1RWVB

Crystal structure of human caspase-1 in complex with 5-[5-(1-carboxymethyl-2-oxo-propylcarbamoyl)-5-phenyl-pentylsulfamoyl]-2-hydroxy-benzoic acid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Novel Caspase-1 Inhibitors Discovered Using Tethering(SM) with Extenders
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwvB00
4ZVQB 3KJNB 3IBCB 1RHKB 3GJQB 4ZVTB 1RHUB 3RJMB 3EDQB 2HBQB 2CNLB 1SC3B 3KJQB 1I51B 2DKOB 2H51B 2P2CB 3R6LB 1PYOB 2H5JB 2QL7B 1RWXB 1I3OB 3D6MB 2C2KB 1RWWB 3D6HB 1QDUB 5IC4B 4LSZB 3R7SB 4ZVPB 2CDRB 4DCOB 4ZVSB 4ZVRB 3R7NB 2QL5B 1QTNB 2H4WB 1RWOB 3P45B 3R7BB 1RHMB 3GJTB 2H48B 3GJSB 3IBFB 2FQQB 2H4YB 1F9EB 3EDRB 2QLJB 4JB8B 1RWNB 2QLFB 2HBRB 1RWMB 4DCJB 1RE1B 1IBCB 2H54B 2CJXB 5IC6B 1GFWB 2Y0BB 3R6GB 2HBYB 2XYPB 3D6FB 2CNOB 1RWKB 2XYHB 1RWPB 1NMEB 3QNWB 3NS7B 1RHJB 4ZVOB 1BMQB 2C1EB 5K20B 2QL9B 2CNNB 2CNKB 1RWVB 1SC1B 1SC4B 3KJFB 2H5IB 3P4UB 1RHQB 2QLBB 1ICEB 3SIPB 2XZTB 4DCPB 2C2OB 4ZVUB 2H65B 3R5JB 2XZDB 2CJYB 3GJRB 2Y1LB 2HBZB 1PAUB 2C2MB 2C2ZB 1RHRB 2XYGB
chains in the Genus database with same CATH superfamily
4CLYA 2QMXA 4DQRA 1FKOA 2E5LF 1SC6A 3HHNB 3GG1A 4D3HA 4CZCA 2G9OA 4ATNA 2R7TA 1NJYA 4OYBA 5AE2A 3NCQA 1KTVA 1VK3A 1LFWA 4LF8J 2VL1A 5FLXU 2Z2LA 4ZCLA 3KTQA 1SQGA 3PW0A 1VGYA 4OX9J 3HVTB 4DFJA 2LEAA 1ACMB 3Q86A 5IT9Y 1IBMF 2PI4A 4WIIA 3H4DA 2V4JA 4ED4A 3HCXA 4I7FA 3H2UB 3E2EA 1LK7A 1RTHB 2GHPA 1Q86T 1X4DA 1QSYA 1FKPA 1HBNA 4QCLA 2DNRA 1VHFA 2VH7A 4OLOA 1RAHB 3GV7B 1UZHA 2K06A 3TRGA 5L1KA 2HQGA 4WP3A 4QIEA 3ZZZA 4ED2A 1S9GA 1F9HA 3WC0A 4F4XA 1VQ5S 2HMIA 1JNZB 4YUDA 4OJ3A 2HNYB 2OFHX 1JLQA 1S4EA 4IO1A 5BYRA 4DUTA 1B3TA 3F41A 3IFEA 4P71A 2OPQB 1Z4UA 2BE2B 2XSFA 2A0FB 4F4WA 2WBRA 4LBHA 1HQ2A 3BJYA 4XDDA 1HW9A 1S59A 2WONA 2Q6CA 2OAUA 1A9NB 2AJQA 1CLFA 4QBUA 2UU9F 3MECB 3AXKA 2W2MP 2OD4A 4A8WA 1JLCB 1CBKA 2XI2A 4KHRA 1EKRA 4LMZA 4B9UA 4HH1A 1KD1T 4ZP9A 5B08A 2M2BA 1LK5A 1DTTB 4O4RA 2KXNB 2AX1A 4EU0A 4KV8A 4DG1B 1R43A 3TVYA 1Y11A 2VB6A 1ELOA 4MFBA 2B5JA 4OHYA 3UNGC 4RW4B 1RT6A 2L9WA 3P96A 2BE9B 2XS7A 1OYDA 1XNRF 1RHKB 3AOCA 4OMFG 4TYBA 4C8YA 3DXSX 4B9VA 2D74B 3SBMA 1NK7A 4NLQA 5B0EA 2BKPA 4RW9A 1IKVB 3OUYB 3LF0A 1GXLA 2N4DA 1FHTA 1N34J 4ED1A 1JLFA 4MH8A 3K5NA 2DNHA 1YBTA 3BZQA 2VKRA 2BXJA 3HHKA 2ACMA 2PGCA 4LBIA 3D2WA 4DPUA 4YHHJ 1IWGA 5LMNJ 4KC5A 2VFVA 1HR0J 2IC3B 3NCPA 5KG4A 4WCEQ 3DGVA 3NWRA 2BJ8A 4V19X 3OL8A 4YR2A 3QO9A 2ATLA 4FXDA 4DDFA 4KR0B 5KFXA 1P9QC 5AJ3J 1S77D 4X4NA 4EZ9A 3TW0A 4NXNF 2EK1A 3PM9A 4WYLA 1NJWA 1N5VA 2W9BA 1SBRA 4QW9A 3EGNA 4IR1A 4RUAA 2IYGA 2P8IA 1CG2A 4LFBJ 3C8YA 5L1JA 3NGDA 1Y5IB 2EC2A 2HRUA 3B4MA 1CJKB 3NS6A 1VBXA 5LJ3Y 1L3KA 3KK1B 3R7BB 3TARA 4ILMA 3QYYA 3AAWB 5HQ8A 1T9TA 3IS9A 2ASLA 4EWTA 3L95X 3H98A 4IYQA 1N36F 2XMAA 2QA4G 4TU9A 3TOQA 5BR8F 3ZTQA 1IJFB 3O1LA 5J2QB 2E9ZA 4NRTA 4ZVOB 1OY9A 3E01A 2OGUA 1UWAA 3IGNA 5CYMA 4ZPDA 2YWGA 3NOCA 3GILA 3CMES 1U8SA 2C3MA 8AT1B 1L3UA 2L9NA 1GMWA 1TKZA 4ZMMA 3DGPB 1UVIA 1IVZA 5E2QA 3W9JA 2GJIA 3QLHA 2N3LA 4R0EA 3AH6A 5HVFA 4DOZA 1TU0B 3I56S 2QV6A 4LF1A 2H5JB 4OHWA 1H2TZ 2JVOA 2ZBQA 3ZZOA 3U7JA 2GO8A 1YDLA 3UVJB 2NUUG 3BGFA 5KFUA 3MPUB 3EPIA 1ZAWA 2A6OA 3I9V9 2MZQA 2V69A 3KXDA 4O3RA 4LFCJ 5LSLA 4IR9A 1N32J 3HHLC 2B43A 1UZDA 4MIBA 3VALA 4DCJB 3CMQA 4CO5A 3VGSA 4DX6A 4JI7J 4GRSA 2DITA 4K4YA 2IMWP 5J2MA 4IDKA 3O2IA 2XMVA 2YNGB 1HNZJ 4EYIB 4YDDB 4ZCMA 3NXZA 3ILIA 3HF5A 3G6VA 4TNOA 2JFDA 1MLAA 1KFDA 1YIJS 1F5CA 1OSCA 4RO0A 2PD1A 3SIPB 3L7PA 5HL7Q 2ZH9A 1JXLA 3M7VA 2X1AA 2AHOB 1JXEA 2BJ3A 1SV5A 1SL2A 2NCKL 5LXRA 3CMAS 4WK3A 2W4PA 5I42A 4N47A 4USWA 2KZMA 2C3YA 1XK8A 1QSLA 1JJHA 1IKYB 3NGSA 4DN9A 4OJHA 3KHRA 2L08A 2FLNA 3MOJB 4KHPJ 3H8YA 5CA5A 4QYZK 3LUYA 4Q2MA 4C8KA 2F5GA 3PFEA 4Q45A 2FQQB 4J9RA 4J91A 4NL5A 4WFNQ 1YITS 2LMIA 4FF3A 5C25A 3ULHA 1Y5NB 4K59A 1LKZA 4LR9A 2BJ9A 4C0HA 4UZBA 2BQUA 2R3VA 2W9AA 4OX6A 1U2CA 2YKMB 4JI1F 4PWDB 2FLLA 4X64J 4F02A 1GK8A 3ILLA 2AT1B 1P8GA 4L6V3 2OPSA 2A3JA 3QIPB 4HLBA 2FVPA 2DR7A 1REGX 2MZRA 4N8NA 2HRYA 3UDEA 4WIQA 2QC3A 3H90A 4ZK7M 3DLGA 3TAMB 5A8RB 4ZDNA 3M8QB 5E3AA 3NG8A 4LF2A 2KJWA 4IUFA 2FC8A 2ZM6J 1Z2ZA 3N5BA 1IWAA 2XULA 2VPZB 5F0WA 1WC5A 3AB4B 5D0EA 4LSZB 3DOKA 2MGZA 4ZVPB 2EFVA 3UN2A 4B08A 3GWCA 1KEKA 4FYXB 2RH3A 1TUVA 1X4GA 4OI2A 3KJVA 1NJXA 3BYPA 2BYCA 4I4BA 5HSPA 5KAKA 2MZJA 3IR7B 1KOHA 3D1OA 1U1LA 1LWFA 1X4BA 1R89A 1VI7A 4DV2J 4A8SA 1I94J 2EFGA 3W8GA 1RBAA 4CO1A 2DT9A 3W2WB 4YS2A 3OFEA 4HYKA 3M6WA 1F0XA 2R2SA 2DNLA 2V34A 3KNGA 4PUOA 4IH5A 4LSLA 4NXMF 3IAM9 3BO4A 1J27A 4HVZA 2NPIA 4B3OA 3SDEA 5G0RB 1MMLA 3CCZA 2O01C 2MJUA 3P8BB 1S1WB 3OHBA 4FYWB 3V4IA 3PTWA 1S1VB 4TQRA 2UUCJ 2B6AB 3D68A 1Q53A 3SV4A 3PRDA 3MM5A 1WSVA 2A6MA 4CLFA 2R42A 3RB6A 1C4CA 5GMEA 3OJUA 4TLRA 2XWYA 1U6FA 3OR1A 1HQUB 4FS2A 1NNDA 3MHYA 3BSCA 1Z1ZA 1OS5A 3R5GA 2HHSA 1HMVA 2UXBF 1UVLA 1T95A 2V2VA 4Y2AA 1S0MA 2BJ1A 3EJMA 2WBMA 3NCRA 1WHYA 2RU9A 4J9LA 3T3FA 1S1UA 5E3QA 4GC6A 3DRSB 1H7WA 3M8YA 1NCLA 1ZPWX 3PW7A 2EFNA 3JQKA 1VC6A 4DR4J 1T0TV 1WF1A 5E3CA 3ZZ0A 3PO4A 3HLUA 3JTOA 3CJKB 1UFWA 1S6OA 2GX8A 2XY7A 4NLVA 2FHKA 1JXVA 4P74A 1QE1A 3GIRA 2IVYA 2FJDB 2IRUA 3TAPA 1B4SA 2RJZA 3H5XA 3JXOA 1BGXT 2BM0A 5F8GA 1LW0A 4LF7J 3RB0A 5DDQC 3L3CA 2FVRA 2R7OA 2DH7A 3TEHB 1TAQA 1G2EA 1S0VA 1EP4B 1TL3B 3RR7A 1NSPA 2E1RA 4PYDA 2QLJB 2AJFE 5IZHA 1Q78A 3ZZUA 5FDLA 1CEZA 1RWKB 3EWGA 3PJXA 3PW2A 5BJRA 3JSMA 2ZDPA 2NQPA 4DUYJ 4WXWA 1KOOA 4UUXA 3FJ2A 3IWXA 3MUTP 3W9HA 4F3MA 4KKOB 3H20A 1N4LA 4GVBA 2FD2A 4ZCKA 1P6TA 3KJNB 4BC9A 2HPUA 2YH0A 1N5YA 1RHUB 5F8LA 3JTPA 4LRDA 2D41A 4PZVA 4ZVEA 2G2OA 3HHEA 4OI0A 4X62J 2FDNA 1E6VA 4ECUA 2C2KB 3K17A 2XMTA 1HLWA 2RDJA 3DHXA 3F44A 1VRUA 3MR2A 4RNFA 4K4XA 1VMBA 2DH8A 3JQJA 6FDRA 5K9FA 4I7FB 2ZE2A 5KT5A 3RAMA 4Q8EA 1NSKL 1FX2A 2DNYA 3M8ZA 4ZJQA 1FKPB 1YQHA 3QZ7A 1S9EA 2NREA 2B9EA 3PEJA 2Y1RI 1HBNB 1S57A 4WTOB 4N5SA 2Q3PA 4M5HA 3G82B 3MURP 3NS7B 3DI6A 4K7QA 1HWLA 2O3DA 3D67A 4OL8A 2H3EB 1D1UA 2XMWA 3VQSA 4QW8A 3LGHA 3CDUA 3Q8YA 2H5EA 1S1XA 2OEMA 3QJJA 3UE2A 4KBIA 2KFYA 5J1EA 2HFZA 1Y7PA 3GB0A 5IFMA 1HD1A 3T5JA 4NLSA 2PFFB 4OZ2A 3KK2B 1RWXB 4JI2J 2YVSA 4ZJLA 2LKZA 2HZCA 2QIFA 4KB7A 2J6SA 2VA3A 1FFGB 4OZ5A 2ZHAA 3CDBA 1NEEA 4NMLA 5KFNA 2CPEA 2F9DA 3QJLA 2WTFA 1X31C 3MM7A 3HZGA 4FBUA 1HKAA 2DB1A 4NLPA 3PVXA 2AGPA 2LQ9A 5DJBA 4TYAA 2VQFF 2H54B 2NR0A 4BWMA 3BM7A 1FI4A 4MFBB 2B5JB 4MIWA 3BN4A 2X1BA 3NGKA 2HHHF 2XZWA 3I0RB 1RT6B 4OZJA 2AV5A 4OZNA 1KVJA 4X4RA 2OMLA 5AXLA 4YB1P 1ICEB 3FBFA 3MEGA 4RW9B 4CLLA 1CS4A 4EBEA 4FXWA 2KHCA 3ZZRA 3J7AN 3MAHA 4RBTA 5A6WA 4FF4A 1S4FA 1C0UB 4QWBA 3WHIA 2YX1A 5C2GA 4X4UA 2JL9A 2QMWA 3W2VA 1JLFB 2BKOA 5CCMA 3ENWA 1CQNA 1TELA 4YFUA 5LL6d 1AB8A 3IRXA 2HHQA 3D1QA 1RCOB 1H2UX 1H38A 2XO7A 4O0NA 3M8RA 2OKQA 1H98A 1FRJA 2KXHA 2QA1A 3G8QA 3M8PA 3ZXWA 1VS3A 4Y0FA 3U02A 2E66A 2CJXB 1HW8A 2RRAA 2KJVA 2P9CA 2R8IA 4MK8A 3WX8A 3GQCA 1U1OA 5F8HA 4RJVA 1X9MA 3VAKA 4TN2A 5DDOC 2YX7A 2P6SA 3OFFA 2UV8G 2V9KA 4ED0A 2W7PA 2CPYA 2QLBB 1JLAA 3TUIC 2R7XA 3R2DJ 2LXUA 2P5VA 5KT4A 2XYGB 3A8JA 2HRTA 1BQXA 1P9YA 3AQOA 3IBCB 4DN0A 3P6YC 3R1HA 4O23A 2VF3A 1UTAA 5AE1A 1N5SA 3LANA 3M2RA 5J1NA 2FLPA 4Q0BA 4QIWD 5EN1A 3OT9A 1UCNA 4G1QA 4WXOA 3IS9B 1UEUA 3KLEA 4OV6A 5L9NA 3GONA 3ITHB 5IV3A 5ETMA 2YWFA 1WACA 2DR6A 3TP2A 3VGVA 3TANA 4W90B 2MDAA 1GX6A 3E01B 4IOAQ 4I1TA 4OX7A 1SL0A 5M2UA 4CLKA 2HAFA 1UVJA 1TKXA 4XDCA 1QSSA 2KYXA 2C3UA 4B3SF 4QQBA 1H72C 2B9YA 2NXUA 2J8SA 3TA2A 5J2NA 3J80Y 5L38A 2ZFHA 3CCWA 2MJNA 2IBOA 4NCGA 1UAWA 3G71S 1PJ7A 1MU2B 2PA8D 3QLHB 1O8BA 1RT2A 3QT5A 1T11A 2KG1A 4X2BA 3JB9k 3AA9A 2VJUA 2QN6B 2C3PA 2FZCB 2V94A 3OTDA 3DLHA 4USIA 3UW1A 2B7CB 4OI4A 4JI4F 2AZ3A 4WYWA 2CQCA 3LP2B 5LSOA 2FVSA 3JSYA 3Q89A 4YOEA 2R8GA 2EBEA 3IRWP 3P5TL 1VQ6S 4EYHB 4ECXA 3R7SB 5L1IA 5HLFB 4F4ZA 3UR0A 5F8IA 5GADI 4DPXA 5DG7A 5J2MB 4IDKB 5MLCV 4X84A 2YWHA 3PHTA 4LUBA 4AL6A 1HNIA 2XO6A 5HMYA 3K8WA 2OO4A 2ZVSA 2HFNA 2GV1A 2YX4A 2PIIA 4OHVA 5CH7B 1X4HA 4LQ3A 4N8OA 3CJQA 4WBFA 1C4AA 5AT1B 1KN6A 2BACA 1RWPB 2XLIA 4B3RF 1B0TA 3TZZA 4DV1J 5CABA 1FJ7A 4AT1B 5I42B 1VQSA 5KFKA 2NZCA 2L41A 4CH0S 3I9ZA 2KT3A 1NK6A 2AJ4A 3IG1A 2FVQA 1TL7A 1TKDA 3ILJA 3EYZA 4C6AA 2CQIA 4ZPWR 2HBQB 3CO0P 2RF2A 3KFWX 5HJXA 5ETVA 1VDHA 4FPIA 4F67A 3BPSP 5HQLA 1IR1A 5D4PA 2QYGA 5H9EJ 3OVSA 2J0XA 1FE4A 5C25B 4DPTA 2UXDJ 4DR6F 4Q2LA 2V8PA 5FLXY 3Q8VA 3PHEA 3R9LA 2VPXB 5B0CA 4OHZA 2VFSA 3RB4A 1IBLF 3H40A 2R7SA 5LJ5Y 4OYMA 5C7PA 2HEKA 2A18A 2GMLA 5B0AA 2OPSB 1FNXH 3AOBA 1FX4A 2M8DB 1WD6A 4YB5A 1U1KA 3D0IE 5ETLA 1XERA 1HBMA 1HBOA 2D9OA 1UPPA 4DPYA 5A8KB 4ID5B 1DQAA 4IRDA 1IUJA 2J76E 2QA4S 2V9WA 3OLAA 2LA6A 1F2GA 2CQ3A 3DOKB 2WVFA 3B78A 4OIXA 2ASDA 1KONA 3U1LA 2J7KA 3HHLA 4ANDA 1IM6A 3KJVB 1WOPA 1I3OB 2DGQA 1F1BB 2N3OA 1UP1A 2VJVA 4YQWA 1AZSA 2HHTA 1K0VA 2W8KA 1V6HA 4HACA 3PRBA 5JMNA 4F0MA 2M0GB 2L48A 3VV2B 2KN4A 3K5PA 2CJQA 4E8UA 3EE3A 3TNVA 2MQLA 2RE1A 4B3MF 2C2DA 4PUOB 2K2PA 2EW9A 4LSLB 4OYOA 1TMMA 1HI0P 1RU1A 3EZ5A 2LEPA 2G2YA 4Z7CA 4RU2A 2WW4A 1SI9A 2ZDOA 3LAKA 4LF6J 3FRYA 4F26A 2V67A 4DR2J 2FJXA 3DRRA 4XPCA 2VZ9A 3BREA 5EWEA 3C2PA 3GR0A 3C3LA 5B0GA 5IQQA 2HGMA 3MM5B 2Z30B 2HK2A 2HFVA 1M1HA 1ZOTA 5KFSA 3CEDA 3LP0A 1M1GA 3QRPA 2WVEA 5J1PA 3B8HA 2RQCA 2ZH3A 2V8GA 5J2PA 1FXDA 3OR1B 3AA8A 3NGTA 2RIJA 2UZAA 3CDEA 3FBEA 4WKYA 2VOPA 3SMZA 1Q79A 3UN5A 3KWMA 3KLGB 4RUCA 3DM2A 2IIHA 3HSZA 3RAQA 1APSA 2UXCF 1YJNS 2DCUB 1RWNB 5K14A 4LFAF 1IXKA 2FJBB 2Y8WA 3GLJA 4MKYA 2CZVC 1R6VA 3OTOF 4NYOA 1Q4RA 5IT0A 4PQAA 1DY3A 4K5SA 1IQZA 1WKKA 5F9LA 5JJBA 2EI5A 2G0CA 3JAMU 3EXYA 1F9FA 3DU6A 3W66A 2NYIA 3QT8A 2CNKB 3RRHA 1XNQJ 4DEZA 3QFWA 1B0PA 5A0YA 3UD5A 1PKUA 1XTZA 4DV6J 3V81A 3D0GE 2UUBF 3T9NA 3MOZA 4ILLA 2YQ0A 3K2YA 2CPHA 2GFFA 4L74A 3OXGA 1KVKA 1LW0B 2GNKA 2HVZA 2VQEJ 1ZA2B 3H42A 2BABA 2LCWA 2HHVA 5A76A 1HHTP 4LF9J 4NLUA 2AKWB 3L4BC 2B0GA 2DNPA 1U1MA 2PEBA 1SPBP 2RS8A 5A6PA 4KSEB 4DFMA 1FK9B 2I9SA 5HO4A 3WIUA 5FDLB 1PGZA 2PN6A 2PFDA 4LVOP 4JI1J 3FC9A 3DLEA 1SIZA 1RK8A 5ETOA 2QFJA 2OEJA 3N6MA 3FZ2A 1S6UA 3PKMA 2Z0GA 1U1NA 3Q83A 4H4MA 5D0RA 1N52B 5IWAF 3SFGA 3ZTSA 4DR3J 5EX0A 3RBEA 1U1QA 1M5PC 1DAXA 2Q79A 1N5YB 3RG6A 1S97A 3VAFA 2CAJA 4RPFA 1YJTA 4DL3A 1TVRA 1PJ6A 3LOUA 1NKCA 1E6VB 4ECVA 1JKHA 2Z56B 4J9PA 1BD6A 2ZZTA 3L09A 1VRUB 4AYBD 1YSJA 1FEEA 4K0KF 1UFLA 2GO9A 3FQLA 3Q0AA 3LPYA 2M5YA 1VQ7S 3VCDA 1S9EB 1NHUA 2AGQA 5EDWA 1LXJA 4NXMJ 1RWOB 3CCRS 1M90T 1X60A 2ZH1A 3DI6B 1Q7YT 1PYSB 2VC0A 3CPWR 2AMCB 1WF2A 3LTOA 3K8VA 4S0MA 1U4BA 3NNCA 3QT6A 2R4FA 4Y2MA 2ATCB 5F9NA 1JNRB 2E9TA 3GIKA 5GAHU 4CH7A 1N48A 4G6VB 1K8AT 3LP1A 2DPIA 4TY8B 1ZH5A 3CCLS 2ZZMA 2GJ2A 4A48A 1KVIA 1TR0A 1VQ8S 3MI7X 3U1MA 2DHSA 4M5DA 1G3OA 1NU4A 2J9DA 1XC9A 3MM7B 4J9SA 2J7WA 2NXCA 1FXLA 2E7XA 3LA0A 3N4WA 2DGSA 2GCFA 1BC6A 3GU0A 4YR0A 1WG4A 5B7WA 2VDHA 5B09A 2R8JA 5KFWA 3UR3C 1YVFA 2HYIB 5GAEU 1DLOA 4ENOA 2EG2A 4WE1A 2LP4A 3MAAA 2VFTA 2DR8A 4RW7B 1AT1B 3R6GB 1FVSA 3TEGA 1T03A 1MN7A 4BS2A 1X4AA 3ZC4A 2I8EA 1HD0A 3MEGB 3IBWA 3RU0A 1U47A 1RKJA 1RYRA 2F3JA 3J81U 2K7JA 3OLBA 3HKWA 2ZZNA 1QAYA 1SQEA 2A2CA 4DR5J 3LQVA 3FMBA 2LECA 2M88A 4PG5A 2ROEA 5T41A 1WDDA 2B3TB 4X66F 2XC9A 1RLCL 1JB0C 4V1Ak 3IRXB 5CZVA 3MR5A 3GIIA 2XG8A 2IM1A 2P2CB 3C15A 4DX8H 4L75A 1GT8A 2M70A 3S1TA 4NLDA 3ZZYA 1O51A 3BV8A 1X4EA 4J9MA 5E3PA 2HQIA 4KO0B 3GFXA 3ETMA 4NCBA 4H4KC 2R8HA 2BANA 4WFXA 2XLKA 3M30A 2XLJA 2HVDA 3UCGA 4IQXA 3V6JA 3SSQA 1FNOA 2ZHOA 2H9ZA 5IC6B 2Y0BB 5THWA 4Z7YA 1PC4A 2QLWA 2GS8A 2ZH6A 2XYHB 4Y3CA 5KTQA 3KK3A 5CXTA 3A8EA 4FBTA 4F3OA 4X4TA 2MSSA 4K4VA 4EI2A 1NK9A 4TKTA 1IJEB 2OEKA 5MAOA 1VJWA 2FTRA 3CJ8A 1WOOA 3M2RB 3N01A 4IFYB 2JC0A 3UN3A 3DC2A 2NLWA 4G1QB 1YJ7A 3FK4A 3UD3P 4HKQA 1LEOA 4EEYA 3FUYA 5HP1A 1H7XA 4NLTA 5ETQA 2GW8A 2J7UA 2QX0A 2XMJA 1RAJA 2CFXA 4OYZA 4DSJA 4ZLJA 4W4MA 4K4ZA 2MXYA 3LGNA 2JJ4D 2KVIA 2CG8A 4KPCA 2APOA 5J2NB 4TY9A 3I5AA 4KY3A 2DTJA 3O44A 4NCGB 1JLBB 2IDEA 4IKAA 2LU2A 1RT2B 3MZIA 2CQDA 2HK3A 3TO8A 1G4CA 4F36A 3CDAA 1RTDB 3BQ0A 2XWXA 3HJFA 1O6XA 3PDNA 4RNHA 1T94A 3IWLA 1TFWA 2H5IB 2RB7A 5KFQA 2BQ3A 4RW6A 2BMBA 3W5ZA 2VG5A 2I1RA 4NPOA 2UVUA 3BH6B 2DNQA 4USKA 2HZAA 2YTCA 2W2PP 1YK9A 4GKJJ 3RJMB 1UA1A 2HQFA 2MLYA 2QE5A 3G8TA 5E7OB 3DYAA 3W60A 2VV5A 3MEKA 4ELTA 3A3NB 1QVGR 1IKXB 3AHPA 3QGHA 1MG7A 4DU8A 1HNIB 1FEHA 1VIOA 4B9TA 2CKWA 4UOGA 4H54A 2DY9A 2YNIB 4HI1A 3MMBA 1RAFB 5DM6Q 2DGWA 1M5KC 4ZN3A 2B7BB 3PX0A 5M2PA 1RISA 3HDSA 1KQKA 1ZM3A 4DUZJ 4LR7A 4ZITA 4WU3A 1VC0A 1TL7B 2M3DA 3CTRA 2FB0A 4JI3J 2JLFA 2ZC4A 3P5BP 3BBFA 3FBBA 3GFYA 2CQ2A 2YY3A 2Y1LB 2AP6A 1FJEB 2F9JA 1VBYA 3KHHA 5JVHQ 2VBYA 4O3QA 4RU9A 1R3NA 3D6MB 2K7KA 1WKLA 4LF5F 1EB0A 3TR5A 5BYSA 2LFVA 2HSEB 2PC6A 3R7NB 2QL5B 1SJ3P 1FTRA 2M8HA 2E29A 1OY8A 3T1HF 2LLZA 3IBFB 1HPZB 3H4BA 2FIUA 1XJWB 3MCOA 3MUVP 4EBCA 3TI0A 4CRJA 1AUDA 3SV3A 1RAGB 2MEWA 3Q23A 2EC0A 3C14A 1FF2A 2F8HA 1HBMB 1Q82T 1QVFR 1RGVA 1Y10A 2XCAA 3EVMA 3VTIA 2DCLA 4MK7A 5KFCA 1RHJB 4AQYF 2OMOA 5AXMA 4EK2A 1CULA 4B3TF 2DHXA 4M5MA 3HFVA 3MPDA 1HL6A 1FXRA 2J0QD 3HHLB 4JV0A 3DRPB 4FXVA 4B9NA 3RGIA 2C3OA 4RR5A 4KGZB 2MQQA 2XB2D 3PACA 5LMUF 1AZSB 4X4OA 1AA1B 2GIQA 4JYAJ 3CUNA 3NAHA 4HACB 3H5UA 2C2EA 3SZ2A 2F4FA 4YY3J 5KG3A 2QA2A 2RILA 3KLFA 4DLEA 2RUSA 3KHGA 2LVWA 2UVVA 2HNZA 3TA1A 3VZIA 3NLCA 1SCJB 2ACYA 3EVWA 4NA3A 1JJ2R 3CJ4A 2JOQA 2IJFA 5DQGA 4YMEA 1XMBA 3DRRB 3MEEB 2MYFA 2YWWA 2XEXA 3BYRA 3NNAA 3VAGA 4ELVA 4C9DA 2DY1A 5F0UA 1WORA 1Q8IA 3GFHA 1U1PA 3LP0B 2V4RA 1S7HA 5CHCB 4JI5F 1SJQA 1R8CA 1S49A 1RAAB 1IKWB 5DQIA 4BHQA 3AFGA 1HIYA 4I67A 4DFKA 1HNWF 1EARA 1SB6A 1EAYC 2D3UA 1H3DA 8ATCB 5B0FA 3T5KA 2E5JA 3R6LB 2W24A 4I69A 2FYXA 4W92B 1JLEB 1GMVA 2QMUB 4DR1J 2KYZA 4R5PA 5K14B 4OI3A 3CCTA 4AL5A 2LXFA 1R8AA 2VOOA 1X7VA 1RCXB 1ITPA 4QYZJ 4U67Q 1TK5A 4Z2XA 4DL7A 2RRBA 3N6LA 2J6UA 1VQPS 3CCES 3T6BA 3X3UA 4CLUA 3S7RA 2HS4A 5A0YB 3PCOB 3AODA 1XMQJ 1YZ7A 3GPAA 2FJAB 3KLIA 4P73A 3HT3A 2MTLA 4X4VA 1SH2A 2K8GA 1UPMB 1U2RA 3IM9A 4O0IA 3HVRA 1KQFB 3BR8A 5L46A 4KGMA 1TUGB 4LF8F 1GAOA 3B6BA 4BDPA 4DV7J 2FLOA 5B0DA 1FWPA 1UJ5A 4RUHA 2XSJA 4L3KA 4ELUA 2JEGA 1WC0A 4PPZA 2R8KA 2FUG9 1LQ9A 1FRKA 2PSZA 5KFGA 3D0HE 3NAIA 2GHWA 3D54A 4RNMA 2QEXS 1V9OA 4QYRA 1W2IA 2E1PA 1F3FA 2HAIA 2ZJQQ 2MZ1A 1ZBTA 2EG1A 2MZTA 4QIFA 2KB2A 4UW2A 2AU0A 2BX6A 3CULA 3UCZP 3IR5B 1NPRA 1D8YA 1JX4A 1AXQA 1YJRA 2EKYA 1TVRB 4O3OA 4QU6A 3QPIA 4C98A 4DU7A 4MKVA 4NLYA 4F8RA 4G3IA 5K20B 2M52A 1DQ9A 3I4PA 2XCPA 2GMHA 2YNHA 1DURA 4C3MA 4DV0J 4P10A 3VZHA 5A2QY 2RDIA 2NYHA 5C42A 3TJ8A 3GJRB 4JI0J 3BEGB 2KM8C 1WEYA 4MKBA 4B3MJ 4WTYA 4X65F 4MMOA 3VAIA 2LQ8A 3MMJA 1HBUA 4M8LA 1QLNA 2E5GA 2DR9A 3GFZA 4RL1A 2IA6A 1PAEX 3C19A 4KFBA 3EM1A 2FC9A 3MPYA 4J9VA 3IXQA 2HQDA 5EGYA 4F2SA 1NSAA 5DQHA 4DQSA 1LXNA 4Y28C 2B51A 4C11A 2W2OP 1ZM9A 1LV5A 1OY6A 3CIMA 3N6NA 1FWLA 4RKUC 2ROPA 4RWWA 2Y3YA 3HXMA 5C2CA 1L5UA 1U0HA 2QJ3A 3TAQA 2CVIA 2D1CA 5GMDA 4DBQA 2DNGA 1K9MT 4QU7A 1IR2A 1N34F 2BJ7A 3QQCD 2VBXA 1Y9OA 1OMSA 4PG6A 2AEJA 1XR7A 2KRBA 2CJKA 2KT2A 2C42A 3QAUA 4KGVB 1VBKA 1X5SA 3GZ7A 3ZTOA 4OFZA 4YHHF 3TA0A 3AY0A 4QWDA 1DLOB 2KDOA 5LMNF 2VPYB 3W7BA 2CPXA 2Y8YA 1HR0F 1YWXA 3MAAB 1RA7A 3GSDA 4ZVRB 2C28A 2JEFA 5KFEA 4CTAB 2I5JA 1HA1A 4ES1A 4HHJA 3DOLB 1RAOA 5KFBA 5AJ3F 2B8QA 3CD0A 1WWHA 2HS3A 5BXIA 2UUTA 4WZMA 3R5CA 2KHDA 4ECQA 4NA2A 1VRTA 1MROA 3B4DA 1BQMB 4IG0A 1YI2S 4EFAC 4N56A 3CF5Q 3P4UB 4LFBF 1ZETA 3FEYB 3G86A 2VASA 2B9WA 1TTHB 2XZTB 2YXLA 3C15B 1URNA 3HVTA 1TL1B 2WB4A 4ZN1A 2F40A 2RQKA 1N8RT 4YR3A 4CWBA 2HIQA 1NJZA 3CJ2A 4P75A 3OXLA 1LNQA 3D9BA 2L9DA 3GR1A 3PZPA 1KC8T 1S12A 2EXUA 2BANB 4WPAA 3M30B 2GA7A 3AD7C 3TWZA 4LBPA 4I64A 5IT4A 2B4UA 2XQCA 4ZVSB 2CUYA 5EX3A 3G6XA 5L1LA 1QY7A 1U48A 1R7IA 4X4SA 1NH8A 1Q8KA 3F73A 4OJGA 3RTVA 4XO0A 3PFOA 2A10A 3LGMA 2E9RX 1DTQA 2XMKA 5L39A 1HWKA 3MUMP 5IV4A 5GMKa 3R97A 4KPYA 3QIDA 1S48A 1V3ZA 1RTZA 2HNYA 1HQEB 1VBZA 2ADCA 4O4GA 3A3PB 3UO0A 3RB3A 1VQ4S 4OJ1A 2IMOA 3ZTPA 5I3QA 5HROA 4LR8A 4HTJA 5HP1B 1R8PA 2Q66A 2JFKA 2GIFA 2UVWA 4LFCF 1U45A 1N32F 3UQSA 1FA0A 2IVFB 3U1NA 3GYGA 2BQRA 3OTEA 1MW7A 3C46A 1JLCA 2VONA 4M5IA 2NXJA 4MYUA 1CJTB 2LQ5A 3M4XA 4JI7F 2R7RA 4I2PA 2ZNYA 2XS2A 4ANEA 1RYSA 2ZUAA 3PRVA 4USMA 3R5AA 3EICA 1FT8A 2B4VA 1HNZF 1ZTWA 2XS5A 5ETNA 2RT3A 2GQCA 3GJTB 1SUQB 1HNVB 4QOTA 4M95A 3M6XA 4CO4A 3J7A1 7FD1A 3S8SA 2KZZA 1KLMB 4RNNA 4JI8J 1RXOB 2K1RA 1RABB 1IKVA 3JAMY 1HWIA 4AL7A 4JBCA 1SIWB 2ZITA 2Q43A 1NK4A 2ZH5A 2ZH2A 4UY85 1IN0A 4XTTA 5A8WA 3DYAB 4O3PA 2RRNA 2UUAJ 3HJVA 4HR2A 1U8WA 1EETB 2E7VA 2DHGA 3OVBA 3PNIA 3WZ0A 2AJ1A 1J5EJ 3I5CA 1JLGA 4H4KA 4N77A 4NLRA 2Z4PA 2FGCA 4YB7A 3OV7A 1JJCB 3C16B 3MMBB 5FD1A 1Y3KA 3GIJA 1U24A 1RLDA 1LWXA 4N41A 4DL0C 1F60B 3DLLQ 4F2RA 4LRFA 4F0HA 1VJQA 4FS1A 1XBWA 4A8FA 4X64F 1HFEL 2HLUA 5D78A 4C8LA 2LA4A 1T9WA 1M5SA 1B99A 3VGTA 3FEZA 3FCWA 1UMJA 4HDGA 3GIMA 3HHDA 3M1VA 2ZM6F 2Z2MA 2J9EA 4NYZA 3MR7A 5KG6A 3NBPB 4DV4J 1V3SA 3QAEA 1TZ0A 2VFUA 3M8SA 1RBOB 3IGVA 4AE5A 3I6PA 4TQSA 5EWGA 2DJWA 1D09B 1WDTA 2MY8A 1HNXJ 4DQPA 3GYNA 4X4PA 2D69A 1ZM2A 4CT9A 4DV2F 3F0NA 4DL6A 1YRUA 4PYAA 2MKKA 2W8LA 4U7CA 3EPGA 4ED6A 5DRKA 4C2MA 3C14B 3RRGA 4KTQA 4GVLA 1VISA 4O3SA 5GADU 3EDRB 3POTA 3NY0A 4RX6A 3Q8PB 2VG6B 3NNHA 2HWIA 1CULB 3DNCA 4DX5A 1K1QA 4DS5A 4Q43A 3WBZA 2BVZA 1KKHA 1FESA 2JNJA 3UVJA 4PXCA 4C97A 4ID8A 1D9FA 2UUCF 2LDYA 1RWUA 1K0TA 3GP9A 1RB0A 2ZD1A 1VQYA 3AJ1A 2RVJA 1U02A 3IC1A 2OH2A 2X1GA 3T1YJ 3T5HA 4DL4A 2R7WA 2I0XA 4J9QA 2RS2A 3HFKA 2MKYA 4KE5A 3I82A 3MM6B 2BV3A 4UY8T 3KLFB 3FDSA 2YNFA 3Q8RB 4ZPVR 4FKYA 2HNZB 3PR4A 2J5AA 2WZ1A 3TUPA 4GO7X 4KJIA 1F6TA 1RWWB 3CW2C 3MPVA 1NKEA 5IC4B 4YN3B 1EZZB 2WVDA 3FFIB 3GYXB 4PABA 2M7SA 3FQKA 4PWWA 2RUGA 1E6YB 4NWBA 5KT7A 3KUHA 3MM9A 4CLPA 4XAKA 4DSEA 1M5OC 3GCXP 1G1XA 2DR5A 4DR4F 4ZVHA 2JSXA 3BSOA 1ROFA 1IBKJ 1WEZA 3K57A 2RNEA 2ERRA 4C8NA 1XQIA 2GVZA 3TUZC 3NMAA 2O67A 1V3RA 1BQNA 2COLA 5ETTA 4ZP6A 3H2LA 3WDOA 1T9VA 3J81Y 3QGGA 2DNOA 1C1CA 2CJ9A 3D7SB 4LF7F 1NH7A 4QR1A 1Q95G 2UP1A 3OTBA 4R5PB 1JWWA 2G1HA 1RJJA 2DXDA 1N5TA 3WC2A 3VAJA 4DZ6A 1U25A 3B82A 3W64A 2WVBA 3H59A 1LWEA 2YKMA 4F50A 3OL7A 3RAXA 5C24B 5KG2A 2P9EA 2BM1A 3VVUA 1X5PA 4DUYF 3BKTA 4CLSA 2FJEB 3QIPA 1RSCA 1X8DA 3VHQA 3KLIB 1S6QA 1U0SA 5M2RA 4NA1A 4GKKJ 3M8QA 3NRBA 1S5ZA 1RTIA 1DZ5A 2BJEA 3SQGB 2CYYA 1M5HA 2C2RA 3N5FA 2E5IA 1Q16B 4Q44A 3V4MA 4OI1A 2QL9B 3FSYA 3Q22A 4X62F 3PV8A 1CC8A 2XSJB 1FCAA 2V2QA 3VAMA 4PEOA 3HVAA 4EMDA 1RAEB 2C2ZB 5KG0A 3VAHA 3CSKA 2HHWA 3G2XA 1NB7A 3QGPA 4DR7J 1XR5A 3W2WA 4IQMA 3WQPA 3MD3A 1MWQA 3DHWC 4FYYB 4NLXA 3MR6A 4LREA 2QGFB 3C6TA 5DGAA 1RT4A 2CXEA 2QSFA 2RKIA 1U2FA 3JS9A 1F5AA 3OL9A 2DXEA 2HFSA 5ETPA 1U26A 4NLWA 1FKOB 3UPFA 5GVQA 3J7Z5 3E51A 1CJUA 1R8HA 2R7QA 2KL8A 3OBIA 1VK8A 3JYTA 5C42B 3CJTA 1YBAA 1O0PA 2DHHA 1VYAA 2VDIA 5DM7Q 4JI2F 2VUGA 3TJ9A 3JSBA 2VODA 4QJVA 2H65B 1Z2LA 2BA9A 1WTBA 2DGTA 1B7YB 3V6HA 2LYVA 1T9YA 2SXLA 2V4JB 4KFBB 2F1FA 2Z2YB 2OD6A 4JI6J 4DLGA 1RQ0A 4YEAA 3PX4A 4PXEA 4J9KA 3T9ZA 2Q6BA 4ZOSA 3TQEA 1FJGJ 1DHMA 2N82B 4FKXA 3OQ2A 3MM8A 1JK9B 1YJUA 1NLKL 4XK8C 3MTJA 3BDPA 5K8MA 3CD6S 1F9EB 2HURA 3CJKA 1YKWA 1Q8BA 5D4LA 2GMJA 3TZWA 5G4DA 4PXDA 1HNWJ 1S9GB 3VF0B 2XYPB 2HMIB 3S6EA 4NZ7A 2UVRA 1FRHA 2D7SA 2GVDA 1R0CB 1UJ4A 4H4OA 1JLQB 1JQGA 1NM2A 1K1SA 2CPIA 3ENQA 2GHVC 3A8IA 4DI6A 2R2UA 2JWNA 2WONB 1UWBA 5GAHI 4JV5J 1IQTA 3MAQA 1HYSA 1D9DA 1HI1A 1U09A 1SVDA 2CPFA 2I5JB 3MDFA 3BQ1A 4UZCA 6FD1A 3CJ5A 2ZUGA 2EPIA 2M9KA 4L76A 1VIXA 1ZS6A 2JDJA 4KV8B 1FRXA 2ZOFA 4KKOA 3KUEA 2WSCC 3P45B 1HARA 2AEFA 2HNDA 1VRTB 1I6JA 3HKZD 3UNYA 1MROB 1RE1B 4IG0B 1W2BR 5CAAA 1GFWB 5HAOA 4QWEA 4U96A 4KGXB 1KDNA 1FDBA 4Y34A 4K4UA 5GAEI 1P1TA 3OVAA 2IBKA 4CNYA 2W4CA 3BS9A 1UKUA 3J7ZT 1NK5A 4EO6A 3A1YG 3J7YU 2ALYB 2XNQA 1SC4B 3MMAA 1SH0A 4OZ0A 5E33A 5IM0A 1RDRA 2MKJA 2W01A 2PA3A 3HULA 1SL1A 4RNOA 3O8WA 2BRKA 4M94A 1C0TA 2HFOA 3M32A 2X1FA 5LSRA 3E3XA 2OELA 3G82A 1MNEA 4QWAA 2W9CA 1B7FA 5KFJA 2QTWA 3ET6A 4LF4J 3OFHA 5DG9A 3D6HB 4PWUA 4ZLNA 1GTHA 3QO9B 3FVYA 1X0FA 1DTQB 1C1BA 1S6PA 1W7WA 2FGOA 4DV3J 4U7UD 2RD5C 1PCAA 3HPOA 3D66A 3MWBA 1YTYA 2H4WB 2OHDA 2E5LJ 3ISND 4LT6A 2CA9A 1CC7A 1X4FA 4FNHA 5KG1A 4O4GB 2W9BB 3D6FB 4B9MA 2YPZA 2PEHA 5HROB 3KK2A 4MJKA 4X65J 1ZA1B 4IFVA 4HHUA 2VU5A 5U47A 2MKIA 3BPDA 3W9IA 1YHQS 1IBMJ 3RW6A 3TVKA 3DRXA 1UVMA 4OYPA 1PJ5A 2GQ2A 2CQBA 4ECWA 4I2PB 2EFPA 4ZVQB 1GH8A 5T7LA 2XMMA 3CXCR 3K89A 4P9SA 2GGPA 2F65A 1N6QA 2HG4A 2KG0A 3I0RA 2HWHA 1V5VA 5CYMB 1NPKA 2LQJA 1U6ZA 4USHA 3HFZB 5KFLA 4DWIA 2K1RB 3C6UA 4DV1F 2IVMA 3P49B 1VFJA 1NUEA 4YB6A 1TKZB 2CZ4A 3D28A 1S7IA 1R0BG 4OLPA 5A2QU 5F8MA 3EGWB 3FSIA 3K7RA 1C0UA 2HS0A 2OLWA 3GV5B 3KHLA 2XTJP 1L3TA 4LRCA 1NXIA 5A8WB 3HVWA 2QSWA 4WJBA 2ZHBA 3DFEA 3HT0A 3OW2R 1MWYA 4R0JA 2VC1A 2DHAA 1FO1A 2VBWA 2XGPA 1FRIA 1YJ9S 3LPEA 1JLGB 2UU9J 2BBEA 4CH1A 4PAAA 3QATA 2CADA 4EUVA 1RHRB 2UXDF 2Z58B 3FZBA 3D4JA 4CDIA 4ZKAA 2R2TA 3DDNA 2B4OA 1QDUB 1TKTA 2XNRA 1OYEA 3AJ2A 3MGJA 4DMZA 1XNRJ 2ZJRQ 1J2VA 3G8SA 3GE9A 1RTJA 1UVNA 2H48B 4LSNA 4CLTA 2NUHA 1VQMS 3NP5A 2FVCA 1SV5B 3M1VB 1YX2A 2E1MC 3W62A 1VRQC 4CO2A 4J90A 1KQGB 4ZHRA 6AT1B 3L7OA 1RT5A 4RW8A 3DOMA 2CQ4A 5AE3A 3H7HB 3GSIA 2AD9A 1SJFA 1PC5A 2ASJA 4DSIA 1FJCA 5CZXA 2RSQA 2UUWA 5F3TA 2Z57B 3ITHA 2DO4A 4OZLA 2RHQB 1UJ6A 2KKHA 2X3GA 4F3QA 3IO1A 2PI5A 2U1AA 2EWHA 2DEJA 2MPUA 4LQ9A 3MCNA 4PXBA 2DKOB 2H51B 2GIRA 4X4QA 2HFUA 4FDFA 3W8PA 2MZSA 1F2HA 1WC4A 3POTB 2ABYA 3DXBA 2JX2A 2IFXA 4NXNJ 3OJSA 3KLVA 3PKYA 4LF6F 3H2VE 1MU2A 2FHJA 4ZVGA 3AB2B 4U7UK 4ZA1A 4U95A 4DR2F 4BBYA 2F7VA 2XY5A 5KFPA 5HATA 4USJC 3LWMA 3DLGB 3QT7A 3TX0A 3PEHA 2ZD1B 2C2NA 3W65A 3NKYA 3LP2A 2Y1JA 2KT5A 3R5DA 1KBRA 3CE8A 3V6KA 1T05A 1EQ0A 3MCMA 2MGZB 5HLFA 2MKCA 2GC8A 2Y9HA 2YNFB 3R3TA 4KRWA 4YP3A 3ADAC 4M5NA 1WUUA 4RBUA 1N36J 1QM9A 2AYEA 1LWFB 1Q1KA 2DO0A 2MMYA 5BR8J 2OJ3A 2V8HA 3GJQB 1PBUA 1GX5A 3UFCX 1EX8A 4NOHA 4CO0A 5AXNA 3ZNJ1 1A0OB 1QUVA 2GQQA 5C5JA 2ZH7A 1SJ4P 4USUA 2XY6A 2H1YA 3IWNC 4KYZA 1P27B 3MM9B 4LRBA 3K59A 5D8HB 1BLUA 1AFIA 3V5RA 1FRLA 3TZXA 1SJRA 4DCOB 5FIIA 2IYIA 2JZ5A 4NLOA 4B3OB 3SDEB 4ZIWA 2A1BA 1HI8A 1HWJA 3NL0A 3MFHA 1XNQF 1T9UA 2GVZB 3V4IB 4K5RA 1BQNB 4P6QA 3W3SA 2CQHA 3BKFA 4WFAQ 1BUXA 2W4DA 1KHVA 4DV6F 1C1CB 2JLGA 1NMEB 2O1PA 5KFOA 1W25A 1FFWB 2EBGA 2CIMA 4JUZA 1YZ6A 5HI7A 2VQEF 4PG4A 1R6YA 1RT3A 3R27A 2V4QA 4LF9F 3IN5A 1XIQA 5I3UA 3CC7S 4I6WA 1NDKA 2MQMA 2HQ3A 3AT1B 2DIUA 1QUPA 1LWEB 4O3NA 1HMVB 3B54A 1FRMA 4CI0B 3MFIA 4DFPA 3CD5A 2AYMA 2DNZA 3TQ1A 3MPWA 1FDDA 1CVJA 1S1UB 4KQZA 3PG9A 4I68A 1S6QB 3HP6A 1RADB 2WOMA 2DEIA 1PSDA 4DR3F 5A8KA 4ID5A 1RTIB 4USTA 3CCSS 2G0IA 3L7UA 3MR3A 1WNEA 1IBCB 5HMXA 1GMWD 4IOBA 1ULRA 3MF5A 2FHJD 4ALZA 4ETZA 3TZYA 2ROGA 2CJBA 3SCIE 4F0KA 1QE1B 4CO3A 4D3GA 2G2ZA 2OPPA 4G1IA 4BC7A 4ES3A 1AUSL 1X0PA 3KJFB 4UF4A 2AYBA 5T14A 2MKSA 3LALA 4LJMA 1K47A 4I56A 4ICLA 3EGZA 2KVQE 4CYUA 4MK9A 4NI2A 4IH6A 4WFYA 2AIRB 2Z8QA 3C6TB 3CT9A 2ALZA 1AYEA 4WWSA 3JSMB 2JEJA 2QYCA 3CIZA 2VFRA 1RT4B 3WX4A 4B02A 3GMGA 2D3OR 3M2UA 2RKIB 3DMJA 5F41A 3UDCA 4ZLLA 5EUHA 3GG0A 3OFGA 2KU7A 4CT8A 4P2FA 3BB5A 2DYAA 1CJUB 2BOPA 3PYEA 4GVBB 3JYTB 1UVKA 3QWUA 2AW0A 1RWMB 4DV5F 3CCJS 5SZTA 1DFDA 4DQIA 5CD4H 1H0HB 4I6YA 4W98A 3KLHA 2WK4A 1UEKA 1CPZA 3AD8C 1B0VA 4MKAA 2MLXA 2KI2A 1WEXA 3ZZTA 4L72B 1FERA 1RWVB 3BKUA 4JP8A 2HHPA 2P6TA 5HVHA 2PMHA 3KLGA 2ZE2B 4ITSA 2ILZA 3IR6B 1KLNA 4PG8A 5EWFA 1U7LA 3MCSA 1Q81T 1D8ZA 4HT7A 4Q8FA 3EDQB 3DRYA 2IRYA 3MM8B 4E98A 5DS7A 3SCJE 2DD8S 3DU5A 5CCLA 2RAQA 1G6BA 4TXSA 1IM4A 2OTLS 1N0UA 2WAQD 2BRLA 4P2XA 5GAGU 4OHXA 2XHWA 3G87A 4NE9C 2BR0A 1N56A 2Z2ZA 1S1XB 1JJ4A 2JEIA 3S01A 2GVDB 3ISZA 2CQPA 1BY9A 3WIVA 4HDHA 2AJ0A 4H4OB 2QLFB 5J1EB 4IG3A 4PG7A 3TYTA 4DR5F 2AQ4A 1LFPA 3BSNA 1WJ9A 2WVCA 1N33F 1XR6A 4A8QA 1B70B 2QO3A 2EFOA 2DGVA 2EK6A 3HD2A 4F04B 2AF6A 3PR5B 2BW7A 1MSWD 1UWBB 3I5BA 3E8OA 4WFZA 4P2SA 4R25A 1HYSB 1H2VZ 5D3GA 1FK9A 1FDAA 2DISA 2UXBJ 1R8BA 2OP5A 4C0BA 2HBZB 1AFJA 1UA0A 1R0AA 1CJVA 2JRSA 3V6DA 5DLFA 3BGLA 2V8VA 1DARA 2HNDB 4Z37A 1H74A 5IOLA 2D3O1 4ES2A 2E44A 2ZBPA 1O5JA 2CDRB 2DPJA 2BJDA 2VD3A 2XMUA 4NLGA 4DF8A 2CRLA 1RHMB 1CS4B 4ED8A 3DLBA 2IY5B 2OI2A 2KM8B 1KWMA 3RR8A 2JVRA 4QR2A 3MMAB 4NX9A 1OPIA 3KOAA 5IM0B 2WSEC 4RZRA 2EKNA 5DGBA 5HVGA 3W2VB 1W26A 1WTFA 1KFSA 2OSRA 4HL9A 4Y00A 5KFIA 3FGVA 4K2XA 2WW8A 3SI8A 1C0TB 2RDDA 4A8MP 3M32B 4NCAA 1NDPA 1CQMA 2W9CB 4DCPB 4ZVUB 2B8PA 3ET6B 3M8PB 5ETSA 4CP5A 2R7VA 2IDLA 2W2NP 1C1BB 1S6PB 1OO0B 3EX7B 5KFFA 3MMCA 3I32A 2OSQA 1S99A 5KT6A 1KTQA 1WELA 2VKZG 2V6AA 4IO9Q 1YLXA 2V5HG 5KFRA 2DVIA 2CPJA 3I96A 4TY8A 1JLAB 3A13A 2H4YB 4IFVB 2ZH4A 3K0JA 3K5OA 3KMSA 1JIHA 3OR2A 3D1HA 1TL5A 2RU3A 1QAJA 5KFMA 2MHNA 4Q0BB 4GKJF 4B9SA 5T7LB 4ZPCA 3CJRA 4I2QA 3KLEB 3DLJA 5D0HA 1RHQB 1VHIA 4IRKA 2GGPB 4NEZA 4J37A 1N6QB 3KG1A 1PAUB 1S1TA 3PXGa 3UDLA 2K3KA 3MD1A 4RW7A 3H5YA 2BDPA 1TKXB 1EKSA 2DRDA 4I0WA 2RQMA 4V19J 4P7VA 3BBBA 1SKRA 3FBCA 4QR0A 1QD1A 3C6UB 4BWJA 3HK2A 4DJBA 4A8YA 3KG4A 4M1KA 2HQCA 2YKNA 4DUZF 3HSDA 4U9RA 4JV2A 4DZDA 2J9DE 1PG5B 4KT0C 5HN0A 2IHR1 1MMDA 4JI3F 5HJYA 3SEOA 3MXHP 4DS4A 4G1PA 3RBXA 4FF2A 3L9ZA 2E7WA 2RMLA 2R2RA 5F8NA 2V2KA 3EGVA 1Y3JA 4F4YA 1LW2A 1UW9A 2BKNA 5JVGQ 3VGUA 4FP9A 3T1AA 3I31A 4KO0A 1DBDA 5B0BA 2VQFJ 4J7CA 3ZTRA 2I2YA 2YWKA 4DSLA 1X4CA 4A8OA 4K4TA 1NK0A 3M9OB 4AXJA 3N9UC 2HHHJ 1TKTB 4NYPA 2DH9A 4MT1A 1K44A 1X5OA 3RBDA 1REVA 1RA6A 1RTJB 3HD1A 4LSNB 3KG0A 3OHAA 3FEXB 3EXCX 3CC4S 3CCMS 1TP7A 4QIGA 4ZHRB 5K8OA 4IFYA 2HVHA 1RT5B 4RW8B 3DOMB 3IG1B 5IXUA 3T6JA 3KMQA 4WU2A 5KOXA 5LM7E 3NGRA 3BGOP 4AXIA 2RF2B 2FHMA 3KDOA 4A47A 5F3ZA 3VWSA 3A8KA 4UT4A 1J5OA 3FNNA 4JYAF 1YRTA 1SC1B 5KG7A 3Q8QB 4HHHA 2QG9B 4YY3F 2FPHX 1XMOF 1DJ0A 1TMJA 1ZAVA 4A4JA 1GXTA 3AXMA 3C66A 2IM0A 1MN9A 2OPRA 1JLBA 4G65A 5I3PA 4PKDB 1LWCA 2U2FA 4ECTA 5K8PA 3M2VA 3O3LA 1RTDA 4OQJA 2N4CA 5RUBA 3HSJA 2J8AA 3OTCA 5DLGA 3PW4A 2NSCA 1HBOB 1PO6A 2B4PA 2CZ9A 5IT9U 2VG7A 1T05B 2IM2A 1CSJA 1NZ8A 5JUMA 7FDRA 3GV8B 3M9MB 2ZWPA 2W2QP 5DG8A 1IKXA 3SSRA 3EUNA 4C7QA 1H73A 1VOMA 1B64A 3CO9A 1QAXA 3Q8SB 3K5LA 4UOHA 2F4VF 3M6VA 2DRBA 1BWVA 3KKFA 2F8EX 4DR1F 2FHOB 4RBVA 2YNIA 3BO3A 2XZDB 4FYVB 4M5JA 3DDIA 1RU2A 4C48A 4B3SJ 1A6LA 3RW7A 3R1LA 2IAJA 5KFYA 3VVTA 1NSQA 4FZVA 1NB2A 3CD7A 3OL6A 2QRRA 2ZWOA 3NMRA 4GO5X 4ZS6A 2V68A 3ZZPA 5E41A 1N54B 2V50A 3BGRA 4J9OA 3DN9A 4MIAA 4ECYA 3T41A 1XMQF 4LIRA 5E3RA 3SQOP 1XEZA 5D4OA 3Q2TC 3PO5A 2D9PA 3M6UA 5D15A 3PYGA 4U8VA 4L3NA 4JI4J 1P1LA 1PIEA 4A46A 2ZBCA 3PW5A 1RT3B 1TUWA 4KH1B 4ZP8A 4P7TA 3CVKA 5I3UB 4DV7F 3NS5A 5J2PB 3UI3A 4U8YA 4M63A 1OQ3A 4ZVFA 1NKBA 3UDVA 2HHUA 3PY8A 1UL3A 1EIYB 4F4AA 3DCAA 3UD4P 4PQUA 1RT7A 3JTNA 4DL2A 3I0SA 3IMQJ 1S0NA 2FZGB 3OXFA 3DM2B 3KNAA 2V8DA 5K8NA 1HPZA 3HSGA 2ZNZA 1SKSA 3TJAA 4CM0A 3BQ2A 4B3RJ 4WP8A 4TLQA 1A7GE 5KOWA 1T3NA 1S0OA 3M9NB 2WOMB 3H25A 1KHWA 3AJDA 3ISNC 1RACB 1BE4A 3MEDA 3PYFA 3ZFVA 3N79A 4K4SA 3OSNA 4TVAB 1T02A 2I6WA 1WG1A 5SUHA 2DGXA 4DL5A 2AWZA 2X3DA 4NZ0A 1KP6A 1U49A 3G4SS 2X7IA 4HEA9 1RUSA 2MQ8A 3DRPA 1GNKA 4CCHA 5KFDA 3FMWA 3V81B 3BR9A 3IP0A 1BWEA 1T9XA 1FE0A 3BSAA 1YG0A 4DV0F 2OPPB 2J0SD 1YJVA 4F7VA 2Y1IA 8RUCA 4FVCA 2M4MA 2HVIA 4WP9A 2DIVA 4JI0F 3LW5C 4J5OA 4DHVA 4URQU 4DR6J 2DRAA 2L3MA 4ICLB 2BE7D 2W7OA 4CYUB 4NI2B 3QZ8A 2V2ZA 3LAMA 3X1LB 4OX9F 2B9XA 1RAIB 3W63A 5DZ6A 1IBLJ 2UV8A 3DLEB 3N0VA 1HHSA 3M2UB 3DMJB 1AROP 2CDQA 4ZPAA 2WSFC 2MY7A 2J9CA 3MEEA 1VLOA 2BEFA 2VPWB 1RKIA 1WOSA 4EZ6A 4GC7A 1V5IB 2IJNA 5D6GA 4H4MB 2KTQA 1BHNA 2ZC3A 4K8RA 4ZLPA 4K2JA 2DXFA 2XHCA 4M5KA 1RBLA 1YBUA 2G1DA 3PX6A 2XI3A 5CYQA 2CJAA 3KLHB 2G0JA 1IKWA 1QTNB 3PJ9A 2E1AA 4RLEA 5E5NA 1JKHB 1TQLA 3VQTA 3DLKA 1KRPA 1FNMA 1GQEA 4DXLA 1M0SA 2YKPA 4J9UE 1JLEA 1N5QA 4PRFA 1TAUA 2YWEA 4EBDA 1WF0A 4WZQA 2GAGC 4FNIA 4I6AA 5ITHA 5DZ7A 4ZJOA 3GCWP 2ZJPQ 4MYTA 4HH0A 4WK1A 4C8OA 3FRZA 2IPOB 3HO1A 4C3LA 5HQMA 4GMKA 5CQGA 3QSIA 5H9FJ 3G96A 3OSPA 4HTIA 4Q7AA 1TV6A 2F63A 4DQQA 4IG3B 1FFSB 4F4KA 3CWJA 4ED3A 1N88A 3RYLA 3LP1B 1WHVA 4R8UA 4U6PA 3GJSB 3QWPA 2CQ0A 3I4HX 4UOCA 1S9FA 2WHOA 4UUWA 4M5DB 5HANA 5D3GB 4PPDA 1KSPA 2XM3A 5KFHA 1D9AA 3HHLD 2N7CA 5HMWA 1SQFA 2V63A 1I1GA 1R0AB 1RT1A 4ANCA 1CJVB 3J81j 2UXCJ 2VBZA 3V6DB 2YKAA 4LFAJ 3Q8UA 5H1SV 1ZTTA 2P9GA 4A8KA 2KH9A 1FTCA 4ZPTR 3AQPA 4O44A 3OTOJ 1NJIT 2DGOA 1M1KT 3IAS9 2O5DA 2AJ2A 4WE1B 3LO3A 1X5TA 5HBMA 3THPA 1D3WA 2YH1A 3CCVS 1T03B 4AUKA 1KR4A 4MTPA 2QL7B 4ECZA 4OI6A 1L3VA 3M05A 1XN9A 4ED5A 2HHXA 5L9XA 4B17A 2UUBJ 3KYLA 3IA0A 2BUNA 2R7UA 1K73T 3LWLA 1U6BA 1GTEA 3QRQA 1NHVA 4NMXA 3W1YC 2LEBA 5K5MA 3CC2S 1JMTA 2MSTA 3H5SA 1MWZA 1NPPA 1X9SA 4C8MA 1BMQB 3UWTA 4IRCA 3QFHA 1IR0A 4Y6IA 3ENVA 3ETOA 4OYXA 1VQLS 1TL4A 2QT7A 3MMCB 2ZEJA 3QJPA 4ILRA 3J7YI 1RTHA 4MAKA 3BF4A 3ZNUA 1GMUA 4FYDA 1OPZA 5IWAJ 4ZVTB 1VQ9S 2CWXA 1KNZA 1Y00A 2ZBRA 2HLTA 4OV1A 4DV5J 3BBCA 1YJWS 1HHQA 4ERDA 1WI8A 3G9CA 4ER8A 4ZCIA 3KK3B 3EVOA 1GEHA 3W61A 4LIWA 4OZ3A 4JI8F 3I55S 1F5BA 1NZAA 1NDLA 3OR2B 5KFAA 4K0KJ 4Y2CA 3HM9A 1XWLA 2W25A 4QPXA 2WCXA 2ZKUA 2WRMA 2HBRB 2OPQA 4ETXA 1LOUA 1R27B 2HKEA 2BE2A 2AX0A 4I2QB 4C4WA 2UUAF 3D3BJ 3P3DA 4NASA 3SYZA 3DDKA 4Y2KA 3PIOQ 1G7CB 5D4NA 3QNWB 1QJHA 1J5EF 1S1TB 2C1EB 3R8YA 2CNNB 3G6YA 3CCUS 3MECA 2EEYA 4CTAA 2IJRA 2VHGA 3RUBL 2J0WA 3SSSA 4BCAA 3QBCA 3DOLA 5I4MA 1DTTA 2IM3A 3HI9A 2DNKA 1D0EA 2CG4A 1TFYA 3JSRA 2FY1A 3US5A 1EJ7L 1Q5VA 2YKNB 4KGKA 4DG1A 1VC5A 4OYIA 3CJ0A 1UEVA 4QPTA 3A3OB 4E2FB 4RW4A 3D3CJ 1N33J 3EZOA 1BQMA 5FJ4A 3AD9C 2HWTA 1PBAA 4XIUA 4IH7A 5KFTA 1BXNA 3R5BA 4RW6B 1OQ6A 5BYQA 4DF4A 3H0PA 3OD2A 5CYJA 2VG5B 1SJ1A 1SH3A 3OUYA 1ZYQA 1TL1A 3FCVA 2G13A 3EMTA 5KG5A 1LW2B 4DV4F 3FCHA 1VQNS 3QGIA 3F56A 2EFQA 4K50A 2KRRA 7AT1B 1U1RA 4KHPF 2ZVIA 1QTMA 1PILA 2G4BA 2ILYA 1HNXF 2R9LA 2FZKB 1URRA 4CLWA 2IC3A 2AYGA 2DNNA 1REVB 3R5JB 4HT5A 2FJVA 2FJWA 4LVNP 1F3VA 4WFBQ 4NRUA 2YQ1A 1HWUA 1Q7LB 1WSRA 4KH0B 2VIHA 2OFGX 2RHSB 3CJ3A 2CQ1A 1PYOB 5L8RC 4IOCQ 4CM2A 5H9EK 1HQEA 4JV1A 1PYTA 9RUBA 3KUGA 3RRKA 3JQMA 1R31A 2ZBIA 4XPEA 4X66J 3Q24A 3EZUA 2CQGA 4ECSA 2MHEA 2KFNA 1J5OB 3T5LA 4URGA 1CJKA 3T1YF 1FDNA 1M5VC 4Q5VA 3KK1A 1VR6A 1CJTA 1DQ8A 3FKBA 2YKOA 2BOAA 5DDRC 1S76D 2YQ3A 1AW0A 4ZIVA 5KT2A 3D5MA 2OPRB 2B56A 4FPRA 1YRXA 1H6KX 4F25A 1LWCB 4K4WA 3M2VB 2CJYB 1I94F 5J2QA 1SUQA 3ICLA 2O66A 1OSDA 1HNVA 2CWKA 2GAHC 2NS1B 2AEMA 1C2PA 4OX8A 1SC3B 5LOQA 5AXKA 1KLMA 2HZVA 1Y4ZB 3TUJC 5KFVA 2QLXA 2VG7B 3ZO7A 1SXLA 4DPWA 3DGPA 1FVQA 2FY8A 4DSKA 1IBKF 2ADBA 2Q1LA 1Q8LA 1GXUA 1SKWA 3KDNA 4TU8A 4UTGA 5LT5A 2E1CA 1WKJA 4BLGA 3LH2S 4ZP7A 1EETA 5JXSA 3NOGA 2YBVA 2X51A 2GZOA 3CB4A 1S72S 4UQTA 3CNQP 2HBYB 2XGQA 2BW2A 2HVEA 2NZ4A 4ED7A 2DGUA 3C16A 1NO8A 2MB0B 3ELHA 1NAQA 2KFZA 1NK8A 1N0VC 2IAJB 4RWXA 1WHWA 3SCKE 3DKDA 4WKRA 4DX7A 2CPZA 1OIAA 2YNGA 2C2OB 2ZOMA 4DSFA 1WI6A 3IM8A 1SKUB 4FF1A 1T3OA 3I87A 2ZKTA 3BGRB 1ZAXA 5EHHA 2CNLB 4N7TA 4HI2A 2MQNA 2VICA 2I38A 4GKKF 4PCQA 5D0GA 1NRKA 1Q0NA 3MTKA 4Y2IA 3NBPA 2CPDA 4PR6A 1T7PA 1RP5A 3PYDA 1IKYA 2K3IA 4JB8B 4C0OC 3BDEA 3O6QA 1Y5LB 4J9NA 1WC6A 5KT3A 2HW3A 4PQUB 1NBEB 3HMJG 1RT7B 1EQMA 4UQGA 4QZVB 3I0SB 1VQKS 4OYAA 4OYWA 3NGUA 1KQSR 2DNMA 2MQOA 3UCUP 2AZ1A 5E0OA 2YKQA 4DR7F 1YGYA 2PE8A 4AFFA 1VQOS 5H9FK 4KHMA 3BN7A 3CDWA 1OWXA 1I5OB 2DK2A 3NWGA 4NZ6A 3MEDB 2C2MB 3ONQA 4EO8A 4C8ZA 2VG6A 3W5XA 3PIPQ 4PWDA 2PO4A 4JOUA 4CQ1A 3THVA 1FKAF 4Y65A 2MKHA 4TU7A 3KJQB 4LRAA 3V2UC 3BGUA 2JHEA 2NSBA 1ZPVA 3NEKA 3BH7B 5HMZA 2C22A 3SFUA 4AD6A 3TAMA 2POKA 4FN5A 5A8RA 3TVZA 4YDXA 2MLZA 4CIOA 5ADZA 5CD4A 2E5HA 4N76A 1FWKA 4M5LA 5ETKA 1RZMA 3MM6A 1XMOJ 2IA0A 4C3KA 1UFKA 2JLEA 2AGOA 4LF5J 3CCQS 4FVMA 2EVZA 3A12A 3THTA 3QMQA 2IRXA 4E0DA 4NEYA 3R2CJ 3W5YA 3M8WA 2XBPA 2OIHA 3T1HJ 2NPFA 4JI6F 3CJSA 2KXFA 4ZPBA 3FFIA 4CLZA 4P72A 1FD8A 1ZM4A 2Y0SD 1FJGF 3ENAA 1E6YA 5ETRA 3K5MA 2VA2A 3HX9A 4L73A 1ZZFA 2W1BA 1ZZNA 5CYQB 4AQYJ 1NHKL 3SCLE 1EHWA 1I51B 4CNZA 3VR1A 5G0RA 2F8MA 4P2MA 4B3TJ 5DDPC 5HK4A 2WB1D 1S1WA 3DLKB 1S1VA 2YNHB 2CVEA 1UW4A 1WC3A 2B6AA 4QWCA 1WC1A 5LMUJ 1FD2A 4M5GA 2F4VJ 4KAIA 5DO2A 2OUGA 1TK0A 3AOAA 4UOFA 2OTJS 3GTYX 1Q5YA 2HGLA 3PJWA 2QZ8A 2CNOB 4USVA 2PMWA 1WG5A 1S10A 1MMNA 3CGIA 4JV5F 2JC1A 2YPYA 1OJ4A 1HQUA 3J80U 2PMZD 1Y0HA 1HBUB 2N7YA 3SXLA 2HGNA 3U27A 4ECRA 4DPOA 1NDCA 5C24A 2NXEA 2MQPA 1T8EA 3Q2SC 3O5TB 3K58A 1TV6B 3DRSA 4URSA 2RQ4A 4C11B 2ZH8A 2D3ZA 2GJFA 4P52A 2LU1A 2ZOGA 1KS2A 4JI5J 2LQBA 4R8UB 2KO1A 3SQGA 4B9LA 3QRRA 2V0NA 3HZEA 2QFIA 1DRZA 2HIYA 2A2DA 1U0HB 2PDAA 5LXYA 2ASYA 2JH3A 3T19A 3N28A 5IQ6A 3QSYB 1RI7A 1TK8A 2J6TA 2DBBA 3FSXA 5GAGI 4EGLA 1RT1B 2LDIA 1UETA 2LXIA 1L3SA 1EP4A 1TL3A 1VCTA 2NXNA 4O44B 1QAIA 3D6TB 9ATCB 5KFZA 3BO2A 4RUBA 2W7AA 1WHXA 3ILOA 5F8JA 3A4TA 5HBMB 5D77A 1X9WA 1VLYA 4LF4F 5DETA 1S79A 2PT0A 3G6ES 4OZ1A 4KIAA 3RBZA 3TX8A 3OPKA 4WF9Q 5IS2A 2BZ2A 4QIVA 3RZAA 4A8XA 4DV3F
chains in the Genus database with same CATH topology
4ZVQB 3KJNB 3IBCB 1RHKB 3GJQB 4ZVTB 1RHUB 3RJMB 3EDQB 2HBQB 2CNLB 1SC3B 3KJQB 1I51B 2DKOB 2H51B 2P2CB 3R6LB 1PYOB 2H5JB 2QL7B 1RWXB 1I3OB 3D6MB 2C2KB 1RWWB 3D6HB 1QDUB 5IC4B 4LSZB 3R7SB 4ZVPB 2CDRB 4DCOB 4ZVSB 4ZVRB 3R7NB 2QL5B 1QTNB 2H4WB 1RWOB 3P45B 3R7BB 1RHMB 3GJTB 2H48B 3GJSB 3IBFB 2FQQB 2H4YB 1F9EB 3EDRB 2QLJB 4JB8B 1RWNB 2QLFB 2HBRB 1RWMB 4DCJB 1RE1B 1IBCB 2H54B 2CJXB 5IC6B 1GFWB 2Y0BB 3R6GB 2HBYB 2XYPB 3D6FB 2CNOB 1RWKB 2XYHB 1RWPB 1NMEB 3QNWB 3NS7B 1RHJB 4ZVOB 1BMQB 2C1EB 5K20B 2QL9B 2CNNB 2CNKB 1RWVB 1SC1B 1SC4B 3KJFB 2H5IB 3P4UB 1RHQB 2QLBB 1ICEB 3SIPB 2XZTB 4DCPB 2C2OB 4ZVUB 2H65B 3R5JB 2XZDB 2CJYB 3GJRB 2Y1LB 2HBZB 1PAUB 2C2MB 2C2ZB 1RHRB 2XYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVQ B;  3KJN B;  3IBC B;  1RHK B;  3GJQ B;  4ZVT B;  1RHU B;  3RJM B;  3EDQ B;  2HBQ B;  2CNL B;  1SC3 B;  3KJQ B;  1I51 B;  2DKO B;  2H51 B;  2P2C B;  3R6L B;  1PYO B;  2H5J B;  2QL7 B;  1RWX B;  1I3O B;  3D6M B;  2C2K B;  1RWW B;  3D6H B;  1QDU B;  5IC4 B;  4LSZ B;  3R7S B;  4ZVP B;  2CDR B;  4DCO B;  4ZVS B;  4ZVR B;  3R7N B;  2QL5 B;  1QTN B;  2H4W B;  1RWO B;  3P45 B;  3R7B B;  1RHM B;  3GJT B;  2H48 B;  3GJS B;  3IBF B;  2FQQ B;  2H4Y B;  1F9E B;  3EDR B;  2QLJ B;  4JB8 B;  1RWN B;  2QLF B;  2HBR B;  1RWM B;  4DCJ B;  1RE1 B;  1IBC B;  2H54 B;  2CJX B;  5IC6 B;  1GFW B;  2Y0B B;  3R6G B;  2HBY B;  2XYP B;  3D6F B;  2CNO B;  1RWK B;  2XYH B;  1RWP B;  1NME B;  3QNW B;  3NS7 B;  1RHJ B;  4ZVO B;  1BMQ B;  2C1E B;  5K20 B;  2QL9 B;  2CNN B;  2CNK B;  1RWV B;  1SC1 B;  1SC4 B;  3KJF B;  2H5I B;  3P4U B;  1RHQ B;  2QLB B;  1ICE B;  3SIP B;  2XZT B;  4DCP B;  2C2O B;  4ZVU B;  2H65 B;  3R5J B;  2XZD B;  2CJY B;  3GJR B;  2Y1L B;  2HBZ B;  1PAU B;  2C2M B;  2C2Z B;  1RHR B;  2XYG B; 
#chains in the Genus database with same CATH topology
 4CLY A;  2QMX A;  4DQR A;  1FKO A;  2E5L F;  1SC6 A;  3HHN B;  3GG1 A;  4D3H A;  4CZC A;  2G9O A;  4ATN A;  2R7T A;  1NJY A;  4OYB A;  5AE2 A;  3NCQ A;  1KTV A;  1VK3 A;  1LFW A;  4LF8 J;  2VL1 A;  5FLX U;  2Z2L A;  4ZCL A;  3KTQ A;  1SQG A;  3PW0 A;  1VGY A;  4OX9 J;  3HVT B;  4DFJ A;  2LEA A;  1ACM B;  3Q86 A;  5IT9 Y;  1IBM F;  2PI4 A;  4WII A;  3H4D A;  2V4J A;  4ED4 A;  3HCX A;  4I7F A;  3H2U B;  3E2E A;  1LK7 A;  1RTH B;  2GHP A;  1Q86 T;  1X4D A;  1QSY A;  1FKP A;  1HBN A;  4QCL A;  2DNR A;  1VHF A;  2VH7 A;  4OLO A;  1RAH B;  3GV7 B;  1UZH A;  2K06 A;  3TRG A;  5L1K A;  2HQG A;  4WP3 A;  4QIE A;  3ZZZ A;  4ED2 A;  1S9G A;  1F9H A;  3WC0 A;  4F4X A;  1VQ5 S;  2HMI A;  1JNZ B;  4YUD A;  4OJ3 A;  2HNY B;  2OFH X;  1JLQ A;  1S4E A;  4IO1 A;  5BYR A;  4DUT A;  1B3T A;  3F41 A;  3IFE A;  4P71 A;  2OPQ B;  1Z4U A;  2BE2 B;  2XSF A;  2A0F B;  4F4W A;  2WBR A;  4LBH A;  1HQ2 A;  3BJY A;  4XDD A;  1HW9 A;  1S59 A;  2WON A;  2Q6C A;  2OAU A;  1A9N B;  2AJQ A;  1CLF A;  4QBU A;  2UU9 F;  3MEC B;  3AXK A;  2W2M P;  2OD4 A;  4A8W A;  1JLC B;  1CBK A;  2XI2 A;  4KHR A;  1EKR A;  4LMZ A;  4B9U A;  4HH1 A;  1KD1 T;  4ZP9 A;  5B08 A;  2M2B A;  1LK5 A;  1DTT B;  4O4R A;  2KXN B;  2AX1 A;  4EU0 A;  4KV8 A;  4DG1 B;  1R43 A;  3TVY A;  1Y11 A;  2VB6 A;  1ELO A;  4MFB A;  2B5J A;  4OHY A;  3UNG C;  4RW4 B;  1RT6 A;  2L9W A;  3P96 A;  2BE9 B;  2XS7 A;  1OYD A;  1XNR F;  1RHK B;  3AOC A;  4OMF G;  4TYB A;  4C8Y A;  3DXS X;  4B9V A;  2D74 B;  3SBM A;  1NK7 A;  4NLQ A;  5B0E A;  2BKP A;  4RW9 A;  1IKV B;  3OUY B;  3LF0 A;  1GXL A;  2N4D A;  1FHT A;  1N34 J;  4ED1 A;  1JLF A;  4MH8 A;  3K5N A;  2DNH A;  1YBT A;  3BZQ A;  2VKR A;  2BXJ A;  3HHK A;  2ACM A;  2PGC A;  4LBI A;  3D2W A;  4DPU A;  4YHH J;  1IWG A;  5LMN J;  4KC5 A;  2VFV A;  1HR0 J;  2IC3 B;  3NCP A;  5KG4 A;  4WCE Q;  3DGV A;  3NWR A;  2BJ8 A;  4V19 X;  3OL8 A;  4YR2 A;  3QO9 A;  2ATL A;  4FXD A;  4DDF A;  4KR0 B;  5KFX A;  1P9Q C;  5AJ3 J;  1S77 D;  4X4N A;  4EZ9 A;  3TW0 A;  4NXN F;  2EK1 A;  3PM9 A;  4WYL A;  1NJW A;  1N5V A;  2W9B A;  1SBR A;  4QW9 A;  3EGN A;  4IR1 A;  4RUA A;  2IYG A;  2P8I A;  1CG2 A;  4LFB J;  3C8Y A;  5L1J A;  3NGD A;  1Y5I B;  2EC2 A;  2HRU A;  3B4M A;  1CJK B;  3NS6 A;  1VBX A;  5LJ3 Y;  1L3K A;  3KK1 B;  3R7B B;  3TAR A;  4ILM A;  3QYY A;  3AAW B;  5HQ8 A;  1T9T A;  3IS9 A;  2ASL A;  4EWT A;  3L95 X;  3H98 A;  4IYQ A;  1N36 F;  2XMA A;  2QA4 G;  4TU9 A;  3TOQ A;  5BR8 F;  3ZTQ A;  1IJF B;  3O1L A;  5J2Q B;  2E9Z A;  4NRT A;  4ZVO B;  1OY9 A;  3E01 A;  2OGU A;  1UWA A;  3IGN A;  5CYM A;  4ZPD A;  2YWG A;  3NOC A;  3GIL A;  3CME S;  1U8S A;  2C3M A;  8AT1 B;  1L3U A;  2L9N A;  1GMW A;  1TKZ A;  4ZMM A;  3DGP B;  1UVI A;  1IVZ A;  5E2Q A;  3W9J A;  2GJI A;  3QLH A;  2N3L A;  4R0E A;  3AH6 A;  5HVF A;  4DOZ A;  1TU0 B;  3I56 S;  2QV6 A;  4LF1 A;  2H5J B;  4OHW A;  1H2T Z;  2JVO A;  2ZBQ A;  3ZZO A;  3U7J A;  2GO8 A;  1YDL A;  3UVJ B;  2NUU G;  3BGF A;  5KFU A;  3MPU B;  3EPI A;  1ZAW A;  2A6O A;  3I9V 9;  2MZQ A;  2V69 A;  3KXD A;  4O3R A;  4LFC J;  5LSL A;  4IR9 A;  1N32 J;  3HHL C;  2B43 A;  1UZD A;  4MIB A;  3VAL A;  4DCJ B;  3CMQ A;  4CO5 A;  3VGS A;  4DX6 A;  4JI7 J;  4GRS A;  2DIT A;  4K4Y A;  2IMW P;  5J2M A;  4IDK A;  3O2I A;  2XMV A;  2YNG B;  1HNZ J;  4EYI B;  4YDD B;  4ZCM A;  3NXZ A;  3ILI A;  3HF5 A;  3G6V A;  4TNO A;  2JFD A;  1MLA A;  1KFD A;  1YIJ S;  1F5C A;  1OSC A;  4RO0 A;  2PD1 A;  3SIP B;  3L7P A;  5HL7 Q;  2ZH9 A;  1JXL A;  3M7V A;  2X1A A;  2AHO B;  1JXE A;  2BJ3 A;  1SV5 A;  1SL2 A;  2NCK L;  5LXR A;  3CMA S;  4WK3 A;  2W4P A;  5I42 A;  4N47 A;  4USW A;  2KZM A;  2C3Y A;  1XK8 A;  1QSL A;  1JJH A;  1IKY B;  3NGS A;  4DN9 A;  4OJH A;  3KHR A;  2L08 A;  2FLN A;  3MOJ B;  4KHP J;  3H8Y A;  5CA5 A;  4QYZ K;  3LUY A;  4Q2M A;  4C8K A;  2F5G A;  3PFE A;  4Q45 A;  2FQQ B;  4J9R A;  4J91 A;  4NL5 A;  4WFN Q;  1YIT S;  2LMI A;  4FF3 A;  5C25 A;  3ULH A;  1Y5N B;  4K59 A;  1LKZ A;  4LR9 A;  2BJ9 A;  4C0H A;  4UZB A;  2BQU A;  2R3V A;  2W9A A;  4OX6 A;  1U2C A;  2YKM B;  4JI1 F;  4PWD B;  2FLL A;  4X64 J;  4F02 A;  1GK8 A;  3ILL A;  2AT1 B;  1P8G A;  4L6V 3;  2OPS A;  2A3J A;  3QIP B;  4HLB A;  2FVP A;  2DR7 A;  1REG X;  2MZR A;  4N8N A;  2HRY A;  3UDE A;  4WIQ A;  2QC3 A;  3H90 A;  4ZK7 M;  3DLG A;  3TAM B;  5A8R B;  4ZDN A;  3M8Q B;  5E3A A;  3NG8 A;  4LF2 A;  2KJW A;  4IUF A;  2FC8 A;  2ZM6 J;  1Z2Z A;  3N5B A;  1IWA A;  2XUL A;  2VPZ B;  5F0W A;  1WC5 A;  3AB4 B;  5D0E A;  4LSZ B;  3DOK A;  2MGZ A;  4ZVP B;  2EFV A;  3UN2 A;  4B08 A;  3GWC A;  1KEK A;  4FYX B;  2RH3 A;  1TUV A;  1X4G A;  4OI2 A;  3KJV A;  1NJX A;  3BYP A;  2BYC A;  4I4B A;  5HSP A;  5KAK A;  2MZJ A;  3IR7 B;  1KOH A;  3D1O A;  1U1L A;  1LWF A;  1X4B A;  1R89 A;  1VI7 A;  4DV2 J;  4A8S A;  1I94 J;  2EFG A;  3W8G A;  1RBA A;  4CO1 A;  2DT9 A;  3W2W B;  4YS2 A;  3OFE A;  4HYK A;  3M6W A;  1F0X A;  2R2S A;  2DNL A;  2V34 A;  3KNG A;  4PUO A;  4IH5 A;  4LSL A;  4NXM F;  3IAM 9;  3BO4 A;  1J27 A;  4HVZ A;  2NPI A;  4B3O A;  3SDE A;  5G0R B;  1MML A;  3CCZ A;  2O01 C;  2MJU A;  3P8B B;  1S1W B;  3OHB A;  4FYW B;  3V4I A;  3PTW A;  1S1V B;  4TQR A;  2UUC J;  2B6A B;  3D68 A;  1Q53 A;  3SV4 A;  3PRD A;  3MM5 A;  1WSV A;  2A6M A;  4CLF A;  2R42 A;  3RB6 A;  1C4C A;  5GME A;  3OJU A;  4TLR A;  2XWY A;  1U6F A;  3OR1 A;  1HQU B;  4FS2 A;  1NND A;  3MHY A;  3BSC A;  1Z1Z A;  1OS5 A;  3R5G A;  2HHS A;  1HMV A;  2UXB F;  1UVL A;  1T95 A;  2V2V A;  4Y2A A;  1S0M A;  2BJ1 A;  3EJM A;  2WBM A;  3NCR A;  1WHY A;  2RU9 A;  4J9L A;  3T3F A;  1S1U A;  5E3Q A;  4GC6 A;  3DRS B;  1H7W A;  3M8Y A;  1NCL A;  1ZPW X;  3PW7 A;  2EFN A;  3JQK A;  1VC6 A;  4DR4 J;  1T0T V;  1WF1 A;  5E3C A;  3ZZ0 A;  3PO4 A;  3HLU A;  3JTO A;  3CJK B;  1UFW A;  1S6O A;  2GX8 A;  2XY7 A;  4NLV A;  2FHK A;  1JXV A;  4P74 A;  1QE1 A;  3GIR A;  2IVY A;  2FJD B;  2IRU A;  3TAP A;  1B4S A;  2RJZ A;  3H5X A;  3JXO A;  1BGX T;  2BM0 A;  5F8G A;  1LW0 A;  4LF7 J;  3RB0 A;  5DDQ C;  3L3C A;  2FVR A;  2R7O A;  2DH7 A;  3TEH B;  1TAQ A;  1G2E A;  1S0V A;  1EP4 B;  1TL3 B;  3RR7 A;  1NSP A;  2E1R A;  4PYD A;  2QLJ B;  2AJF E;  5IZH A;  1Q78 A;  3ZZU A;  5FDL A;  1CEZ A;  1RWK B;  3EWG A;  3PJX A;  3PW2 A;  5BJR A;  3JSM A;  2ZDP A;  2NQP A;  4DUY J;  4WXW A;  1KOO A;  4UUX A;  3FJ2 A;  3IWX A;  3MUT P;  3W9H A;  4F3M A;  4KKO B;  3H20 A;  1N4L A;  4GVB A;  2FD2 A;  4ZCK A;  1P6T A;  3KJN B;  4BC9 A;  2HPU A;  2YH0 A;  1N5Y A;  1RHU B;  5F8L A;  3JTP A;  4LRD A;  2D41 A;  4PZV A;  4ZVE A;  2G2O A;  3HHE A;  4OI0 A;  4X62 J;  2FDN A;  1E6V A;  4ECU A;  2C2K B;  3K17 A;  2XMT A;  1HLW A;  2RDJ A;  3DHX A;  3F44 A;  1VRU A;  3MR2 A;  4RNF A;  4K4X A;  1VMB A;  2DH8 A;  3JQJ A;  6FDR A;  5K9F A;  4I7F B;  2ZE2 A;  5KT5 A;  3RAM A;  4Q8E A;  1NSK L;  1FX2 A;  2DNY A;  3M8Z A;  4ZJQ A;  1FKP B;  1YQH A;  3QZ7 A;  1S9E A;  2NRE A;  2B9E A;  3PEJ A;  2Y1R I;  1HBN B;  1S57 A;  4WTO B;  4N5S A;  2Q3P A;  4M5H A;  3G82 B;  3MUR P;  3NS7 B;  3DI6 A;  4K7Q A;  1HWL A;  2O3D A;  3D67 A;  4OL8 A;  2H3E B;  1D1U A;  2XMW A;  3VQS A;  4QW8 A;  3LGH A;  3CDU A;  3Q8Y A;  2H5E A;  1S1X A;  2OEM A;  3QJJ A;  3UE2 A;  4KBI A;  2KFY A;  5J1E A;  2HFZ A;  1Y7P A;  3GB0 A;  5IFM A;  1HD1 A;  3T5J A;  4NLS A;  2PFF B;  4OZ2 A;  3KK2 B;  1RWX B;  4JI2 J;  2YVS A;  4ZJL A;  2LKZ A;  2HZC A;  2QIF A;  4KB7 A;  2J6S A;  2VA3 A;  1FFG B;  4OZ5 A;  2ZHA A;  3CDB A;  1NEE A;  4NML A;  5KFN A;  2CPE A;  2F9D A;  3QJL A;  2WTF A;  1X31 C;  3MM7 A;  3HZG A;  4FBU A;  1HKA A;  2DB1 A;  4NLP A;  3PVX A;  2AGP A;  2LQ9 A;  5DJB A;  4TYA A;  2VQF F;  2H54 B;  2NR0 A;  4BWM A;  3BM7 A;  1FI4 A;  4MFB B;  2B5J B;  4MIW A;  3BN4 A;  2X1B A;  3NGK A;  2HHH F;  2XZW A;  3I0R B;  1RT6 B;  4OZJ A;  2AV5 A;  4OZN A;  1KVJ A;  4X4R A;  2OML A;  5AXL A;  4YB1 P;  1ICE B;  3FBF A;  3MEG A;  4RW9 B;  4CLL A;  1CS4 A;  4EBE A;  4FXW A;  2KHC A;  3ZZR A;  3J7A N;  3MAH A;  4RBT A;  5A6W A;  4FF4 A;  1S4F A;  1C0U B;  4QWB A;  3WHI A;  2YX1 A;  5C2G A;  4X4U A;  2JL9 A;  2QMW A;  3W2V A;  1JLF B;  2BKO A;  5CCM A;  3ENW A;  1CQN A;  1TEL A;  4YFU A;  5LL6 d;  1AB8 A;  3IRX A;  2HHQ A;  3D1Q A;  1RCO B;  1H2U X;  1H38 A;  2XO7 A;  4O0N A;  3M8R A;  2OKQ A;  1H98 A;  1FRJ A;  2KXH A;  2QA1 A;  3G8Q A;  3M8P A;  3ZXW A;  1VS3 A;  4Y0F A;  3U02 A;  2E66 A;  2CJX B;  1HW8 A;  2RRA A;  2KJV A;  2P9C A;  2R8I A;  4MK8 A;  3WX8 A;  3GQC A;  1U1O A;  5F8H A;  4RJV A;  1X9M A;  3VAK A;  4TN2 A;  5DDO C;  2YX7 A;  2P6S A;  3OFF A;  2UV8 G;  2V9K A;  4ED0 A;  2W7P A;  2CPY A;  2QLB B;  1JLA A;  3TUI C;  2R7X A;  3R2D J;  2LXU A;  2P5V A;  5KT4 A;  2XYG B;  3A8J A;  2HRT A;  1BQX A;  1P9Y A;  3AQO A;  3IBC B;  4DN0 A;  3P6Y C;  3R1H A;  4O23 A;  2VF3 A;  1UTA A;  5AE1 A;  1N5S A;  3LAN A;  3M2R A;  5J1N A;  2FLP A;  4Q0B A;  4QIW D;  5EN1 A;  3OT9 A;  1UCN A;  4G1Q A;  4WXO A;  3IS9 B;  1UEU A;  3KLE A;  4OV6 A;  5L9N A;  3GON A;  3ITH B;  5IV3 A;  5ETM A;  2YWF A;  1WAC A;  2DR6 A;  3TP2 A;  3VGV A;  3TAN A;  4W90 B;  2MDA A;  1GX6 A;  3E01 B;  4IOA Q;  4I1T A;  4OX7 A;  1SL0 A;  5M2U A;  4CLK A;  2HAF A;  1UVJ A;  1TKX A;  4XDC A;  1QSS A;  2KYX A;  2C3U A;  4B3S F;  4QQB A;  1H72 C;  2B9Y A;  2NXU A;  2J8S A;  3TA2 A;  5J2N A;  3J80 Y;  5L38 A;  2ZFH A;  3CCW A;  2MJN A;  2IBO A;  4NCG A;  1UAW A;  3G71 S;  1PJ7 A;  1MU2 B;  2PA8 D;  3QLH B;  1O8B A;  1RT2 A;  3QT5 A;  1T11 A;  2KG1 A;  4X2B A;  3JB9 k;  3AA9 A;  2VJU A;  2QN6 B;  2C3P A;  2FZC B;  2V94 A;  3OTD A;  3DLH A;  4USI A;  3UW1 A;  2B7C B;  4OI4 A;  4JI4 F;  2AZ3 A;  4WYW A;  2CQC A;  3LP2 B;  5LSO A;  2FVS A;  3JSY A;  3Q89 A;  4YOE A;  2R8G A;  2EBE A;  3IRW P;  3P5T L;  1VQ6 S;  4EYH B;  4ECX A;  3R7S B;  5L1I A;  5HLF B;  4F4Z A;  3UR0 A;  5F8I A;  5GAD I;  4DPX A;  5DG7 A;  5J2M B;  4IDK B;  5MLC V;  4X84 A;  2YWH A;  3PHT A;  4LUB A;  4AL6 A;  1HNI A;  2XO6 A;  5HMY A;  3K8W A;  2OO4 A;  2ZVS A;  2HFN A;  2GV1 A;  2YX4 A;  2PII A;  4OHV A;  5CH7 B;  1X4H A;  4LQ3 A;  4N8O A;  3CJQ A;  4WBF A;  1C4A A;  5AT1 B;  1KN6 A;  2BAC A;  1RWP B;  2XLI A;  4B3R F;  1B0T A;  3TZZ A;  4DV1 J;  5CAB A;  1FJ7 A;  4AT1 B;  5I42 B;  1VQS A;  5KFK A;  2NZC A;  2L41 A;  4CH0 S;  3I9Z A;  2KT3 A;  1NK6 A;  2AJ4 A;  3IG1 A;  2FVQ A;  1TL7 A;  1TKD A;  3ILJ A;  3EYZ A;  4C6A A;  2CQI A;  4ZPW R;  2HBQ B;  3CO0 P;  2RF2 A;  3KFW X;  5HJX A;  5ETV A;  1VDH A;  4FPI A;  4F67 A;  3BPS P;  5HQL A;  1IR1 A;  5D4P A;  2QYG A;  5H9E J;  3OVS A;  2J0X A;  1FE4 A;  5C25 B;  4DPT A;  2UXD J;  4DR6 F;  4Q2L A;  2V8P A;  5FLX Y;  3Q8V A;  3PHE A;  3R9L A;  2VPX B;  5B0C A;  4OHZ A;  2VFS A;  3RB4 A;  1IBL F;  3H40 A;  2R7S A;  5LJ5 Y;  4OYM A;  5C7P A;  2HEK A;  2A18 A;  2GML A;  5B0A A;  2OPS B;  1FNX H;  3AOB A;  1FX4 A;  2M8D B;  1WD6 A;  4YB5 A;  1U1K A;  3D0I E;  5ETL A;  1XER A;  1HBM A;  1HBO A;  2D9O A;  1UPP A;  4DPY A;  5A8K B;  4ID5 B;  1DQA A;  4IRD A;  1IUJ A;  2J76 E;  2QA4 S;  2V9W A;  3OLA A;  2LA6 A;  1F2G A;  2CQ3 A;  3DOK B;  2WVF A;  3B78 A;  4OIX A;  2ASD A;  1KON A;  3U1L A;  2J7K A;  3HHL A;  4AND A;  1IM6 A;  3KJV B;  1WOP A;  1I3O B;  2DGQ A;  1F1B B;  2N3O A;  1UP1 A;  2VJV A;  4YQW A;  1AZS A;  2HHT A;  1K0V A;  2W8K A;  1V6H A;  4HAC A;  3PRB A;  5JMN A;  4F0M A;  2M0G B;  2L48 A;  3VV2 B;  2KN4 A;  3K5P A;  2CJQ A;  4E8U A;  3EE3 A;  3TNV A;  2MQL A;  2RE1 A;  4B3M F;  2C2D A;  4PUO B;  2K2P A;  2EW9 A;  4LSL B;  4OYO A;  1TMM A;  1HI0 P;  1RU1 A;  3EZ5 A;  2LEP A;  2G2Y A;  4Z7C A;  4RU2 A;  2WW4 A;  1SI9 A;  2ZDO A;  3LAK A;  4LF6 J;  3FRY A;  4F26 A;  2V67 A;  4DR2 J;  2FJX A;  3DRR A;  4XPC A;  2VZ9 A;  3BRE A;  5EWE A;  3C2P A;  3GR0 A;  3C3L A;  5B0G A;  5IQQ A;  2HGM A;  3MM5 B;  2Z30 B;  2HK2 A;  2HFV A;  1M1H A;  1ZOT A;  5KFS A;  3CED A;  3LP0 A;  1M1G A;  3QRP A;  2WVE A;  5J1P A;  3B8H A;  2RQC A;  2ZH3 A;  2V8G A;  5J2P A;  1FXD A;  3OR1 B;  3AA8 A;  3NGT A;  2RIJ A;  2UZA A;  3CDE A;  3FBE A;  4WKY A;  2VOP A;  3SMZ A;  1Q79 A;  3UN5 A;  3KWM A;  3KLG B;  4RUC A;  3DM2 A;  2IIH A;  3HSZ A;  3RAQ A;  1APS A;  2UXC F;  1YJN S;  2DCU B;  1RWN B;  5K14 A;  4LFA F;  1IXK A;  2FJB B;  2Y8W A;  3GLJ A;  4MKY A;  2CZV C;  1R6V A;  3OTO F;  4NYO A;  1Q4R A;  5IT0 A;  4PQA A;  1DY3 A;  4K5S A;  1IQZ A;  1WKK A;  5F9L A;  5JJB A;  2EI5 A;  2G0C A;  3JAM U;  3EXY A;  1F9F A;  3DU6 A;  3W66 A;  2NYI A;  3QT8 A;  2CNK B;  3RRH A;  1XNQ J;  4DEZ A;  3QFW A;  1B0P A;  5A0Y A;  3UD5 A;  1PKU A;  1XTZ A;  4DV6 J;  3V81 A;  3D0G E;  2UUB F;  3T9N A;  3MOZ A;  4ILL A;  2YQ0 A;  3K2Y A;  2CPH A;  2GFF A;  4L74 A;  3OXG A;  1KVK A;  1LW0 B;  2GNK A;  2HVZ A;  2VQE J;  1ZA2 B;  3H42 A;  2BAB A;  2LCW A;  2HHV A;  5A76 A;  1HHT P;  4LF9 J;  4NLU A;  2AKW B;  3L4B C;  2B0G A;  2DNP A;  1U1M A;  2PEB A;  1SPB P;  2RS8 A;  5A6P A;  4KSE B;  4DFM A;  1FK9 B;  2I9S A;  5HO4 A;  3WIU A;  5FDL B;  1PGZ A;  2PN6 A;  2PFD A;  4LVO P;  4JI1 J;  3FC9 A;  3DLE A;  1SIZ A;  1RK8 A;  5ETO A;  2QFJ A;  2OEJ A;  3N6M A;  3FZ2 A;  1S6U A;  3PKM A;  2Z0G A;  1U1N A;  3Q83 A;  4H4M A;  5D0R A;  1N52 B;  5IWA F;  3SFG A;  3ZTS A;  4DR3 J;  5EX0 A;  3RBE A;  1U1Q A;  1M5P C;  1DAX A;  2Q79 A;  1N5Y B;  3RG6 A;  1S97 A;  3VAF A;  2CAJ A;  4RPF A;  1YJT A;  4DL3 A;  1TVR A;  1PJ6 A;  3LOU A;  1NKC A;  1E6V B;  4ECV A;  1JKH A;  2Z56 B;  4J9P A;  1BD6 A;  2ZZT A;  3L09 A;  1VRU B;  4AYB D;  1YSJ A;  1FEE A;  4K0K F;  1UFL A;  2GO9 A;  3FQL A;  3Q0A A;  3LPY A;  2M5Y A;  1VQ7 S;  3VCD A;  1S9E B;  1NHU A;  2AGQ A;  5EDW A;  1LXJ A;  4NXM J;  1RWO B;  3CCR S;  1M90 T;  1X60 A;  2ZH1 A;  3DI6 B;  1Q7Y T;  1PYS B;  2VC0 A;  3CPW R;  2AMC B;  1WF2 A;  3LTO A;  3K8V A;  4S0M A;  1U4B A;  3NNC A;  3QT6 A;  2R4F A;  4Y2M A;  2ATC B;  5F9N A;  1JNR B;  2E9T A;  3GIK A;  5GAH U;  4CH7 A;  1N48 A;  4G6V B;  1K8A T;  3LP1 A;  2DPI A;  4TY8 B;  1ZH5 A;  3CCL S;  2ZZM A;  2GJ2 A;  4A48 A;  1KVI A;  1TR0 A;  1VQ8 S;  3MI7 X;  3U1M A;  2DHS A;  4M5D A;  1G3O A;  1NU4 A;  2J9D A;  1XC9 A;  3MM7 B;  4J9S A;  2J7W A;  2NXC A;  1FXL A;  2E7X A;  3LA0 A;  3N4W A;  2DGS A;  2GCF A;  1BC6 A;  3GU0 A;  4YR0 A;  1WG4 A;  5B7W A;  2VDH A;  5B09 A;  2R8J A;  5KFW A;  3UR3 C;  1YVF A;  2HYI B;  5GAE U;  1DLO A;  4ENO A;  2EG2 A;  4WE1 A;  2LP4 A;  3MAA A;  2VFT A;  2DR8 A;  4RW7 B;  1AT1 B;  3R6G B;  1FVS A;  3TEG A;  1T03 A;  1MN7 A;  4BS2 A;  1X4A A;  3ZC4 A;  2I8E A;  1HD0 A;  3MEG B;  3IBW A;  3RU0 A;  1U47 A;  1RKJ A;  1RYR A;  2F3J A;  3J81 U;  2K7J A;  3OLB A;  3HKW A;  2ZZN A;  1QAY A;  1SQE A;  2A2C A;  4DR5 J;  3LQV A;  3FMB A;  2LEC A;  2M88 A;  4PG5 A;  2ROE A;  5T41 A;  1WDD A;  2B3T B;  4X66 F;  2XC9 A;  1RLC L;  1JB0 C;  4V1A k;  3IRX B;  5CZV A;  3MR5 A;  3GII A;  2XG8 A;  2IM1 A;  2P2C B;  3C15 A;  4DX8 H;  4L75 A;  1GT8 A;  2M70 A;  3S1T A;  4NLD A;  3ZZY A;  1O51 A;  3BV8 A;  1X4E A;  4J9M A;  5E3P A;  2HQI A;  4KO0 B;  3GFX A;  3ETM A;  4NCB A;  4H4K C;  2R8H A;  2BAN A;  4WFX A;  2XLK A;  3M30 A;  2XLJ A;  2HVD A;  3UCG A;  4IQX A;  3V6J A;  3SSQ A;  1FNO A;  2ZHO A;  2H9Z A;  5IC6 B;  2Y0B B;  5THW A;  4Z7Y A;  1PC4 A;  2QLW A;  2GS8 A;  2ZH6 A;  2XYH B;  4Y3C A;  5KTQ A;  3KK3 A;  5CXT A;  3A8E A;  4FBT A;  4F3O A;  4X4T A;  2MSS A;  4K4V A;  4EI2 A;  1NK9 A;  4TKT A;  1IJE B;  2OEK A;  5MAO A;  1VJW A;  2FTR A;  3CJ8 A;  1WOO A;  3M2R B;  3N01 A;  4IFY B;  2JC0 A;  3UN3 A;  3DC2 A;  2NLW A;  4G1Q B;  1YJ7 A;  3FK4 A;  3UD3 P;  4HKQ A;  1LEO A;  4EEY A;  3FUY A;  5HP1 A;  1H7X A;  4NLT A;  5ETQ A;  2GW8 A;  2J7U A;  2QX0 A;  2XMJ A;  1RAJ A;  2CFX A;  4OYZ A;  4DSJ A;  4ZLJ A;  4W4M A;  4K4Z A;  2MXY A;  3LGN A;  2JJ4 D;  2KVI A;  2CG8 A;  4KPC A;  2APO A;  5J2N B;  4TY9 A;  3I5A A;  4KY3 A;  2DTJ A;  3O44 A;  4NCG B;  1JLB B;  2IDE A;  4IKA A;  2LU2 A;  1RT2 B;  3MZI A;  2CQD A;  2HK3 A;  3TO8 A;  1G4C A;  4F36 A;  3CDA A;  1RTD B;  3BQ0 A;  2XWX A;  3HJF A;  1O6X A;  3PDN A;  4RNH A;  1T94 A;  3IWL A;  1TFW A;  2H5I B;  2RB7 A;  5KFQ A;  2BQ3 A;  4RW6 A;  2BMB A;  3W5Z A;  2VG5 A;  2I1R A;  4NPO A;  2UVU A;  3BH6 B;  2DNQ A;  4USK A;  2HZA A;  2YTC A;  2W2P P;  1YK9 A;  4GKJ J;  3RJM B;  1UA1 A;  2HQF A;  2MLY A;  2QE5 A;  3G8T A;  5E7O B;  3DYA A;  3W60 A;  2VV5 A;  3MEK A;  4ELT A;  3A3N B;  1QVG R;  1IKX B;  3AHP A;  3QGH A;  1MG7 A;  4DU8 A;  1HNI B;  1FEH A;  1VIO A;  4B9T A;  2CKW A;  4UOG A;  4H54 A;  2DY9 A;  2YNI B;  4HI1 A;  3MMB A;  1RAF B;  5DM6 Q;  2DGW A;  1M5K C;  4ZN3 A;  2B7B B;  3PX0 A;  5M2P A;  1RIS A;  3HDS A;  1KQK A;  1ZM3 A;  4DUZ J;  4LR7 A;  4ZIT A;  4WU3 A;  1VC0 A;  1TL7 B;  2M3D A;  3CTR A;  2FB0 A;  4JI3 J;  2JLF A;  2ZC4 A;  3P5B P;  3BBF A;  3FBB A;  3GFY A;  2CQ2 A;  2YY3 A;  2Y1L B;  2AP6 A;  1FJE B;  2F9J A;  1VBY A;  3KHH A;  5JVH Q;  2VBY A;  4O3Q A;  4RU9 A;  1R3N A;  3D6M B;  2K7K A;  1WKL A;  4LF5 F;  1EB0 A;  3TR5 A;  5BYS A;  2LFV A;  2HSE B;  2PC6 A;  3R7N B;  2QL5 B;  1SJ3 P;  1FTR A;  2M8H A;  2E29 A;  1OY8 A;  3T1H F;  2LLZ A;  3IBF B;  1HPZ B;  3H4B A;  2FIU A;  1XJW B;  3MCO A;  3MUV P;  4EBC A;  3TI0 A;  4CRJ A;  1AUD A;  3SV3 A;  1RAG B;  2MEW A;  3Q23 A;  2EC0 A;  3C14 A;  1FF2 A;  2F8H A;  1HBM B;  1Q82 T;  1QVF R;  1RGV A;  1Y10 A;  2XCA A;  3EVM A;  3VTI A;  2DCL A;  4MK7 A;  5KFC A;  1RHJ B;  4AQY F;  2OMO A;  5AXM A;  4EK2 A;  1CUL A;  4B3T F;  2DHX A;  4M5M A;  3HFV A;  3MPD A;  1HL6 A;  1FXR A;  2J0Q D;  3HHL B;  4JV0 A;  3DRP B;  4FXV A;  4B9N A;  3RGI A;  2C3O A;  4RR5 A;  4KGZ B;  2MQQ A;  2XB2 D;  3PAC A;  5LMU F;  1AZS B;  4X4O A;  1AA1 B;  2GIQ A;  4JYA J;  3CUN A;  3NAH A;  4HAC B;  3H5U A;  2C2E A;  3SZ2 A;  2F4F A;  4YY3 J;  5KG3 A;  2QA2 A;  2RIL A;  3KLF A;  4DLE A;  2RUS A;  3KHG A;  2LVW A;  2UVV A;  2HNZ A;  3TA1 A;  3VZI A;  3NLC A;  1SCJ B;  2ACY A;  3EVW A;  4NA3 A;  1JJ2 R;  3CJ4 A;  2JOQ A;  2IJF A;  5DQG A;  4YME A;  1XMB A;  3DRR B;  3MEE B;  2MYF A;  2YWW A;  2XEX A;  3BYR A;  3NNA A;  3VAG A;  4ELV A;  4C9D A;  2DY1 A;  5F0U A;  1WOR A;  1Q8I A;  3GFH A;  1U1P A;  3LP0 B;  2V4R A;  1S7H A;  5CHC B;  4JI5 F;  1SJQ A;  1R8C A;  1S49 A;  1RAA B;  1IKW B;  5DQI A;  4BHQ A;  3AFG A;  1HIY A;  4I67 A;  4DFK A;  1HNW F;  1EAR A;  1SB6 A;  1EAY C;  2D3U A;  1H3D A;  8ATC B;  5B0F A;  3T5K A;  2E5J A;  3R6L B;  2W24 A;  4I69 A;  2FYX A;  4W92 B;  1JLE B;  1GMV A;  2QMU B;  4DR1 J;  2KYZ A;  4R5P A;  5K14 B;  4OI3 A;  3CCT A;  4AL5 A;  2LXF A;  1R8A A;  2VOO A;  1X7V A;  1RCX B;  1ITP A;  4QYZ J;  4U67 Q;  1TK5 A;  4Z2X A;  4DL7 A;  2RRB A;  3N6L A;  2J6U A;  1VQP S;  3CCE S;  3T6B A;  3X3U A;  4CLU A;  3S7R A;  2HS4 A;  5A0Y B;  3PCO B;  3AOD A;  1XMQ J;  1YZ7 A;  3GPA A;  2FJA B;  3KLI A;  4P73 A;  3HT3 A;  2MTL A;  4X4V A;  1SH2 A;  2K8G A;  1UPM B;  1U2R A;  3IM9 A;  4O0I A;  3HVR A;  1KQF B;  3BR8 A;  5L46 A;  4KGM A;  1TUG B;  4LF8 F;  1GAO A;  3B6B A;  4BDP A;  4DV7 J;  2FLO A;  5B0D A;  1FWP A;  1UJ5 A;  4RUH A;  2XSJ A;  4L3K A;  4ELU A;  2JEG A;  1WC0 A;  4PPZ A;  2R8K A;  2FUG 9;  1LQ9 A;  1FRK A;  2PSZ A;  5KFG A;  3D0H E;  3NAI A;  2GHW A;  3D54 A;  4RNM A;  2QEX S;  1V9O A;  4QYR A;  1W2I A;  2E1P A;  1F3F A;  2HAI A;  2ZJQ Q;  2MZ1 A;  1ZBT A;  2EG1 A;  2MZT A;  4QIF A;  2KB2 A;  4UW2 A;  2AU0 A;  2BX6 A;  3CUL A;  3UCZ P;  3IR5 B;  1NPR A;  1D8Y A;  1JX4 A;  1AXQ A;  1YJR A;  2EKY A;  1TVR B;  4O3O A;  4QU6 A;  3QPI A;  4C98 A;  4DU7 A;  4MKV A;  4NLY A;  4F8R A;  4G3I A;  5K20 B;  2M52 A;  1DQ9 A;  3I4P A;  2XCP A;  2GMH A;  2YNH A;  1DUR A;  4C3M A;  4DV0 J;  4P10 A;  3VZH A;  5A2Q Y;  2RDI A;  2NYH A;  5C42 A;  3TJ8 A;  3GJR B;  4JI0 J;  3BEG B;  2KM8 C;  1WEY A;  4MKB A;  4B3M J;  4WTY A;  4X65 F;  4MMO A;  3VAI A;  2LQ8 A;  3MMJ A;  1HBU A;  4M8L A;  1QLN A;  2E5G A;  2DR9 A;  3GFZ A;  4RL1 A;  2IA6 A;  1PAE X;  3C19 A;  4KFB A;  3EM1 A;  2FC9 A;  3MPY A;  4J9V A;  3IXQ A;  2HQD A;  5EGY A;  4F2S A;  1NSA A;  5DQH A;  4DQS A;  1LXN A;  4Y28 C;  2B51 A;  4C11 A;  2W2O P;  1ZM9 A;  1LV5 A;  1OY6 A;  3CIM A;  3N6N A;  1FWL A;  4RKU C;  2ROP A;  4RWW A;  2Y3Y A;  3HXM A;  5C2C A;  1L5U A;  1U0H A;  2QJ3 A;  3TAQ A;  2CVI A;  2D1C A;  5GMD A;  4DBQ A;  2DNG A;  1K9M T;  4QU7 A;  1IR2 A;  1N34 F;  2BJ7 A;  3QQC D;  2VBX A;  1Y9O A;  1OMS A;  4PG6 A;  2AEJ A;  1XR7 A;  2KRB A;  2CJK A;  2KT2 A;  2C42 A;  3QAU A;  4KGV B;  1VBK A;  1X5S A;  3GZ7 A;  3ZTO A;  4OFZ A;  4YHH F;  3TA0 A;  3AY0 A;  4QWD A;  1DLO B;  2KDO A;  5LMN F;  2VPY B;  3W7B A;  2CPX A;  2Y8Y A;  1HR0 F;  1YWX A;  3MAA B;  1RA7 A;  3GSD A;  4ZVR B;  2C28 A;  2JEF A;  5KFE A;  4CTA B;  2I5J A;  1HA1 A;  4ES1 A;  4HHJ A;  3DOL B;  1RAO A;  5KFB A;  5AJ3 F;  2B8Q A;  3CD0 A;  1WWH A;  2HS3 A;  5BXI A;  2UUT A;  4WZM A;  3R5C A;  2KHD A;  4ECQ A;  4NA2 A;  1VRT A;  1MRO A;  3B4D A;  1BQM B;  4IG0 A;  1YI2 S;  4EFA C;  4N56 A;  3CF5 Q;  3P4U B;  4LFB F;  1ZET A;  3FEY B;  3G86 A;  2VAS A;  2B9W A;  1TTH B;  2XZT B;  2YXL A;  3C15 B;  1URN A;  3HVT A;  1TL1 B;  2WB4 A;  4ZN1 A;  2F40 A;  2RQK A;  1N8R T;  4YR3 A;  4CWB A;  2HIQ A;  1NJZ A;  3CJ2 A;  4P75 A;  3OXL A;  1LNQ A;  3D9B A;  2L9D A;  3GR1 A;  3PZP A;  1KC8 T;  1S12 A;  2EXU A;  2BAN B;  4WPA A;  3M30 B;  2GA7 A;  3AD7 C;  3TWZ A;  4LBP A;  4I64 A;  5IT4 A;  2B4U A;  2XQC A;  4ZVS B;  2CUY A;  5EX3 A;  3G6X A;  5L1L A;  1QY7 A;  1U48 A;  1R7I A;  4X4S A;  1NH8 A;  1Q8K A;  3F73 A;  4OJG A;  3RTV A;  4XO0 A;  3PFO A;  2A10 A;  3LGM A;  2E9R X;  1DTQ A;  2XMK A;  5L39 A;  1HWK A;  3MUM P;  5IV4 A;  5GMK a;  3R97 A;  4KPY A;  3QID A;  1S48 A;  1V3Z A;  1RTZ A;  2HNY A;  1HQE B;  1VBZ A;  2ADC A;  4O4G A;  3A3P B;  3UO0 A;  3RB3 A;  1VQ4 S;  4OJ1 A;  2IMO A;  3ZTP A;  5I3Q A;  5HRO A;  4LR8 A;  4HTJ A;  5HP1 B;  1R8P A;  2Q66 A;  2JFK A;  2GIF A;  2UVW A;  4LFC F;  1U45 A;  1N32 F;  3UQS A;  1FA0 A;  2IVF B;  3U1N A;  3GYG A;  2BQR A;  3OTE A;  1MW7 A;  3C46 A;  1JLC A;  2VON A;  4M5I A;  2NXJ A;  4MYU A;  1CJT B;  2LQ5 A;  3M4X A;  4JI7 F;  2R7R A;  4I2P A;  2ZNY A;  2XS2 A;  4ANE A;  1RYS A;  2ZUA A;  3PRV A;  4USM A;  3R5A A;  3EIC A;  1FT8 A;  2B4V A;  1HNZ F;  1ZTW A;  2XS5 A;  5ETN A;  2RT3 A;  2GQC A;  3GJT B;  1SUQ B;  1HNV B;  4QOT A;  4M95 A;  3M6X A;  4CO4 A;  3J7A 1;  7FD1 A;  3S8S A;  2KZZ A;  1KLM B;  4RNN A;  4JI8 J;  1RXO B;  2K1R A;  1RAB B;  1IKV A;  3JAM Y;  1HWI A;  4AL7 A;  4JBC A;  1SIW B;  2ZIT A;  2Q43 A;  1NK4 A;  2ZH5 A;  2ZH2 A;  4UY8 5;  1IN0 A;  4XTT A;  5A8W A;  3DYA B;  4O3P A;  2RRN A;  2UUA J;  3HJV A;  4HR2 A;  1U8W A;  1EET B;  2E7V A;  2DHG A;  3OVB A;  3PNI A;  3WZ0 A;  2AJ1 A;  1J5E J;  3I5C A;  1JLG A;  4H4K A;  4N77 A;  4NLR A;  2Z4P A;  2FGC A;  4YB7 A;  3OV7 A;  1JJC B;  3C16 B;  3MMB B;  5FD1 A;  1Y3K A;  3GIJ A;  1U24 A;  1RLD A;  1LWX A;  4N41 A;  4DL0 C;  1F60 B;  3DLL Q;  4F2R A;  4LRF A;  4F0H A;  1VJQ A;  4FS1 A;  1XBW A;  4A8F A;  4X64 F;  1HFE L;  2HLU A;  5D78 A;  4C8L A;  2LA4 A;  1T9W A;  1M5S A;  1B99 A;  3VGT A;  3FEZ A;  3FCW A;  1UMJ A;  4HDG A;  3GIM A;  3HHD A;  3M1V A;  2ZM6 F;  2Z2M A;  2J9E A;  4NYZ A;  3MR7 A;  5KG6 A;  3NBP B;  4DV4 J;  1V3S A;  3QAE A;  1TZ0 A;  2VFU A;  3M8S A;  1RBO B;  3IGV A;  4AE5 A;  3I6P A;  4TQS A;  5EWG A;  2DJW A;  1D09 B;  1WDT A;  2MY8 A;  1HNX J;  4DQP A;  3GYN A;  4X4P A;  2D69 A;  1ZM2 A;  4CT9 A;  4DV2 F;  3F0N A;  4DL6 A;  1YRU A;  4PYA A;  2MKK A;  2W8L A;  4U7C A;  3EPG A;  4ED6 A;  5DRK A;  4C2M A;  3C14 B;  3RRG A;  4KTQ A;  4GVL A;  1VIS A;  4O3S A;  5GAD U;  3EDR B;  3POT A;  3NY0 A;  4RX6 A;  3Q8P B;  2VG6 B;  3NNH A;  2HWI A;  1CUL B;  3DNC A;  4DX5 A;  1K1Q A;  4DS5 A;  4Q43 A;  3WBZ A;  2BVZ A;  1KKH A;  1FES A;  2JNJ A;  3UVJ A;  4PXC A;  4C97 A;  4ID8 A;  1D9F A;  2UUC F;  2LDY A;  1RWU A;  1K0T A;  3GP9 A;  1RB0 A;  2ZD1 A;  1VQY A;  3AJ1 A;  2RVJ A;  1U02 A;  3IC1 A;  2OH2 A;  2X1G A;  3T1Y J;  3T5H A;  4DL4 A;  2R7W A;  2I0X A;  4J9Q A;  2RS2 A;  3HFK A;  2MKY A;  4KE5 A;  3I82 A;  3MM6 B;  2BV3 A;  4UY8 T;  3KLF B;  3FDS A;  2YNF A;  3Q8R B;  4ZPV R;  4FKY A;  2HNZ B;  3PR4 A;  2J5A A;  2WZ1 A;  3TUP A;  4GO7 X;  4KJI A;  1F6T A;  1RWW B;  3CW2 C;  3MPV A;  1NKE A;  5IC4 B;  4YN3 B;  1EZZ B;  2WVD A;  3FFI B;  3GYX B;  4PAB A;  2M7S A;  3FQK A;  4PWW A;  2RUG A;  1E6Y B;  4NWB A;  5KT7 A;  3KUH A;  3MM9 A;  4CLP A;  4XAK A;  4DSE A;  1M5O C;  3GCX P;  1G1X A;  2DR5 A;  4DR4 F;  4ZVH A;  2JSX A;  3BSO A;  1ROF A;  1IBK J;  1WEZ A;  3K57 A;  2RNE A;  2ERR A;  4C8N A;  1XQI A;  2GVZ A;  3TUZ C;  3NMA A;  2O67 A;  1V3R A;  1BQN A;  2COL A;  5ETT A;  4ZP6 A;  3H2L A;  3WDO A;  1T9V A;  3J81 Y;  3QGG A;  2DNO A;  1C1C A;  2CJ9 A;  3D7S B;  4LF7 F;  1NH7 A;  4QR1 A;  1Q95 G;  2UP1 A;  3OTB A;  4R5P B;  1JWW A;  2G1H A;  1RJJ A;  2DXD A;  1N5T A;  3WC2 A;  3VAJ A;  4DZ6 A;  1U25 A;  3B82 A;  3W64 A;  2WVB A;  3H59 A;  1LWE A;  2YKM A;  4F50 A;  3OL7 A;  3RAX A;  5C24 B;  5KG2 A;  2P9E A;  2BM1 A;  3VVU A;  1X5P A;  4DUY F;  3BKT A;  4CLS A;  2FJE B;  3QIP A;  1RSC A;  1X8D A;  3VHQ A;  3KLI B;  1S6Q A;  1U0S A;  5M2R A;  4NA1 A;  4GKK J;  3M8Q A;  3NRB A;  1S5Z A;  1RTI A;  1DZ5 A;  2BJE A;  3SQG B;  2CYY A;  1M5H A;  2C2R A;  3N5F A;  2E5I A;  1Q16 B;  4Q44 A;  3V4M A;  4OI1 A;  2QL9 B;  3FSY A;  3Q22 A;  4X62 F;  3PV8 A;  1CC8 A;  2XSJ B;  1FCA A;  2V2Q A;  3VAM A;  4PEO A;  3HVA A;  4EMD A;  1RAE B;  2C2Z B;  5KG0 A;  3VAH A;  3CSK A;  2HHW A;  3G2X A;  1NB7 A;  3QGP A;  4DR7 J;  1XR5 A;  3W2W A;  4IQM A;  3WQP A;  3MD3 A;  1MWQ A;  3DHW C;  4FYY B;  4NLX A;  3MR6 A;  4LRE A;  2QGF B;  3C6T A;  5DGA A;  1RT4 A;  2CXE A;  2QSF A;  2RKI A;  1U2F A;  3JS9 A;  1F5A A;  3OL9 A;  2DXE A;  2HFS A;  5ETP A;  1U26 A;  4NLW A;  1FKO B;  3UPF A;  5GVQ A;  3J7Z 5;  3E51 A;  1CJU A;  1R8H A;  2R7Q A;  2KL8 A;  3OBI A;  1VK8 A;  3JYT A;  5C42 B;  3CJT A;  1YBA A;  1O0P A;  2DHH A;  1VYA A;  2VDI A;  5DM7 Q;  4JI2 F;  2VUG A;  3TJ9 A;  3JSB A;  2VOD A;  4QJV A;  2H65 B;  1Z2L A;  2BA9 A;  1WTB A;  2DGT A;  1B7Y B;  3V6H A;  2LYV A;  1T9Y A;  2SXL A;  2V4J B;  4KFB B;  2F1F A;  2Z2Y B;  2OD6 A;  4JI6 J;  4DLG A;  1RQ0 A;  4YEA A;  3PX4 A;  4PXE A;  4J9K A;  3T9Z A;  2Q6B A;  4ZOS A;  3TQE A;  1FJG J;  1DHM A;  2N82 B;  4FKX A;  3OQ2 A;  3MM8 A;  1JK9 B;  1YJU A;  1NLK L;  4XK8 C;  3MTJ A;  3BDP A;  5K8M A;  3CD6 S;  1F9E B;  2HUR A;  3CJK A;  1YKW A;  1Q8B A;  5D4L A;  2GMJ A;  3TZW A;  5G4D A;  4PXD A;  1HNW J;  1S9G B;  3VF0 B;  2XYP B;  2HMI B;  3S6E A;  4NZ7 A;  2UVR A;  1FRH A;  2D7S A;  2GVD A;  1R0C B;  1UJ4 A;  4H4O A;  1JLQ B;  1JQG A;  1NM2 A;  1K1S A;  2CPI A;  3ENQ A;  2GHV C;  3A8I A;  4DI6 A;  2R2U A;  2JWN A;  2WON B;  1UWB A;  5GAH I;  4JV5 J;  1IQT A;  3MAQ A;  1HYS A;  1D9D A;  1HI1 A;  1U09 A;  1SVD A;  2CPF A;  2I5J B;  3MDF A;  3BQ1 A;  4UZC A;  6FD1 A;  3CJ5 A;  2ZUG A;  2EPI A;  2M9K A;  4L76 A;  1VIX A;  1ZS6 A;  2JDJ A;  4KV8 B;  1FRX A;  2ZOF A;  4KKO A;  3KUE A;  2WSC C;  3P45 B;  1HAR A;  2AEF A;  2HND A;  1VRT B;  1I6J A;  3HKZ D;  3UNY A;  1MRO B;  1RE1 B;  4IG0 B;  1W2B R;  5CAA A;  1GFW B;  5HAO A;  4QWE A;  4U96 A;  4KGX B;  1KDN A;  1FDB A;  4Y34 A;  4K4U A;  5GAE I;  1P1T A;  3OVA A;  2IBK A;  4CNY A;  2W4C A;  3BS9 A;  1UKU A;  3J7Z T;  1NK5 A;  4EO6 A;  3A1Y G;  3J7Y U;  2ALY B;  2XNQ A;  1SC4 B;  3MMA A;  1SH0 A;  4OZ0 A;  5E33 A;  5IM0 A;  1RDR A;  2MKJ A;  2W01 A;  2PA3 A;  3HUL A;  1SL1 A;  4RNO A;  3O8W A;  2BRK A;  4M94 A;  1C0T A;  2HFO A;  3M32 A;  2X1F A;  5LSR A;  3E3X A;  2OEL A;  3G82 A;  1MNE A;  4QWA A;  2W9C A;  1B7F A;  5KFJ A;  2QTW A;  3ET6 A;  4LF4 J;  3OFH A;  5DG9 A;  3D6H B;  4PWU A;  4ZLN A;  1GTH A;  3QO9 B;  3FVY A;  1X0F A;  1DTQ B;  1C1B A;  1S6P A;  1W7W A;  2FGO A;  4DV3 J;  4U7U D;  2RD5 C;  1PCA A;  3HPO A;  3D66 A;  3MWB A;  1YTY A;  2H4W B;  2OHD A;  2E5L J;  3ISN D;  4LT6 A;  2CA9 A;  1CC7 A;  1X4F A;  4FNH A;  5KG1 A;  4O4G B;  2W9B B;  3D6F B;  4B9M A;  2YPZ A;  2PEH A;  5HRO B;  3KK2 A;  4MJK A;  4X65 J;  1ZA1 B;  4IFV A;  4HHU A;  2VU5 A;  5U47 A;  2MKI A;  3BPD A;  3W9I A;  1YHQ S;  1IBM J;  3RW6 A;  3TVK A;  3DRX A;  1UVM A;  4OYP A;  1PJ5 A;  2GQ2 A;  2CQB A;  4ECW A;  4I2P B;  2EFP A;  4ZVQ B;  1GH8 A;  5T7L A;  2XMM A;  3CXC R;  3K89 A;  4P9S A;  2GGP A;  2F65 A;  1N6Q A;  2HG4 A;  2KG0 A;  3I0R A;  2HWH A;  1V5V A;  5CYM B;  1NPK A;  2LQJ A;  1U6Z A;  4USH A;  3HFZ B;  5KFL A;  4DWI A;  2K1R B;  3C6U A;  4DV1 F;  2IVM A;  3P49 B;  1VFJ A;  1NUE A;  4YB6 A;  1TKZ B;  2CZ4 A;  3D28 A;  1S7I A;  1R0B G;  4OLP A;  5A2Q U;  5F8M A;  3EGW B;  3FSI A;  3K7R A;  1C0U A;  2HS0 A;  2OLW A;  3GV5 B;  3KHL A;  2XTJ P;  1L3T A;  4LRC A;  1NXI A;  5A8W B;  3HVW A;  2QSW A;  4WJB A;  2ZHB A;  3DFE A;  3HT0 A;  3OW2 R;  1MWY A;  4R0J A;  2VC1 A;  2DHA A;  1FO1 A;  2VBW A;  2XGP A;  1FRI A;  1YJ9 S;  3LPE A;  1JLG B;  2UU9 J;  2BBE A;  4CH1 A;  4PAA A;  3QAT A;  2CAD A;  4EUV A;  1RHR B;  2UXD F;  2Z58 B;  3FZB A;  3D4J A;  4CDI A;  4ZKA A;  2R2T A;  3DDN A;  2B4O A;  1QDU B;  1TKT A;  2XNR A;  1OYE A;  3AJ2 A;  3MGJ A;  4DMZ A;  1XNR J;  2ZJR Q;  1J2V A;  3G8S A;  3GE9 A;  1RTJ A;  1UVN A;  2H48 B;  4LSN A;  4CLT A;  2NUH A;  1VQM S;  3NP5 A;  2FVC A;  1SV5 B;  3M1V B;  1YX2 A;  2E1M C;  3W62 A;  1VRQ C;  4CO2 A;  4J90 A;  1KQG B;  4ZHR A;  6AT1 B;  3L7O A;  1RT5 A;  4RW8 A;  3DOM A;  2CQ4 A;  5AE3 A;  3H7H B;  3GSI A;  2AD9 A;  1SJF A;  1PC5 A;  2ASJ A;  4DSI A;  1FJC A;  5CZX A;  2RSQ A;  2UUW A;  5F3T A;  2Z57 B;  3ITH A;  2DO4 A;  4OZL A;  2RHQ B;  1UJ6 A;  2KKH A;  2X3G A;  4F3Q A;  3IO1 A;  2PI5 A;  2U1A A;  2EWH A;  2DEJ A;  2MPU A;  4LQ9 A;  3MCN A;  4PXB A;  2DKO B;  2H51 B;  2GIR A;  4X4Q A;  2HFU A;  4FDF A;  3W8P A;  2MZS A;  1F2H A;  1WC4 A;  3POT B;  2ABY A;  3DXB A;  2JX2 A;  2IFX A;  4NXN J;  3OJS A;  3KLV A;  3PKY A;  4LF6 F;  3H2V E;  1MU2 A;  2FHJ A;  4ZVG A;  3AB2 B;  4U7U K;  4ZA1 A;  4U95 A;  4DR2 F;  4BBY A;  2F7V A;  2XY5 A;  5KFP A;  5HAT A;  4USJ C;  3LWM A;  3DLG B;  3QT7 A;  3TX0 A;  3PEH A;  2ZD1 B;  2C2N A;  3W65 A;  3NKY A;  3LP2 A;  2Y1J A;  2KT5 A;  3R5D A;  1KBR A;  3CE8 A;  3V6K A;  1T05 A;  1EQ0 A;  3MCM A;  2MGZ B;  5HLF A;  2MKC A;  2GC8 A;  2Y9H A;  2YNF B;  3R3T A;  4KRW A;  4YP3 A;  3ADA C;  4M5N A;  1WUU A;  4RBU A;  1N36 J;  1QM9 A;  2AYE A;  1LWF B;  1Q1K A;  2DO0 A;  2MMY A;  5BR8 J;  2OJ3 A;  2V8H A;  3GJQ B;  1PBU A;  1GX5 A;  3UFC X;  1EX8 A;  4NOH A;  4CO0 A;  5AXN A;  3ZNJ 1;  1A0O B;  1QUV A;  2GQQ A;  5C5J A;  2ZH7 A;  1SJ4 P;  4USU A;  2XY6 A;  2H1Y A;  3IWN C;  4KYZ A;  1P27 B;  3MM9 B;  4LRB A;  3K59 A;  5D8H B;  1BLU A;  1AFI A;  3V5R A;  1FRL A;  3TZX A;  1SJR A;  4DCO B;  5FII A;  2IYI A;  2JZ5 A;  4NLO A;  4B3O B;  3SDE B;  4ZIW A;  2A1B A;  1HI8 A;  1HWJ A;  3NL0 A;  3MFH A;  1XNQ F;  1T9U A;  2GVZ B;  3V4I B;  4K5R A;  1BQN B;  4P6Q A;  3W3S A;  2CQH A;  3BKF A;  4WFA Q;  1BUX A;  2W4D A;  1KHV A;  4DV6 F;  1C1C B;  2JLG A;  1NME B;  2O1P A;  5KFO A;  1W25 A;  1FFW B;  2EBG A;  2CIM A;  4JUZ A;  1YZ6 A;  5HI7 A;  2VQE F;  4PG4 A;  1R6Y A;  1RT3 A;  3R27 A;  2V4Q A;  4LF9 F;  3IN5 A;  1XIQ A;  5I3U A;  3CC7 S;  4I6W A;  1NDK A;  2MQM A;  2HQ3 A;  3AT1 B;  2DIU A;  1QUP A;  1LWE B;  4O3N A;  1HMV B;  3B54 A;  1FRM A;  4CI0 B;  3MFI A;  4DFP A;  3CD5 A;  2AYM A;  2DNZ A;  3TQ1 A;  3MPW A;  1FDD A;  1CVJ A;  1S1U B;  4KQZ A;  3PG9 A;  4I68 A;  1S6Q B;  3HP6 A;  1RAD B;  2WOM A;  2DEI A;  1PSD A;  4DR3 F;  5A8K A;  4ID5 A;  1RTI B;  4UST A;  3CCS S;  2G0I A;  3L7U A;  3MR3 A;  1WNE A;  1IBC B;  5HMX A;  1GMW D;  4IOB A;  1ULR A;  3MF5 A;  2FHJ D;  4ALZ A;  4ETZ A;  3TZY A;  2ROG A;  2CJB A;  3SCI E;  4F0K A;  1QE1 B;  4CO3 A;  4D3G A;  2G2Z A;  2OPP A;  4G1I A;  4BC7 A;  4ES3 A;  1AUS L;  1X0P A;  3KJF B;  4UF4 A;  2AYB A;  5T14 A;  2MKS A;  3LAL A;  4LJM A;  1K47 A;  4I56 A;  4ICL A;  3EGZ A;  2KVQ E;  4CYU A;  4MK9 A;  4NI2 A;  4IH6 A;  4WFY A;  2AIR B;  2Z8Q A;  3C6T B;  3CT9 A;  2ALZ A;  1AYE A;  4WWS A;  3JSM B;  2JEJ A;  2QYC A;  3CIZ A;  2VFR A;  1RT4 B;  3WX4 A;  4B02 A;  3GMG A;  2D3O R;  3M2U A;  2RKI B;  3DMJ A;  5F41 A;  3UDC A;  4ZLL A;  5EUH A;  3GG0 A;  3OFG A;  2KU7 A;  4CT8 A;  4P2F A;  3BB5 A;  2DYA A;  1CJU B;  2BOP A;  3PYE A;  4GVB B;  3JYT B;  1UVK A;  3QWU A;  2AW0 A;  1RWM B;  4DV5 F;  3CCJ S;  5SZT A;  1DFD A;  4DQI A;  5CD4 H;  1H0H B;  4I6Y A;  4W98 A;  3KLH A;  2WK4 A;  1UEK A;  1CPZ A;  3AD8 C;  1B0V A;  4MKA A;  2MLX A;  2KI2 A;  1WEX A;  3ZZT A;  4L72 B;  1FER A;  1RWV B;  3BKU A;  4JP8 A;  2HHP A;  2P6T A;  5HVH A;  2PMH A;  3KLG A;  2ZE2 B;  4ITS A;  2ILZ A;  3IR6 B;  1KLN A;  4PG8 A;  5EWF A;  1U7L A;  3MCS A;  1Q81 T;  1D8Z A;  4HT7 A;  4Q8F A;  3EDQ B;  3DRY A;  2IRY A;  3MM8 B;  4E98 A;  5DS7 A;  3SCJ E;  2DD8 S;  3DU5 A;  5CCL A;  2RAQ A;  1G6B A;  4TXS A;  1IM4 A;  2OTL S;  1N0U A;  2WAQ D;  2BRL A;  4P2X A;  5GAG U;  4OHX A;  2XHW A;  3G87 A;  4NE9 C;  2BR0 A;  1N56 A;  2Z2Z A;  1S1X B;  1JJ4 A;  2JEI A;  3S01 A;  2GVD B;  3ISZ A;  2CQP A;  1BY9 A;  3WIV A;  4HDH A;  2AJ0 A;  4H4O B;  2QLF B;  5J1E B;  4IG3 A;  4PG7 A;  3TYT A;  4DR5 F;  2AQ4 A;  1LFP A;  3BSN A;  1WJ9 A;  2WVC A;  1N33 F;  1XR6 A;  4A8Q A;  1B70 B;  2QO3 A;  2EFO A;  2DGV A;  2EK6 A;  3HD2 A;  4F04 B;  2AF6 A;  3PR5 B;  2BW7 A;  1MSW D;  1UWB B;  3I5B A;  3E8O A;  4WFZ A;  4P2S A;  4R25 A;  1HYS B;  1H2V Z;  5D3G A;  1FK9 A;  1FDA A;  2DIS A;  2UXB J;  1R8B A;  2OP5 A;  4C0B A;  2HBZ B;  1AFJ A;  1UA0 A;  1R0A A;  1CJV A;  2JRS A;  3V6D A;  5DLF A;  3BGL A;  2V8V A;  1DAR A;  2HND B;  4Z37 A;  1H74 A;  5IOL A;  2D3O 1;  4ES2 A;  2E44 A;  2ZBP A;  1O5J A;  2CDR B;  2DPJ A;  2BJD A;  2VD3 A;  2XMU A;  4NLG A;  4DF8 A;  2CRL A;  1RHM B;  1CS4 B;  4ED8 A;  3DLB A;  2IY5 B;  2OI2 A;  2KM8 B;  1KWM A;  3RR8 A;  2JVR A;  4QR2 A;  3MMA B;  4NX9 A;  1OPI A;  3KOA A;  5IM0 B;  2WSE C;  4RZR A;  2EKN A;  5DGB A;  5HVG A;  3W2V B;  1W26 A;  1WTF A;  1KFS A;  2OSR A;  4HL9 A;  4Y00 A;  5KFI A;  3FGV A;  4K2X A;  2WW8 A;  3SI8 A;  1C0T B;  2RDD A;  4A8M P;  3M32 B;  4NCA A;  1NDP A;  1CQM A;  2W9C B;  4DCP B;  4ZVU B;  2B8P A;  3ET6 B;  3M8P B;  5ETS A;  4CP5 A;  2R7V A;  2IDL A;  2W2N P;  1C1B B;  1S6P B;  1OO0 B;  3EX7 B;  5KFF A;  3MMC A;  3I32 A;  2OSQ A;  1S99 A;  5KT6 A;  1KTQ A;  1WEL A;  2VKZ G;  2V6A A;  4IO9 Q;  1YLX A;  2V5H G;  5KFR A;  2DVI A;  2CPJ A;  3I96 A;  4TY8 A;  1JLA B;  3A13 A;  2H4Y B;  4IFV B;  2ZH4 A;  3K0J A;  3K5O A;  3KMS A;  1JIH A;  3OR2 A;  3D1H A;  1TL5 A;  2RU3 A;  1QAJ A;  5KFM A;  2MHN A;  4Q0B B;  4GKJ F;  4B9S A;  5T7L B;  4ZPC A;  3CJR A;  4I2Q A;  3KLE B;  3DLJ A;  5D0H A;  1RHQ B;  1VHI A;  4IRK A;  2GGP B;  4NEZ A;  4J37 A;  1N6Q B;  3KG1 A;  1PAU B;  1S1T A;  3PXG a;  3UDL A;  2K3K A;  3MD1 A;  4RW7 A;  3H5Y A;  2BDP A;  1TKX B;  1EKS A;  2DRD A;  4I0W A;  2RQM A;  4V19 J;  4P7V A;  3BBB A;  1SKR A;  3FBC A;  4QR0 A;  1QD1 A;  3C6U B;  4BWJ A;  3HK2 A;  4DJB A;  4A8Y A;  3KG4 A;  4M1K A;  2HQC A;  2YKN A;  4DUZ F;  3HSD A;  4U9R A;  4JV2 A;  4DZD A;  2J9D E;  1PG5 B;  4KT0 C;  5HN0 A;  2IHR 1;  1MMD A;  4JI3 F;  5HJY A;  3SEO A;  3MXH P;  4DS4 A;  4G1P A;  3RBX A;  4FF2 A;  3L9Z A;  2E7W A;  2RML A;  2R2R A;  5F8N A;  2V2K A;  3EGV A;  1Y3J A;  4F4Y A;  1LW2 A;  1UW9 A;  2BKN A;  5JVG Q;  3VGU A;  4FP9 A;  3T1A A;  3I31 A;  4KO0 A;  1DBD A;  5B0B A;  2VQF J;  4J7C A;  3ZTR A;  2I2Y A;  2YWK A;  4DSL A;  1X4C A;  4A8O A;  4K4T A;  1NK0 A;  3M9O B;  4AXJ A;  3N9U C;  2HHH J;  1TKT B;  4NYP A;  2DH9 A;  4MT1 A;  1K44 A;  1X5O A;  3RBD A;  1REV A;  1RA6 A;  1RTJ B;  3HD1 A;  4LSN B;  3KG0 A;  3OHA A;  3FEX B;  3EXC X;  3CC4 S;  3CCM S;  1TP7 A;  4QIG A;  4ZHR B;  5K8O A;  4IFY A;  2HVH A;  1RT5 B;  4RW8 B;  3DOM B;  3IG1 B;  5IXU A;  3T6J A;  3KMQ A;  4WU2 A;  5KOX A;  5LM7 E;  3NGR A;  3BGO P;  4AXI A;  2RF2 B;  2FHM A;  3KDO A;  4A47 A;  5F3Z A;  3VWS A;  3A8K A;  4UT4 A;  1J5O A;  3FNN A;  4JYA F;  1YRT A;  1SC1 B;  5KG7 A;  3Q8Q B;  4HHH A;  2QG9 B;  4YY3 F;  2FPH X;  1XMO F;  1DJ0 A;  1TMJ A;  1ZAV A;  4A4J A;  1GXT A;  3AXM A;  3C66 A;  2IM0 A;  1MN9 A;  2OPR A;  1JLB A;  4G65 A;  5I3P A;  4PKD B;  1LWC A;  2U2F A;  4ECT A;  5K8P A;  3M2V A;  3O3L A;  1RTD A;  4OQJ A;  2N4C A;  5RUB A;  3HSJ A;  2J8A A;  3OTC A;  5DLG A;  3PW4 A;  2NSC A;  1HBO B;  1PO6 A;  2B4P A;  2CZ9 A;  5IT9 U;  2VG7 A;  1T05 B;  2IM2 A;  1CSJ A;  1NZ8 A;  5JUM A;  7FDR A;  3GV8 B;  3M9M B;  2ZWP A;  2W2Q P;  5DG8 A;  1IKX A;  3SSR A;  3EUN A;  4C7Q A;  1H73 A;  1VOM A;  1B64 A;  3CO9 A;  1QAX A;  3Q8S B;  3K5L A;  4UOH A;  2F4V F;  3M6V A;  2DRB A;  1BWV A;  3KKF A;  2F8E X;  4DR1 F;  2FHO B;  4RBV A;  2YNI A;  3BO3 A;  2XZD B;  4FYV B;  4M5J A;  3DDI A;  1RU2 A;  4C48 A;  4B3S J;  1A6L A;  3RW7 A;  3R1L A;  2IAJ A;  5KFY A;  3VVT A;  1NSQ A;  4FZV A;  1NB2 A;  3CD7 A;  3OL6 A;  2QRR A;  2ZWO A;  3NMR A;  4GO5 X;  4ZS6 A;  2V68 A;  3ZZP A;  5E41 A;  1N54 B;  2V50 A;  3BGR A;  4J9O A;  3DN9 A;  4MIA A;  4ECY A;  3T41 A;  1XMQ F;  4LIR A;  5E3R A;  3SQO P;  1XEZ A;  5D4O A;  3Q2T C;  3PO5 A;  2D9P A;  3M6U A;  5D15 A;  3PYG A;  4U8V A;  4L3N A;  4JI4 J;  1P1L A;  1PIE A;  4A46 A;  2ZBC A;  3PW5 A;  1RT3 B;  1TUW A;  4KH1 B;  4ZP8 A;  4P7T A;  3CVK A;  5I3U B;  4DV7 F;  3NS5 A;  5J2P B;  3UI3 A;  4U8Y A;  4M63 A;  1OQ3 A;  4ZVF A;  1NKB A;  3UDV A;  2HHU A;  3PY8 A;  1UL3 A;  1EIY B;  4F4A A;  3DCA A;  3UD4 P;  4PQU A;  1RT7 A;  3JTN A;  4DL2 A;  3I0S A;  3IMQ J;  1S0N A;  2FZG B;  3OXF A;  3DM2 B;  3KNA A;  2V8D A;  5K8N A;  1HPZ A;  3HSG A;  2ZNZ A;  1SKS A;  3TJA A;  4CM0 A;  3BQ2 A;  4B3R J;  4WP8 A;  4TLQ A;  1A7G E;  5KOW A;  1T3N A;  1S0O A;  3M9N B;  2WOM B;  3H25 A;  1KHW A;  3AJD A;  3ISN C;  1RAC B;  1BE4 A;  3MED A;  3PYF A;  3ZFV A;  3N79 A;  4K4S A;  3OSN A;  4TVA B;  1T02 A;  2I6W A;  1WG1 A;  5SUH A;  2DGX A;  4DL5 A;  2AWZ A;  2X3D A;  4NZ0 A;  1KP6 A;  1U49 A;  3G4S S;  2X7I A;  4HEA 9;  1RUS A;  2MQ8 A;  3DRP A;  1GNK A;  4CCH A;  5KFD A;  3FMW A;  3V81 B;  3BR9 A;  3IP0 A;  1BWE A;  1T9X A;  1FE0 A;  3BSA A;  1YG0 A;  4DV0 F;  2OPP B;  2J0S D;  1YJV A;  4F7V A;  2Y1I A;  8RUC A;  4FVC A;  2M4M A;  2HVI A;  4WP9 A;  2DIV A;  4JI0 F;  3LW5 C;  4J5O A;  4DHV A;  4URQ U;  4DR6 J;  2DRA A;  2L3M A;  4ICL B;  2BE7 D;  2W7O A;  4CYU B;  4NI2 B;  3QZ8 A;  2V2Z A;  3LAM A;  3X1L B;  4OX9 F;  2B9X A;  1RAI B;  3W63 A;  5DZ6 A;  1IBL J;  2UV8 A;  3DLE B;  3N0V A;  1HHS A;  3M2U B;  3DMJ B;  1ARO P;  2CDQ A;  4ZPA A;  2WSF C;  2MY7 A;  2J9C A;  3MEE A;  1VLO A;  2BEF A;  2VPW B;  1RKI A;  1WOS A;  4EZ6 A;  4GC7 A;  1V5I B;  2IJN A;  5D6G A;  4H4M B;  2KTQ A;  1BHN A;  2ZC3 A;  4K8R A;  4ZLP A;  4K2J A;  2DXF A;  2XHC A;  4M5K A;  1RBL A;  1YBU A;  2G1D A;  3PX6 A;  2XI3 A;  5CYQ A;  2CJA A;  3KLH B;  2G0J A;  1IKW A;  1QTN B;  3PJ9 A;  2E1A A;  4RLE A;  5E5N A;  1JKH B;  1TQL A;  3VQT A;  3DLK A;  1KRP A;  1FNM A;  1GQE A;  4DXL A;  1M0S A;  2YKP A;  4J9U E;  1JLE A;  1N5Q A;  4PRF A;  1TAU A;  2YWE A;  4EBD A;  1WF0 A;  4WZQ A;  2GAG C;  4FNI A;  4I6A A;  5ITH A;  5DZ7 A;  4ZJO A;  3GCW P;  2ZJP Q;  4MYT A;  4HH0 A;  4WK1 A;  4C8O A;  3FRZ A;  2IPO B;  3HO1 A;  4C3L A;  5HQM A;  4GMK A;  5CQG A;  3QSI A;  5H9F J;  3G96 A;  3OSP A;  4HTI A;  4Q7A A;  1TV6 A;  2F63 A;  4DQQ A;  4IG3 B;  1FFS B;  4F4K A;  3CWJ A;  4ED3 A;  1N88 A;  3RYL A;  3LP1 B;  1WHV A;  4R8U A;  4U6P A;  3GJS B;  3QWP A;  2CQ0 A;  3I4H X;  4UOC A;  1S9F A;  2WHO A;  4UUW A;  4M5D B;  5HAN A;  5D3G B;  4PPD A;  1KSP A;  2XM3 A;  5KFH A;  1D9A A;  3HHL D;  2N7C A;  5HMW A;  1SQF A;  2V63 A;  1I1G A;  1R0A B;  1RT1 A;  4ANC A;  1CJV B;  3J81 j;  2UXC J;  2VBZ A;  3V6D B;  2YKA A;  4LFA J;  3Q8U A;  5H1S V;  1ZTT A;  2P9G A;  4A8K A;  2KH9 A;  1FTC A;  4ZPT R;  3AQP A;  4O44 A;  3OTO J;  1NJI T;  2DGO A;  1M1K T;  3IAS 9;  2O5D A;  2AJ2 A;  4WE1 B;  3LO3 A;  1X5T A;  5HBM A;  3THP A;  1D3W A;  2YH1 A;  3CCV S;  1T03 B;  4AUK A;  1KR4 A;  4MTP A;  2QL7 B;  4ECZ A;  4OI6 A;  1L3V A;  3M05 A;  1XN9 A;  4ED5 A;  2HHX A;  5L9X A;  4B17 A;  2UUB J;  3KYL A;  3IA0 A;  2BUN A;  2R7U A;  1K73 T;  3LWL A;  1U6B A;  1GTE A;  3QRQ A;  1NHV A;  4NMX A;  3W1Y C;  2LEB A;  5K5M A;  3CC2 S;  1JMT A;  2MST A;  3H5S A;  1MWZ A;  1NPP A;  1X9S A;  4C8M A;  1BMQ B;  3UWT A;  4IRC A;  3QFH A;  1IR0 A;  4Y6I A;  3ENV A;  3ETO A;  4OYX A;  1VQL S;  1TL4 A;  2QT7 A;  3MMC B;  2ZEJ A;  3QJP A;  4ILR A;  3J7Y I;  1RTH A;  4MAK A;  3BF4 A;  3ZNU A;  1GMU A;  4FYD A;  1OPZ A;  5IWA J;  4ZVT B;  1VQ9 S;  2CWX A;  1KNZ A;  1Y00 A;  2ZBR A;  2HLT A;  4OV1 A;  4DV5 J;  3BBC A;  1YJW S;  1HHQ A;  4ERD A;  1WI8 A;  3G9C A;  4ER8 A;  4ZCI A;  3KK3 B;  3EVO A;  1GEH A;  3W61 A;  4LIW A;  4OZ3 A;  4JI8 F;  3I55 S;  1F5B A;  1NZA A;  1NDL A;  3OR2 B;  5KFA A;  4K0K J;  4Y2C A;  3HM9 A;  1XWL A;  2W25 A;  4QPX A;  2WCX A;  2ZKU A;  2WRM A;  2HBR B;  2OPQ A;  4ETX A;  1LOU A;  1R27 B;  2HKE A;  2BE2 A;  2AX0 A;  4I2Q B;  4C4W A;  2UUA F;  3D3B J;  3P3D A;  4NAS A;  3SYZ A;  3DDK A;  4Y2K A;  3PIO Q;  1G7C B;  5D4N A;  3QNW B;  1QJH A;  1J5E F;  1S1T B;  2C1E B;  3R8Y A;  2CNN B;  3G6Y A;  3CCU S;  3MEC A;  2EEY A;  4CTA A;  2IJR A;  2VHG A;  3RUB L;  2J0W A;  3SSS A;  4BCA A;  3QBC A;  3DOL A;  5I4M A;  1DTT A;  2IM3 A;  3HI9 A;  2DNK A;  1D0E A;  2CG4 A;  1TFY A;  3JSR A;  2FY1 A;  3US5 A;  1EJ7 L;  1Q5V A;  2YKN B;  4KGK A;  4DG1 A;  1VC5 A;  4OYI A;  3CJ0 A;  1UEV A;  4QPT A;  3A3O B;  4E2F B;  4RW4 A;  3D3C J;  1N33 J;  3EZO A;  1BQM A;  5FJ4 A;  3AD9 C;  2HWT A;  1PBA A;  4XIU A;  4IH7 A;  5KFT A;  1BXN A;  3R5B A;  4RW6 B;  1OQ6 A;  5BYQ A;  4DF4 A;  3H0P A;  3OD2 A;  5CYJ A;  2VG5 B;  1SJ1 A;  1SH3 A;  3OUY A;  1ZYQ A;  1TL1 A;  3FCV A;  2G13 A;  3EMT A;  5KG5 A;  1LW2 B;  4DV4 F;  3FCH A;  1VQN S;  3QGI A;  3F56 A;  2EFQ A;  4K50 A;  2KRR A;  7AT1 B;  1U1R A;  4KHP F;  2ZVI A;  1QTM A;  1PIL A;  2G4B A;  2ILY A;  1HNX F;  2R9L A;  2FZK B;  1URR A;  4CLW A;  2IC3 A;  2AYG A;  2DNN A;  1REV B;  3R5J B;  4HT5 A;  2FJV A;  2FJW A;  4LVN P;  1F3V A;  4WFB Q;  4NRU A;  2YQ1 A;  1HWU A;  1Q7L B;  1WSR A;  4KH0 B;  2VIH A;  2OFG X;  2RHS B;  3CJ3 A;  2CQ1 A;  1PYO B;  5L8R C;  4IOC Q;  4CM2 A;  5H9E K;  1HQE A;  4JV1 A;  1PYT A;  9RUB A;  3KUG A;  3RRK A;  3JQM A;  1R31 A;  2ZBI A;  4XPE A;  4X66 J;  3Q24 A;  3EZU A;  2CQG A;  4ECS A;  2MHE A;  2KFN A;  1J5O B;  3T5L A;  4URG A;  1CJK A;  3T1Y F;  1FDN A;  1M5V C;  4Q5V A;  3KK1 A;  1VR6 A;  1CJT A;  1DQ8 A;  3FKB A;  2YKO A;  2BOA A;  5DDR C;  1S76 D;  2YQ3 A;  1AW0 A;  4ZIV A;  5KT2 A;  3D5M A;  2OPR B;  2B56 A;  4FPR A;  1YRX A;  1H6K X;  4F25 A;  1LWC B;  4K4W A;  3M2V B;  2CJY B;  1I94 F;  5J2Q A;  1SUQ A;  3ICL A;  2O66 A;  1OSD A;  1HNV A;  2CWK A;  2GAH C;  2NS1 B;  2AEM A;  1C2P A;  4OX8 A;  1SC3 B;  5LOQ A;  5AXK A;  1KLM A;  2HZV A;  1Y4Z B;  3TUJ C;  5KFV A;  2QLX A;  2VG7 B;  3ZO7 A;  1SXL A;  4DPW A;  3DGP A;  1FVQ A;  2FY8 A;  4DSK A;  1IBK F;  2ADB A;  2Q1L A;  1Q8L A;  1GXU A;  1SKW A;  3KDN A;  4TU8 A;  4UTG A;  5LT5 A;  2E1C A;  1WKJ A;  4BLG A;  3LH2 S;  4ZP7 A;  1EET A;  5JXS A;  3NOG A;  2YBV A;  2X51 A;  2GZO A;  3CB4 A;  1S72 S;  4UQT A;  3CNQ P;  2HBY B;  2XGQ A;  2BW2 A;  2HVE A;  2NZ4 A;  4ED7 A;  2DGU A;  3C16 A;  1NO8 A;  2MB0 B;  3ELH A;  1NAQ A;  2KFZ A;  1NK8 A;  1N0V C;  2IAJ B;  4RWX A;  1WHW A;  3SCK E;  3DKD A;  4WKR A;  4DX7 A;  2CPZ A;  1OIA A;  2YNG A;  2C2O B;  2ZOM A;  4DSF A;  1WI6 A;  3IM8 A;  1SKU B;  4FF1 A;  1T3O A;  3I87 A;  2ZKT A;  3BGR B;  1ZAX A;  5EHH A;  2CNL B;  4N7T A;  4HI2 A;  2MQN A;  2VIC A;  2I38 A;  4GKK F;  4PCQ A;  5D0G A;  1NRK A;  1Q0N A;  3MTK A;  4Y2I A;  3NBP A;  2CPD A;  4PR6 A;  1T7P A;  1RP5 A;  3PYD A;  1IKY A;  2K3I A;  4JB8 B;  4C0O C;  3BDE A;  3O6Q A;  1Y5L B;  4J9N A;  1WC6 A;  5KT3 A;  2HW3 A;  4PQU B;  1NBE B;  3HMJ G;  1RT7 B;  1EQM A;  4UQG A;  4QZV B;  3I0S B;  1VQK S;  4OYA A;  4OYW A;  3NGU A;  1KQS R;  2DNM A;  2MQO A;  3UCU P;  2AZ1 A;  5E0O A;  2YKQ A;  4DR7 F;  1YGY A;  2PE8 A;  4AFF A;  1VQO S;  5H9F K;  4KHM A;  3BN7 A;  3CDW A;  1OWX A;  1I5O B;  2DK2 A;  3NWG A;  4NZ6 A;  3MED B;  2C2M B;  3ONQ A;  4EO8 A;  4C8Z A;  2VG6 A;  3W5X A;  3PIP Q;  4PWD A;  2PO4 A;  4JOU A;  4CQ1 A;  3THV A;  1FKA F;  4Y65 A;  2MKH A;  4TU7 A;  3KJQ B;  4LRA A;  3V2U C;  3BGU A;  2JHE A;  2NSB A;  1ZPV A;  3NEK A;  3BH7 B;  5HMZ A;  2C22 A;  3SFU A;  4AD6 A;  3TAM A;  2POK A;  4FN5 A;  5A8R A;  3TVZ A;  4YDX A;  2MLZ A;  4CIO A;  5ADZ A;  5CD4 A;  2E5H A;  4N76 A;  1FWK A;  4M5L A;  5ETK A;  1RZM A;  3MM6 A;  1XMO J;  2IA0 A;  4C3K A;  1UFK A;  2JLE A;  2AGO A;  4LF5 J;  3CCQ S;  4FVM A;  2EVZ A;  3A12 A;  3THT A;  3QMQ A;  2IRX A;  4E0D A;  4NEY A;  3R2C J;  3W5Y A;  3M8W A;  2XBP A;  2OIH A;  3T1H J;  2NPF A;  4JI6 F;  3CJS A;  2KXF A;  4ZPB A;  3FFI A;  4CLZ A;  4P72 A;  1FD8 A;  1ZM4 A;  2Y0S D;  1FJG F;  3ENA A;  1E6Y A;  5ETR A;  3K5M A;  2VA2 A;  3HX9 A;  4L73 A;  1ZZF A;  2W1B A;  1ZZN A;  5CYQ B;  4AQY J;  1NHK L;  3SCL E;  1EHW A;  1I51 B;  4CNZ A;  3VR1 A;  5G0R A;  2F8M A;  4P2M A;  4B3T J;  5DDP C;  5HK4 A;  2WB1 D;  1S1W A;  3DLK B;  1S1V A;  2YNH B;  2CVE A;  1UW4 A;  1WC3 A;  2B6A A;  4QWC A;  1WC1 A;  5LMU J;  1FD2 A;  4M5G A;  2F4V J;  4KAI A;  5DO2 A;  2OUG A;  1TK0 A;  3AOA A;  4UOF A;  2OTJ S;  3GTY X;  1Q5Y A;  2HGL A;  3PJW A;  2QZ8 A;  2CNO B;  4USV A;  2PMW A;  1WG5 A;  1S10 A;  1MMN A;  3CGI A;  4JV5 F;  2JC1 A;  2YPY A;  1OJ4 A;  1HQU A;  3J80 U;  2PMZ D;  1Y0H A;  1HBU B;  2N7Y A;  3SXL A;  2HGN A;  3U27 A;  4ECR A;  4DPO A;  1NDC A;  5C24 A;  2NXE A;  2MQP A;  1T8E A;  3Q2S C;  3O5T B;  3K58 A;  1TV6 B;  3DRS A;  4URS A;  2RQ4 A;  4C11 B;  2ZH8 A;  2D3Z A;  2GJF A;  4P52 A;  2LU1 A;  2ZOG A;  1KS2 A;  4JI5 J;  2LQB A;  4R8U B;  2KO1 A;  3SQG A;  4B9L A;  3QRR A;  2V0N A;  3HZE A;  2QFI A;  1DRZ A;  2HIY A;  2A2D A;  1U0H B;  2PDA A;  5LXY A;  2ASY A;  2JH3 A;  3T19 A;  3N28 A;  5IQ6 A;  3QSY B;  1RI7 A;  1TK8 A;  2J6T A;  2DBB A;  3FSX A;  5GAG I;  4EGL A;  1RT1 B;  2LDI A;  1UET A;  2LXI A;  1L3S A;  1EP4 A;  1TL3 A;  1VCT A;  2NXN A;  4O44 B;  1QAI A;  3D6T B;  9ATC B;  5KFZ A;  3BO2 A;  4RUB A;  2W7A A;  1WHX A;  3ILO A;  5F8J A;  3A4T A;  5HBM B;  5D77 A;  1X9W A;  1VLY A;  4LF4 F;  5DET A;  1S79 A;  2PT0 A;  3G6E S;  4OZ1 A;  4KIA A;  3RBZ A;  3TX8 A;  3OPK A;  4WF9 Q;  5IS2 A;  2BZ2 A;  4QIV A;  3RZA A;  4A8X A;  4DV3 F; 
#chains in the Genus database with same CATH homology
 4ZVQ B;  3KJN B;  3IBC B;  1RHK B;  3GJQ B;  4ZVT B;  1RHU B;  3RJM B;  3EDQ B;  2HBQ B;  2CNL B;  1SC3 B;  3KJQ B;  1I51 B;  2DKO B;  2H51 B;  2P2C B;  3R6L B;  1PYO B;  2H5J B;  2QL7 B;  1RWX B;  1I3O B;  3D6M B;  2C2K B;  1RWW B;  3D6H B;  1QDU B;  5IC4 B;  4LSZ B;  3R7S B;  4ZVP B;  2CDR B;  4DCO B;  4ZVS B;  4ZVR B;  3R7N B;  2QL5 B;  1QTN B;  2H4W B;  1RWO B;  3P45 B;  3R7B B;  1RHM B;  3GJT B;  2H48 B;  3GJS B;  3IBF B;  2FQQ B;  2H4Y B;  1F9E B;  3EDR B;  2QLJ B;  4JB8 B;  1RWN B;  2QLF B;  2HBR B;  1RWM B;  4DCJ B;  1RE1 B;  1IBC B;  2H54 B;  2CJX B;  5IC6 B;  1GFW B;  2Y0B B;  3R6G B;  2HBY B;  2XYP B;  3D6F B;  2CNO B;  1RWK B;  2XYH B;  1RWP B;  1NME B;  3QNW B;  3NS7 B;  1RHJ B;  4ZVO B;  1BMQ B;  2C1E B;  5K20 B;  2QL9 B;  2CNN B;  2CNK B;  1RWV B;  1SC1 B;  1SC4 B;  3KJF B;  2H5I B;  3P4U B;  1RHQ B;  2QLB B;  1ICE B;  3SIP B;  2XZT B;  4DCP B;  2C2O B;  4ZVU B;  2H65 B;  3R5J B;  2XZD B;  2CJY B;  3GJR B;  2Y1L B;  2HBZ B;  1PAU B;  2C2M B;  2C2Z B;  1RHR B;  2XYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...