A;  5H1S V;  5F0U A;  2E66 A;  1HBU B;  1UAW A;  1RZM A;  1P1L A;  2HNZ A;  5ETR A;  2OPS A;  5KFB A;  1J5E F;  4CLF A;  2DXF A;  3HSD A;  2YKO A;  3L7P A;  1SKR A;  1EJ7 L;  1S4E A;  2HFU A;  2JH3 A;  1QAX A;  2MQ8 A;  4GVL A;  4RNF A;  2MGZ B;  4P2F A;  1CJU A;  1HL6 A;  1HYS B;  4DHV A;  5AJ3 J;  3BN4 A;  1VBZ A;  4Y28 C;  5CA5 A;  2FDN A;  2QL7 B;  1T9Y A;  3QWP A;  4WK3 A;  4U96 A;  1S77 D;  3CUL A;  2VG7 B;  3W9I A;  2FVR A;  4FZV A;  1HNW F;  4WBF A;  5L8R C;  2IMO A;  3KUG A;  2DNR A;  2C42 A;  3I82 A;  2HHX A;  2HVZ A;  2HVH A;  2DHX A;  2NUU G;  2OPP A;  4UUX A;  3K57 A;  1EQ0 A;  1JLG B;  1S72 S;  1X5S A;  3I6P A;  1HNV B;  2V2Q A;  1PC5 A;  2H65 B;  2BKN A;  2DNZ A;  4KBI A;  5L39 A;  1KRP A;  4JUZ A;  5A2Q Y;  1X4H A;  2ZH2 A;  3R6G B;  3UDV A;  3ELH A;  1DLO B;  1IKY A;  4LSN A;  5A76 A;  2COL A;  3GFX A;  3PHE A;  4NEZ A;  2JSX A;  3TYT A;  2R7W A;  2VA2 A;  2DKO B;  4O23 A;  1T02 A;  4OQJ A;  3NGS A;  3FRZ A;  3BH7 B;  3D0H E;  2ZEJ A;  4Y65 A;  3RBZ A;  4ZMM A;  3V81 B;  2JX2 A;  1Y3K A;  3NAI A;  5CYQ A;  4CLT A;  4OV6 A;  4Q44 A;  4U8Y A;  2OSR A;  4NLP A;  4BDP A;  1V9O A;  1OIA A;  2F9J A;  1RAE B;  5A0Y B;  4B02 A;  3LWM A;  2ASJ A;  2AGP A;  3A1Y G;  4DQI A;  3JSM A;  2YNH A;  3G87 A;  1KR4 A;  1T7P A;  1X9S A;  3J80 U;  2MEW A;  2QSW A;  1N48 A;  3BDP A;  4F02 A;  2C2K B;  3SSQ A;  1U24 A;  2V67 A;  5HK4 A;  2JC0 A;  1U02 A;  3J7A N;  2VFR A;  2L9W A;  2CJ9 A;  4DOZ A;  3QZ7 A;  2UXC F;  2QN6 B;  4XDD A;  4AYB D;  4CIO A;  1HIY A;  3NS7 B;  4J5O A;  1K0V A;  2H5I B;  2ZBI A;  1WHV A;  5KOX A;  3N01 A;  2MLX A;  1KWM A;  3M6V A;  2DNM A;  3A13 A;  2RQ4 A;  4ZLL A;  2BV3 A;  4LFA J;  4UOG A;  1UWB B;  1RDR A;  5KFR A;  1DHM A;  2QFI A;  2C28 A;  2AIR B;  3OBI A;  2OEM A;  1JLE A;  1CJK B;  3SI8 A;  2QRR A;  2O01 C;  2ZC4 A;  1VBX A;  3DRX A;  1Q53 A;  2JL9 A;  1YVF A;  4TLR A;  1J2V A;  4DL4 A;  2FVS A;  3FJ2 A;  2W1B A;  2R8I A;  2RDD A;  2DNN A;  2ZC3 A;  4IFY A;  3NNH A;  2WON A;  4LVO P;  3PVX A;  3MDF A;  3RAX A;  1VQP S;  3RYL A;  3OVB A;  5E33 A;  2YNF B;  3FUY A;  3QNW B;  3PFO A;  5DLG A;  1UZD A;  3I0S A;  4ED4 A;  2DT9 A;  4RNN A;  4WFX A;  5LMN J;  5CHC B;  4DSJ A;  5KFW A;  4DR6 F;  4USI A;  4ECQ A;  4L72 B;  2CJK A;  1Q16 B;  1Q8B A;  2VV5 A;  2LVW A;  5LSR A;  4BS2 A;  1CS4 A;  2OHD A;  3EXC X;  3KUE A;  2AX1 A;  3ISN D;  1GXL A;  4WP3 A;  1UTA A;  4IOC Q;  4K5R A;  5DET A;  4PWD A;  5J2M A;  1MG7 A;  1R8P A;  2I9S A;  2MQN A;  2N7Y A;  2BM0 A;  4GVB B;  4K59 A;  1GMU A;  4CLU A;  2VOP A;  2MY8 A;  2FHJ A;  5LOQ A;  1TV6 B;  5J2N A;  3MHY A;  1V3R A;  3CDU A;  4ZPC A;  3LW5 C;  2BAN B;  2L08 A;  1X4B A;  3C8Y A;  2ZDP A;  1XBW A;  3I5A A;  5KT7 A;  1F5C A;  4RBU A;  3FCV A;  4OV1 A;  2HBR B;  4X62 F;  4DF4 A;  2IM2 A;  3AOD A;  2Y1I A;  1RAF B;  5DDQ C;  2XWY A;  4HAC A;  2XCP A;  3THT A;  2I5J A;  2LMI A;  3R5G A;  5K20 B;  3KLG B;  3QAT A;  5C2G A;  3N0V A;  3H4B A;  3TAN A;  3VCD A;  4QCL A;  2Z2L A;  3M30 B;  2K7K A;  1NHK L;  1C0U A;  5EUH A;  4ID5 A;  3KK1 A;  4CO2 A;  2MXY A;  3ZZ0 A;  4A8M P;  2L3M A;  3OV7 A;  2W2P P;  3QAE A;  1NK8 A;  3DI6 B;  4IH5 A;  4ZOS A;  3AY0 A;  1WOO A;  2HRU A;  3L95 X;  3M2U A;  2FJW A;  1NKB A;  3D9B A;  1TMJ A;  2PMH A;  4DPX A;  1C2P A;  1U4B A;  3M8Q A;  1RCO B;  3DNC A;  3KG4 A;  3MD1 A;  1FKO B;  1MN9 A;  4YB1 P;  1TTH B;  1LWX A;  3GV5 B;  3BYP A;  1CQN A;  2W7A A;  3DHX A;  3AT1 B;  4Z7Y A;  2H9Z A;  1BHN A;  2XHC A;  2XYG B;  2C3P A;  3MM5 B;  4NRT A;  2ZBP A;  5ETN A;  2DGX A;  3QO9 A;  1FFS B;  4DDF A;  2UUA F;  4LRD A;  3HF5 A;  2HHT A;  3ZXW A;  4KRW A;  5F8L A;  3IBW A;  3PM9 A;  5F41 A;  4BCA A;  1JJ2 R;  5EX3 A;  4DR1 F;  4Q8F A;  1TR0 A;  1WDT A;  3AH6 A;  2RVJ A;  2NPF A;  4WFZ A;  4I68 A;  1J5O B;  2BJ9 A;  1GMV A;  1F2H A;  1OY8 A;  2KI2 A;  1NND A;  2BKO A;  2WB1 D;  3HPO A;  2F5G A;  2ZM6 J;  3N6N A;  5BXI A;  4Y34 A;  2RNE A;  1N5Y A;  1F9E B;  2WZ1 A;  5F3T A;  3JYT B;  3DLB A;  4LBP A;  4NA3 A;  2Z2Z A;  5K14 A;  4F2R A;  4A4J A;  4AUK A;  4OHW A;  3WIV A;  1LFP A;  1Q1K A;  1FKO A;  2RS8 A;  5CYM B;  1XTZ A;  4Q43 A;  4JI3 J;  4NXN J;  1DY3 A;  1HQU B;  2CJA A;  4FS1 A;  3PX6 A;  2XMU A;  2W2O P;  3CJS A;  4Q0B A;  2DGQ A;  3GIR A;  3SQG A;  1LW0 A;  2ILY A;  1PYS B;  1KC8 T;  1UEK A;  2RIJ A;  2HS3 A;  2WBM A;  2FLP A;  4RWX A;  4DSI A;  2XUL A;  1WI6 A;  2GJF A;  4ID5 B;  3KK1 B;  2HFS A;  2Q6C A;  4EYH B;  2OKQ A;  3IRX A;  4X62 J;  4K4S A;  1FDN A;  3TRG A;  1HD1 A;  5GAH I;  4EBD A;  2YQ1 A;  5J1E B;  2YKA A;  5D4O A;  5SZT A;  2B56 A;  3RAM A;  4DV6 J;  1RB0 A;  1VC0 A;  3NGD A;  1WEX A;  5IQQ A;  4Q2L A;  3DC2 A;  1HBM B;  2HG4 A;  2M5Y A;  3O6Q A;  5C2C A;  2ZJP Q;  4OX7 A;  5K14 B;  4NYO A;  1SI9 A;  3EGN A;  1Q81 T;  3L7O A;  2Q6B A;  2FYX A;  3LAM A;  3PYD A;  3D5M A;  2GZO A;  2IC3 B;  3DLK A;  2MLY A;  2ROE A;  2PT0 A;  3MD3 A;  3NOC A;  3V6H A;  2J9C A;  4DSE A;  5D78 A;  1HNZ J;  1WG5 A;  2HND B;  1BMQ B;  2VKZ G;  4NRU A;  2CYY A;  2C2Z B;  2WRM A;  3KJQ B;  3KKF A;  4KKO A;  1MMD A;  1VRU A;  5CAA A;  1S1T A;  2M7S A;  3OLA A;  5HLF B;  3AD8 C;  2DIS A;  4YS2 A;  1DQ9 A;  1Q8L A;  1FKP B;  2GAG C;  4KGM A;  2OEL A;  5KFP A;  1DUR A;  3PFE A;  3H42 A;  3OTO F;  3T5H A;  1RT4 B;  3CDW A;  1V6H A;  4LF9 J;  2F3J A;  1FK9 A;  2EXU A;  4DX8 H;  4DV0 J;  3ZTQ A;  2BJD A;  1H3D A;  3DMJ B;  1FWL A;  1G4C A;  4EUV A;  4UW2 A;  2ZHO A;  4RPF A;  4RZR A;  5B0C A;  3DLE B;  4J9Q A;  3KG1 A;  2FZK B;  2GMJ A;  4H4O A;  1TL3 B;  4JV5 J;  3L4B C;  1UJ5 A;  3EGW B;  4RW6 B;  5IFM A;  3BBF A;  1JXV A;  4WFA Q;  2R7U A;  1JLC A;  1QE1 A;  3L7U A;  4LF8 F;  3CMQ A;  1S1V A;  2XS7 A;  4B3S F;  4IR9 A;  4ECX A;  4NXN F;  2GNK A;  2C3Y A;  3ZZZ A;  4J9L A;  5KFD A;  2WVB A;  5KG1 A;  2CJX B;  4USH A;  3KTQ A;  1QM9 A;  4RR5 A;  4A8Y A;  5LJ5 Y;  4ECU A;  4WKR A;  1V3S A;  1XQI A;  4F2S A;  3U1N A;  1WC3 A;  4WTY A;  3KLV A;  4FXW A;  3GSI A;  3DRP B;  4CLY A;  1UPM B;  1B7F A;  3NGU A;  4KH0 B;  1FNM A;  4B9L A;  2F1F A;  2CPZ A;  1WG4 A;  1IN0 A;  1U1K A;  1RXO B;  3R97 A;  2FUG 9;  2GVD A;  4EO6 A;  5HQL A;  3U27 A;  2E1R A;  2FC9 A;  2A10 A;  4Y6I A;  4DV4 F;  3N6M A;  4HAC B;  2DO0 A;  1R8A A;  4ED7 A;  1Y9O A;  1D9A A;  2BE2 B;  3C6T A;  4DWI A;  1VQM S;  1CEZ A;  1HAR A;  2HBZ B;  4HDH A;  4ZP7 A;  1ZZN A;  1YJN S;  3A8K A;  3CJ2 A;  4U7U D;  2WK4 A;  1HBN A;  4P71 A;  2GVZ A;  3A3O B;  4PEO A;  4CO4 A;  1DLO A;  1IWA A;  2E29 A;  5BR8 F;  2XQC A;  3IA0 A;  3M8Y A;  4ZVP B;  2ZD1 A;  5C25 B;  3KJV B;  2D1C A;  2QLJ B;  3WX8 A;  4FF1 A;  4C4W A;  3QT7 A;  1XMQ F;  4C9D A;  1G3O A;  3F0N A;  2MSS A;  1YGY A;  2G0J A;  1GX6 A;  3OL8 A;  3PYE A;  2YWF A;  1VS3 A;  3V81 A;  4O44 B;  2H51 B;  1S57 A;  1HWK A;  4B9U A;  2LA6 A;  3DDN A;  4C0O C;  4YR2 A;  3AFG A;  3M8P A;  1VLO A;  4OHV A;  4ZVS B;  2V69 A;  1WKK A;  3THV A;  1B4S A;  2C3M A;  3H20 A;  5KFJ A;  5J2Q B;  1K47 A;  2J8S A;  2RT3 A;  3O3L A;  1BD6 A;  3SXL A;  1U6F A;  1TEL A;  2I38 A;  4LRC A;  2FZG B;  3FBF A;  2NSB A;  2BXJ A;  4NL5 A;  4K2J A;  1K1S A;  2OPS B;  3R7S B;  3UE2 A;  3CC4 S;  2V50 A;  4DR4 F;  4UY8 5;  2RRN A;  2HS4 A;  4R8U B;  1RWN B;  4B9N A;  1IJE B;  1QUP A;  2QJ3 A;  5E0O A;  3T1H F;  2Y1J A;  1S49 A;  1K0T A;  4YEA A;  5IM0 A;  4AL7 A;  5DDO C;  4WII A;  5HMX A;  4WXW A;  4DL3 A;  3MED B;  3M2R A;  1U1Q A;  3OR1 A;  3LGM A;  4PXE A;  4HHU A;  2O1P A;  2EFP A;  1UWB A;  2HQC A;  5A6W A;  2HHU A;  1NXI A;  3ZZU A;  3PTW A;  1WWH A;  2M8D B;  4RBT A;  1AUS L;  1RWW B;  3BEG B;  4BBY A;  4A8K A;  3DRR A;  2AJ4 A;  3ZTR A;  3UPF A;  3TUP A;  5GMK a;  1KN6 A;  5A8R A;  3BO2 A;  3BGO P;  4B3M F;  1RT5 A;  1IVZ A;  2WON B;  7FD1 A;  2VIH A;  2LDI A;  4IH7 A;  3TQ1 A;  1MN7 A;  3HXM A;  2F8E X;  4DN0 A;  4MK7 A;  1NB2 A;  4C0H A;  2DCU B;  2YWG A;  2UXD F;  1Q78 A;  3KG0 A;  2FIU A;  3PNI A;  4L75 A;  1IM6 A;  2CDQ A;  2KRR A;  3H5S A;  1HWJ A;  2MHN A;  2GVZ B;  3BGR B;  2N3O A;  2UU9 J;  1RU2 A;  3SCK E;  2YNG A;  1IKW B;  1F0X A;  4OLO A;  2BYC A;  3I31 A;  2B5J A;  4RNO A;  1J27 A;  3TVZ A;  3DLG B;  5ETM A;  1M0S A;  1EX8 A;  2CJY B;  3ZO7 A;  5CAB A;  4PKD B;  3JB9 k;  2LQ9 A;  3PG9 A;  2FGO A;  1ZZF A;  2H5E A;  1PYT A;  2PEB A;  1WC6 A;  3ILL A;  5G0R B;  3TJ8 A;  4ZKA A;  8RUC A;  3KLI A;  4YFU A;  3DKD A;  2GC8 A;  4U9R A;  1K9M T;  1FTR A;  3UCU P;  2HZV A;  3I9V 9;  3J7A 1;  3RR8 A;  1O5J A;  1XMQ J;  3GR1 A;  2UXC J;  1V3Z A;  2B6A A;  4NOH A;  1IKV A;  3DXS X;  3SSR A;  2Q43 A;  4TYA A;  2KHD A;  4DR5 J;  5DQI A;  1S97 A;  1CJT B;  3D6M B;  2FGC A;  2QIF A;  3C6U A;  5KG0 A;  1X4D A;  1NZA A;  3PO5 A;  1XNR F;  4L73 A;  2HS0 A;  5KOW A;  5A2Q U;  2UXB F;  3GV7 B;  1TKT A;  4CLW A;  4X2B A;  4JI5 F;  2RML A;  3POT A;  1BC6 A;  1TK8 A;  5RUB A;  4DV3 F;  1OSC A;  3BH6 B;  1SPB P;  2DRA A;  2XCA A;  3Q86 A;  3M1V B;  1I6J A;  4OZ3 A;  1URN A;  1RWV B;  2HNY A;  4WE1 A;  4U8V A;  3HDS A;  1X60 A;  2HBQ B;  2GMH A;  3T5K A;  1Y5I B;  3LP0 A;  4IG0 B;  5A8R B;  4O3O A;  2VG6 B;  3NMR A;  2CQ0 A;  2G1H A;  3T6J A;  4NE9 C;  4WTO B;  4TU7 A;  4K4U A;  4I0W A;  3ITH A;  4HDG A;  3MUR P;  1EKS A;  3D3C J;  4F3Q A;  4C11 B;  3M6U A;  2F40 A;  1ZH5 A;  2P6T A;  1RTH B;  3IG1 B;  3D67 A;  4YUD A;  2HMI B;  2M52 A;  2HBY B;  3LP2 B;  4B3S J;  1AZS B;  1PIL A;  2YQ0 A;  3N5B A;  4DMZ A;  4KAI A;  1UW4 A;  3ETO A;  1AA1 B;  1RE1 B;  5HJX A;  2H1Y A;  2K8G A;  4U7C A;  4ED8 A;  3MR7 A;  3G9C A;  1IJF B;  3Q89 A;  4K8R A;  2V4Q A;  2CDR B;  1TVR A;  1VQS A;  4IO1 A;  1VQ5 S;  3B8H A;  4C8Y A;  1TL7 A;  2LU1 A;  2EFQ A;  2NYH A;  3HVA A;  2G9O A;  4NML A;  2OH2 A;  1F2G A;  2FPH X;  2G0I A;  3HHL A;  4UQT A;  3T9N A;  2ZWO A;  1RAB B;  4HEA 9;  4HTJ A;  4K4Y A;  2GFF A;  2RB7 A;  2LQB A;  4PG5 A;  4U67 Q;  4MFB B;  3CCR S;  2ATL A;  3M6W A;  2VG5 B;  2OLW A;  3PX0 A;  4ZDN A;  2XZW A;  4MYU A;  1FKA F;  3TO8 A;  4EBC A;  1VQY A;  1O8B A;  3LPE A;  4C8N A;  4DZ6 A;  4HKQ A;  1V5V A;  2DGS A;  2AV5 A;  2IRY A;  2VG7 A;  3BZQ A;  3GG1 A;  3R3T A;  3HM9 A;  4JV5 F;  2M9K A;  4ETZ A;  2PC6 A;  1S9G A;  2AKW B;  3S6E A;  2DNP A;  4O4G B;  1YZ7 A;  1DTQ A;  1C0T B;  1ZS6 A;  3FFI A;  3PJ9 A;  2ZH9 A;  3DOL A;  2KM8 B;  1YZ6 A;  4TLQ A;  3KJV A;  4WPA A;  2OPQ B;  2ROG A;  4J9O A;  4DUZ F;  4Q7A A;  2YX1 A;  5L38 A;  2VPX B;  4RW8 A;  3S7R A;  1YIJ S;  4NCG A;  1URR A;  2HEK A;  1VIS A;  5LXY A;  4LUB A;  5GVQ A;  5BYR A;  1HNI A;  1WC4 A;  5ETT A;  2LLZ A;  4HYK A;  2UUA J;  1SIZ A;  4OJG A;  3WC0 A;  1S6U A;  2IHR 1;  1B3T A;  5I42 B;  1HKA A;  1WKL A;  3D6T B;  3IXQ A;  2XO6 A;  2VON A;  1LFW A;  4F7V A;  2HPU A;  3FGV A;  3NBP A;  4O3P A;  2GGP A;  1VQL S;  3P6Y C;  2R7R A;  4OYA A;  1FVS A;  3FMW A;  4HHJ A;  4CO1 A;  5A8K B;  5KAK A;  4DR4 J;  4BC7 A;  3GIJ A;  4OHY A;  5EGY A;  4QU6 A;  4DV5 J;  4K4V A;  3K5M A;  2DRD A;  4MT1 A;  5DGB A;  2GCF A;  4E0D A;  4MH8 A;  5DRK A;  2CNK B;  5ETV A;  2AYG A;  1B64 A;  2OAU A;  2YNG B;  3SMZ A;  4DPY A;  2OTJ S;  2LU2 A;  5E5N A;  1RI7 A;  2J8A A;  2FZC B;  4X4O A;  1WEL A;  2RF2 B;  3VWS A;  4V19 J;  1RT1 B;  3CO0 P;  3GCW P;  1R89 A;  5HP1 A;  4XK8 C;  2PEH A;  1JNR B;  3T3F A;  3CO9 A;  5KFG A;  2FHO B;  2KFZ A;  3CCV S;  3DMJ A;  1VLY A;  4JI6 J;  4UST A;  4NEY A;  4YB7 A;  3US5 A;  2DRB A;  4CWB A;  5GAE I;  2BE7 D;  2F65 A;  3A3P B;  2X7I A;  2DR5 A;  3QRP A;  4BWJ A;  2UXD J;  2AF6 A;  4NLS A;  5DM6 Q;  1W2B R;  3RB6 A;  3A4T A;  4HTI A;  5ETP A;  3BV8 A;  1WUU A;  5IT9 U;  2V6A A;  1C4C A;  1TKX A;  1SJF A;  1MNE A;  1XN9 A;  5AXM A;  4YB5 A;  5KT5 A;  1YTY A;  3H2L A;  1SJ1 A;  3KLH A;  4X64 J;  2RHQ B;  1S1U B;  3D7S B;  1UA1 A;  1T05 B;  2A2D A;  3DDK A;  2QA4 S;  1QAJ A;  2JLE A;  2PI4 A;  2WOM B;  1JX4 A;  1RT2 B;  4M5M A;  4JI4 J;  3NNA A;  1DAX A;  4PQU B;  3CJR A;  1HBO A;  2O67 A;  3M1V A;  2AJ1 A;  3M2V B;  4J37 A;  2J9D E;  1ZAW A;  2YVS A;  4GKK F;  4OYZ A;  1P1T A;  2M88 A;  2E9T A;  1A9N B;  3BO4 A;  1IR2 A;  1H6K X;  1MWQ A;  3HHE A;  2BVZ A;  4NYP A;  5E3P A;  1TV6 A;  4KB7 A;  2EFV A;  4Q45 A;  1NHU A;  1VQ6 S;  1C0U B;  2Z56 B;  2O5D A;  3T41 A;  3HVR A;  1RLC L;  4W92 B;  4XPC A;  1SV5 B;  2POK A;  3ENA A;  4I2Q A;  1N0V C;  2H5J B;  1IQT A;  2FY8 A;  1NKC A;  4IRD A;  4FKX A;  4BHQ A;  1RBL A;  2BKP A;  3GYX B;  3D1Q A;  2MQP A;  2KVQ E;  4L3N A;  4P73 A;  4QR2 A;  1R43 A;  2HFZ A;  1N33 J;  4W90 B;  2CAD A;  2ZD1 B;  2FLO A;  3AQO A;  3VGT A;  2IM3 A;  3TI0 A;  4LF4 J;  4DR2 J;  5H9F K;  3T1A A;  4CO0 A;  1IM4 A;  4L6V 3;  5DS7 A;  2KJW A;  4Y2C A;  5D4L A;  1HD0 A;  4OHZ A;  2F4V F;  1S6P B;  1GNK A;  2EI5 A;  2QE5 A;  1FE0 A;  4YN3 B;  4WU2 A;  1KFD A;  1B0T A;  1BE4 A;  1IQZ A;  2YKM A;  5D15 A;  5HAT A;  4C3K A;  4F04 B;  2IY5 B;  4Y3C A;  3W8G A;  3AOC A;  3Q2T C;  3NEK A;  4MFB A;  1HLW A;  2MZR A;  2QL9 B;  4PUO A;  4C2M A;  4LSN B;  4A8S A;  1FJG F;  3JQJ A;  4LFB F;  2BMB A;  2XWX A;  3BRE A;  1SC4 B;  1TL3 A;  1S59 A;  3MI7 X;  2EKN A;  1U6Z A;  1SC6 A;  3GWC A;  5JVG Q;  5F9L A;  5SUH A;  4IOB A;  2CVE A;  1HWI A;  3DU5 A;  2GIR A;  1ZTT A;  3GQC A;  2ZBQ A;  1YJV A;  4QIF A;  3LA0 A;  4X66 F;  5D3G B;  3KHL A;  1F3V A;  1FDB A;  1YIT S;  1T0T V;  3OTB A;  1EKR A;  3CD5 A;  4OJH A;  4PG7 A;  4KIA A;  2XG8 A;  2VU5 A;  3MMJ A;  1U25 A;  4OFZ A;  3D4J A;  4YP3 A;  3J7Z 5;  4C0B A;  2BUN A;  2MZQ A;  2WTF A;  3PW2 A;  4M94 A;  1RHM B;  1S1V B;  1RKI A;  5F9N A;  5EWG A;  4DV4 J;  1RAG B;  2CVI A;  2VPZ B;  4EU0 A;  3MM6 A;  2FHK A;  2MKY A;  4ECT A;  2XMA A;  2ZOF A;  1IR1 A;  1PIE A;  3TWZ A;  1IBL J;  3E3X A;  3KK3 B;  3UNY A;  3IN5 A;  4P2S A;  4ZVH A;  4FBT A;  1PJ6 A;  2Z8Q A;  3GLJ A;  1RWM B;  1C0T A;  2B8Q A;  4QIV A;  5D0G A;  1WNE A;  4GVB A;  5GAE U;  4DUZ J;  2X3D A;  3KXD A;  2FTR A;  1TKT B;  2OD4 A;  4HLB A;  3CF5 Q;  4GKJ F;  1Q8K A;  3TA1 A;  1VQK S;  2V0N A;  2IVF B;  3QRR A;  1X5P A;  2RJZ A;  2DD8 S;  3VF0 B;  2CNO B;  4RU2 A;  2D3Z A;  3SCL E;  3KHG A;  2NS1 B;  4JI8 J;  2RQK A;  1XR5 A;  1XJW B;  2WVC A;  3GJS B;  4ZPV R;  5IXU A;  2NSC A;  2MKH A;  4W98 A;  3F41 A;  1GT8 A;  5LT5 A;  1XC9 A;  1FRH A;  2VQF J;  1T9X A;  4O3N A;  4DQR A;  3C2P A;  5F8M A;  1JJ4 A;  1P9Q C;  2RKI B;  4ZIV A;  5D0H A;  5KFA A;  5J2M B;  5LMN F;  1LK5 A;  3OTE A;  4KHP F;  4XDC A;  4ZP9 A;  4UZB A;  1T8E A;  4DCO B;  3LAK A;  4LSL A;  5KFE A;  2ZHB A;  2PN6 A;  2VKR A;  4UZC A;  3SEO A;  5J1N A;  4ATN A;  1U1O A;  1UEV A;  2M8H A;  3ZZR A;  4FNI A;  3ZZY A;  1G1X A;  1A0O B;  1JLB A;  3OHB A;  1HA1 A;  4XO0 A;  3PIP Q;  2BOP A;  1Q5V A;  4DL0 C;  3A12 A;  2C2R A;  5BYQ A;  1WC0 A;  4IH6 A;  1MRO B;  3MAA B;  4GMK A;  2HGN A;  3CJK A;  2AEM A;  3K8W A;  3KLE B;  1TK0 A;  2D3O 1;  2FLN A;  3A8I A;  3MCN A;  1NO8 A;  3EPG A;  1N4L A;  2IRU A;  1VC5 A;  4PXC A;  4NXM F;  3W5Z A;  2VPW B;  2MGZ A;  4AL6 A;  2VG5 A;  4FDF A;  5AXN A;  3AOA A;  1UFW A;  1M5K C;  3K5P A;  3CCM S;  1QAY A;  6FD1 A;  4ZLJ A;  4K50 A;  4NA2 A;  3GR0 A;  4RW6 A;  4MK8 A;  4LJM A;  3M8W A;  1HNI B;  4ECR A;  3D54 A;  3VTI A;  1R8H A;  4WCE Q;  3T1Y F;  2MYF A;  4ZN1 A;  1I3O B;  4YQW A;  2QLW A;  2FJX A;  1TP7 A;  2VOD A;  3WBZ A;  1WOP A;  1VQO S;  3PXG a;  3NNC A;  1RHK B;  3D0I E;  3S01 A;  1UWA A;  4CLZ A;  1DQA A;  1O0P A;  3B78 A;  1RA7 A;  2CWK A;  2VDH A;  2BJ7 A;  3H90 A;  4DF8 A;  3OXL A;  3V6D A;  1M1H A;  4IYQ A;  3OJS A;  3DGV A;  3IS9 B;  3EGZ A;  4TVA B;  4DG1 B;  1RTJ B;  3TZW A;  2BOA A;  1CC8 A;  4PCQ A;  3A8J A;  1H0H B;  3KJN B;  2A18 A;  4K4T A;  2RDI A;  5F8I A;  5HN0 A;  1SKW A;  1EIY B;  4HH0 A;  1U8W A;  5L1K A;  3PJW A;  1KP6 A;  4DFM A;  2XZD B;  1YI2 S;  1T9U A;  5IT0 A;  2ZH6 A;  1S6P A;  1FX2 A;  1KD1 T;  4ETX A;  2IAJ B;  4NZ6 A;  1F5A A;  2XLJ A;  2JEJ A;  3J81 j;  2ALZ A;  2GJI A;  2J76 E;  2KZM A;  2JVR A;  4NCA A;  4A8F A;  4FNH A;  2MQO A;  4EFA C;  1Q7Y T;  3H2V E;  4FYD A;  2HNZ B;  1F9F A;  5J2P B;  2DH7 A;  1YBA A;  1Y5N B;  2B0G A;  3U02 A;  4FVM A;  1XMO F;  1VQ9 S;  3Q83 A;  3DGP B;  3MM7 B;  5KFQ A;  3PAC A;  5GAH U;  1VHF A;  1LNQ A;  2DEI A;  2APO A;  2HWI A;  2MQM A;  1WHY A;  5KFV A;  4NLR A;  1TKX B;  3TJA A;  5DG8 A;  5C5J A;  2L48 A;  4JI1 J;  4DV2 J;  3M9N B;  3EZU A;  4OL8 A;  4QYZ J;  1TAU A;  1OQ3 A;  4I64 A;  4N8O A;  1ZET A;  2GGP B;  2PFF B;  1SJQ A;  3HVT A;  3OJU A;  3H59 A;  1WF2 A;  3SIP B;  2V2Z A;  1T3N A;  4N41 A;  3CDB A;  2DR9 A;  2B4O A;  1VQ8 S;  3QGI A;  3BN7 A;  5IZH A;  1HBO B;  1KVI A;  2QMU B;  4NLT A;  1HBM A;  4EWT A;  2XZT B;  4YOE A;  2OSQ A;  3H8Y A;  2LDY A;  2LA4 A;  2MKS A;  2YKN A;  1IBK J;  3ULH A;  1QTN B;  3CCT A;  1S0V A;  4USW A;  3KLH B;  1KKH A;  2HHW A;  5IS2 A;  4FVC A;  3R1H A;  2NRE A;  1SB6 A;  4EYI B;  3IG1 A;  2IIH A;  3I9Z A;  4L3K A;  1Z2L A;  4DV1 F;  2DHS A;  4B3T J;  1OQ6 A;  1P8G A;  1R27 B;  1RIS A;  3ICL A;  2HZC A;  5DO2 A;  4JV1 A;  2IDE A;  4ZCI A;  1YJR A;  4WZQ A;  3SV3 A;  3KDN A;  1NSA A;  2YWK A;  3QIP B;  5KFI A;  4CDI A;  1HQE A;  3SYZ A;  1WC5 A;  2ROP A;  2YY3 A;  3DDI A;  3C19 A;  2YNH B;  1SJR A;  5KFX A;  5BJR A;  2QMW A;  4JYA J;  3THP A;  2W4D A;  2EEY A;  1HR0 F;  4A48 A;  2YKQ A;  4XPE A;  3OVS A;  7AT1 B;  2CQ2 A;  4QWC A;  4F36 A;  3CCL S;  1N5Y B;  2W9C A;  2VPY B;  4LSL B;  5K8M A;  4XAK A;  3HHK A;  3UO0 A;  2GML A;  3G2X A;  2FQQ B;  4DPT A;  1HHT P;  1KSP A;  4MKY A;  4JI0 F;  2OMO A;  4JI8 F;  2R4F A;  5J1P A;  1D9F A;  2CPF A;  3L9Z A;  2WB4 A;  2NZC A;  2E1A A;  1CJT A;  4IRK A;  3QID A;  3DFE A;  4ZPT R;  1BUX A;  5ETK A;  1SL1 A;  2FHJ D;  2LEA A;  4OI3 A;  2HIY A;  5T7L A;  3D3B J;  1IWG A;  1RGV A;  5GAD I;  1FD2 A;  4PXB A;  1XK8 A;  2CNL B;  4FKY A;  3MMB A;  1BWV A;  3DRY A;  1HWU A;  5JVH Q;  1UEU A;  3T5J A;  2EFN A;  3NKY A;  4QYR A;  2CAJ A;  3EIC A;  2G2Z A;  4H54 A;  2RQM A;  3CJ5 A;  4USV A;  4F3O A;  3W1Y C;  3GB0 A;  4ICL A;  4X84 A;  1JXE A;  2P5V A;  2C2D A;  1VBY A;  1RYS A;  2E44 A;  4KHR A;  5IOL A;  1N5V A;  2DB1 A;  2PII A;  1U49 A;  3H7H B;  2KVI A;  3MEG A;  3ZZO A;  1L3S A;  2BAN A;  1NPR A;  2G13 A;  2VL1 A;  3MPU B;  4UQG A;  3T1H J;  1DTT A;  1BQX A;  2DR6 A;  1LW0 B;  4DX5 A;  3C14 A;  4G1P A;  3RB4 A;  2ZNZ A;  2DR8 A;  2SXL A;  4KO0 B;  1RHU B;  3PJX A;  4QOT A;  1BY9 A;  2A3J A;  2FJA B;  3Q8P B;  3MR2 A;  4KQZ A;  3DRS A;  1FXL A;  2AYE A;  4E8U A;  2CJB A;  2J9E A;  1OPI A;  1WKJ A;  2MKJ A;  1RTJ A;  2UUW A;  1YBT A;  3JXO A;  4P2X A;  5EHH A;  2HFN A;  1Z4U A;  3RUB L;  4C6A A;  4PXD A;  2MST A;  3JAM Y;  4X64 F;  4IG3 B;  3ITH B;  4IRC A;  1U8S A;  3LF0 A;  2HSE B;  1TKD A;  2NXJ A;  1RBA A;  2QC3 A;  2XSJ B;  2DNH A;  4FN5 A;  3B4D A;  5I3P A;  5B0A A;  4PR6 A;  4QW9 A;  2FJD B;  1T9V A;  1Y11 A;  1FRL A;  2XBP A;  2B4U A;  1KHW A;  3H5U A;  4IG0 A;  4A46 A;  5M2P A;  4KH1 B;  1ARO P;  2V63 A;  2CZ4 A;  2DPI A;  2QLF B;  4QIE A;  4YR0 A;  3G6Y A;  2XNR A;  4OI1 A;  4QWB A;  4JYA F;  3CMA S;  2AZ3 A;  3TJ9 A;  1H7X A;  1VK3 A;  3L09 A;  2VFT A;  3LAN A;  3TUI C;  3J81 U;  3UN3 A;  1FEH A;  1U1R A;  4X65 F;  1BGX T;  2XTJ P;  3MZI A;  1A7G E;  1P6T A;  3LP2 A;  3V6K A;  2N82 B;  2C2N A;  4DR3 F;  3PV8 A;  3J7Y I;  2Q79 A;  3UQS A;  3G82 A;  3L3C A;  1GFW B;  2BR0 A;  3K17 A;  2DGU A;  2K3I A;  3O5T B;  3RRG A;  5E3Q A;  1AYE A;  3NGR A;  1VK8 A;  1R7I A;  4K7Q A;  4ZCK A;  2AEF A;  2ZOG A;  4FYY B;  2F8H A;  4B3R F;  1QVF R;  1TUV A;  2I0X A;  1KQG B;  5AT1 B;  3I5C A;  2RIL A;  2QV6 A;  3GFY A;  3MAA A;  4QU7 A;  2YPZ A;  1FTC A;  4Y2A A;  4ZLN A;  1DBD A;  4ECW A;  1U26 A;  4ZVF A;  5KFO A;  1BWE A;  5B0D A;  2ALY B;  4ZCM A;  1U09 A;  1L3K A;  3TAQ A;  2E9Z A;  2ZDO A;  4LF2 A;  1P27 B;  1EAY C;  1WD6 A;  2LFV A;  4WFY A;  3TUJ C;  2J7K A;  3HZE A;  5F8J A;  5F3Z A;  2A1B A;  4FF3 A;  1UMJ A;  2C1E B;  3KFW X;  4NCG B;  2DK2 A;  1FJG J;  2CPH A;  3DLH A;  3AOB A;  3H2U B;  4GRS A;  2AZ1 A;  4Z2X A;  4DR1 J;  2K2P A;  4QJV A;  3V2U C;  1WG1 A;  4DSK A;  4G1Q B;  5HAO A;  5J2N B;  4LVN P;  4JBC A;  2IBK A;  3EWG A;  1OYD A;  3MUT P;  2KKH A;  1PSD A;  1J5O A;  2F9D A;  4URS A;  2XEX A;  2N7C A;  5L9X A;  4UTG A;  4ID8 A;  1N36 F;  1REV A;  4OZ1 A;  2HRT A;  4GKJ J;  5G0R A;  3MEC B;  4YY3 F;  4JI2 J;  3FBE A;  4AND A;  2YXL A;  2CQB A;  4LBH A;  2DGO A;  2GA7 A;  1NJY A;  1E6V A;  3UVJ B;  4G6V B;  5D0E A;  3R8Y A;  3M8Z A;  5K8P A;  5CCL A;  4RW4 A;  5H9E J;  1QAI A;  2CQP A;  3FNN A;  3RW7 A;  1ZBT A;  1RLD A; 
#chains in the Genus database with same CATH homology
 1SC3 B;  1PAU B;  1RWV B;  4ZVU B;  2HBQ B;  3KJF B;  1RHJ B;  4ZVT B;  2Y0B B;  3EDR B;  2CNL B;  2QL7 B;  2XYH B;  2XYG B;  3R7B B;  2H5J B;  4LSZ B;  2HBY B;  2HBZ B;  1RE1 B;  2H65 B;  2H48 B;  1RHQ B;  1RHR B;  2CDR B;  3P45 B;  3R6G B;  1I3O B;  4ZVP B;  2QLJ B;  2H54 B;  4JB8 B;  1RHK B;  2DKO B;  1RHU B;  1F9E B;  3R7N B;  1NME B;  2H51 B;  1RWP B;  1IBC B;  4DCJ B;  4ZVS B;  2QL9 B;  3KJN B;  2XZD B;  1SC4 B;  3GJT B;  3IBC B;  3R7S B;  2C2M B;  2C2K B;  1RWN B;  3GJR B;  2QLF B;  3D6F B;  3R5J B;  1RWX B;  3NS7 B;  2H5I B;  1SC1 B;  1RHM B;  2CNN B;  1RWW B;  3D6H B;  1GFW B;  3EDQ B;  5IC6 B;  3SIP B;  3IBF B;  1RWO B;  3QNW B;  1RWM B;  1BMQ B;  2H4W B;  2C2Z B;  2XZT B;  3KJQ B;  2P2C B;  1QTN B;  2CNK B;  4DCP B;  2H4Y B;  3P4U B;  2CNO B;  2CJY B;  2Y1L B;  2C1E B;  1PYO B;  3R6L B;  3RJM B;  3GJQ B;  3GJS B;  1ICE B;  2QLB B;  1I51 B;  1QDU B;  5IC4 B;  2HBR B;  2QL5 B;  3D6M B;  2C2O B;  1RWK B;  4DCO B;  5K20 B;  4ZVR B;  4ZVO B;  2XYP B;  4ZVQ B;  2FQQ B;  2CJX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...