1RWXB

Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-yloxy)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-butyric acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Tethering identifies fragment that yields potent inhibitors of human caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwxB00
1RHKB 1RWKB 2H51B 3P45B 3D6HB 2HBRB 3D6FB 1RWMB 1RWNB 3EDQB 4ZVUB 1RWVB 2CJXB 2QL5B 3GJTB 1QDUB 3KJNB 2C2MB 3GJRB 2FQQB 3R7SB 1BMQB 2C1EB 1NMEB 2C2KB 4LSZB 3GJSB 3R6LB 4JB8B 1QTNB 2CNKB 3P4UB 2H48B 4ZVOB 1I3OB 1SC1B 3QNWB 1GFWB 2C2OB 4ZVRB 4DCOB 1F9EB 3RJMB 2Y1LB 3KJQB 3NS7B 5IC6B 1PYOB 2C2ZB 2QLBB 4ZVPB 2P2CB 2DKOB 2QL7B 2QLFB 2XYHB 1SC4B 3R5JB 3D6MB 2HBZB 1RHJB 1IBCB 1RHUB 1ICEB 1RHQB 2H4YB 2CNOB 2XYGB 4DCPB 3EDRB 3KJFB 1RWWB 2QLJB 2CDRB 2Y0BB 1PAUB 5IC4B 2CNLB 4ZVSB 2H5IB 4ZVQB 2HBYB 3IBCB 2H65B 2CJYB 2QL9B 1RHMB 3R7NB 2XZTB 1RE1B 2HBQB 2XZDB 2XYPB 1RWXB 2H54B 3R7BB 5K20B 3IBFB 1RHRB 2H4WB 2H5JB 1RWPB 4ZVTB 1I51B 1RWOB 3SIPB 1SC3B 2CNNB 3R6GB 4DCJB 3GJQB
chains in the Genus database with same CATH superfamily
2DT9A 2VPYB 2HG4A 4FYXB 3EDQB 3MEEA 2NQPA 1X7VA 2B4UA 3MGJA 3KJNB 2HHQA 2AHOB 1IKXB 1WHWA 3D3BJ 2XM3A 5HQLA 5F8LA 2ZZNA 2G13A 2EBGA 2O67A 3SV4A 2R42A 4OJHA 4I56A 4ZCKA 1SPBP 4OYXA 1W26A 2P9GA 2J7KA 3FRZA 4NEYA 4IFYA 4DG1B 2C3YA 4JP8A 2CAJA 3HHEA 2CQ2A 2XHCA 4Y2MA 1RHQB 3UN2A 2IVFB 1SL2A 1CJTB 2G0JA 2PFFB 4UOHA 1HPZA 4TU7A 2ZH5A 2AT1B 1U02A 3ILOA 4P72A 2HQCA 2W25A 2L08A 4ZVQB 4PXDA 4HKQA 4DF4A 9RUBA 4RNOA 1VOMA 3I9V9 1NDLA 5AJ3J 1X0PA 2XZWA 2J7UA 4KHRA 4GKKF 3GMGA 2DBBA 1TL5A 3M6VA 3P3DA 2Z2YB 3QQCD 1NSAA 1FDNA 1NLKL 3E2EA 2HBRB 2VQFJ 3AFGA 2OO4A 5DQIA 4K4XA 2Y1JA 3OR2A 2ZBCA 3FNNA 1N6QA 2AD9A 2GA7A 4K4UA 1X0FA 3EGZA 2LA6A 1U1RA 4C3LA 2OPQA 4CLWA 2HNZB 5A76A 4IUFA 4C8YA 5KG3A 3CSKA 1GFWB 2BW7A 2UU9F 1P1LA 4FF4A 8AT1B 2ZHAA 2XWYA 2UVWA 3V6DB 3TZYA 2F1FA 2YKMA 4BWJA 4DZ6A 1A0OB 4D3GA 4C8ZA 3LUYA 4LR7A 3D66A 5HVGA 1SH2A 1B4SA 5B0DA 1KC8T 3I56S 1DAXA 3FZ2A 1O0PA 2E5HA 4EMDA 3SI8A 1KN6A 2VH7A 1NJXA 1IXKA 3J7A1 2AX1A 4MKBA 2POKA 2NR0A 2RUSA 2M70A 4Z7CA 3ETOA 4DV7F 2QTWA 3V6JA 4M5MA 3KXDA 6FD1A 2FJDB 1NHVA 1RT7B 4DV0J 2C3UA 4DU7A 1RBAA 2E1MC 2MJUA 3PYGA 3I0RA 8ATCB 3GJRB 4F0MA 2R8KA 2LMIA 1ITPA 2B4VA 3ZNUA 1XEZA 2MZJA 2K1RB 3CJ3A 2HQFA 3CJQA 3H5SA 1VBZA 2YNIB 3EVWA 2AGOA 3UPFA 2DITA 3AB4B 2HK3A 3CC4S 1NDPA 4EI2A 3OSPA 3S7RA 4DR5F 2BJ1A 3GPAA 2LDYA 2XULA 3QATA 2UUWA 2AYBA 4B9UA 4K2JA 2W2QP 3UR0A 4J9RA 4KT0C 1VQKS 2Y0SD 5CAAA 2CQIA 4P9SA 1KSPA 1TVRA 1RP5A 3SCLE 1DQ9A 1S6QB 1UKUA 3CDBA 3W65A 2CJQA 3W66A 3G4SS 3IAM9 3H2UB 1AUSL 5LMUF 2CG4A 4M5DB 4FYWB 2IMWP 3GILA 4ECWA 2SXLA 5KFGA 3D28A 1PBAA 4OYAA 3CB4A 4PYDA 2B6AB 1T11A 3TA1A 1WG4A 2FJXA 2CQHA 1QTNB 2HNZA 1FESA 2ABYA 4R5PB 3MEDB 3MM8A 2BKNA 2JRSA 5J2MB 3DHXA 1XNRJ 1HHTP 2CZ4A 1BWEA 4DPXA 2OELA 3NGTA 2DXDA 1HA1A 1PSDA 3D6MB 4XPCA 2VZ9A 1HNZJ 3SBMA 4JI5F 4N47A 2ZHBA 3X1LB 2M8DB 4I64A 3I6PA 2JOQA 5JMNA 4ZPWR 4DI6A 1N5YA 2OFGX 5D3GB 3OXGA 2BANB 3IBCB 4FKXA 1LWEA 2OEKA 4V19J 3T1HJ 3IGVA 1Q1KA 3ZZUA 2WCXA 3HHLB 2KDOA 2VODA 4DL3A 3BZQA 4C8NA 3PRBA 3G6YA 1AYEA 1MNEA 2BE7D 1C2PA 3BQ2A 5K14B 2Z2MA 3MMJA 3N4WA 1RAJA 1YZ7A 1NKCA 1BQNA 3UD3P 4YP3A 2MKSA 2WB1D 2CPXA 3R3TA 5L1KA 2K1RA 1TV6A 3MM6B 1SC1B 2MPUA 2GS8A 3UCUP 2F9JA 3L09A 1SJ1A 5A2QU 1WG1A 2P2CB 3EVMA 2DGWA 2XMKA 3NMAA 2DR8A 5AJ3F 4RLEA 1V3SA 1WACA 3H20A 4O3RA 2MMYA 3EXCX 2LDIA 2LQJA 3DLLQ 3NGRA 3V81B 1JLCB 4B3MJ 2E1CA 2N4CA 3HZGA 1U1NA 2F40A 3CD0A 2C2RA 5F9LA 2DIUA 2F8MA 3DDIA 4GC7A 2ZZMA 3DI6A 4Q0BB 3JQMA 3AH6A 1IQZA 1CPZA 2V34A 1ZA1B 4ECVA 4KV8B 3TANA 2PEHA 2NUUG 4M95A 1OQ6A 2OLWA 3P49B 3IXQA 3KTQA 3QSIA 3PW7A 5KFXA 3OTBA 5DDRC 1YLXA 1TKZA 1PYOB 2IMOA 3DDKA 3T5HA 2ZD1A 3H7HB 3US5A 1FK9A 4CYUA 3BGFA 2VG7A 1S6PA 3KHHA 1P8GA 1FKPB 2KJVA 3W64A 3WX8A 3WIVA 2AGQA 4H4MA 1EZZB 2E7WA 5K9FA 2LLZA 4DV0F 3VGTA 5GAHU 2KJWA 2HYIB 1QAXA 1KQSR 1AA1B 4ES3A 4A8WA 2FHOB 3HHLA 2VJUA 2JX2A 5H9EJ 2MQNA 1NXIA 4MK8A 2XMAA 3AA9A 1OPIA 3M2VB 1X5OA 2GJIA 2K3IA 2V9KA 3TARA 2NCKL 2YKQA 3OFHA 3JQKA 4TY8A 5DO2A 2Z0GA 5KFSA 3CWJA 1W2IA 1EETB 1XMOF 5HJXA 7FDRA 4RL1A 1RTJB 4FZVA 1TQLA 5CYQA 4P2SA 2A6MA 3KUEA 2W9AA 4FYYB 4LIWA 2KG1A 4DFMA 2I2YA 3PIPQ 1E6YB 3FJ2A 2HFUA 1OYDA 4YB7A 5B7WA 1ZAXA 5LL6d 1MMNA 1U6FA 3U02A 2VPXB 1DFDA 3PEJA 1RKIA 3A8JA 5B0BA 2DHGA 1RISA 2EXUA 2COLA 5LJ5Y 3DGVA 4H4OA 1N33F 2JFKA 4A8XA 2DISA 2CJYB 3EWGA 1R0BG 2DGUA 3PW0A 1FRKA 2EFPA 3UFCX 5KFDA 2KL8A 2CDQA 3NG8A 1S99A 1QJHA 5K8OA 3UDEA 4PRFA 1URRA 2FPHX 5KG0A 3M2UA 4DR3J 1MROA 1XNRF 3L9ZA 5FDLA 1S76D 4JV0A 3BYPA 3M8QB 3RAQA 5E41A 1T9TA 2QA1A 1M1HA 4WCEQ 1N5VA 1HNZF 4ILMA 3F73A 2E5LJ 1DURA 4IG0B 3EX7B 1SJRA 3QWUA 2UXCJ 1JKHB 4DCOB 2OJ3A 4DR7J 4A8KA 3A8KA 4HYKA 1UL3A 3T1HF 4ZP6A 1RA6A 2DY9A 1FKPA 1UPPA 4NLSA 2XHWA 3Q2TC 1U09A 1R8CA 4RO0A 4DL0C 2XSJB 1IUJA 1D1UA 3B6BA 2E44A 1KTVA 4LF5F 4NOHA 5ETKA 2QIFA 3CJ0A 3VHQA 5IQ6A 4L75A 4QYZK 3FQKA 4DL4A 3CJRA 4Q44A 2XZDB 4DV1F 5JVGQ 5KFQA 4CO2A 3SXLA 3M2VA 4ZDNA 4C3MA 2V2QA 2HQDA 1JJCB 4HI1A 2RUGA 4X4SA 2A0FB 1CSJA 3HHDA 1F3FA 3NXZA 3PO4A 3J81j 4LQ9A 3KG0A 2B7BB 5HLFA 3AAWB 3PYFA 5BR8J 3ISNC 1WHXA 5DG9A 1VRUB 4QCLA 1CJKB 5E3RA 4B02A 4RNNA 5HVHA 3OVBA 1XJWB 3JSRA 3MZIA 1HR0J 2GVZA 3G9CA 4XIUA 3GLJA 3RAMA 1Q7LB 2X1AA 1VQSA 2D3OR 1UP1A 3Q8PB 1RBLA 4OI3A 2HFSA 1EKSA 4DL5A 4DS5A 3NGUA 3QIPA 1S6UA 1JXVA 4MK9A 3UW1A 1SQFA 2MEWA 2OHDA 3CDUA 1JLBB 4LQ3A 2IJRA 3CNQP 2RVJA 4ANEA 3HFKA 4EWTA 4ED5A 1V9OA 1F2HA 2LXIA 2IVMA 4HT5A 4GO7X 4C11B 4F4ZA 3GG1A 4LF1A 3CCZA 3NWGA 5J2PB 3M8ZA 4UF4A 5CQGA 4PG7A 3QIDA 5I3PA 1OYEA 3M8QA 1TL1A 4K4WA 5EWFA 3ADAC 4Y28C 4B3OB 1C4CA 2E7XA 4G1PA 1WD6A 4QR1A 3J7Z5 2X7IA 3TO8A 3BSOA 1HBUA 3TQEA 3HK2A 1JKHA 1JLAB 2B0GA 3BBFA 1S7HA 1F9HA 1GTEA 4Y2AA 2JJ4D 4NXNJ 2DNPA 5GAEU 3KLHA 1S1VB 3BB5A 1T7PA 1W7WA 2CPIA 3KJVA 2BJ3A 1ZPVA 2RRNA 4EK2A 2GW8A 1YZ6A 5AE1A 2HNDB 2DVIA 3T5KA 3IWXA 2YY3A 3MR2A 3M9OB 2F9DA 2VQEF 3PV8A 2H9ZA 2RB7A 2HBYB 1S10A 1FRLA 3UD4P 4JI8J 4J90A 5HP1B 1N4LA 3DLHA 3X3UA 2MY8A 3J7YU 5KFBA 2YH1A 1EX8A 2NXCA 5LMNJ 2H1YA 1X5PA 3ISND 4JV5J 2CQ4A 2B4OA 5C7PA 2B9EA 1BHNA 4JI1J 3CCSS 4OV1A 4LF4J 3V6KA 2QGFB 2FLOA 3C46A 1DARA 5GADU 1RGVA 2ZBIA 3E01B 4DUZF 1VRUA 4KKOA 2OAUA 3E51A 5I3UB 3CO0P 1S5ZA 1R43A 1F3VA 3K2YA 4XK8C 1CJUB 1HBNA 4OQJA 4ZVRB 4ZVEA 3CCWA 4FP9A 1NO8A 3NCPA 1JJHA 5ETOA 1SKSA 1IWGA 2ZE2B 1X9WA 2XGQA 4YR3A 5KFAA 4MT1A 3IS9A 4N5SA 3W2VB 1HARA 5DG7A 2VONA 2X1BA 3MMBB 1TZ0A 4DV4J 2V50A 4DR3F 1H73A 4ED2A 2RJZA 3M9MB 4MK7A 2VV5A 2UVUA 1OO0B 1FJEB 2HQGA 1NM2A 4QWCA 4MIWA 3C2PA 4YB6A 3C6TA 4WK1A 2VG5B 4L74A 2A1BA 3BS9A 3DNCA 1SXLA 3KLFB 3RBEA 4ILRA 4W90B 4BDPA 3MCNA 2UXCF 3D6FB 1YRXA 3V2UC 4DR7F 3EPIA 4KGMA 4ZIWA 5DLFA 3HVAA 1NK9A 4XPEA 1RT2B 3TEGA 2UUAJ 2K7KA 1DTTA 2E5JA 3TAMB 3HSJA 1AB8A 2EC0A 2B51A 4EGLA 4IKAA 3FEXB 5IOLA 3PRDA 3CF5Q 4Y2IA 3GCXP 3DU6A 3RYLA 2RIJA 4RBVA 4URSA 5LOQA 3CVKA 5AE2A 5ETVA 3FSXA 3FRYA 4J9OA 4CO5A 4J9SA 2GZOA 3I0SA 2EEYA 2QFJA 5D4LA 3DXBA 2Q43A 4CLFA 4AQYJ 2CQPA 3SSQA 1RAGB 3DCAA 1W25A 3KK3B 2M4MA 4KQZA 5BR8F 2OD4A 2OPPA 1S1TB 2MHEA 4QZVB 3PZPA 4WWSA 1RTHA 2NREA 3PX4A 1TFYA 3T9ZA 2IJFA 1JLQB 1APSA 5CA5A 4IH5A 4QWBA 2YWKA 4USMA 1C0UB 1U1QA 1CULA 3PR4A 2H51B 1HR0F 3UI3A 1FWKA 3PG9A 3O8WA 2DGSA 4DQSA 2LEPA 4U9RA 5CYJA 3MUVP 2A18A 3CE8A 5KT6A 5LXRA 2FZGB 3P4UB 2J6SA 2CVIA 3TUIC 3S8SA 2ZEJA 3M1VB 2A6OA 4OHXA 4NZ0A 1YJRA 4JV2A 2CFXA 5A0YA 3GE9A 1Q0NA 5AXNA 1Y3JA 2WOMB 4OMFG 3NGSA 5L1JA 2VKZG 4F02A 2CYYA 1SUQA 2PMZD 1KLNA 3FCVA 2XMWA 3GCWP 4JI3J 2XMVA 5KFWA 1WTBA 1XMQF 4Y00A 3BQ0A 4KHPJ 4Y3CA 4L72B 1DBDA 3IGNA 3TX0A 2FYXA 3IWNC 3PJWA 4OHZA 2DNMA 1LK5A 3HHLC 3BV8A 4HHUA 3GFXA 4CLZA 4NXNF 1NUEA 3DRPA 3FMBA 4WE1A 2PD1A 1NSQA 1KONA 2V0NA 1RT2A 3TAMA 3BGRB 4TXSA 3LH2S 4A8YA 5C25A 1ELOA 2GJFA 3IG1B 2ZOFA 2LQ8A 2RKIB 2XS5A 4P75A 1F9EB 1VIXA 3MMCB 1FE4A 2Z58B 3KK2B 2QLBB 4DSLA 5DQGA 1FA0A 1UMJA 1RTDA 2UUCJ 3UDLA 2R7SA 2IIHA 4DR2J 1KDNA 1O5JA 1HLWA 2XWXA 2V2ZA 4ZVFA 3ENQA 1WUUA 2BJ9A 3KMSA 4JV5F 2I5JB 2FD2A 4Y2CA 3I5AA 4JI1F 2KYZA 4BS2A 3KK3A 4F2RA 1RHMB 1MMDA 1WSRA 4ZPDA 2QA2A 3HSGA 1GMWA 3FEYB 3MMAB 4OHYA 3OL8A 2B8PA 1I51B 1M5HA 5LT5A 2BQRA 2CQDA 2WVBA 1NDCA 1C0UA 2AYMA 4CRJA 3MECB 2YX7A 1WOPA 1KRPA 4IR1A 2W9BB 1YX2A 5DDQC 1T9YA 3CULA 3EPGA 1Y10A 5IWAF 4ZVGA 4Y65A 5F41A 4F3QA 1BWVA 2FDNA 3CCES 3DKDA 1GMUA 5F8NA 1FNMA 3M1VA 3G6VA 2HWHA 2KKHA 2RILA 2FLPA 1RCOB 5LSLA 3MURP 3ETMA 3MCOA 1WORA 2BR0A 4I6WA 3MOJB 5I4MA 4Y6IA 3NNCA 4MKYA 1ZS6A 3DRRB 3ZZYA 1NK5A 4OJGA 1RDRA 3IM9A 1ICEB 1QUVA 4ANCA 4O0NA 1S9GA 4OX6A 3T1YJ 2QLJB 2HQ3A 5HI7A 3F41A 4ZMMA 5EHHA 4KB7A 1FRMA 5L1LA 4YR2A 3A13A 3VWSA 1SJQA 1QD1A 2XBPA 3G87A 5HANA 3DOKA 3BSAA 3V4IB 3TZZA 2UUAF 1LWCA 4RNFA 2ALYB 5HMXA 5IXUA 1K73T 4Q7AA 5KFMA 3TWZA 1BLUA 2RU9A 3H5YA 1F1BB 2N3OA 2RRAA 1RYSA 4C0BA 2AGPA 2UVVA 4ZCLA 1T9UA 2C1EB 3LP0B 2XB2D 1Q95G 4O23A 4J9KA 1RABB 2BM1A 3NCQA 3BBBA 1NCLA 1LXNA 2PE8A 5M2RA 4CLTA 5KOWA 3QMQA 3MMCA 3KJQB 3W1YC 1HNVB 2B5JA 3RB0A 1MU2A 4C0HA 4DUTA 5IT0A 1S0VA 5HBMA 1BQXA 1WC6A 2I1RA 4HHHA 4QW8A 4GC6A 2GQ2A 2VD3A 1Q8KA 3JQJA 5HK4A 4X4TA 4OZ0A 3UCGA 5E33A 3PRVA 3CCTA 1WKLA 4E2FB 1VQPS 1CVJA 1IKYB 1R3NA 3W8GA 4ED7A 5K5MA 1PG5B 3MMAA 4CNYA 5DJBA 3HSZA 1PC5A 4I2QA 3NS6A 5B0CA 1HMVB 4E8UA 1SC6A 1TAQA 3C19A 1B0TA 4QBUA 4PWDA 3OXLA 4OHWA 1TUGB 3ZXWA 5U47A 3DYAB 5KFUA 2MLXA 4UUXA 3SDEB 3TJAA 5E2QA 1TKTB 2UXDJ 4P73A 2IBOA 4RU2A 1T05A 1VHIA 3O2IA 1NSKL 3LPYA 2L3MA 1CS4B 1OPZA 4ECZA 1SV5A 4JI3F 1R89A 2XC9A 3S1TA 3C16A 4USKA 3BSCA 5CXTA 1GK8A 3THPA 4HH1A 3LAMA 3DHWC 1QE1B 2IAJB 1HQUB 3DLJA 4CO3A 4UOCA 4C8LA 1WSVA 4QJVA 3O44A 1UCNA 1LWFA 4DX6A 1VHFA 4L3KA 5A8KB 4AT1B 2V4QA 1JK9B 4A46A 3GSDA 3E8OA 5KT5A 1B0VA 4B9NA 3Q8VA 3MM9A 4XAKA 1D09B 4EO8A 2B9YA 4ECXA 1G1XA 5EUHA 1HQ2A 2AEJA 2AX0A 4LFBJ 4KR0B 5A8RB 4B9SA 4ZVUB 5HVFA 5ETSA 3LPEA 4OZLA 2YNHA 5B0AA 4DR2F 3PIOQ 3ZTOA 2K2PA 3LOUA 4YN3B 2ATCB 4A4JA 2G4BA 3DXSX 3LP2A 3D4JA 2VPWB 2PA8D 2NPIA 4PWUA 2DGTA 5KFZA 3FFIB 4MH8A 5T14A 1ZBTA 4DZDA 2HGLA 4ZHRB 3HSDA 1X60A 4EO6A 2F4FA 1Q81T 4ZP9A 4UT4A 4M5NA 3MM7A 2C2EA 1HHQA 4F3OA 3OR1B 3GV8B 2MLYA 4FXVA 4EYIB 5HMZA 4OL8A 3GYXB 2AWZA 5JVHQ 3BN4A 2HS0A 3W3SA 1RWOB 4PG5A 1FKAF 5KFHA 4TU8A 1S77D 2LP4A 3IBWA 1FCAA 3TP2A 3WQPA 1N5QA 3MHYA 5D0HA 4FNIA 3W5ZA 1FI4A 4QU7A 1TKTA 1S1WA 5AE3A 5LM7E 4F4AA 1TL3B 2I38A 2M88A 4Z7YA 3O1LA 3JTNA 4FS2A 2LKZA 3GIJA 3A12A 3NP5A 2X3DA 5JUMA 4X4OA 2F4VJ 2IAJA 2W8KA 1HBMA 1RT4A 3PFEA 1DY3A 1XMBA 3R1HA 2V8VA 2VFSA 3NEKA 4RW8A 4NYPA 2CDRB 5A8KA 3KKFA 4ZVSB 2H5IB 3CMAS 1VRTA 4N76A 4ZP8A 3OTOJ 4LBIA 1TK5A 2PFDA 2MB0B 3GIRA 2OTLS 4DR1J 5F0WA 3DLEB 4I6YA 4AD6A 4HACA 2GGPB 1S7IA 2D3UA 1Y0HA 2ILYA 1YJ9S 4NMXA 4S0MA 4K5RA 3N5BA 3I9ZA 2QEXS 4NLQA 2ROEA 3VALA 4RW4B 3QLHB 3HFVA 1NMEB 2BOPA 4NRTA 1F5BA 3LGNA 4J5OA 4EU0A 4ZN3A 2O5DA 3W9JA 1FDAA 3ILIA 4FF3A 5IM0B 4ILLA 3CO9A 2RH3A 3D0GE 3TI0A 2CXEA 3R2DJ 1PGZA 4ZVHA 5KFVA 1ZOTA 2XSFA 2DNQA 1FX4A 2UV8A 2ZWOA 3R5JB 1WTFA 5RUBA 1SQGA 5F9NA 5LSOA 4GMKA 1F60B 3R27A 5ETQA 2BOAA 4U7UD 5G0RB 3EGNA 1TK0A 1REGX 5KT4A 1K1SA 3DRSB 1Y5IB 1EP4A 2HWTA 4YQWA 3B4DA 2ASDA 3BR9A 3GQCA 2R2SA 2UXDF 5D15A 4P7TA 1Q78A 4ZPVR 1NNDA 4A8FA 4A8QA 3CPWR 1IWAA 4OYWA 1FNOA 4LFAJ 5GAGU 2ACMA 5L9NA 4KAIA 2CJ9A 1QSLA 2HFVA 3DMJB 3IRXB 2HIYA 2R7UA 1CBKA 2Q79A 4DQPA 1KLMB 4M94A 2H5EA 4NLPA 3VV2B 2BJEA 4U96A 3GB0A 1B0PA 1VIOA 4HDGA 3KDNA 1CQNA 4P74A 2DKOB 1DZ5A 2C2NA 2L41A 2VBXA 1RHJB 4K4YA 3AQOA 3EUNA 4WPAA 4CO0A 5AT1B 4CNZA 1TKXA 3VAGA 3VGSA 4LFBF 2BZ2A 4MYTA 1FD8A 4X66J 1U24A 4EZ6A 3LANA 3SYZA 5B0EA 1KQFB 4O3PA 1TTHB 2RT3A 2HK2A 3OXFA 1GNKA 4I2PA 4NLDA 5F3TA 1J5EJ 3DLKB 2VPZB 4DPYA 1R8PA 2XI3A 2W4PA 3SMZA 4UZCA 3PO5A 3LP1A 3AXKA 1S48A 2FJAB 1P9QC 4OX7A 3BGUA 1D3WA 3T5LA 2GO9A 2G2YA 4DX5A 1RACB 2XNQA 4X4VA 4QQBA 1YJWS 2JC1A 4DSIA 1JLFA 2JVRA 3LGHA 2R2UA 2YX4A 3DRYA 5DDOC 3M2RB 3OL7A 1MSWD 1WWHA 1NU4A 1UA1A 3Q2SC 2ZM6J 4BHQA 3DRSA 3EICA 1VBXA 1FEEA 4ZP7A 2IYGA 2Q6BA 4HR2A 3FKBA 2VFUA 3H40A 3D2WA 1EAYC 4DEZA 2G0CA 2ADCA 4OYBA 2DNNA 3FEZA 1SC3B 4HH0A 1WI6A 8RUCA 5J2NA 2NSBA 1ZA2B 3P5TL 1HW8A 3PYDA 2W2MP 1B7YB 1CQMA 2CJXB 2BRLA 1JLGA 2AMCB 2M8HA 3IRXA 1MG7A 1N0VC 3BKUA 1URNA 1UVJA 3OFGA 3GJSB 3NLCA 3M8RA 2KYXA 3KLIB 2Z56B 1SB6A 2NS1B 1NZAA 1LWXA 2GQQA 1N48A 1FVQA 1HFEL 4DSEA 2M7SA 3OTOF 1SVDA 1SJFA 3JAMU 2FJEB 2DH9A 2ZZTA 2IM0A 2B4PA 1LXJA 3RB6A 4LF9J 4DR1F 3D1QA 3TVKA 4UZBA 1Y4ZB 3G82B 2FVSA 1VQ9S 2L48A 2HNYB 2PO4A 1NJIT 1RAAB 2OD6A 4B9VA 2V8GA 1HWLA 4EYHB 4DQRA 2X1FA 3U7JA 2KG0A 3MAQA 4NYZA 2M0GB 1VJWA 1WC4A 3ET6B 5CZVA 2YQ0A 3J81U 4AE5A 1I5OB 5LJ3Y 3DLKA 3OUYB 1TL7A 2DR6A 4R8UB 2AQ4A 4DSKA 5G4DA 4LF6J 5HSPA 1GXUA 1O8BA 2KFZA 4U7UK 1S1XB 3UDVA 3CCVS 2MSSA 4C8OA 1RT6B 3R6LB 1YJUA 4U7CA 1MMLA 2OKQA 5AXLA 3ICLA 1LK7A 3DLGA 2DRDA 1X5SA 4RUAA 3V4MA 3V5RA 3I32A 1R8BA 2PDAA 4IG3B 2JWNA 1H7WA 1GX5A 4ZJLA 2KZMA 1R6YA 4NL5A 2JLFA 2YKPA 3CXCR 2WSFC 4CTAA 4IO1A 3WBZA 1VS3A 2YKNA 1VQLS 3R9LA 2W4DA 3BO3A 4LFAF 1DQ8A 4X65J 2JZ5A 3AB2B 1FT8A 2VBYA 1B7FA 1NZ8A 2IPOB 4LF2A 3M7VA 2OIHA 3MEKA 3F56A 2MZQA 3TNVA 4ZPBA 2H4WB 3PX6A 3S6EA 2YXLA 1QVFR 4KPYA 1Z4UA 1JJ2R 1AXQA 1S9EA 4E98A 4YHHJ 4X4UA 4WF9Q 3GP9A 2NPFA 3CW2C 4JI6F 3DC2A 2LXUA 1U1OA 3MR3A 2E9TA 4WXWA 4AL5A 4X66F 4ERDA 3OBIA 2OEJA 3AOCA 4MTPA 2WZ1A 5DM6Q 4X62J 2ZDOA 1KVIA 4J9UE 2V8PA 4OYOA 2HBZB 2GMHA 2OI2A 4IRDA 1MN9A 3J80Y 1J5EF 2D74B 4ZN1A 1RWWB 3SFGA 2BXJA 1YG0A 4X64J 3EZ5A 1FJ7A 1X4FA 5KT7A 3MEEB 1K0VA 3EE3A 3PKYA 4A8SA 3KLEA 2N82B 2E9ZA 2FGOA 2XMJA 4UQTA 4WP9A 4M5KA 4ITSA 4C0OC 4DF8A 2QYCA 2QX0A 3FBFA 4IR9A 4P2XA 3ZZRA 1RTZA 4N77A 3D7SB 4IFYB 1RT6A 2R7QA 2J9DE 4KRWA 2FHJD 1U0HA 5ITHA 2QO3A 1HNIA 2ZM6F 4DFJA 1OJ4A 4NLWA 2K8GA 4FN5A 4UW2A 1HPZB 2VBZA 3OD2A 3BBCA 1C1CB 3R2CJ 1RXOB 2V8HA 3BGLA 1Q53A 3TJ9A 1LKZA 4N41A 2YNGA 5C42A 2ZH2A 4ZA1A 2M9KA 3TRGA 2PN6A 1LNQA 5EX0A 2K7JA 4BLGA 3C66A 4CQ1A 5EWEA 3V6HA 1XR5A 2WVDA 2VC1A 4HEA9 1UWAA 5BYQA 1N6QB 3OVSA 3THTA 4C48A 3HP6A 1J5OA 3G6XA 3NNHA 1M0SA 2XG8A 2OPQB 5L46A 5KFYA 3R5AA 3AODA 2V2VA 1IR2A 2HHWA 4L76A 3ITHB 4RWXA 1UA0A 1PYSB 2GIQA 3VZHA 4B9MA 1HI1A 2BYCA 1FFWB 3GTYX 1AUDA 5C2GA 2DTJA 2YKMB 1H74A 3VR1A 3GONA 4JI7J 2DGXA 4CH1A 4KGXB 2HPUA 2DXFA 1R8AA 2AJ1A 2CADA 5F8HA 1JNZB 5EN1A 1L3SA 1DTQA 2AJ2A 3OFFA 1SBRA 4JV1A 2HHVA 1MWYA 1NK7A 1RWUA 3EDRB 3RR7A 1L3VA 1WKJA 2Y1RI 1G3OA 3DRXA 4LF6F 2W7PA 1F9FA 2ZH1A 1E6VA 2NXJA 2FZKB 3I0RB 2AJ0A 4OLOA 4I7FB 2HVEA 4KSEB 3T41A 1JMTA 2GMJA 2KT5A 1CG2A 4P52A 2GO8A 5F8GA 1H0HB 2IM3A 4C98A 2HVIA 2VF3A 2KO1A 4NYOA 3CT9A 4C7QA 4JUZA 4LSNA 1NPKA 1HNWJ 3M30A 5HL7Q 1KS2A 1FRJA 1JLEA 1D8ZA 3JSMA 4I69A 3MI7X 2MDAA 4PUOA 3ILLA 3KDOA 2NYIA 1KTQA 2HURA 3RU0A 4X65F 2RDDA 1C1BA 2IBKA 3E3XA 3HVRA 1C1CA 1NK8A 2YVSA 2XNRA 3CJ8A 3H98A 3KFWX 3BDPA 4JBCA 1JX4A 1TVRB 2ZKTA 1SI9A 4OI1A 4W4MA 2IA0A 1H38A 4DOZA 5KFNA 4ED8A 3HKZD 4AFFA 3NAHA 1IBLJ 4OFZA 1NRKA 3CCUS 4UOGA 3IM8A 3SZ2A 1I1GA 4FNHA 1FXLA 1WC0A 1UW9A 5DETA 1VC6A 3M32B 4PZVA 5D77A 2VDIA 3GJQB 1RB0A 3VAJA 3H2LA 2ZC3A 3MM8B 2JLGA 1NK6A 3RTVA 3ITHA 3UNYA 4Q5VA 2YBVA 2ZUGA 4DQQA 3UQSA 2OTJS 1R6VA 3HJFA 1REVA 2MKCA 1QVGR 4X84A 5KFCA 5HMWA 3SCIE 3UO0A 3W60A 2PI5A 4USUA 3DM2B 3A3PB 3OLBA 5T41A 1N5YB 2V8DA 3AJ1A 2J6TA 1LWEB 3SFUA 1ROFA 4QPTA 4ZCIA 1XNQJ 3RW6A 4LRFA 1X8DA 2HKEA 2PC6A 2RMLA 4USJC 1YIJS 3KJFB 4FVMA 2Q3PA 3RZAA 3VQTA 4ER8A 3D9BA 4M5HA 2DO0A 2VASA 3K7RA 4N8NA 5BJRA 3LQVA 3VTIA 1UWBA 1Z1ZA 4C8MA 5BXIA 2BABA 3IC1A 4HTIA 4QIVA 1L5UA 5CD4H 3IFEA 4HL9A 3HFZB 4I7FA 2UXBJ 5KOXA 4QW9A 1BQNB 4P2MA 3A1YG 4AYBD 3BKTA 1U2FA 1RHKB 3NS5A 4DDFA 2Y1IA 3TA0A 2DCLA 1TV6B 4ED0A 2DXEA 5F8IA 2WBMA 4JI0F 3MTJA 2R2TA 2QA4G 5FLXU 3W7BA 5E7OB 3LALA 2ACYA 2D41A 2ZH9A 3D54A 4NA1A 1ZTWA 2H48B 3FMWA 1RT3A 1X9MA 5E3CA 4NLYA 1GQEA 3M05A 4KIAA 1NB2A 2MZSA 3BPSP 2V6AA 2CQ1A 4JOUA 4BBYA 1QSSA 2HLUA 4F8RA 3Q89A 3CD7A 3RG6A 2KM8B 2Y8YA 5A2QY 1X5TA 2XYGB 2KFNA 3WDOA 1NEEA 2CJAA 3DI6B 5GVQA 3FSIA 2AJQA 5KG7A 4ETZA 1D8YA 1NPPA 2DK2A 5A6WA 1Y9OA 2KZZA 2W1BA 4XO0A 4PPZA 1T94A 2HRYA 2IDEA 2E1RA 4URGA 3K0JA 4BCAA 3AHPA 3M32A 2AJ4A 4Y2KA 2ERRA 1RAEB 1WHYA 2WTFA 4X4NA 3ELHA 3HO1A 2YNFA 1AT1B 3L95X 3PW4A 4YMEA 5EDWA 2KXNB 4O3OA 2APOA 4OZ3A 1TKZB 1PILA 3A8IA 3KLVA 4ZK7M 1BMQB 5H1SV 2ZD1B 1QLNA 1FK9B 4CYUB 5A8WB 2VG7B 4UTGA 1S6PB 1UPMB 4USWA 2OFHX 5I42A 3H42A 2J8AA 3DM2A 4H4MB 4ES2A 2LYVA 2HS4A 2P9CA 1M1KT 3QO9A 1S57A 4UOFA 3W5XA 4FPRA 1OMSA 1NHUA 3OT9A 2JEGA 1CC7A 3M6UA 2FVPA 1BD6A 2UUBJ 4DV5J 1RLCL 2B9XA 3L7OA 1XIQA 1HNWF 1IBMJ 1VC0A 1XK8A 2QN6B 3JYTA 1TR0A 2LFVA 3Q8QB 4TY8B 3QFWA 1GXLA 2IC3B 3VVTA 3PDNA 3CDEA 5ETTA 1LW2A 2BUNA 1X4BA 4B08A 5CYQB 1O6XA 1MWQA 3TYTA 1QDUB 3NKYA 3K5MA 5KG4A 1IM4A 4A8MP 1Y11A 1JXEA 1S4EA 2N4DA 4MJKA 4USHA 1UETA 2VQFF 1N34J 1IBLF 4OZJA 3OHAA 2C28A 2EBEA 1VDHA 4H4OB 2WONA 1JWWA 4WFNQ 1IKWA 4RZRA 2AJFE 4LRCA 2IM2A 2EC2A 3Q0AA 2ZUAA 2RSQA 3H5UA 1VR6A 2IDLA 5B09A 2F7VA 1HBOA 3M2UB 2HFZA 4ID5A 1MROB 1VJQA 3CJ4A 3BO4A 1FD2A 3CCLS 3M8SA 4N8OA 5FDLB 4WK3A 5EWGA 1FRHA 3M8YA 1SCJB 3G96A 3K5PA 2VC0A 3M8WA 2BX6A 2VFVA 3CMQA 4ZKAA 1NH7A 4WZMA 1LW0B 1U1MA 5E3AA 2WVFA 1K47A 3VZIA 4RPFA 2ZOGA 4LR9A 4ICLA 2DNKA 4LF8J 1MWZA 1WDDA 1H72C 1XNQF 5A8WA 1SKUB 4WTOB 2ZH6A 4KFBA 4O4GA 1XBWA 3QT7A 3HZEA 3KYLA 4OV6A 2NUHA 2Q6CA 2GC8A 3ONQA 5J1NA 3L7PA 1B70B 3DFEA 3FK4A 5DZ7A 2XYHB 1IKVA 1OWXA 1T95A 3JTOA 1U8SA 2HZAA 2BMBA 4OZ1A 3C14A 2AW0A 2CJBA 1S79A 2IYIA 2KRBA 2XLJA 4J9PA 3VGUA 2Y0BB 2ROGA 1U26A 1YBAA 1FERA 4RU9A 3LW5C 4F0KA 4IFVB 2WW8A 2J6UA 3IBFB 3N6MA 4CLYA 5HROA 2IC3A 2W2NP 1IJFB 3MXHP 5HLFB 1CJVB 1U2CA 4DN0A 3TAPA 1Q7YT 2VHGA 1RCXB 4TYBA 2VG6A 2CPYA 3BF4A 1H3DA 2GVZB 3CJKA 4OJ3A 3IO1A 4AXJA 4HVZA 2NXNA 1R8HA 2R7OA 3Q23A 1M90T 2IRYA 4A47A 4F2SA 1S0MA 3FBBA 4NA3A 3DN9A 2LEAA 4JYAJ 3KWMA 1HWJA 3QIPB 3O5TB 1SJ3P 4U8VA 1KP6A 1AFJA 1S6OA 2RHSB 2JC0A 3AXMA 5E3QA 4PXCA 2JFDA 4Q8FA 5KG6A 3QBCA 2BRKA 4OLPA 2MY7A 5L1IA 2J7WA 4DFKA 1KFDA 2KI2A 2CNLB 5BYRA 3FVYA 2QL9B 1HYSA 1HD0A 4KHMA 2ZVSA 2ZBRA 3QGGA 1TL1B 4WYLA 3BJYA 1ZZNA 3GSIA 1H2VZ 1S59A 4PG6A 2PSZA 2XCAA 2FHKA 3D6HB 2IFXA 2H3EB 3OJUA 1LW0A 1HBUB 2FUG9 4LBPA 1A7GE 4FXWA 2ZNZA 2AEFA 5CH7B 4CT9A 3KLHB 2LU2A 1DHMA 2W2PP 2G9OA 3KJVB 2Y8WA 2UUBF 2J9EA 2EFGA 2RHQB 4USVA 4DV5F 1UZHA 1IBMF 2KT2A 4DR6J 1VQOS 2JDJA 3MFIA 1EHWA 4LVNP 3FUYA 1RSCA 3JB9k 1H2UX 3CCQS 2DR9A 3D6TB 2DPJA 3WHIA 3BREA 1XERA 3BQ1A 1UJ5A 2WSCC 3TEHB 2PA3A 3TAQA 4IFVA 2IY5B 4QR2A 5IT9U 4J9NA 1ZM9A 3DOLA 1CJVA 1WOOA 1U1PA 2UU9J 1ACMB 4KKOB 3P8BB 4MFBA 4BC7A 3MM5A 4P10A 2DNZA 4JI2J 2ZFHA 3TZXA 5J1EA 1J27A 1HBNB 3GG0A 4KYZA 2QRRA 3PCOB 3C3LA 3KG4A 2N7CA 1VC5A 5IT4A 2VU5A 4B3MF 4Q2LA 1P6TA 4C4WA 1SJ4P 1GXTA 1BXNA 3HVTA 4NLOA 3IS9B 3B82A 3BDEA 4DPUA 1YITS 2QLWA 3HHKA 3QGIA 2K06A 3I4PA 1RT5A 4RNMA 1XWLA 3UNGC 5B08A 2V67A 4OZ2A 3I5BA 1P1TA 4PQUA 5L9XA 3RBZA 3C6TB 3FZBA 4MYUA 3W9IA 2VB6A 3HKWA 4EBEA 1WEZA 1NKEA 1TFWA 2O3DA 1HI8A 1PO6A 3Q8UA 3HCXA 1K9MT 3KOAA 4ZLPA 5CYMB 1XQIA 3C15A 1U6BA 2RQ4A 3H90A 1RQ0A 2E1AA 3QZ8A 3Q24A 1U45A 2HHHJ 5F8MA 3MDFA 1DTTB 4QOTA 1YJNS 1OQ3A 1KOOA 2FLLA 3PYEA 4HLBA 3BM7A 1YJVA 4DR5J 4C97A 2XLIA 2P9EA 2HVHA 5KFRA 5GMKa 3HPOA 4KGKA 4JB8B 4FVCA 2I9SA 2CA9A 2DB1A 1NSPA 2WK4A 3CIMA 2KH9A 3EZUA 3I0SB 1GH8A 3DU5A 4AUKA 2WSEC 4ECRA 4F4XA 1WKKA 4V1Ak 1SC4B 1FJGJ 5SZTA 2KU7A 2CVEA 3T19A 3HD2A 1RHUB 2OPPB 3LGMA 1RTHB 2BE2B 5LMUJ 4IOCQ 2LCWA 2M52A 3W8PA 1AFIA 1PJ5A 4DV2J 2U2FA 1CC8A 2XO6A 1V5IB 1CULB 1KHWA 4EZ9A 1U0SA 1RT1A 2LEBA 1RTIA 1VRQC 4I0WA 4MKVA 1C0TA 1X4AA 1QUPA 1KKHA 3VCDA 4RW9A 3MEGA 4Q45A 2FZCB 3MF5A 2HEKA 3PNIA 1S49A 1RWNB 1CLFA 3QJPA 4UY8T 3GJTB 1LFPA 4LJMA 2MQQA 2XMUA 3K57A 1VQ7S 1SL0A 4K0KJ 3M6XA 2IM1A 4CLKA 3IR6B 5A0YB 2R7TA 2V69A 3GIIA 2FLNA 4V19X 4LF7J 1UVNA 4TKTA 1LQ9A 4ZOSA 2YWWA 1SUQB 1WI8A 4P2FA 2MLZA 4G1QA 3LO3A 2ZJQQ 4Q8EA 1XC9A 2D9PA 3FBEA 1AZSA 1GX6A 2LQ9A 2W4CA 2AEMA 2BA9A 2BKPA 1V3RA 2B7CB 4P6QA 2V4JB 3C6UA 2GIFA 2CJKA 2CNOB 2E5LF 4G1IA 1TUVA 1HKAA 3GR0A 4FKYA 4OYMA 5CYMA 3D5MA 2UV8G 2RU3A 4DWIA 1A9NB 1YJ7A 2R4FA 1B99A 3N6LA 1K44A 3DRPB 4WE1B 4RUHA 4IH6A 2VFTA 3NOGA 3H25A 4M5LA 1Y5NB 1VBKA 2VBWA 3G8SA 3ZFVA 1KNZA 5C25B 2RQMA 2WBRA 4NASA 1Q8LA 5AXMA 1N32J 5E3PA 4DR6F 1RAOA 1KVKA 3RUBL 4RW7A 2ZOMA 2V68A 1B64A 3WIUA 2FC9A 2OPSA 1RTDB 1RYRA 3HI9A 1XN9A 4ETXA 3B4MA 2YWHA 1WF1A 3BSNA 1T3OA 4JI4J 5KT3A 4R0JA 4IQXA 4PG8A 4MIBA 1H98A 2CQBA 4ED1A 1TK8A 1OIAA 1FEHA 2BE2A 1RI7A 2XCPA 1VMBA 4DJBA 3QGPA 3DOMA 4JI2F 2KM8C 2OGUA 3NRBA 1KBRA 3RAXA 4PKDB 3ZTRA 2UUTA 2CQ3A 5ETNA 3IA0A 3CDWA 1WF0A 3H4DA 2CPJA 2HMIA 4ZCMA 2BVZA 1FWPA 1T9VA 1VISA 4UUWA 4X4RA 4LRAA 3HDSA 1KR4A 1NJYA 4ANDA 4IOBA 2MQLA 2CPFA 2CPZA 1FFGB 3LF0A 3PTWA 2QSWA 4IOAQ 1IKXA 4AL6A 4F0HA 3AD9C 5IC6B 1S9GB 4LR8A 4ZJOA 1PJ7A 1S4FA 3N6NA 2P5VA 4B3RJ 2V4JA 2FVCA 5KFTA 2MTLA 3DOKB 5DLGA 2MZRA 2JNJA 2HHHF 1UFWA 4N7TA 2JH3A 4P7VA 3C8YA 1LWCB 4DG1A 3QSYB 3U27A 2NXUA 3CD5A 1GEHA 2J0SD 1RBOB 3BGOP 4FF1A 2HQIA 2YWFA 1XMOJ 3QWPA 2R7RA 1HI0P 5K20B 3D3CJ 4DPTA 1CJTA 3ILJA 3MUMP 2XO7A 2HSEB 4C2MA 1QTMA 2OH2A 2L9NA 5DZ6A 2CNNB 2VL1A 2D1CA 2QYGA 4W92B 3KHRA 2R3VA 2PT0A 2RAQA 3AJ2A 3Q8YA 4OHVA 2LU1A 2ZH8A 1JJ4A 4YB5A 2CQ0A 5E0OA 1HD1A 4JI8F 1FJGF 2B5JB 2W7OA 3K59A 1MU2B 1TL4A 4CT8A 3MR5A 5HBMB 3QYYA 4LSLB 1N33J 2DNHA 5LMNF 4ZPCA 4DV2F 2Y1LB 1GMVA 2DYAA 1DJ0A 1FFSB 1F5CA 4ZLNA 1YQHA 4F3MA 4Z2XA 1S12A 4OIXA 3G8TA 4LF4F 2CUYA 2HHSA 3OW2R 1AROP 4RJVA 4I2QB 1YRUA 5EGYA 3O3LA 3V6DA 5IC4B 4C6AA 4NLXA 4PG4A 2O66A 3UWTA 4PWDB 4YB1P 1T0TV 4PEOA 1U1LA 2C3OA 2GHPA 4BWMA 4F7VA 3GYNA 4WU2A 3K58A 4K0KF 1IVZA 4H4KA 2GMLA 4DCJB 4LF7F 1HQEB 1T05B 3JXOA 3ZZTA 4O3QA 3CC2S 2VOOA 2EG2A 3G6ES 1YBUA 4DV4F 3K8VA 3HM9A 4WFBQ 1SV5B 2B3TB 3I96A 3TUJC 1EJ7L 3C16B 1RT7A 4LF5J 2LXFA 5IQQA 3QRPA 3MFHA 2U1AA 1SQEA 3F44A 9ATCB 1FTRA 4F04B 1G7CB 4DN9A 2IVYA 4LRDA 5GMEA 1LWFB 2R9LA 4DV1J 3P96A 4ZVPB 3CIZA 2G2ZA 1T3NA 2EFNA 1WF2A 4I1TA 2F63A 4ECUA 2YNIA 3THVA 1B3TA 4IRKA 3MM9B 2Z8QA 4ELVA 4FBUA 2J9CA 3ENVA 1RU1A 4QWDA 4J91A 1N32F 2CG8A 4O44B 3OV7A 4YUDA 3WZ0A 4QU6A 2D7SA 1T02A 2YNHB 4NCGB 3SSSA 3PM9A 2EFQA 4RW6B 5B0GA 4KE5A 3LP2B 4U95A 2Z2LA 4KGVB 4JI4F 4AQYF 2KVQE 1S6QA 1H2TZ 2ZDPA 4LVOP 1W2BR 5HATA 1F2GA 5DDPC 1X4EA 2AYGA 5IV3A 4HT7A 4YY3J 1IBKJ 3GYGA 4LSLA 3JS9A 3CDAA 4M5DA 2XMTA 4Y34A 3BPDA 4DPOA 3MM7B 3P5BP 1M5OC 4ECYA 4RNHA 2B6AA 5E5NA 4EUVA 4R5PA 3G8QA 3MEDA 2R2RA 5J2MA 5LSRA 1EQMA 2ATLA 3VAHA 2AP6A 1D9DA 2D69A 1Z2ZA 1QSYA 2IRXA 3CUNA 3TW0A 1Q16B 2ASJA 2XY7A 3AY0A 4NLVA 5CCLA 3L3CA 2ZWPA 4CLUA 2HAFA 3EM1A 3MPDA 1NH8A 1RWPB 2IA6A 4NZ6A 3MCMA 4NLGA 2C22A 1S1WB 1L3KA 2J0WA 1HQEA 2EKYA 2CNKB 2FHJA 5D3GA 1U25A 2BANA 4NLRA 2RQKA 4EFAC 4CM0A 3UR3C 5D0RA 3PX0A 1UAWA 2WHOA 4F4YA 1SKWA 4TYAA 5IZHA 3QT5A 5KG2A 4DX7A 4KHPF 2LECA 4B3RF 1FTCA 5HN0A 4LSZB 4PCQA 1BY9A 3Q86A 2J0XA 2DEIA 1HBMB 2MKKA 1RT4B 4XTTA 1OS5A 2HFNA 1ZM2A 2VQEJ 1FNXH 2GQCA 1MN7A 5K14A 4RW8B 3RW7A 2AV5A 4ES1A 4K5SA 1VRTB 3JSYA 3MAHA 4UQGA 1UVKA 2G2OA 3MM6A 2E66A 2F5GA 3D0IE 1H7XA 1JXLA 1WELA 1N56A 5FD1A 3A3NB 4PXBA 1ZPWX 2ZJRQ 4AXIA 5KFJA 3MPUB 2W2OP 4HACB 1UJ6A 2ZH7A 5KFLA 4M5GA 2HWIA 4DUZJ 4O44A 3H59A 1S97A 2BJDA 2K3KA 2JEJA 4HHJA 4DHVA 1HNXJ 1WHVA 2XY6A 2UUCF 4NCGA 1Y5LB 3V81A 2BEFA 1JLCA 4RW6A 2Z4PA 4ED4A 2X3GA 2DJWA 1RWVB 3QRQA 5HO4A 1VLOA 4DXLA 5KFPA 5DG8A 2BE9B 3OFEA 1VK3A 1NK4A 2ZH4A 4Q0BA 2UVRA 2PGCA 2C2KB 4KV8A 2XGPA 3W5YA 4NI2B 2NXEA 1I3OB 2RE1A 4DU8A 3FCWA 4HTJA 2E5GA 3UDCA 1WC3A 4K50A 4ZPTR 1PJ6A 4USTA 2DNOA 1EP4B 4IQMA 4DBQA 2MQMA 4L3NA 2BW2A 1UVMA 4LBHA 1KEKA 4LREA 3RRHA 2HZCA 2LQBA 2HHXA 2XS7A 2CPEA 5JXSA 3MWBA 2MQPA 4PPDA 1UJ4A 4TLQA 5KTQA 2CQCA 5HQ8A 4Q43A 3GZ7A 2BACA 1I6JA 4WU3A 3EXYA 2QT7A 1IR1A 1GTHA 4KGZB 1OSDA 4TVAB 5D78A 4G3IA 3DDNA 3G86A 3RRKA 1JIHA 3ENAA 3T1YF 4WFYA 4MIAA 1FO1A 1SH0A 5FJ4A 1ZM4A 3OJSA 2DO4A 1NKBA 4OX9J 1A6LA 3EZOA 3IMQJ 2VA2A 3BYRA 1SIZA 1VLYA 1VQNS 3Q8RB 2OEMA 3MPYA 3FC9A 3BEGB 4O3NA 2XS2A 2IHR1 2EW9A 3NS7B 2DY1A 1TKXB 4G65A 2IRUA 1V6HA 3R8YA 4CP5A 1EETA 3MOZA 4J9VA 4OZ5A 1RTJA 3K5LA 2R7VA 2LVWA 4LFCJ 3RRGA 4LRBA 4HDHA 3HX9A 4DR4J 1E6YA 4KBIA 4I2PB 3FBCA 3OHBA 1KOHA 3AQPA 2EKNA 1VQYA 4KPCA 4LMZA 4B9TA 3LP1B 1KVJA 2BJ8A 5C24B 4YY3F 1IBKF 1GAOA 3QT6A 3T6BA 3P45B 1U6ZA 1RWMB 4GKJJ 4NPOA 4U8YA 3OQ2A 1NAQA 1D0EA 4J9MA 2C2MB 1TKDA 4P71A 7FD1A 3GU0A 1JLFB 4C8KA 1EKRA 4NI2A 3GIMA 3UVJB 4G6VB 3BH7B 3FQLA 3D1OA 3A8EA 1XMQJ 2DGVA 5KFEA 2C2OB 2Y3YA 4OYZA 2O1PA 1FX2A 1LOUA 2OMOA 1I94J 4IG0A 2MQOA 4WFAQ 2J0QD 1CEZA 2C3PA 1WC5A 1F5AA 3CGIA 2R8HA 2MQ8A 2B43A 2YTCA 5J2NB 4KC5A 2QC3A 3GV7B 2CPHA 4DLEA 2XSJA 2DHSA 5GAHI 1JLGB 1QAIA 3AD7C 3MD3A 2BDPA 3QFHA 4UY85 3B8HA 3TQ1A 4IRCA 4K7QA 3BN7A 1J2VA 3J7AN 2GAHC 3T3FA 3KMQA 2PI4A 3PJXA 1WNEA 1TMMA 1KQKA 4OJ1A 1YBTA 4EEYA 4GRSA 3R1LA 2GCFA 2W7AA 1LEOA 1S0NA 2C42A 1VQ8S 1HWUA 2FHMA 3Q22A 5J2QB 2QLXA 2ILZA 4TNOA 3H4BA 2MKIA 4U6PA 2C2ZB 4M5IA 2CWKA 2J8SA 3U1NA 1SL1A 5D8HB 2F3JA 1GT8A 2QL7B 1CJKA 3LTOA 1PCAA 3HLUA 3HHNB 3EJMA 4F67A 5CD4A 1HNXF 2GAGC 2EK1A 3QRRA 2R8JA 4W98A 3JAMY 3NMRA 4CLPA 2OP5A 1Q5YA 5HAOA 3POTB 5GMDA 1TL7B 5IWAJ 4WIIA 2YQ1A 1M5KC 1D9FA 4WXOA 2HRUA 4B17A 1RAIB 5K8MA 1R31A 1N5SA 1TAUA 5C24A 4YS2A 2WAQD 1JLBA 2DR5A 5A6PA 4R25A 4H4KC 3WX4A 3D67A 3O6QA 3DLGB 3ZZPA 1UEUA 3J81Y 3GFHA 4C11A 2C3MA 4RX6A 3CJ5A 3UVJA 5J2PA 4XDCA 1WEYA 2A3JA 3KK1B 2QMXA 2M3DA 2PMWA 4CTAB 2B8QA 4FYDA 3IRWP 2MKJA 2YKNB 2VFRA 4NLUA 3RGIA 4B3OA 6AT1B 1NB7A 3BR8A 1MLAA 3NOCA 2NZ4A 4ALZA 1O51A 2CQGA 4TY9A 5LXYA 1JLAA 3CC7S 3VGVA 1N5TA 1S1VA 5J1PA 2JVOA 4NCAA 1S1UB 1S9EB 3CCMS 4OX9F 3KNGA 2HNDA 2OPRB 2FJBB 2F4VF 4M1KA 4GVLA 2FTRA 4OI0A 4RKUC 2ZITA 3BH6B 4TLRA 3PVXA 2HZVA 4N56A 1KQGB 4Y0FA 1ZAVA 5F0UA 1G4CA 1N54B 5HP1A 3T1AA 1T03B 3ZZOA 3ZZ0A 3N01A 3VAMA 3D68A 3NCRA 1P27B 1Q4RA 1IJEB 3OLAA 4LFCF 2RDIA 5THWA 5HMYA 5J2QA 2KXFA 4ZJQA 2W01A 3CTRA 4DR4F 3RR8A 2DRAA 3I4HX 1NPRA 2N3LA 1HWKA 3E01A 3NGDA 3PR5B 5I3UA 4O0IA 3TZWA 4ZITA 2MYFA 3EYZA 3CJSA 3Q83A 4WKYA 1CJUA 4ZS6A 2RDJA 4X4QA 2BJ7A 3GV5B 4DUYJ 2XMMA 2DR7A 3PFOA 2XY5A 3KLEB 3POTA 4GKJF 2ZE2A 3L7UA 4QIWD 2MZ1A 2V4RA 4CM2A 1PAEX 1JNRB 2Z2ZA 4PXEA 3W2WB 3W2VA 4K8RA 2VUGA 1SIWB 3MMBA 2WW4A 4ZLJA 2RF2B 5D0GA 4RBTA 4OI4A 3W61A 1U0HB 2FJWA 3VQSA 1HNIB 2VG5A 3S01A 1IR0A 1NHKL 2PEBA 2XLKA 1I94F 2JHEA 4CZCA 3KLFA 2Q1LA 1BGXT 4B3TJ 3KK1A 2NZCA 4NEZA 2L9WA 4K4ZA 2HLTA 3BO2A 2YNGB 5C42B 3LAKA 4WFXA 1OY8A 2DEJA 2GX8A 2M5YA 2Y9HA 2HHTA 1YDLA 5GAEI 4NXMJ 1NBEB 4RR5A 2IJNA 1G6BA 3MAAB 1YGYA 1FVSA 1J5OB 1PAUB 4CLSA 1S1UA 4PYAA 2QMUB 2JEFA 2HBQB 2OPRA 4DSFA 4F26A 1R27B 2DPIA 3HD1A 2GHWA 2YPYA 4ELUA 3R6GB 1UVLA 1M1GA 3J7YI 2EFVA 1FDBA 3HVWA 2NLWA 4PQAA 2DNRA 3UCZP 1T03A 2PMHA 1S1TA 3PHTA 4YEAA 2FQQB 2E5IA 3AOAA 5F3ZA 2YQ3A 3N9UC 1JLQA 4RWWA 1UZDA 4I68A 3A3OB 4A8OA 4WP3A 2Z57B 1UFLA 2AYEA 3QZ7A 5GADI 1S0OA 1DTQB 5DQHA 2JLEA 3HMJG 3T5JA 4IDKB 4F25A 3RB4A 3OL6A 2JEIA 2YKOA 1Y00A 4IO9Q 4K2XA 2G1HA 3JSBA 4NE9C 3MCSA 4K59A 4WP8A 2HGMA 1E6VB 2RRBA 4Z37A 2P6TA 2FVRA 3VVUA 2ZKUA 4DLGA 1VK8A 4ECSA 2MKYA 1PYTA 4M5JA 3PW5A 4WFZA 1RLDA 2WOMA 3W2WA 3TUPA 2OSQA 3U1LA 2XYPB 2V5HG 3H8YA 2DRBA 4LSNB 3TVYA 3M30B 5IFMA 2RF2A 2EG1A 4URQU 2C2DA 2KB2A 1NK0A 1JLEB 2HVZA 1N36J 1U2RA 2DHXA 3JSMB 1Q5VA 1RWKB 4NLTA 4PUOB 4ZIVA 5B0FA 1OY6A 4RUCA 4H54A 2L9DA 3HHLD 3SV3A 2EWHA 1DLOB 3CCRS 3T6JA 2G0IA 3IAS9 1C1BB 2ZBPA 3L4BC 4QIEA 2GHVC 2GNKA 3SQOP 4YOEA 1Q79A 4OI2A 4CWBA 1Z2LA 2ASYA 4CDIA 4IH7A 3PACA 3GWCA 2CIMA 3PHEA 3BGRA 4QPXA 3M8PB 4FS1A 4DV6J 2XQCA 1FXRA 3IG1A 2RKIA 2AZ1A 1X9SA 2VICA 3CJ2A 2J5AA 2W8LA 3MAAA 4DCPB 4OYPA 4C3KA 2GFFA 3EGVA 2CWXA 1EARA 3KK2A 5KT2A 2FB0A 2QMWA 1SKRA 4KH0B 4J9LA 4QYZJ 4ENOA 2MJNA 2J76E 4KJIA 1N52B 1RWXB 3LWMA 4ECTA 4DV3J 1IN0A 1ZM3A 1TMJA 2I5JA 4LF9F 1PIEA 1YJTA 1WC1A 1REVB 1X31C 4DSJA 3R5CA 4ATNA 2RD5C 2KXHA 1YWXA 4KO0B 3HULA 3HJVA 2MHNA 3F0NA 2RNEA 4DL7A 1EQ0A 1DQAA 1K8AT 3MECA 1EB0A 2P8IA 4DUYF 5KG1A 2W9BA 4K4SA 2YWEA 4ED3A 2EK6A 4IDKA 4QR0A 2KTQA 3ZTPA 3KNAA 2CZ9A 3KLGB 3K8WA 4L6V3 1T9XA 1UWBB 4B3SJ 2XI2A 4CO4A 2E7VA 2NYHA 1VQ4S 2QA4S 4OX8A 5MAOA 2QJ3A 5DM7Q 1VBYA 5C5JA 2CZVC 2D3ZA 1UW4A 1JB0C 3DRRA 2FVQA 2ASLA 2XEXA 2H54B 1HWIA 3H2VE 2DIVA 3MPVA 3D1HA 1PBUA 4B3TF 3CJTA 2QZ8A 4D3HA 1RT3B 4M8LA 3KUHA 4DS4A 2ROPA 1IQTA 3V4IA 3CD6S 1DLOA 1ZH5A 4QWEA 3R7SB 3U1MA 4F36A 1QAYA 3MTKA 2CPDA 1Q82T 1BC6A 4NXMF 1WDTA 4J9QA 4FPIA 3ISZA 5FLXY 1YI2S 1L3UA 2DGQA 2UP1A 3LP0A 2DH7A 3M8PA 3OL9A 4YHHF 4DX8H 1EIYB 2FGCA 1X4CA 5DGAA 5IS2A 1NDKA 1VFJA 5ADZA 3HXMA 1WJ9A 1H6KX 1ZTTA 2X51A 5DS7A 1HNVA 3JTPA 3I82A 4KH1B 4NX9A 2H65B 1HIYA 1HHSA 2HIQA 1Y7PA 2YNFB 3MR7A 4X62F 3TR5A 2MGZB 3EMTA 4OYIA 4O3SA 1IKYA 2V9WA 4ELTA 5L38A 3R5BA 4Q2MA 1ZYQA 2O01C 4B9LA 2QL5B 3WC2A 5I42B 4WZQA 4X64F 4KO0A 1HMVA 1PKUA 2YH0A 1R7IA 3CEDA 2R8GA 4FBTA 3QO9B 1ZAWA 2E9RX 4NWBA 5F8JA 1RAHB 2QG9B 1Q8BA 3SEOA 3DYAA 1OSCA 3RJMB 2QE5A 4C9DA 3SDEA 3LA0A 1Y3KA 3KLGA 3QJJA 2FC8A 1AW0A 1WEXA 1VQ6S 3TUZC 1IM6A 4FYVB 4FF2A 2HGNA 1CS4A 5H9FK 3JYTB 1ZETA 1N36F 1FJCA 1PC4A 2W24A 2RS2A 2EI5A 1LW2B 2HFOA 1QE1A 1HQUA 5AXKA 4NMLA 3G2XA 2I0XA 5L39A 2EFOA 2FIUA 3I31A 5T7LB 3AD8C 4KTQA 3DGPB 1TELA 3OPKA 2QV6A 2HHPA 2AZ3A 4U67Q 3PKMA 1VQMS 1TU0B 4DV6F 2OSRA 1VI7A 4GVBB 3RBDA 1MW7A 3NWRA 1TUWA 2WONB 5ETMA 5DRKA 2V94A 5A8RA 1KD1T 2X1GA 4ZVOB 1IKWB 2QFIA 2PIIA 4I67A 1VCTA 3H0PA 1RKJA 3CMES 3K17A 1G2EA 3IR7B 5HJYA 1HBOB 1FHTA 3AA8A 2F8EX 2KHCA 3IR5B 5D0EA 2GJ2A 3UN3A 2OUGA 4DV3F 4ID5B 2E1PA 2I6WA 3VAIA 5HQMA 2D3O1 3SQGB 3FFIA 4JI7F 3NBPB 1VYAA 1U4BA 3R7NB 2DH8A 2MKHA 3ENWA 3KG1A 4ZHRA 3NAIA 4NA2A 3FCHA 3IN5A 4CI0B 3D0HE 2HHUA 3I5CA 2MGZA 4ICLB 5D6GA 3OR1A 2HRTA 1U8WA 1FXDA 5IV4A 2I8EA 4PABA 4QIFA 4KFBB 2WRMA 4O4GB 2DHAA 2P6SA 1YVFA 2AF6A 5K8PA 4B3SF 1R0AB 1IKVB 2R8IA 3C14B 4QYRA 4EBDA 4CLLA 2ZC4A 1TL3A 1HW9A 2CRLA 1K1QA 4CH0S 4F4KA 1TP7A 2HVDA 1NJZA 4E0DA 2WB4A 5HROB 4PAAA 3G71S 2EPIA 4OI6A 5KAKA 4ZLLA 3NL0A 3M6WA 4F4WA 4JI6J 3R97A 5BYSA 5KFOA 2A2CA 5T7LA 2VG6B 2GV1A 3R7BB 1T8EA 1ZZFA 3CJKB 4YR0A 3DGPA 3PJ9A 5KFIA 2UZAA 4CO1A 3KHLA 3N5FA 2KFYA 3EVOA 1U1KA 1N88A 4I6AA 4USIA 3SSRA 3MR6A 1BUXA 4GVBA 3HT3A 3DLEA 3B54A 2BV3A 2GGPA 2B56A 4QWAA 3PW2A 1X4HA 2J9DA 3VAKA 4YFUA 1RZMA 3I55S 2ZVIA 3M9NB 4IYQA 4RW4A 1X4GA 1XR7A 3QLHA 1KHVA 5MLCV 3OTDA 1LFWA 2AU0A 2QLFB 1YTYA 5IM0A 2KT3A 1HYSB 3AT1B 1QY7A 1L3TA 2YX1A 1U48A 3P6YC 3MUTP 3SQGA 3NBPA 3QT8A 3CCJS 2NSCA 2DD8S 5KFFA 2HAIA 3NNAA 1S72S 3FDSA 1JQGA 2VIHA 3DLBA 5CCMA 1F0XA 4YDXA 3QPIA 2H5JB 4ZVTB 2Q66A 5G0RA 4TN2A 3NY0A 2ZH3A 4I4BA 2G1DA 2AKWB 5D4PA 3MD1A 3VAFA 1FRXA 4MMOA 1U49A 1Q86T 1U7LA 3ZTSA 4EBCA 3H5XA 5D4NA 4ZPAA 1U47A 2OMLA 4YDDB 2MXYA 3T9NA 1R0AA 2RS8A 4CH7A 4DMZA 4FDFA 2UXBF 2VKRA 1HL6A 4LT6A 2KVIA 3DMJA 2GVDB 1KLMA 2JL9A 4GO5X 2DNYA 2F8HA 4F50A 3HT0A 3N79A 2LQ5A 1NJWA 1Q8IA 4DL2A 4PWWA 2DNLA 5ETLA 1D9AA 3DOLB 3KHGA 3UD5A 2WVCA 4MFBB 1R0CB 2YPZA 2GIRA 2W9CB 3MM5B 2XZTB 1RE1B 3AOBA 4RUBA 5J1EB 1M5VC 3BKFA 3WC0A 4MKAA 3TVZA 3HVTB 3MPWA 3ZTQA 1FKOB 2HS3A 4J7CA 5IT9Y 2KHDA 4HI2A 5EX3A 1GMWD 1M5PC 2ZBQA 5ETPA 2DCUB 1RT5B 4PR6A 3UN5A 4WJBA 4MAKA 3GR1A 1UTAA 1YSJA 5CZXA 4PQUB 3R5GA 4K4TA 2LA4A 2BKOA 4WTYA 4O4RA 3SCJE 3TA2A 4RBUA 4LUBA 3W9HA 1YK9A 3C15B 3FGVA 1DRZA 4DQIA 3PY8A 2B9WA 1VGYA 1N0UA 5SUHA 1WG5A 3QAEA 2D9OA 3M2RA 3TX8A 5CHCB 3N0VA 4TQSA 3ULHA 5D4OA 2ZNYA 4A48A 1WOSA 3SCKE 4CCHA 1N8RT 2ALZA 2QSFA 2DHHA 2M2BA 1QM9A 4NZ7A 1XR6A 1BQMB 2YKAA 3FSYA 3OVAA 5GAGI 4LIRA 3W62A 2DGOA 4GKKJ 3QAUA 2FJVA 3B78A 4KY3A 2A2DA 2GVDA 2JSXA 3ZZZA 5DGBA 4WIQA 1K0TA 1UVIA 3HF5A 1RU2A 1VQ5S 3PEHA 3KLIA 1RT1B 4QIGA 1T9WA 1RTIB 4WKRA 2H4YB 1C0TB 2RQCA 4RW9B 2FY8A 3MEGB 5M2PA 3GFYA 4WYWA 2W9CA 4TU9A 3G82A 3R5DA 3W63A 1XTZA 1N34F 2VA3A 2HNYA 5I3QA 1OY9A 1RHRB 1YHQS 3IWLA 1ULRA 5L8RC 1UEKA 2KN4A 5KFKA 1RAFB 2BQUA 3RBXA 1FKOA 2BQ3A 2ZJPQ 2MSTA 3OSNA 2V2KA 1RADB 4DFPA 1F6TA 3ET6A 3TJ8A 5ETRA 2FY1A 1LV5A 4WBFA 4G1QB 4J37A 5H9EK 1YKWA 5K8NA 1RA7A 3OUYA 5CABA 1FE0A 4DV7J 4R8UA 3I87A 4FXDA 1AZSB 2YWGA 3K89A 2ADBA 1S1XA 3C6UB 3OTCA 2R7XA 2MZTA 2KRRA 4XDDA 4TQRA 2BBEA 4OZNA 5FIIA 3RB3A 2VDHA 1P9YA 4BC9A 1QAJA 1FWLA 5C2CA 1M5SA 4ED6A 4LF8F 1IBCB 1FRIA 3ZC4A 4IG3A 4JI0J 1YRTA 1V3ZA 1FF2A 3K5OA 4X4PA 3K5NA 2VJVA 3TOQA 1UFKA 2EVZA 1KFSA 1UEVA 4ID8A 2E29A 2ZHOA 1S9FA 3Q8SB 3A4TA 2XTJP 3VF0B 4RW7B 1BE4A 1RJJA 2OPSB 4DL6A 2AIRB 1BQMA 3GIKA 6FDRA 3OR2B 3N28A 5JJBA 4DPWA 1KWMA 2A10A 4R0EA 4X2BA 3UE2A 2N7YA 4NRUA 3PXGa 3GFZA 2CKWA 5H9FJ 3OTEA 3LWLA 3ZO7A 5KG5A 3QNWB 4NCBA 2HW3A 2VOPA 4AL7A 1RUSA 3IP0A 3J7ZT 3J80U 3DOMB 3KUGA 1V5VA 4CIOA 5M2UA 1RK8A 3QJLA 2DNGA 1C4AA 4ECQA 1X4DA 3NGKA 2HMIB 4JYAF 2V63A 3ZNJ1 4L73A 2Z30B 3AJDA 1FDDA 7AT1B 3M4XA 2BM0A 2R7WA 3EGWB 4M63A 4JI5J 4K4VA 2WVEA 3QGHA 1SH3A 3SIPB 2F65A
chains in the Genus database with same CATH topology
1RHKB 1RWKB 2H51B 3P45B 3D6HB 2HBRB 3D6FB 1RWMB 1RWNB 3EDQB 4ZVUB 1RWVB 2CJXB 2QL5B 3GJTB 1QDUB 3KJNB 2C2MB 3GJRB 2FQQB 3R7SB 1BMQB 2C1EB 1NMEB 2C2KB 4LSZB 3GJSB 3R6LB 4JB8B 1QTNB 2CNKB 3P4UB 2H48B 4ZVOB 1I3OB 1SC1B 3QNWB 1GFWB 2C2OB 4ZVRB 4DCOB 1F9EB 3RJMB 2Y1LB 3KJQB 3NS7B 5IC6B 1PYOB 2C2ZB 2QLBB 4ZVPB 2P2CB 2DKOB 2QL7B 2QLFB 2XYHB 1SC4B 3R5JB 3D6MB 2HBZB 1RHJB 1IBCB 1RHUB 1ICEB 1RHQB 2H4YB 2CNOB 2XYGB 4DCPB 3EDRB 3KJFB 1RWWB 2QLJB 2CDRB 2Y0BB 1PAUB 5IC4B 2CNLB 4ZVSB 2H5IB 4ZVQB 2HBYB 3IBCB 2H65B 2CJYB 2QL9B 1RHMB 3R7NB 2XZTB 1RE1B 2HBQB 2XZDB 2XYPB 1RWXB 2H54B 3R7BB 5K20B 3IBFB 1RHRB 2H4WB 2H5JB 1RWPB 4ZVTB 1I51B 1RWOB 3SIPB 1SC3B 2CNNB 3R6GB 4DCJB 3GJQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHK B;  1RWK B;  2H51 B;  3P45 B;  3D6H B;  2HBR B;  3D6F B;  1RWM B;  1RWN B;  3EDQ B;  4ZVU B;  1RWV B;  2CJX B;  2QL5 B;  3GJT B;  1QDU B;  3KJN B;  2C2M B;  3GJR B;  2FQQ B;  3R7S B;  1BMQ B;  2C1E B;  1NME B;  2C2K B;  4LSZ B;  3GJS B;  3R6L B;  4JB8 B;  1QTN B;  2CNK B;  3P4U B;  2H48 B;  4ZVO B;  1I3O B;  1SC1 B;  3QNW B;  1GFW B;  2C2O B;  4ZVR B;  4DCO B;  1F9E B;  3RJM B;  2Y1L B;  3KJQ B;  3NS7 B;  5IC6 B;  1PYO B;  2C2Z B;  2QLB B;  4ZVP B;  2P2C B;  2DKO B;  2QL7 B;  2QLF B;  2XYH B;  1SC4 B;  3R5J B;  3D6M B;  2HBZ B;  1RHJ B;  1IBC B;  1RHU B;  1ICE B;  1RHQ B;  2H4Y B;  2CNO B;  2XYG B;  4DCP B;  3EDR B;  3KJF B;  1RWW B;  2QLJ B;  2CDR B;  2Y0B B;  1PAU B;  5IC4 B;  2CNL B;  4ZVS B;  2H5I B;  4ZVQ B;  2HBY B;  3IBC B;  2H65 B;  2CJY B;  2QL9 B;  1RHM B;  3R7N B;  2XZT B;  1RE1 B;  2HBQ B;  2XZD B;  2XYP B;  1RWX B;  2H54 B;  3R7B B;  5K20 B;  3IBF B;  1RHR B;  2H4W B;  2H5J B;  1RWP B;  4ZVT B;  1I51 B;  1RWO B;  3SIP B;  1SC3 B;  2CNN B;  3R6G B;  4DCJ B;  3GJQ B; 
#chains in the Genus database with same CATH topology
 2DT9 A;  2VPY B;  2HG4 A;  4FYX B;  3EDQ B;  3MEE A;  2NQP A;  1X7V A;  2B4U A;  3MGJ A;  3KJN B;  2HHQ A;  2AHO B;  1IKX B;  1WHW A;  3D3B J;  2XM3 A;  5HQL A;  5F8L A;  2ZZN A;  2G13 A;  2EBG A;  2O67 A;  3SV4 A;  2R42 A;  4OJH A;  4I56 A;  4ZCK A;  1SPB P;  4OYX A;  1W26 A;  2P9G A;  2J7K A;  3FRZ A;  4NEY A;  4IFY A;  4DG1 B;  2C3Y A;  4JP8 A;  2CAJ A;  3HHE A;  2CQ2 A;  2XHC A;  4Y2M A;  1RHQ B;  3UN2 A;  2IVF B;  1SL2 A;  1CJT B;  2G0J A;  2PFF B;  4UOH A;  1HPZ A;  4TU7 A;  2ZH5 A;  2AT1 B;  1U02 A;  3ILO A;  4P72 A;  2HQC A;  2W25 A;  2L08 A;  4ZVQ B;  4PXD A;  4HKQ A;  4DF4 A;  9RUB A;  4RNO A;  1VOM A;  3I9V 9;  1NDL A;  5AJ3 J;  1X0P A;  2XZW A;  2J7U A;  4KHR A;  4GKK F;  3GMG A;  2DBB A;  1TL5 A;  3M6V A;  3P3D A;  2Z2Y B;  3QQC D;  1NSA A;  1FDN A;  1NLK L;  3E2E A;  2HBR B;  2VQF J;  3AFG A;  2OO4 A;  5DQI A;  4K4X A;  2Y1J A;  3OR2 A;  2ZBC A;  3FNN A;  1N6Q A;  2AD9 A;  2GA7 A;  4K4U A;  1X0F A;  3EGZ A;  2LA6 A;  1U1R A;  4C3L A;  2OPQ A;  4CLW A;  2HNZ B;  5A76 A;  4IUF A;  4C8Y A;  5KG3 A;  3CSK A;  1GFW B;  2BW7 A;  2UU9 F;  1P1L A;  4FF4 A;  8AT1 B;  2ZHA A;  2XWY A;  2UVW A;  3V6D B;  3TZY A;  2F1F A;  2YKM A;  4BWJ A;  4DZ6 A;  1A0O B;  4D3G A;  4C8Z A;  3LUY A;  4LR7 A;  3D66 A;  5HVG A;  1SH2 A;  1B4S A;  5B0D A;  1KC8 T;  3I56 S;  1DAX A;  3FZ2 A;  1O0P A;  2E5H A;  4EMD A;  3SI8 A;  1KN6 A;  2VH7 A;  1NJX A;  1IXK A;  3J7A 1;  2AX1 A;  4MKB A;  2POK A;  2NR0 A;  2RUS A;  2M70 A;  4Z7C A;  3ETO A;  4DV7 F;  2QTW A;  3V6J A;  4M5M A;  3KXD A;  6FD1 A;  2FJD B;  1NHV A;  1RT7 B;  4DV0 J;  2C3U A;  4DU7 A;  1RBA A;  2E1M C;  2MJU A;  3PYG A;  3I0R A;  8ATC B;  3GJR B;  4F0M A;  2R8K A;  2LMI A;  1ITP A;  2B4V A;  3ZNU A;  1XEZ A;  2MZJ A;  2K1R B;  3CJ3 A;  2HQF A;  3CJQ A;  3H5S A;  1VBZ A;  2YNI B;  3EVW A;  2AGO A;  3UPF A;  2DIT A;  3AB4 B;  2HK3 A;  3CC4 S;  1NDP A;  4EI2 A;  3OSP A;  3S7R A;  4DR5 F;  2BJ1 A;  3GPA A;  2LDY A;  2XUL A;  3QAT A;  2UUW A;  2AYB A;  4B9U A;  4K2J A;  2W2Q P;  3UR0 A;  4J9R A;  4KT0 C;  1VQK S;  2Y0S D;  5CAA A;  2CQI A;  4P9S A;  1KSP A;  1TVR A;  1RP5 A;  3SCL E;  1DQ9 A;  1S6Q B;  1UKU A;  3CDB A;  3W65 A;  2CJQ A;  3W66 A;  3G4S S;  3IAM 9;  3H2U B;  1AUS L;  5LMU F;  2CG4 A;  4M5D B;  4FYW B;  2IMW P;  3GIL A;  4ECW A;  2SXL A;  5KFG A;  3D28 A;  1PBA A;  4OYA A;  3CB4 A;  4PYD A;  2B6A B;  1T11 A;  3TA1 A;  1WG4 A;  2FJX A;  2CQH A;  1QTN B;  2HNZ A;  1FES A;  2ABY A;  4R5P B;  3MED B;  3MM8 A;  2BKN A;  2JRS A;  5J2M B;  3DHX A;  1XNR J;  1HHT P;  2CZ4 A;  1BWE A;  4DPX A;  2OEL A;  3NGT A;  2DXD A;  1HA1 A;  1PSD A;  3D6M B;  4XPC A;  2VZ9 A;  1HNZ J;  3SBM A;  4JI5 F;  4N47 A;  2ZHB A;  3X1L B;  2M8D B;  4I64 A;  3I6P A;  2JOQ A;  5JMN A;  4ZPW R;  4DI6 A;  1N5Y A;  2OFG X;  5D3G B;  3OXG A;  2BAN B;  3IBC B;  4FKX A;  1LWE A;  2OEK A;  4V19 J;  3T1H J;  3IGV A;  1Q1K A;  3ZZU A;  2WCX A;  3HHL B;  2KDO A;  2VOD A;  4DL3 A;  3BZQ A;  4C8N A;  3PRB A;  3G6Y A;  1AYE A;  1MNE A;  2BE7 D;  1C2P A;  3BQ2 A;  5K14 B;  2Z2M A;  3MMJ A;  3N4W A;  1RAJ A;  1YZ7 A;  1NKC A;  1BQN A;  3UD3 P;  4YP3 A;  2MKS A;  2WB1 D;  2CPX A;  3R3T A;  5L1K A;  2K1R A;  1TV6 A;  3MM6 B;  1SC1 B;  2MPU A;  2GS8 A;  3UCU P;  2F9J A;  3L09 A;  1SJ1 A;  5A2Q U;  1WG1 A;  2P2C B;  3EVM A;  2DGW A;  2XMK A;  3NMA A;  2DR8 A;  5AJ3 F;  4RLE A;  1V3S A;  1WAC A;  3H20 A;  4O3R A;  2MMY A;  3EXC X;  2LDI A;  2LQJ A;  3DLL Q;  3NGR A;  3V81 B;  1JLC B;  4B3M J;  2E1C A;  2N4C A;  3HZG A;  1U1N A;  2F40 A;  3CD0 A;  2C2R A;  5F9L A;  2DIU A;  2F8M A;  3DDI A;  4GC7 A;  2ZZM A;  3DI6 A;  4Q0B B;  3JQM A;  3AH6 A;  1IQZ A;  1CPZ A;  2V34 A;  1ZA1 B;  4ECV A;  4KV8 B;  3TAN A;  2PEH A;  2NUU G;  4M95 A;  1OQ6 A;  2OLW A;  3P49 B;  3IXQ A;  3KTQ A;  3QSI A;  3PW7 A;  5KFX A;  3OTB A;  5DDR C;  1YLX A;  1TKZ A;  1PYO B;  2IMO A;  3DDK A;  3T5H A;  2ZD1 A;  3H7H B;  3US5 A;  1FK9 A;  4CYU A;  3BGF A;  2VG7 A;  1S6P A;  3KHH A;  1P8G A;  1FKP B;  2KJV A;  3W64 A;  3WX8 A;  3WIV A;  2AGQ A;  4H4M A;  1EZZ B;  2E7W A;  5K9F A;  2LLZ A;  4DV0 F;  3VGT A;  5GAH U;  2KJW A;  2HYI B;  1QAX A;  1KQS R;  1AA1 B;  4ES3 A;  4A8W A;  2FHO B;  3HHL A;  2VJU A;  2JX2 A;  5H9E J;  2MQN A;  1NXI A;  4MK8 A;  2XMA A;  3AA9 A;  1OPI A;  3M2V B;  1X5O A;  2GJI A;  2K3I A;  2V9K A;  3TAR A;  2NCK L;  2YKQ A;  3OFH A;  3JQK A;  4TY8 A;  5DO2 A;  2Z0G A;  5KFS A;  3CWJ A;  1W2I A;  1EET B;  1XMO F;  5HJX A;  7FDR A;  4RL1 A;  1RTJ B;  4FZV A;  1TQL A;  5CYQ A;  4P2S A;  2A6M A;  3KUE A;  2W9A A;  4FYY B;  4LIW A;  2KG1 A;  4DFM A;  2I2Y A;  3PIP Q;  1E6Y B;  3FJ2 A;  2HFU A;  1OYD A;  4YB7 A;  5B7W A;  1ZAX A;  5LL6 d;  1MMN A;  1U6F A;  3U02 A;  2VPX B;  1DFD A;  3PEJ A;  1RKI A;  3A8J A;  5B0B A;  2DHG A;  1RIS A;  2EXU A;  2COL A;  5LJ5 Y;  3DGV A;  4H4O A;  1N33 F;  2JFK A;  4A8X A;  2DIS A;  2CJY B;  3EWG A;  1R0B G;  2DGU A;  3PW0 A;  1FRK A;  2EFP A;  3UFC X;  5KFD A;  2KL8 A;  2CDQ A;  3NG8 A;  1S99 A;  1QJH A;  5K8O A;  3UDE A;  4PRF A;  1URR A;  2FPH X;  5KG0 A;  3M2U A;  4DR3 J;  1MRO A;  1XNR F;  3L9Z A;  5FDL A;  1S76 D;  4JV0 A;  3BYP A;  3M8Q B;  3RAQ A;  5E41 A;  1T9T A;  2QA1 A;  1M1H A;  4WCE Q;  1N5V A;  1HNZ F;  4ILM A;  3F73 A;  2E5L J;  1DUR A;  4IG0 B;  3EX7 B;  1SJR A;  3QWU A;  2UXC J;  1JKH B;  4DCO B;  2OJ3 A;  4DR7 J;  4A8K A;  3A8K A;  4HYK A;  1UL3 A;  3T1H F;  4ZP6 A;  1RA6 A;  2DY9 A;  1FKP A;  1UPP A;  4NLS A;  2XHW A;  3Q2T C;  1U09 A;  1R8C A;  4RO0 A;  4DL0 C;  2XSJ B;  1IUJ A;  1D1U A;  3B6B A;  2E44 A;  1KTV A;  4LF5 F;  4NOH A;  5ETK A;  2QIF A;  3CJ0 A;  3VHQ A;  5IQ6 A;  4L75 A;  4QYZ K;  3FQK A;  4DL4 A;  3CJR A;  4Q44 A;  2XZD B;  4DV1 F;  5JVG Q;  5KFQ A;  4CO2 A;  3SXL A;  3M2V A;  4ZDN A;  4C3M A;  2V2Q A;  2HQD A;  1JJC B;  4HI1 A;  2RUG A;  4X4S A;  2A0F B;  1CSJ A;  3HHD A;  1F3F A;  3NXZ A;  3PO4 A;  3J81 j;  4LQ9 A;  3KG0 A;  2B7B B;  5HLF A;  3AAW B;  3PYF A;  5BR8 J;  3ISN C;  1WHX A;  5DG9 A;  1VRU B;  4QCL A;  1CJK B;  5E3R A;  4B02 A;  4RNN A;  5HVH A;  3OVB A;  1XJW B;  3JSR A;  3MZI A;  1HR0 J;  2GVZ A;  3G9C A;  4XIU A;  3GLJ A;  3RAM A;  1Q7L B;  2X1A A;  1VQS A;  2D3O R;  1UP1 A;  3Q8P B;  1RBL A;  4OI3 A;  2HFS A;  1EKS A;  4DL5 A;  4DS5 A;  3NGU A;  3QIP A;  1S6U A;  1JXV A;  4MK9 A;  3UW1 A;  1SQF A;  2MEW A;  2OHD A;  3CDU A;  1JLB B;  4LQ3 A;  2IJR A;  3CNQ P;  2RVJ A;  4ANE A;  3HFK A;  4EWT A;  4ED5 A;  1V9O A;  1F2H A;  2LXI A;  2IVM A;  4HT5 A;  4GO7 X;  4C11 B;  4F4Z A;  3GG1 A;  4LF1 A;  3CCZ A;  3NWG A;  5J2P B;  3M8Z A;  4UF4 A;  5CQG A;  4PG7 A;  3QID A;  5I3P A;  1OYE A;  3M8Q A;  1TL1 A;  4K4W A;  5EWF A;  3ADA C;  4Y28 C;  4B3O B;  1C4C A;  2E7X A;  4G1P A;  1WD6 A;  4QR1 A;  3J7Z 5;  2X7I A;  3TO8 A;  3BSO A;  1HBU A;  3TQE A;  3HK2 A;  1JKH A;  1JLA B;  2B0G A;  3BBF A;  1S7H A;  1F9H A;  1GTE A;  4Y2A A;  2JJ4 D;  4NXN J;  2DNP A;  5GAE U;  3KLH A;  1S1V B;  3BB5 A;  1T7P A;  1W7W A;  2CPI A;  3KJV A;  2BJ3 A;  1ZPV A;  2RRN A;  4EK2 A;  2GW8 A;  1YZ6 A;  5AE1 A;  2HND B;  2DVI A;  3T5K A;  3IWX A;  2YY3 A;  3MR2 A;  3M9O B;  2F9D A;  2VQE F;  3PV8 A;  2H9Z A;  2RB7 A;  2HBY B;  1S10 A;  1FRL A;  3UD4 P;  4JI8 J;  4J90 A;  5HP1 B;  1N4L A;  3DLH A;  3X3U A;  2MY8 A;  3J7Y U;  5KFB A;  2YH1 A;  1EX8 A;  2NXC A;  5LMN J;  2H1Y A;  1X5P A;  3ISN D;  4JV5 J;  2CQ4 A;  2B4O A;  5C7P A;  2B9E A;  1BHN A;  4JI1 J;  3CCS S;  4OV1 A;  4LF4 J;  3V6K A;  2QGF B;  2FLO A;  3C46 A;  1DAR A;  5GAD U;  1RGV A;  2ZBI A;  3E01 B;  4DUZ F;  1VRU A;  4KKO A;  2OAU A;  3E51 A;  5I3U B;  3CO0 P;  1S5Z A;  1R43 A;  1F3V A;  3K2Y A;  4XK8 C;  1CJU B;  1HBN A;  4OQJ A;  4ZVR B;  4ZVE A;  3CCW A;  4FP9 A;  1NO8 A;  3NCP A;  1JJH A;  5ETO A;  1SKS A;  1IWG A;  2ZE2 B;  1X9W A;  2XGQ A;  4YR3 A;  5KFA A;  4MT1 A;  3IS9 A;  4N5S A;  3W2V B;  1HAR A;  5DG7 A;  2VON A;  2X1B A;  3MMB B;  1TZ0 A;  4DV4 J;  2V50 A;  4DR3 F;  1H73 A;  4ED2 A;  2RJZ A;  3M9M B;  4MK7 A;  2VV5 A;  2UVU A;  1OO0 B;  1FJE B;  2HQG A;  1NM2 A;  4QWC A;  4MIW A;  3C2P A;  4YB6 A;  3C6T A;  4WK1 A;  2VG5 B;  4L74 A;  2A1B A;  3BS9 A;  3DNC A;  1SXL A;  3KLF B;  3RBE A;  4ILR A;  4W90 B;  4BDP A;  3MCN A;  2UXC F;  3D6F B;  1YRX A;  3V2U C;  4DR7 F;  3EPI A;  4KGM A;  4ZIW A;  5DLF A;  3HVA A;  1NK9 A;  4XPE A;  1RT2 B;  3TEG A;  2UUA J;  2K7K A;  1DTT A;  2E5J A;  3TAM B;  3HSJ A;  1AB8 A;  2EC0 A;  2B51 A;  4EGL A;  4IKA A;  3FEX B;  5IOL A;  3PRD A;  3CF5 Q;  4Y2I A;  3GCX P;  3DU6 A;  3RYL A;  2RIJ A;  4RBV A;  4URS A;  5LOQ A;  3CVK A;  5AE2 A;  5ETV A;  3FSX A;  3FRY A;  4J9O A;  4CO5 A;  4J9S A;  2GZO A;  3I0S A;  2EEY A;  2QFJ A;  5D4L A;  3DXB A;  2Q43 A;  4CLF A;  4AQY J;  2CQP A;  3SSQ A;  1RAG B;  3DCA A;  1W25 A;  3KK3 B;  2M4M A;  4KQZ A;  5BR8 F;  2OD4 A;  2OPP A;  1S1T B;  2MHE A;  4QZV B;  3PZP A;  4WWS A;  1RTH A;  2NRE A;  3PX4 A;  1TFY A;  3T9Z A;  2IJF A;  1JLQ B;  1APS A;  5CA5 A;  4IH5 A;  4QWB A;  2YWK A;  4USM A;  1C0U B;  1U1Q A;  1CUL A;  3PR4 A;  2H51 B;  1HR0 F;  3UI3 A;  1FWK A;  3PG9 A;  3O8W A;  2DGS A;  4DQS A;  2LEP A;  4U9R A;  5CYJ A;  3MUV P;  2A18 A;  3CE8 A;  5KT6 A;  5LXR A;  2FZG B;  3P4U B;  2J6S A;  2CVI A;  3TUI C;  3S8S A;  2ZEJ A;  3M1V B;  2A6O A;  4OHX A;  4NZ0 A;  1YJR A;  4JV2 A;  2CFX A;  5A0Y A;  3GE9 A;  1Q0N A;  5AXN A;  1Y3J A;  2WOM B;  4OMF G;  3NGS A;  5L1J A;  2VKZ G;  4F02 A;  2CYY A;  1SUQ A;  2PMZ D;  1KLN A;  3FCV A;  2XMW A;  3GCW P;  4JI3 J;  2XMV A;  5KFW A;  1WTB A;  1XMQ F;  4Y00 A;  3BQ0 A;  4KHP J;  4Y3C A;  4L72 B;  1DBD A;  3IGN A;  3TX0 A;  2FYX A;  3IWN C;  3PJW A;  4OHZ A;  2DNM A;  1LK5 A;  3HHL C;  3BV8 A;  4HHU A;  3GFX A;  4CLZ A;  4NXN F;  1NUE A;  3DRP A;  3FMB A;  4WE1 A;  2PD1 A;  1NSQ A;  1KON A;  2V0N A;  1RT2 A;  3TAM A;  3BGR B;  4TXS A;  3LH2 S;  4A8Y A;  5C25 A;  1ELO A;  2GJF A;  3IG1 B;  2ZOF A;  2LQ8 A;  2RKI B;  2XS5 A;  4P75 A;  1F9E B;  1VIX A;  3MMC B;  1FE4 A;  2Z58 B;  3KK2 B;  2QLB B;  4DSL A;  5DQG A;  1FA0 A;  1UMJ A;  1RTD A;  2UUC J;  3UDL A;  2R7S A;  2IIH A;  4DR2 J;  1KDN A;  1O5J A;  1HLW A;  2XWX A;  2V2Z A;  4ZVF A;  3ENQ A;  1WUU A;  2BJ9 A;  3KMS A;  4JV5 F;  2I5J B;  2FD2 A;  4Y2C A;  3I5A A;  4JI1 F;  2KYZ A;  4BS2 A;  3KK3 A;  4F2R A;  1RHM B;  1MMD A;  1WSR A;  4ZPD A;  2QA2 A;  3HSG A;  1GMW A;  3FEY B;  3MMA B;  4OHY A;  3OL8 A;  2B8P A;  1I51 B;  1M5H A;  5LT5 A;  2BQR A;  2CQD A;  2WVB A;  1NDC A;  1C0U A;  2AYM A;  4CRJ A;  3MEC B;  2YX7 A;  1WOP A;  1KRP A;  4IR1 A;  2W9B B;  1YX2 A;  5DDQ C;  1T9Y A;  3CUL A;  3EPG A;  1Y10 A;  5IWA F;  4ZVG A;  4Y65 A;  5F41 A;  4F3Q A;  1BWV A;  2FDN A;  3CCE S;  3DKD A;  1GMU A;  5F8N A;  1FNM A;  3M1V A;  3G6V A;  2HWH A;  2KKH A;  2RIL A;  2FLP A;  1RCO B;  5LSL A;  3MUR P;  3ETM A;  3MCO A;  1WOR A;  2BR0 A;  4I6W A;  3MOJ B;  5I4M A;  4Y6I A;  3NNC A;  4MKY A;  1ZS6 A;  3DRR B;  3ZZY A;  1NK5 A;  4OJG A;  1RDR A;  3IM9 A;  1ICE B;  1QUV A;  4ANC A;  4O0N A;  1S9G A;  4OX6 A;  3T1Y J;  2QLJ B;  2HQ3 A;  5HI7 A;  3F41 A;  4ZMM A;  5EHH A;  4KB7 A;  1FRM A;  5L1L A;  4YR2 A;  3A13 A;  3VWS A;  1SJQ A;  1QD1 A;  2XBP A;  3G87 A;  5HAN A;  3DOK A;  3BSA A;  3V4I B;  3TZZ A;  2UUA F;  1LWC A;  4RNF A;  2ALY B;  5HMX A;  5IXU A;  1K73 T;  4Q7A A;  5KFM A;  3TWZ A;  1BLU A;  2RU9 A;  3H5Y A;  1F1B B;  2N3O A;  2RRA A;  1RYS A;  4C0B A;  2AGP A;  2UVV A;  4ZCL A;  1T9U A;  2C1E B;  3LP0 B;  2XB2 D;  1Q95 G;  4O23 A;  4J9K A;  1RAB B;  2BM1 A;  3NCQ A;  3BBB A;  1NCL A;  1LXN A;  2PE8 A;  5M2R A;  4CLT A;  5KOW A;  3QMQ A;  3MMC A;  3KJQ B;  3W1Y C;  1HNV B;  2B5J A;  3RB0 A;  1MU2 A;  4C0H A;  4DUT A;  5IT0 A;  1S0V A;  5HBM A;  1BQX A;  1WC6 A;  2I1R A;  4HHH A;  4QW8 A;  4GC6 A;  2GQ2 A;  2VD3 A;  1Q8K A;  3JQJ A;  5HK4 A;  4X4T A;  4OZ0 A;  3UCG A;  5E33 A;  3PRV A;  3CCT A;  1WKL A;  4E2F B;  1VQP S;  1CVJ A;  1IKY B;  1R3N A;  3W8G A;  4ED7 A;  5K5M A;  1PG5 B;  3MMA A;  4CNY A;  5DJB A;  3HSZ A;  1PC5 A;  4I2Q A;  3NS6 A;  5B0C A;  1HMV B;  4E8U A;  1SC6 A;  1TAQ A;  3C19 A;  1B0T A;  4QBU A;  4PWD A;  3OXL A;  4OHW A;  1TUG B;  3ZXW A;  5U47 A;  3DYA B;  5KFU A;  2MLX A;  4UUX A;  3SDE B;  3TJA A;  5E2Q A;  1TKT B;  2UXD J;  4P73 A;  2IBO A;  4RU2 A;  1T05 A;  1VHI A;  3O2I A;  1NSK L;  3LPY A;  2L3M A;  1CS4 B;  1OPZ A;  4ECZ A;  1SV5 A;  4JI3 F;  1R89 A;  2XC9 A;  3S1T A;  3C16 A;  4USK A;  3BSC A;  5CXT A;  1GK8 A;  3THP A;  4HH1 A;  3LAM A;  3DHW C;  1QE1 B;  2IAJ B;  1HQU B;  3DLJ A;  4CO3 A;  4UOC A;  4C8L A;  1WSV A;  4QJV A;  3O44 A;  1UCN A;  1LWF A;  4DX6 A;  1VHF A;  4L3K A;  5A8K B;  4AT1 B;  2V4Q A;  1JK9 B;  4A46 A;  3GSD A;  3E8O A;  5KT5 A;  1B0V A;  4B9N A;  3Q8V A;  3MM9 A;  4XAK A;  1D09 B;  4EO8 A;  2B9Y A;  4ECX A;  1G1X A;  5EUH A;  1HQ2 A;  2AEJ A;  2AX0 A;  4LFB J;  4KR0 B;  5A8R B;  4B9S A;  4ZVU B;  5HVF A;  5ETS A;  3LPE A;  4OZL A;  2YNH A;  5B0A A;  4DR2 F;  3PIO Q;  3ZTO A;  2K2P A;  3LOU A;  4YN3 B;  2ATC B;  4A4J A;  2G4B A;  3DXS X;  3LP2 A;  3D4J A;  2VPW B;  2PA8 D;  2NPI A;  4PWU A;  2DGT A;  5KFZ A;  3FFI B;  4MH8 A;  5T14 A;  1ZBT A;  4DZD A;  2HGL A;  4ZHR B;  3HSD A;  1X60 A;  4EO6 A;  2F4F A;  1Q81 T;  4ZP9 A;  4UT4 A;  4M5N A;  3MM7 A;  2C2E A;  1HHQ A;  4F3O A;  3OR1 B;  3GV8 B;  2MLY A;  4FXV A;  4EYI B;  5HMZ A;  4OL8 A;  3GYX B;  2AWZ A;  5JVH Q;  3BN4 A;  2HS0 A;  3W3S A;  1RWO B;  4PG5 A;  1FKA F;  5KFH A;  4TU8 A;  1S77 D;  2LP4 A;  3IBW A;  1FCA A;  3TP2 A;  3WQP A;  1N5Q A;  3MHY A;  5D0H A;  4FNI A;  3W5Z A;  1FI4 A;  4QU7 A;  1TKT A;  1S1W A;  5AE3 A;  5LM7 E;  4F4A A;  1TL3 B;  2I38 A;  2M88 A;  4Z7Y A;  3O1L A;  3JTN A;  4FS2 A;  2LKZ A;  3GIJ A;  3A12 A;  3NP5 A;  2X3D A;  5JUM A;  4X4O A;  2F4V J;  2IAJ A;  2W8K A;  1HBM A;  1RT4 A;  3PFE A;  1DY3 A;  1XMB A;  3R1H A;  2V8V A;  2VFS A;  3NEK A;  4RW8 A;  4NYP A;  2CDR B;  5A8K A;  3KKF A;  4ZVS B;  2H5I B;  3CMA S;  1VRT A;  4N76 A;  4ZP8 A;  3OTO J;  4LBI A;  1TK5 A;  2PFD A;  2MB0 B;  3GIR A;  2OTL S;  4DR1 J;  5F0W A;  3DLE B;  4I6Y A;  4AD6 A;  4HAC A;  2GGP B;  1S7I A;  2D3U A;  1Y0H A;  2ILY A;  1YJ9 S;  4NMX A;  4S0M A;  4K5R A;  3N5B A;  3I9Z A;  2QEX S;  4NLQ A;  2ROE A;  3VAL A;  4RW4 B;  3QLH B;  3HFV A;  1NME B;  2BOP A;  4NRT A;  1F5B A;  3LGN A;  4J5O A;  4EU0 A;  4ZN3 A;  2O5D A;  3W9J A;  1FDA A;  3ILI A;  4FF3 A;  5IM0 B;  4ILL A;  3CO9 A;  2RH3 A;  3D0G E;  3TI0 A;  2CXE A;  3R2D J;  1PGZ A;  4ZVH A;  5KFV A;  1ZOT A;  2XSF A;  2DNQ A;  1FX4 A;  2UV8 A;  2ZWO A;  3R5J B;  1WTF A;  5RUB A;  1SQG A;  5F9N A;  5LSO A;  4GMK A;  1F60 B;  3R27 A;  5ETQ A;  2BOA A;  4U7U D;  5G0R B;  3EGN A;  1TK0 A;  1REG X;  5KT4 A;  1K1S A;  3DRS B;  1Y5I B;  1EP4 A;  2HWT A;  4YQW A;  3B4D A;  2ASD A;  3BR9 A;  3GQC A;  2R2S A;  2UXD F;  5D15 A;  4P7T A;  1Q78 A;  4ZPV R;  1NND A;  4A8F A;  4A8Q A;  3CPW R;  1IWA A;  4OYW A;  1FNO A;  4LFA J;  5GAG U;  2ACM A;  5L9N A;  4KAI A;  2CJ9 A;  1QSL A;  2HFV A;  3DMJ B;  3IRX B;  2HIY A;  2R7U A;  1CBK A;  2Q79 A;  4DQP A;  1KLM B;  4M94 A;  2H5E A;  4NLP A;  3VV2 B;  2BJE A;  4U96 A;  3GB0 A;  1B0P A;  1VIO A;  4HDG A;  3KDN A;  1CQN A;  4P74 A;  2DKO B;  1DZ5 A;  2C2N A;  2L41 A;  2VBX A;  1RHJ B;  4K4Y A;  3AQO A;  3EUN A;  4WPA A;  4CO0 A;  5AT1 B;  4CNZ A;  1TKX A;  3VAG A;  3VGS A;  4LFB F;  2BZ2 A;  4MYT A;  1FD8 A;  4X66 J;  1U24 A;  4EZ6 A;  3LAN A;  3SYZ A;  5B0E A;  1KQF B;  4O3P A;  1TTH B;  2RT3 A;  2HK2 A;  3OXF A;  1GNK A;  4I2P A;  4NLD A;  5F3T A;  1J5E J;  3DLK B;  2VPZ B;  4DPY A;  1R8P A;  2XI3 A;  2W4P A;  3SMZ A;  4UZC A;  3PO5 A;  3LP1 A;  3AXK A;  1S48 A;  2FJA B;  1P9Q C;  4OX7 A;  3BGU A;  1D3W A;  3T5L A;  2GO9 A;  2G2Y A;  4DX5 A;  1RAC B;  2XNQ A;  4X4V A;  4QQB A;  1YJW S;  2JC1 A;  4DSI A;  1JLF A;  2JVR A;  3LGH A;  2R2U A;  2YX4 A;  3DRY A;  5DDO C;  3M2R B;  3OL7 A;  1MSW D;  1WWH A;  1NU4 A;  1UA1 A;  3Q2S C;  2ZM6 J;  4BHQ A;  3DRS A;  3EIC A;  1VBX A;  1FEE A;  4ZP7 A;  2IYG A;  2Q6B A;  4HR2 A;  3FKB A;  2VFU A;  3H40 A;  3D2W A;  1EAY C;  4DEZ A;  2G0C A;  2ADC A;  4OYB A;  2DNN A;  3FEZ A;  1SC3 B;  4HH0 A;  1WI6 A;  8RUC A;  5J2N A;  2NSB A;  1ZA2 B;  3P5T L;  1HW8 A;  3PYD A;  2W2M P;  1B7Y B;  1CQM A;  2CJX B;  2BRL A;  1JLG A;  2AMC B;  2M8H A;  3IRX A;  1MG7 A;  1N0V C;  3BKU A;  1URN A;  1UVJ A;  3OFG A;  3GJS B;  3NLC A;  3M8R A;  2KYX A;  3KLI B;  2Z56 B;  1SB6 A;  2NS1 B;  1NZA A;  1LWX A;  2GQQ A;  1N48 A;  1FVQ A;  1HFE L;  4DSE A;  2M7S A;  3OTO F;  1SVD A;  1SJF A;  3JAM U;  2FJE B;  2DH9 A;  2ZZT A;  2IM0 A;  2B4P A;  1LXJ A;  3RB6 A;  4LF9 J;  4DR1 F;  3D1Q A;  3TVK A;  4UZB A;  1Y4Z B;  3G82 B;  2FVS A;  1VQ9 S;  2L48 A;  2HNY B;  2PO4 A;  1NJI T;  1RAA B;  2OD6 A;  4B9V A;  2V8G A;  1HWL A;  4EYH B;  4DQR A;  2X1F A;  3U7J A;  2KG0 A;  3MAQ A;  4NYZ A;  2M0G B;  1VJW A;  1WC4 A;  3ET6 B;  5CZV A;  2YQ0 A;  3J81 U;  4AE5 A;  1I5O B;  5LJ3 Y;  3DLK A;  3OUY B;  1TL7 A;  2DR6 A;  4R8U B;  2AQ4 A;  4DSK A;  5G4D A;  4LF6 J;  5HSP A;  1GXU A;  1O8B A;  2KFZ A;  4U7U K;  1S1X B;  3UDV A;  3CCV S;  2MSS A;  4C8O A;  1RT6 B;  3R6L B;  1YJU A;  4U7C A;  1MML A;  2OKQ A;  5AXL A;  3ICL A;  1LK7 A;  3DLG A;  2DRD A;  1X5S A;  4RUA A;  3V4M A;  3V5R A;  3I32 A;  1R8B A;  2PDA A;  4IG3 B;  2JWN A;  1H7W A;  1GX5 A;  4ZJL A;  2KZM A;  1R6Y A;  4NL5 A;  2JLF A;  2YKP A;  3CXC R;  2WSF C;  4CTA A;  4IO1 A;  3WBZ A;  1VS3 A;  2YKN A;  1VQL S;  3R9L A;  2W4D A;  3BO3 A;  4LFA F;  1DQ8 A;  4X65 J;  2JZ5 A;  3AB2 B;  1FT8 A;  2VBY A;  1B7F A;  1NZ8 A;  2IPO B;  4LF2 A;  3M7V A;  2OIH A;  3MEK A;  3F56 A;  2MZQ A;  3TNV A;  4ZPB A;  2H4W B;  3PX6 A;  3S6E A;  2YXL A;  1QVF R;  4KPY A;  1Z4U A;  1JJ2 R;  1AXQ A;  1S9E A;  4E98 A;  4YHH J;  4X4U A;  4WF9 Q;  3GP9 A;  2NPF A;  3CW2 C;  4JI6 F;  3DC2 A;  2LXU A;  1U1O A;  3MR3 A;  2E9T A;  4WXW A;  4AL5 A;  4X66 F;  4ERD A;  3OBI A;  2OEJ A;  3AOC A;  4MTP A;  2WZ1 A;  5DM6 Q;  4X62 J;  2ZDO A;  1KVI A;  4J9U E;  2V8P A;  4OYO A;  2HBZ B;  2GMH A;  2OI2 A;  4IRD A;  1MN9 A;  3J80 Y;  1J5E F;  2D74 B;  4ZN1 A;  1RWW B;  3SFG A;  2BXJ A;  1YG0 A;  4X64 J;  3EZ5 A;  1FJ7 A;  1X4F A;  5KT7 A;  3MEE B;  1K0V A;  3EE3 A;  3PKY A;  4A8S A;  3KLE A;  2N82 B;  2E9Z A;  2FGO A;  2XMJ A;  4UQT A;  4WP9 A;  4M5K A;  4ITS A;  4C0O C;  4DF8 A;  2QYC A;  2QX0 A;  3FBF A;  4IR9 A;  4P2X A;  3ZZR A;  1RTZ A;  4N77 A;  3D7S B;  4IFY B;  1RT6 A;  2R7Q A;  2J9D E;  4KRW A;  2FHJ D;  1U0H A;  5ITH A;  2QO3 A;  1HNI A;  2ZM6 F;  4DFJ A;  1OJ4 A;  4NLW A;  2K8G A;  4FN5 A;  4UW2 A;  1HPZ B;  2VBZ A;  3OD2 A;  3BBC A;  1C1C B;  3R2C J;  1RXO B;  2V8H A;  3BGL A;  1Q53 A;  3TJ9 A;  1LKZ A;  4N41 A;  2YNG A;  5C42 A;  2ZH2 A;  4ZA1 A;  2M9K A;  3TRG A;  2PN6 A;  1LNQ A;  5EX0 A;  2K7J A;  4BLG A;  3C66 A;  4CQ1 A;  5EWE A;  3V6H A;  1XR5 A;  2WVD A;  2VC1 A;  4HEA 9;  1UWA A;  5BYQ A;  1N6Q B;  3OVS A;  3THT A;  4C48 A;  3HP6 A;  1J5O A;  3G6X A;  3NNH A;  1M0S A;  2XG8 A;  2OPQ B;  5L46 A;  5KFY A;  3R5A A;  3AOD A;  2V2V A;  1IR2 A;  2HHW A;  4L76 A;  3ITH B;  4RWX A;  1UA0 A;  1PYS B;  2GIQ A;  3VZH A;  4B9M A;  1HI1 A;  2BYC A;  1FFW B;  3GTY X;  1AUD A;  5C2G A;  2DTJ A;  2YKM B;  1H74 A;  3VR1 A;  3GON A;  4JI7 J;  2DGX A;  4CH1 A;  4KGX B;  2HPU A;  2DXF A;  1R8A A;  2AJ1 A;  2CAD A;  5F8H A;  1JNZ B;  5EN1 A;  1L3S A;  1DTQ A;  2AJ2 A;  3OFF A;  1SBR A;  4JV1 A;  2HHV A;  1MWY A;  1NK7 A;  1RWU A;  3EDR B;  3RR7 A;  1L3V A;  1WKJ A;  2Y1R I;  1G3O A;  3DRX A;  4LF6 F;  2W7P A;  1F9F A;  2ZH1 A;  1E6V A;  2NXJ A;  2FZK B;  3I0R B;  2AJ0 A;  4OLO A;  4I7F B;  2HVE A;  4KSE B;  3T41 A;  1JMT A;  2GMJ A;  2KT5 A;  1CG2 A;  4P52 A;  2GO8 A;  5F8G A;  1H0H B;  2IM3 A;  4C98 A;  2HVI A;  2VF3 A;  2KO1 A;  4NYO A;  3CT9 A;  4C7Q A;  4JUZ A;  4LSN A;  1NPK A;  1HNW J;  3M30 A;  5HL7 Q;  1KS2 A;  1FRJ A;  1JLE A;  1D8Z A;  3JSM A;  4I69 A;  3MI7 X;  2MDA A;  4PUO A;  3ILL A;  3KDO A;  2NYI A;  1KTQ A;  2HUR A;  3RU0 A;  4X65 F;  2RDD A;  1C1B A;  2IBK A;  3E3X A;  3HVR A;  1C1C A;  1NK8 A;  2YVS A;  2XNR A;  3CJ8 A;  3H98 A;  3KFW X;  3BDP A;  4JBC A;  1JX4 A;  1TVR B;  2ZKT A;  1SI9 A;  4OI1 A;  4W4M A;  2IA0 A;  1H38 A;  4DOZ A;  5KFN A;  4ED8 A;  3HKZ D;  4AFF A;  3NAH A;  1IBL J;  4OFZ A;  1NRK A;  3CCU S;  4UOG A;  3IM8 A;  3SZ2 A;  1I1G A;  4FNH A;  1FXL A;  1WC0 A;  1UW9 A;  5DET A;  1VC6 A;  3M32 B;  4PZV A;  5D77 A;  2VDI A;  3GJQ B;  1RB0 A;  3VAJ A;  3H2L A;  2ZC3 A;  3MM8 B;  2JLG A;  1NK6 A;  3RTV A;  3ITH A;  3UNY A;  4Q5V A;  2YBV A;  2ZUG A;  4DQQ A;  3UQS A;  2OTJ S;  1R6V A;  3HJF A;  1REV A;  2MKC A;  1QVG R;  4X84 A;  5KFC A;  5HMW A;  3SCI E;  3UO0 A;  3W60 A;  2PI5 A;  4USU A;  3DM2 B;  3A3P B;  3OLB A;  5T41 A;  1N5Y B;  2V8D A;  3AJ1 A;  2J6T A;  1LWE B;  3SFU A;  1ROF A;  4QPT A;  4ZCI A;  1XNQ J;  3RW6 A;  4LRF A;  1X8D A;  2HKE A;  2PC6 A;  2RML A;  4USJ C;  1YIJ S;  3KJF B;  4FVM A;  2Q3P A;  3RZA A;  3VQT A;  4ER8 A;  3D9B A;  4M5H A;  2DO0 A;  2VAS A;  3K7R A;  4N8N A;  5BJR A;  3LQV A;  3VTI A;  1UWB A;  1Z1Z A;  4C8M A;  5BXI A;  2BAB A;  3IC1 A;  4HTI A;  4QIV A;  1L5U A;  5CD4 H;  3IFE A;  4HL9 A;  3HFZ B;  4I7F A;  2UXB J;  5KOX A;  4QW9 A;  1BQN B;  4P2M A;  3A1Y G;  4AYB D;  3BKT A;  1U2F A;  1RHK B;  3NS5 A;  4DDF A;  2Y1I A;  3TA0 A;  2DCL A;  1TV6 B;  4ED0 A;  2DXE A;  5F8I A;  2WBM A;  4JI0 F;  3MTJ A;  2R2T A;  2QA4 G;  5FLX U;  3W7B A;  5E7O B;  3LAL A;  2ACY A;  2D41 A;  2ZH9 A;  3D54 A;  4NA1 A;  1ZTW A;  2H48 B;  3FMW A;  1RT3 A;  1X9M A;  5E3C A;  4NLY A;  1GQE A;  3M05 A;  4KIA A;  1NB2 A;  2MZS A;  3BPS P;  2V6A A;  2CQ1 A;  4JOU A;  4BBY A;  1QSS A;  2HLU A;  4F8R A;  3Q89 A;  3CD7 A;  3RG6 A;  2KM8 B;  2Y8Y A;  5A2Q Y;  1X5T A;  2XYG B;  2KFN A;  3WDO A;  1NEE A;  2CJA A;  3DI6 B;  5GVQ A;  3FSI A;  2AJQ A;  5KG7 A;  4ETZ A;  1D8Y A;  1NPP A;  2DK2 A;  5A6W A;  1Y9O A;  2KZZ A;  2W1B A;  4XO0 A;  4PPZ A;  1T94 A;  2HRY A;  2IDE A;  2E1R A;  4URG A;  3K0J A;  4BCA A;  3AHP A;  3M32 A;  2AJ4 A;  4Y2K A;  2ERR A;  1RAE B;  1WHY A;  2WTF A;  4X4N A;  3ELH A;  3HO1 A;  2YNF A;  1AT1 B;  3L95 X;  3PW4 A;  4YME A;  5EDW A;  2KXN B;  4O3O A;  2APO A;  4OZ3 A;  1TKZ B;  1PIL A;  3A8I A;  3KLV A;  4ZK7 M;  1BMQ B;  5H1S V;  2ZD1 B;  1QLN A;  1FK9 B;  4CYU B;  5A8W B;  2VG7 B;  4UTG A;  1S6P B;  1UPM B;  4USW A;  2OFH X;  5I42 A;  3H42 A;  2J8A A;  3DM2 A;  4H4M B;  4ES2 A;  2LYV A;  2HS4 A;  2P9C A;  1M1K T;  3QO9 A;  1S57 A;  4UOF A;  3W5X A;  4FPR A;  1OMS A;  1NHU A;  3OT9 A;  2JEG A;  1CC7 A;  3M6U A;  2FVP A;  1BD6 A;  2UUB J;  4DV5 J;  1RLC L;  2B9X A;  3L7O A;  1XIQ A;  1HNW F;  1IBM J;  1VC0 A;  1XK8 A;  2QN6 B;  3JYT A;  1TR0 A;  2LFV A;  3Q8Q B;  4TY8 B;  3QFW A;  1GXL A;  2IC3 B;  3VVT A;  3PDN A;  3CDE A;  5ETT A;  1LW2 A;  2BUN A;  1X4B A;  4B08 A;  5CYQ B;  1O6X A;  1MWQ A;  3TYT A;  1QDU B;  3NKY A;  3K5M A;  5KG4 A;  1IM4 A;  4A8M P;  1Y11 A;  1JXE A;  1S4E A;  2N4D A;  4MJK A;  4USH A;  1UET A;  2VQF F;  1N34 J;  1IBL F;  4OZJ A;  3OHA A;  2C28 A;  2EBE A;  1VDH A;  4H4O B;  2WON A;  1JWW A;  4WFN Q;  1IKW A;  4RZR A;  2AJF E;  4LRC A;  2IM2 A;  2EC2 A;  3Q0A A;  2ZUA A;  2RSQ A;  3H5U A;  1VR6 A;  2IDL A;  5B09 A;  2F7V A;  1HBO A;  3M2U B;  2HFZ A;  4ID5 A;  1MRO B;  1VJQ A;  3CJ4 A;  3BO4 A;  1FD2 A;  3CCL S;  3M8S A;  4N8O A;  5FDL B;  4WK3 A;  5EWG A;  1FRH A;  3M8Y A;  1SCJ B;  3G96 A;  3K5P A;  2VC0 A;  3M8W A;  2BX6 A;  2VFV A;  3CMQ A;  4ZKA A;  1NH7 A;  4WZM A;  1LW0 B;  1U1M A;  5E3A A;  2WVF A;  1K47 A;  3VZI A;  4RPF A;  2ZOG A;  4LR9 A;  4ICL A;  2DNK A;  4LF8 J;  1MWZ A;  1WDD A;  1H72 C;  1XNQ F;  5A8W A;  1SKU B;  4WTO B;  2ZH6 A;  4KFB A;  4O4G A;  1XBW A;  3QT7 A;  3HZE A;  3KYL A;  4OV6 A;  2NUH A;  2Q6C A;  2GC8 A;  3ONQ A;  5J1N A;  3L7P A;  1B70 B;  3DFE A;  3FK4 A;  5DZ7 A;  2XYH B;  1IKV A;  1OWX A;  1T95 A;  3JTO A;  1U8S A;  2HZA A;  2BMB A;  4OZ1 A;  3C14 A;  2AW0 A;  2CJB A;  1S79 A;  2IYI A;  2KRB A;  2XLJ A;  4J9P A;  3VGU A;  2Y0B B;  2ROG A;  1U26 A;  1YBA A;  1FER A;  4RU9 A;  3LW5 C;  4F0K A;  4IFV B;  2WW8 A;  2J6U A;  3IBF B;  3N6M A;  4CLY A;  5HRO A;  2IC3 A;  2W2N P;  1IJF B;  3MXH P;  5HLF B;  1CJV B;  1U2C A;  4DN0 A;  3TAP A;  1Q7Y T;  2VHG A;  1RCX B;  4TYB A;  2VG6 A;  2CPY A;  3BF4 A;  1H3D A;  2GVZ B;  3CJK A;  4OJ3 A;  3IO1 A;  4AXJ A;  4HVZ A;  2NXN A;  1R8H A;  2R7O A;  3Q23 A;  1M90 T;  2IRY A;  4A47 A;  4F2S A;  1S0M A;  3FBB A;  4NA3 A;  3DN9 A;  2LEA A;  4JYA J;  3KWM A;  1HWJ A;  3QIP B;  3O5T B;  1SJ3 P;  4U8V A;  1KP6 A;  1AFJ A;  1S6O A;  2RHS B;  2JC0 A;  3AXM A;  5E3Q A;  4PXC A;  2JFD A;  4Q8F A;  5KG6 A;  3QBC A;  2BRK A;  4OLP A;  2MY7 A;  5L1I A;  2J7W A;  4DFK A;  1KFD A;  2KI2 A;  2CNL B;  5BYR A;  3FVY A;  2QL9 B;  1HYS A;  1HD0 A;  4KHM A;  2ZVS A;  2ZBR A;  3QGG A;  1TL1 B;  4WYL A;  3BJY A;  1ZZN A;  3GSI A;  1H2V Z;  1S59 A;  4PG6 A;  2PSZ A;  2XCA A;  2FHK A;  3D6H B;  2IFX A;  2H3E B;  3OJU A;  1LW0 A;  1HBU B;  2FUG 9;  4LBP A;  1A7G E;  4FXW A;  2ZNZ A;  2AEF A;  5CH7 B;  4CT9 A;  3KLH B;  2LU2 A;  1DHM A;  2W2P P;  2G9O A;  3KJV B;  2Y8W A;  2UUB F;  2J9E A;  2EFG A;  2RHQ B;  4USV A;  4DV5 F;  1UZH A;  1IBM F;  2KT2 A;  4DR6 J;  1VQO S;  2JDJ A;  3MFI A;  1EHW A;  4LVN P;  3FUY A;  1RSC A;  3JB9 k;  1H2U X;  3CCQ S;  2DR9 A;  3D6T B;  2DPJ A;  3WHI A;  3BRE A;  1XER A;  3BQ1 A;  1UJ5 A;  2WSC C;  3TEH B;  2PA3 A;  3TAQ A;  4IFV A;  2IY5 B;  4QR2 A;  5IT9 U;  4J9N A;  1ZM9 A;  3DOL A;  1CJV A;  1WOO A;  1U1P A;  2UU9 J;  1ACM B;  4KKO B;  3P8B B;  4MFB A;  4BC7 A;  3MM5 A;  4P10 A;  2DNZ A;  4JI2 J;  2ZFH A;  3TZX A;  5J1E A;  1J27 A;  1HBN B;  3GG0 A;  4KYZ A;  2QRR A;  3PCO B;  3C3L A;  3KG4 A;  2N7C A;  1VC5 A;  5IT4 A;  2VU5 A;  4B3M F;  4Q2L A;  1P6T A;  4C4W A;  1SJ4 P;  1GXT A;  1BXN A;  3HVT A;  4NLO A;  3IS9 B;  3B82 A;  3BDE A;  4DPU A;  1YIT S;  2QLW A;  3HHK A;  3QGI A;  2K06 A;  3I4P A;  1RT5 A;  4RNM A;  1XWL A;  3UNG C;  5B08 A;  2V67 A;  4OZ2 A;  3I5B A;  1P1T A;  4PQU A;  5L9X A;  3RBZ A;  3C6T B;  3FZB A;  4MYU A;  3W9I A;  2VB6 A;  3HKW A;  4EBE A;  1WEZ A;  1NKE A;  1TFW A;  2O3D A;  1HI8 A;  1PO6 A;  3Q8U A;  3HCX A;  1K9M T;  3KOA A;  4ZLP A;  5CYM B;  1XQI A;  3C15 A;  1U6B A;  2RQ4 A;  3H90 A;  1RQ0 A;  2E1A A;  3QZ8 A;  3Q24 A;  1U45 A;  2HHH J;  5F8M A;  3MDF A;  1DTT B;  4QOT A;  1YJN S;  1OQ3 A;  1KOO A;  2FLL A;  3PYE A;  4HLB A;  3BM7 A;  1YJV A;  4DR5 J;  4C97 A;  2XLI A;  2P9E A;  2HVH A;  5KFR A;  5GMK a;  3HPO A;  4KGK A;  4JB8 B;  4FVC A;  2I9S A;  2CA9 A;  2DB1 A;  1NSP A;  2WK4 A;  3CIM A;  2KH9 A;  3EZU A;  3I0S B;  1GH8 A;  3DU5 A;  4AUK A;  2WSE C;  4ECR A;  4F4X A;  1WKK A;  4V1A k;  1SC4 B;  1FJG J;  5SZT A;  2KU7 A;  2CVE A;  3T19 A;  3HD2 A;  1RHU B;  2OPP B;  3LGM A;  1RTH B;  2BE2 B;  5LMU J;  4IOC Q;  2LCW A;  2M52 A;  3W8P A;  1AFI A;  1PJ5 A;  4DV2 J;  2U2F A;  1CC8 A;  2XO6 A;  1V5I B;  1CUL B;  1KHW A;  4EZ9 A;  1U0S A;  1RT1 A;  2LEB A;  1RTI A;  1VRQ C;  4I0W A;  4MKV A;  1C0T A;  1X4A A;  1QUP A;  1KKH A;  3VCD A;  4RW9 A;  3MEG A;  4Q45 A;  2FZC B;  3MF5 A;  2HEK A;  3PNI A;  1S49 A;  1RWN B;  1CLF A;  3QJP A;  4UY8 T;  3GJT B;  1LFP A;  4LJM A;  2MQQ A;  2XMU A;  3K57 A;  1VQ7 S;  1SL0 A;  4K0K J;  3M6X A;  2IM1 A;  4CLK A;  3IR6 B;  5A0Y B;  2R7T A;  2V69 A;  3GII A;  2FLN A;  4V19 X;  4LF7 J;  1UVN A;  4TKT A;  1LQ9 A;  4ZOS A;  2YWW A;  1SUQ B;  1WI8 A;  4P2F A;  2MLZ A;  4G1Q A;  3LO3 A;  2ZJQ Q;  4Q8E A;  1XC9 A;  2D9P A;  3FBE A;  1AZS A;  1GX6 A;  2LQ9 A;  2W4C A;  2AEM A;  2BA9 A;  2BKP A;  1V3R A;  2B7C B;  4P6Q A;  2V4J B;  3C6U A;  2GIF A;  2CJK A;  2CNO B;  2E5L F;  4G1I A;  1TUV A;  1HKA A;  3GR0 A;  4FKY A;  4OYM A;  5CYM A;  3D5M A;  2UV8 G;  2RU3 A;  4DWI A;  1A9N B;  1YJ7 A;  2R4F A;  1B99 A;  3N6L A;  1K44 A;  3DRP B;  4WE1 B;  4RUH A;  4IH6 A;  2VFT A;  3NOG A;  3H25 A;  4M5L A;  1Y5N B;  1VBK A;  2VBW A;  3G8S A;  3ZFV A;  1KNZ A;  5C25 B;  2RQM A;  2WBR A;  4NAS A;  1Q8L A;  5AXM A;  1N32 J;  5E3P A;  4DR6 F;  1RAO A;  1KVK A;  3RUB L;  4RW7 A;  2ZOM A;  2V68 A;  1B64 A;  3WIU A;  2FC9 A;  2OPS A;  1RTD B;  1RYR A;  3HI9 A;  1XN9 A;  4ETX A;  3B4M A;  2YWH A;  1WF1 A;  3BSN A;  1T3O A;  4JI4 J;  5KT3 A;  4R0J A;  4IQX A;  4PG8 A;  4MIB A;  1H98 A;  2CQB A;  4ED1 A;  1TK8 A;  1OIA A;  1FEH A;  2BE2 A;  1RI7 A;  2XCP A;  1VMB A;  4DJB A;  3QGP A;  3DOM A;  4JI2 F;  2KM8 C;  2OGU A;  3NRB A;  1KBR A;  3RAX A;  4PKD B;  3ZTR A;  2UUT A;  2CQ3 A;  5ETN A;  3IA0 A;  3CDW A;  1WF0 A;  3H4D A;  2CPJ A;  2HMI A;  4ZCM A;  2BVZ A;  1FWP A;  1T9V A;  1VIS A;  4UUW A;  4X4R A;  4LRA A;  3HDS A;  1KR4 A;  1NJY A;  4AND A;  4IOB A;  2MQL A;  2CPF A;  2CPZ A;  1FFG B;  3LF0 A;  3PTW A;  2QSW A;  4IOA Q;  1IKX A;  4AL6 A;  4F0H A;  3AD9 C;  5IC6 B;  1S9G B;  4LR8 A;  4ZJO A;  1PJ7 A;  1S4F A;  3N6N A;  2P5V A;  4B3R J;  2V4J A;  2FVC A;  5KFT A;  2MTL A;  3DOK B;  5DLG A;  2MZR A;  2JNJ A;  2HHH F;  1UFW A;  4N7T A;  2JH3 A;  4P7V A;  3C8Y A;  1LWC B;  4DG1 A;  3QSY B;  3U27 A;  2NXU A;  3CD5 A;  1GEH A;  2J0S D;  1RBO B;  3BGO P;  4FF1 A;  2HQI A;  2YWF A;  1XMO J;  3QWP A;  2R7R A;  1HI0 P;  5K20 B;  3D3C J;  4DPT A;  1CJT A;  3ILJ A;  3MUM P;  2XO7 A;  2HSE B;  4C2M A;  1QTM A;  2OH2 A;  2L9N A;  5DZ6 A;  2CNN B;  2VL1 A;  2D1C A;  2QYG A;  4W92 B;  3KHR A;  2R3V A;  2PT0 A;  2RAQ A;  3AJ2 A;  3Q8Y A;  4OHV A;  2LU1 A;  2ZH8 A;  1JJ4 A;  4YB5 A;  2CQ0 A;  5E0O A;  1HD1 A;  4JI8 F;  1FJG F;  2B5J B;  2W7O A;  3K59 A;  1MU2 B;  1TL4 A;  4CT8 A;  3MR5 A;  5HBM B;  3QYY A;  4LSL B;  1N33 J;  2DNH A;  5LMN F;  4ZPC A;  4DV2 F;  2Y1L B;  1GMV A;  2DYA A;  1DJ0 A;  1FFS B;  1F5C A;  4ZLN A;  1YQH A;  4F3M A;  4Z2X A;  1S12 A;  4OIX A;  3G8T A;  4LF4 F;  2CUY A;  2HHS A;  3OW2 R;  1ARO P;  4RJV A;  4I2Q B;  1YRU A;  5EGY A;  3O3L A;  3V6D A;  5IC4 B;  4C6A A;  4NLX A;  4PG4 A;  2O66 A;  3UWT A;  4PWD B;  4YB1 P;  1T0T V;  4PEO A;  1U1L A;  2C3O A;  2GHP A;  4BWM A;  4F7V A;  3GYN A;  4WU2 A;  3K58 A;  4K0K F;  1IVZ A;  4H4K A;  2GML A;  4DCJ B;  4LF7 F;  1HQE B;  1T05 B;  3JXO A;  3ZZT A;  4O3Q A;  3CC2 S;  2VOO A;  2EG2 A;  3G6E S;  1YBU A;  4DV4 F;  3K8V A;  3HM9 A;  4WFB Q;  1SV5 B;  2B3T B;  3I96 A;  3TUJ C;  1EJ7 L;  3C16 B;  1RT7 A;  4LF5 J;  2LXF A;  5IQQ A;  3QRP A;  3MFH A;  2U1A A;  1SQE A;  3F44 A;  9ATC B;  1FTR A;  4F04 B;  1G7C B;  4DN9 A;  2IVY A;  4LRD A;  5GME A;  1LWF B;  2R9L A;  4DV1 J;  3P96 A;  4ZVP B;  3CIZ A;  2G2Z A;  1T3N A;  2EFN A;  1WF2 A;  4I1T A;  2F63 A;  4ECU A;  2YNI A;  3THV A;  1B3T A;  4IRK A;  3MM9 B;  2Z8Q A;  4ELV A;  4FBU A;  2J9C A;  3ENV A;  1RU1 A;  4QWD A;  4J91 A;  1N32 F;  2CG8 A;  4O44 B;  3OV7 A;  4YUD A;  3WZ0 A;  4QU6 A;  2D7S A;  1T02 A;  2YNH B;  4NCG B;  3SSS A;  3PM9 A;  2EFQ A;  4RW6 B;  5B0G A;  4KE5 A;  3LP2 B;  4U95 A;  2Z2L A;  4KGV B;  4JI4 F;  4AQY F;  2KVQ E;  1S6Q A;  1H2T Z;  2ZDP A;  4LVO P;  1W2B R;  5HAT A;  1F2G A;  5DDP C;  1X4E A;  2AYG A;  5IV3 A;  4HT7 A;  4YY3 J;  1IBK J;  3GYG A;  4LSL A;  3JS9 A;  3CDA A;  4M5D A;  2XMT A;  4Y34 A;  3BPD A;  4DPO A;  3MM7 B;  3P5B P;  1M5O C;  4ECY A;  4RNH A;  2B6A A;  5E5N A;  4EUV A;  4R5P A;  3G8Q A;  3MED A;  2R2R A;  5J2M A;  5LSR A;  1EQM A;  2ATL A;  3VAH A;  2AP6 A;  1D9D A;  2D69 A;  1Z2Z A;  1QSY A;  2IRX A;  3CUN A;  3TW0 A;  1Q16 B;  2ASJ A;  2XY7 A;  3AY0 A;  4NLV A;  5CCL A;  3L3C A;  2ZWP A;  4CLU A;  2HAF A;  3EM1 A;  3MPD A;  1NH8 A;  1RWP B;  2IA6 A;  4NZ6 A;  3MCM A;  4NLG A;  2C22 A;  1S1W B;  1L3K A;  2J0W A;  1HQE A;  2EKY A;  2CNK B;  2FHJ A;  5D3G A;  1U25 A;  2BAN A;  4NLR A;  2RQK A;  4EFA C;  4CM0 A;  3UR3 C;  5D0R A;  3PX0 A;  1UAW A;  2WHO A;  4F4Y A;  1SKW A;  4TYA A;  5IZH A;  3QT5 A;  5KG2 A;  4DX7 A;  4KHP F;  2LEC A;  4B3R F;  1FTC A;  5HN0 A;  4LSZ B;  4PCQ A;  1BY9 A;  3Q86 A;  2J0X A;  2DEI A;  1HBM B;  2MKK A;  1RT4 B;  4XTT A;  1OS5 A;  2HFN A;  1ZM2 A;  2VQE J;  1FNX H;  2GQC A;  1MN7 A;  5K14 A;  4RW8 B;  3RW7 A;  2AV5 A;  4ES1 A;  4K5S A;  1VRT B;  3JSY A;  3MAH A;  4UQG A;  1UVK A;  2G2O A;  3MM6 A;  2E66 A;  2F5G A;  3D0I E;  1H7X A;  1JXL A;  1WEL A;  1N56 A;  5FD1 A;  3A3N B;  4PXB A;  1ZPW X;  2ZJR Q;  4AXI A;  5KFJ A;  3MPU B;  2W2O P;  4HAC B;  1UJ6 A;  2ZH7 A;  5KFL A;  4M5G A;  2HWI A;  4DUZ J;  4O44 A;  3H59 A;  1S97 A;  2BJD A;  2K3K A;  2JEJ A;  4HHJ A;  4DHV A;  1HNX J;  1WHV A;  2XY6 A;  2UUC F;  4NCG A;  1Y5L B;  3V81 A;  2BEF A;  1JLC A;  4RW6 A;  2Z4P A;  4ED4 A;  2X3G A;  2DJW A;  1RWV B;  3QRQ A;  5HO4 A;  1VLO A;  4DXL A;  5KFP A;  5DG8 A;  2BE9 B;  3OFE A;  1VK3 A;  1NK4 A;  2ZH4 A;  4Q0B A;  2UVR A;  2PGC A;  2C2K B;  4KV8 A;  2XGP A;  3W5Y A;  4NI2 B;  2NXE A;  1I3O B;  2RE1 A;  4DU8 A;  3FCW A;  4HTJ A;  2E5G A;  3UDC A;  1WC3 A;  4K50 A;  4ZPT R;  1PJ6 A;  4UST A;  2DNO A;  1EP4 B;  4IQM A;  4DBQ A;  2MQM A;  4L3N A;  2BW2 A;  1UVM A;  4LBH A;  1KEK A;  4LRE A;  3RRH A;  2HZC A;  2LQB A;  2HHX A;  2XS7 A;  2CPE A;  5JXS A;  3MWB A;  2MQP A;  4PPD A;  1UJ4 A;  4TLQ A;  5KTQ A;  2CQC A;  5HQ8 A;  4Q43 A;  3GZ7 A;  2BAC A;  1I6J A;  4WU3 A;  3EXY A;  2QT7 A;  1IR1 A;  1GTH A;  4KGZ B;  1OSD A;  4TVA B;  5D78 A;  4G3I A;  3DDN A;  3G86 A;  3RRK A;  1JIH A;  3ENA A;  3T1Y F;  4WFY A;  4MIA A;  1FO1 A;  1SH0 A;  5FJ4 A;  1ZM4 A;  3OJS A;  2DO4 A;  1NKB A;  4OX9 J;  1A6L A;  3EZO A;  3IMQ J;  2VA2 A;  3BYR A;  1SIZ A;  1VLY A;  1VQN S;  3Q8R B;  2OEM A;  3MPY A;  3FC9 A;  3BEG B;  4O3N A;  2XS2 A;  2IHR 1;  2EW9 A;  3NS7 B;  2DY1 A;  1TKX B;  4G65 A;  2IRU A;  1V6H A;  3R8Y A;  4CP5 A;  1EET A;  3MOZ A;  4J9V A;  4OZ5 A;  1RTJ A;  3K5L A;  2R7V A;  2LVW A;  4LFC J;  3RRG A;  4LRB A;  4HDH A;  3HX9 A;  4DR4 J;  1E6Y A;  4KBI A;  4I2P B;  3FBC A;  3OHB A;  1KOH A;  3AQP A;  2EKN A;  1VQY A;  4KPC A;  4LMZ A;  4B9T A;  3LP1 B;  1KVJ A;  2BJ8 A;  5C24 B;  4YY3 F;  1IBK F;  1GAO A;  3QT6 A;  3T6B A;  3P45 B;  1U6Z A;  1RWM B;  4GKJ J;  4NPO A;  4U8Y A;  3OQ2 A;  1NAQ A;  1D0E A;  4J9M A;  2C2M B;  1TKD A;  4P71 A;  7FD1 A;  3GU0 A;  1JLF B;  4C8K A;  1EKR A;  4NI2 A;  3GIM A;  3UVJ B;  4G6V B;  3BH7 B;  3FQL A;  3D1O A;  3A8E A;  1XMQ J;  2DGV A;  5KFE A;  2C2O B;  2Y3Y A;  4OYZ A;  2O1P A;  1FX2 A;  1LOU A;  2OMO A;  1I94 J;  4IG0 A;  2MQO A;  4WFA Q;  2J0Q D;  1CEZ A;  2C3P A;  1WC5 A;  1F5A A;  3CGI A;  2R8H A;  2MQ8 A;  2B43 A;  2YTC A;  5J2N B;  4KC5 A;  2QC3 A;  3GV7 B;  2CPH A;  4DLE A;  2XSJ A;  2DHS A;  5GAH I;  1JLG B;  1QAI A;  3AD7 C;  3MD3 A;  2BDP A;  3QFH A;  4UY8 5;  3B8H A;  3TQ1 A;  4IRC A;  4K7Q A;  3BN7 A;  1J2V A;  3J7A N;  2GAH C;  3T3F A;  3KMQ A;  2PI4 A;  3PJX A;  1WNE A;  1TMM A;  1KQK A;  4OJ1 A;  1YBT A;  4EEY A;  4GRS A;  3R1L A;  2GCF A;  2W7A A;  1LEO A;  1S0N A;  2C42 A;  1VQ8 S;  1HWU A;  2FHM A;  3Q22 A;  5J2Q B;  2QLX A;  2ILZ A;  4TNO A;  3H4B A;  2MKI A;  4U6P A;  2C2Z B;  4M5I A;  2CWK A;  2J8S A;  3U1N A;  1SL1 A;  5D8H B;  2F3J A;  1GT8 A;  2QL7 B;  1CJK A;  3LTO A;  1PCA A;  3HLU A;  3HHN B;  3EJM A;  4F67 A;  5CD4 A;  1HNX F;  2GAG C;  2EK1 A;  3QRR A;  2R8J A;  4W98 A;  3JAM Y;  3NMR A;  4CLP A;  2OP5 A;  1Q5Y A;  5HAO A;  3POT B;  5GMD A;  1TL7 B;  5IWA J;  4WII A;  2YQ1 A;  1M5K C;  1D9F A;  4WXO A;  2HRU A;  4B17 A;  1RAI B;  5K8M A;  1R31 A;  1N5S A;  1TAU A;  5C24 A;  4YS2 A;  2WAQ D;  1JLB A;  2DR5 A;  5A6P A;  4R25 A;  4H4K C;  3WX4 A;  3D67 A;  3O6Q A;  3DLG B;  3ZZP A;  1UEU A;  3J81 Y;  3GFH A;  4C11 A;  2C3M A;  4RX6 A;  3CJ5 A;  3UVJ A;  5J2P A;  4XDC A;  1WEY A;  2A3J A;  3KK1 B;  2QMX A;  2M3D A;  2PMW A;  4CTA B;  2B8Q A;  4FYD A;  3IRW P;  2MKJ A;  2YKN B;  2VFR A;  4NLU A;  3RGI A;  4B3O A;  6AT1 B;  1NB7 A;  3BR8 A;  1MLA A;  3NOC A;  2NZ4 A;  4ALZ A;  1O51 A;  2CQG A;  4TY9 A;  5LXY A;  1JLA A;  3CC7 S;  3VGV A;  1N5T A;  1S1V A;  5J1P A;  2JVO A;  4NCA A;  1S1U B;  1S9E B;  3CCM S;  4OX9 F;  3KNG A;  2HND A;  2OPR B;  2FJB B;  2F4V F;  4M1K A;  4GVL A;  2FTR A;  4OI0 A;  4RKU C;  2ZIT A;  3BH6 B;  4TLR A;  3PVX A;  2HZV A;  4N56 A;  1KQG B;  4Y0F A;  1ZAV A;  5F0U A;  1G4C A;  1N54 B;  5HP1 A;  3T1A A;  1T03 B;  3ZZO A;  3ZZ0 A;  3N01 A;  3VAM A;  3D68 A;  3NCR A;  1P27 B;  1Q4R A;  1IJE B;  3OLA A;  4LFC F;  2RDI A;  5THW A;  5HMY A;  5J2Q A;  2KXF A;  4ZJQ A;  2W01 A;  3CTR A;  4DR4 F;  3RR8 A;  2DRA A;  3I4H X;  1NPR A;  2N3L A;  1HWK A;  3E01 A;  3NGD A;  3PR5 B;  5I3U A;  4O0I A;  3TZW A;  4ZIT A;  2MYF A;  3EYZ A;  3CJS A;  3Q83 A;  4WKY A;  1CJU A;  4ZS6 A;  2RDJ A;  4X4Q A;  2BJ7 A;  3GV5 B;  4DUY J;  2XMM A;  2DR7 A;  3PFO A;  2XY5 A;  3KLE B;  3POT A;  4GKJ F;  2ZE2 A;  3L7U A;  4QIW D;  2MZ1 A;  2V4R A;  4CM2 A;  1PAE X;  1JNR B;  2Z2Z A;  4PXE A;  3W2W B;  3W2V A;  4K8R A;  2VUG A;  1SIW B;  3MMB A;  2WW4 A;  4ZLJ A;  2RF2 B;  5D0G A;  4RBT A;  4OI4 A;  3W61 A;  1U0H B;  2FJW A;  3VQS A;  1HNI B;  2VG5 A;  3S01 A;  1IR0 A;  1NHK L;  2PEB A;  2XLK A;  1I94 F;  2JHE A;  4CZC A;  3KLF A;  2Q1L A;  1BGX T;  4B3T J;  3KK1 A;  2NZC A;  4NEZ A;  2L9W A;  4K4Z A;  2HLT A;  3BO2 A;  2YNG B;  5C42 B;  3LAK A;  4WFX A;  1OY8 A;  2DEJ A;  2GX8 A;  2M5Y A;  2Y9H A;  2HHT A;  1YDL A;  5GAE I;  4NXM J;  1NBE B;  4RR5 A;  2IJN A;  1G6B A;  3MAA B;  1YGY A;  1FVS A;  1J5O B;  1PAU B;  4CLS A;  1S1U A;  4PYA A;  2QMU B;  2JEF A;  2HBQ B;  2OPR A;  4DSF A;  4F26 A;  1R27 B;  2DPI A;  3HD1 A;  2GHW A;  2YPY A;  4ELU A;  3R6G B;  1UVL A;  1M1G A;  3J7Y I;  2EFV A;  1FDB A;  3HVW A;  2NLW A;  4PQA A;  2DNR A;  3UCZ P;  1T03 A;  2PMH A;  1S1T A;  3PHT A;  4YEA A;  2FQQ B;  2E5I A;  3AOA A;  5F3Z A;  2YQ3 A;  3N9U C;  1JLQ A;  4RWW A;  1UZD A;  4I68 A;  3A3O B;  4A8O A;  4WP3 A;  2Z57 B;  1UFL A;  2AYE A;  3QZ7 A;  5GAD I;  1S0O A;  1DTQ B;  5DQH A;  2JLE A;  3HMJ G;  3T5J A;  4IDK B;  4F25 A;  3RB4 A;  3OL6 A;  2JEI A;  2YKO A;  1Y00 A;  4IO9 Q;  4K2X A;  2G1H A;  3JSB A;  4NE9 C;  3MCS A;  4K59 A;  4WP8 A;  2HGM A;  1E6V B;  2RRB A;  4Z37 A;  2P6T A;  2FVR A;  3VVU A;  2ZKU A;  4DLG A;  1VK8 A;  4ECS A;  2MKY A;  1PYT A;  4M5J A;  3PW5 A;  4WFZ A;  1RLD A;  2WOM A;  3W2W A;  3TUP A;  2OSQ A;  3U1L A;  2XYP B;  2V5H G;  3H8Y A;  2DRB A;  4LSN B;  3TVY A;  3M30 B;  5IFM A;  2RF2 A;  2EG1 A;  4URQ U;  2C2D A;  2KB2 A;  1NK0 A;  1JLE B;  2HVZ A;  1N36 J;  1U2R A;  2DHX A;  3JSM B;  1Q5V A;  1RWK B;  4NLT A;  4PUO B;  4ZIV A;  5B0F A;  1OY6 A;  4RUC A;  4H54 A;  2L9D A;  3HHL D;  3SV3 A;  2EWH A;  1DLO B;  3CCR S;  3T6J A;  2G0I A;  3IAS 9;  1C1B B;  2ZBP A;  3L4B C;  4QIE A;  2GHV C;  2GNK A;  3SQO P;  4YOE A;  1Q79 A;  4OI2 A;  4CWB A;  1Z2L A;  2ASY A;  4CDI A;  4IH7 A;  3PAC A;  3GWC A;  2CIM A;  3PHE A;  3BGR A;  4QPX A;  3M8P B;  4FS1 A;  4DV6 J;  2XQC A;  1FXR A;  3IG1 A;  2RKI A;  2AZ1 A;  1X9S A;  2VIC A;  3CJ2 A;  2J5A A;  2W8L A;  3MAA A;  4DCP B;  4OYP A;  4C3K A;  2GFF A;  3EGV A;  2CWX A;  1EAR A;  3KK2 A;  5KT2 A;  2FB0 A;  2QMW A;  1SKR A;  4KH0 B;  4J9L A;  4QYZ J;  4ENO A;  2MJN A;  2J76 E;  4KJI A;  1N52 B;  1RWX B;  3LWM A;  4ECT A;  4DV3 J;  1IN0 A;  1ZM3 A;  1TMJ A;  2I5J A;  4LF9 F;  1PIE A;  1YJT A;  1WC1 A;  1REV B;  1X31 C;  4DSJ A;  3R5C A;  4ATN A;  2RD5 C;  2KXH A;  1YWX A;  4KO0 B;  3HUL A;  3HJV A;  2MHN A;  3F0N A;  2RNE A;  4DL7 A;  1EQ0 A;  1DQA A;  1K8A T;  3MEC A;  1EB0 A;  2P8I A;  4DUY F;  5KG1 A;  2W9B A;  4K4S A;  2YWE A;  4ED3 A;  2EK6 A;  4IDK A;  4QR0 A;  2KTQ A;  3ZTP A;  3KNA A;  2CZ9 A;  3KLG B;  3K8W A;  4L6V 3;  1T9X A;  1UWB B;  4B3S J;  2XI2 A;  4CO4 A;  2E7V A;  2NYH A;  1VQ4 S;  2QA4 S;  4OX8 A;  5MAO A;  2QJ3 A;  5DM7 Q;  1VBY A;  5C5J A;  2CZV C;  2D3Z A;  1UW4 A;  1JB0 C;  3DRR A;  2FVQ A;  2ASL A;  2XEX A;  2H54 B;  1HWI A;  3H2V E;  2DIV A;  3MPV A;  3D1H A;  1PBU A;  4B3T F;  3CJT A;  2QZ8 A;  4D3H A;  1RT3 B;  4M8L A;  3KUH A;  4DS4 A;  2ROP A;  1IQT A;  3V4I A;  3CD6 S;  1DLO A;  1ZH5 A;  4QWE A;  3R7S B;  3U1M A;  4F36 A;  1QAY A;  3MTK A;  2CPD A;  1Q82 T;  1BC6 A;  4NXM F;  1WDT A;  4J9Q A;  4FPI A;  3ISZ A;  5FLX Y;  1YI2 S;  1L3U A;  2DGQ A;  2UP1 A;  3LP0 A;  2DH7 A;  3M8P A;  3OL9 A;  4YHH F;  4DX8 H;  1EIY B;  2FGC A;  1X4C A;  5DGA A;  5IS2 A;  1NDK A;  1VFJ A;  5ADZ A;  3HXM A;  1WJ9 A;  1H6K X;  1ZTT A;  2X51 A;  5DS7 A;  1HNV A;  3JTP A;  3I82 A;  4KH1 B;  4NX9 A;  2H65 B;  1HIY A;  1HHS A;  2HIQ A;  1Y7P A;  2YNF B;  3MR7 A;  4X62 F;  3TR5 A;  2MGZ B;  3EMT A;  4OYI A;  4O3S A;  1IKY A;  2V9W A;  4ELT A;  5L38 A;  3R5B A;  4Q2M A;  1ZYQ A;  2O01 C;  4B9L A;  2QL5 B;  3WC2 A;  5I42 B;  4WZQ A;  4X64 F;  4KO0 A;  1HMV A;  1PKU A;  2YH0 A;  1R7I A;  3CED A;  2R8G A;  4FBT A;  3QO9 B;  1ZAW A;  2E9R X;  4NWB A;  5F8J A;  1RAH B;  2QG9 B;  1Q8B A;  3SEO A;  3DYA A;  1OSC A;  3RJM B;  2QE5 A;  4C9D A;  3SDE A;  3LA0 A;  1Y3K A;  3KLG A;  3QJJ A;  2FC8 A;  1AW0 A;  1WEX A;  1VQ6 S;  3TUZ C;  1IM6 A;  4FYV B;  4FF2 A;  2HGN A;  1CS4 A;  5H9F K;  3JYT B;  1ZET A;  1N36 F;  1FJC A;  1PC4 A;  2W24 A;  2RS2 A;  2EI5 A;  1LW2 B;  2HFO A;  1QE1 A;  1HQU A;  5AXK A;  4NML A;  3G2X A;  2I0X A;  5L39 A;  2EFO A;  2FIU A;  3I31 A;  5T7L B;  3AD8 C;  4KTQ A;  3DGP B;  1TEL A;  3OPK A;  2QV6 A;  2HHP A;  2AZ3 A;  4U67 Q;  3PKM A;  1VQM S;  1TU0 B;  4DV6 F;  2OSR A;  1VI7 A;  4GVB B;  3RBD A;  1MW7 A;  3NWR A;  1TUW A;  2WON B;  5ETM A;  5DRK A;  2V94 A;  5A8R A;  1KD1 T;  2X1G A;  4ZVO B;  1IKW B;  2QFI A;  2PII A;  4I67 A;  1VCT A;  3H0P A;  1RKJ A;  3CME S;  3K17 A;  1G2E A;  3IR7 B;  5HJY A;  1HBO B;  1FHT A;  3AA8 A;  2F8E X;  2KHC A;  3IR5 B;  5D0E A;  2GJ2 A;  3UN3 A;  2OUG A;  4DV3 F;  4ID5 B;  2E1P A;  2I6W A;  3VAI A;  5HQM A;  2D3O 1;  3SQG B;  3FFI A;  4JI7 F;  3NBP B;  1VYA A;  1U4B A;  3R7N B;  2DH8 A;  2MKH A;  3ENW A;  3KG1 A;  4ZHR A;  3NAI A;  4NA2 A;  3FCH A;  3IN5 A;  4CI0 B;  3D0H E;  2HHU A;  3I5C A;  2MGZ A;  4ICL B;  5D6G A;  3OR1 A;  2HRT A;  1U8W A;  1FXD A;  5IV4 A;  2I8E A;  4PAB A;  4QIF A;  4KFB B;  2WRM A;  4O4G B;  2DHA A;  2P6S A;  1YVF A;  2AF6 A;  5K8P A;  4B3S F;  1R0A B;  1IKV B;  2R8I A;  3C14 B;  4QYR A;  4EBD A;  4CLL A;  2ZC4 A;  1TL3 A;  1HW9 A;  2CRL A;  1K1Q A;  4CH0 S;  4F4K A;  1TP7 A;  2HVD A;  1NJZ A;  4E0D A;  2WB4 A;  5HRO B;  4PAA A;  3G71 S;  2EPI A;  4OI6 A;  5KAK A;  4ZLL A;  3NL0 A;  3M6W A;  4F4W A;  4JI6 J;  3R97 A;  5BYS A;  5KFO A;  2A2C A;  5T7L A;  2VG6 B;  2GV1 A;  3R7B B;  1T8E A;  1ZZF A;  3CJK B;  4YR0 A;  3DGP A;  3PJ9 A;  5KFI A;  2UZA A;  4CO1 A;  3KHL A;  3N5F A;  2KFY A;  3EVO A;  1U1K A;  1N88 A;  4I6A A;  4USI A;  3SSR A;  3MR6 A;  1BUX A;  4GVB A;  3HT3 A;  3DLE A;  3B54 A;  2BV3 A;  2GGP A;  2B56 A;  4QWA A;  3PW2 A;  1X4H A;  2J9D A;  3VAK A;  4YFU A;  1RZM A;  3I55 S;  2ZVI A;  3M9N B;  4IYQ A;  4RW4 A;  1X4G A;  1XR7 A;  3QLH A;  1KHV A;  5MLC V;  3OTD A;  1LFW A;  2AU0 A;  2QLF B;  1YTY A;  5IM0 A;  2KT3 A;  1HYS B;  3AT1 B;  1QY7 A;  1L3T A;  2YX1 A;  1U48 A;  3P6Y C;  3MUT P;  3SQG A;  3NBP A;  3QT8 A;  3CCJ S;  2NSC A;  2DD8 S;  5KFF A;  2HAI A;  3NNA A;  1S72 S;  3FDS A;  1JQG A;  2VIH A;  3DLB A;  5CCM A;  1F0X A;  4YDX A;  3QPI A;  2H5J B;  4ZVT B;  2Q66 A;  5G0R A;  4TN2 A;  3NY0 A;  2ZH3 A;  4I4B A;  2G1D A;  2AKW B;  5D4P A;  3MD1 A;  3VAF A;  1FRX A;  4MMO A;  1U49 A;  1Q86 T;  1U7L A;  3ZTS A;  4EBC A;  3H5X A;  5D4N A;  4ZPA A;  1U47 A;  2OML A;  4YDD B;  2MXY A;  3T9N A;  1R0A A;  2RS8 A;  4CH7 A;  4DMZ A;  4FDF A;  2UXB F;  2VKR A;  1HL6 A;  4LT6 A;  2KVI A;  3DMJ A;  2GVD B;  1KLM A;  2JL9 A;  4GO5 X;  2DNY A;  2F8H A;  4F50 A;  3HT0 A;  3N79 A;  2LQ5 A;  1NJW A;  1Q8I A;  4DL2 A;  4PWW A;  2DNL A;  5ETL A;  1D9A A;  3DOL B;  3KHG A;  3UD5 A;  2WVC A;  4MFB B;  1R0C B;  2YPZ A;  2GIR A;  2W9C B;  3MM5 B;  2XZT B;  1RE1 B;  3AOB A;  4RUB A;  5J1E B;  1M5V C;  3BKF A;  3WC0 A;  4MKA A;  3TVZ A;  3HVT B;  3MPW A;  3ZTQ A;  1FKO B;  2HS3 A;  4J7C A;  5IT9 Y;  2KHD A;  4HI2 A;  5EX3 A;  1GMW D;  1M5P C;  2ZBQ A;  5ETP A;  2DCU B;  1RT5 B;  4PR6 A;  3UN5 A;  4WJB A;  4MAK A;  3GR1 A;  1UTA A;  1YSJ A;  5CZX A;  4PQU B;  3R5G A;  4K4T A;  2LA4 A;  2BKO A;  4WTY A;  4O4R A;  3SCJ E;  3TA2 A;  4RBU A;  4LUB A;  3W9H A;  1YK9 A;  3C15 B;  3FGV A;  1DRZ A;  4DQI A;  3PY8 A;  2B9W A;  1VGY A;  1N0U A;  5SUH A;  1WG5 A;  3QAE A;  2D9O A;  3M2R A;  3TX8 A;  5CHC B;  3N0V A;  4TQS A;  3ULH A;  5D4O A;  2ZNY A;  4A48 A;  1WOS A;  3SCK E;  4CCH A;  1N8R T;  2ALZ A;  2QSF A;  2DHH A;  2M2B A;  1QM9 A;  4NZ7 A;  1XR6 A;  1BQM B;  2YKA A;  3FSY A;  3OVA A;  5GAG I;  4LIR A;  3W62 A;  2DGO A;  4GKK J;  3QAU A;  2FJV A;  3B78 A;  4KY3 A;  2A2D A;  2GVD A;  2JSX A;  3ZZZ A;  5DGB A;  4WIQ A;  1K0T A;  1UVI A;  3HF5 A;  1RU2 A;  1VQ5 S;  3PEH A;  3KLI A;  1RT1 B;  4QIG A;  1T9W A;  1RTI B;  4WKR A;  2H4Y B;  1C0T B;  2RQC A;  4RW9 B;  2FY8 A;  3MEG B;  5M2P A;  3GFY A;  4WYW A;  2W9C A;  4TU9 A;  3G82 A;  3R5D A;  3W63 A;  1XTZ A;  1N34 F;  2VA3 A;  2HNY A;  5I3Q A;  1OY9 A;  1RHR B;  1YHQ S;  3IWL A;  1ULR A;  5L8R C;  1UEK A;  2KN4 A;  5KFK A;  1RAF B;  2BQU A;  3RBX A;  1FKO A;  2BQ3 A;  2ZJP Q;  2MST A;  3OSN A;  2V2K A;  1RAD B;  4DFP A;  1F6T A;  3ET6 A;  3TJ8 A;  5ETR A;  2FY1 A;  1LV5 A;  4WBF A;  4G1Q B;  4J37 A;  5H9E K;  1YKW A;  5K8N A;  1RA7 A;  3OUY A;  5CAB A;  1FE0 A;  4DV7 J;  4R8U A;  3I87 A;  4FXD A;  1AZS B;  2YWG A;  3K89 A;  2ADB A;  1S1X A;  3C6U B;  3OTC A;  2R7X A;  2MZT A;  2KRR A;  4XDD A;  4TQR A;  2BBE A;  4OZN A;  5FII A;  3RB3 A;  2VDH A;  1P9Y A;  4BC9 A;  1QAJ A;  1FWL A;  5C2C A;  1M5S A;  4ED6 A;  4LF8 F;  1IBC B;  1FRI A;  3ZC4 A;  4IG3 A;  4JI0 J;  1YRT A;  1V3Z A;  1FF2 A;  3K5O A;  4X4P A;  3K5N A;  2VJV A;  3TOQ A;  1UFK A;  2EVZ A;  1KFS A;  1UEV A;  4ID8 A;  2E29 A;  2ZHO A;  1S9F A;  3Q8S B;  3A4T A;  2XTJ P;  3VF0 B;  4RW7 B;  1BE4 A;  1RJJ A;  2OPS B;  4DL6 A;  2AIR B;  1BQM A;  3GIK A;  6FDR A;  3OR2 B;  3N28 A;  5JJB A;  4DPW A;  1KWM A;  2A10 A;  4R0E A;  4X2B A;  3UE2 A;  2N7Y A;  4NRU A;  3PXG a;  3GFZ A;  2CKW A;  5H9F J;  3OTE A;  3LWL A;  3ZO7 A;  5KG5 A;  3QNW B;  4NCB A;  2HW3 A;  2VOP A;  4AL7 A;  1RUS A;  3IP0 A;  3J7Z T;  3J80 U;  3DOM B;  3KUG A;  1V5V A;  4CIO A;  5M2U A;  1RK8 A;  3QJL A;  2DNG A;  1C4A A;  4ECQ A;  1X4D A;  3NGK A;  2HMI B;  4JYA F;  2V63 A;  3ZNJ 1;  4L73 A;  2Z30 B;  3AJD A;  1FDD A;  7AT1 B;  3M4X A;  2BM0 A;  2R7W A;  3EGW B;  4M63 A;  4JI5 J;  4K4V A;  2WVE A;  3QGH A;  1SH3 A;  3SIP B;  2F65 A; 
#chains in the Genus database with same CATH homology
 1RHK B;  1RWK B;  2H51 B;  3P45 B;  3D6H B;  2HBR B;  3D6F B;  1RWM B;  1RWN B;  3EDQ B;  4ZVU B;  1RWV B;  2CJX B;  2QL5 B;  3GJT B;  1QDU B;  3KJN B;  2C2M B;  3GJR B;  2FQQ B;  3R7S B;  1BMQ B;  2C1E B;  1NME B;  2C2K B;  4LSZ B;  3GJS B;  3R6L B;  4JB8 B;  1QTN B;  2CNK B;  3P4U B;  2H48 B;  4ZVO B;  1I3O B;  1SC1 B;  3QNW B;  1GFW B;  2C2O B;  4ZVR B;  4DCO B;  1F9E B;  3RJM B;  2Y1L B;  3KJQ B;  3NS7 B;  5IC6 B;  1PYO B;  2C2Z B;  2QLB B;  4ZVP B;  2P2C B;  2DKO B;  2QL7 B;  2QLF B;  2XYH B;  1SC4 B;  3R5J B;  3D6M B;  2HBZ B;  1RHJ B;  1IBC B;  1RHU B;  1ICE B;  1RHQ B;  2H4Y B;  2CNO B;  2XYG B;  4DCP B;  3EDR B;  3KJF B;  1RWW B;  2QLJ B;  2CDR B;  2Y0B B;  1PAU B;  5IC4 B;  2CNL B;  4ZVS B;  2H5I B;  4ZVQ B;  2HBY B;  3IBC B;  2H65 B;  2CJY B;  2QL9 B;  1RHM B;  3R7N B;  2XZT B;  1RE1 B;  2HBQ B;  2XZD B;  2XYP B;  1RWX B;  2H54 B;  3R7B B;  5K20 B;  3IBF B;  1RHR B;  2H4W B;  2H5J B;  1RWP B;  4ZVT B;  1I51 B;  1RWO B;  3SIP B;  1SC3 B;  2CNN B;  3R6G B;  4DCJ B;  3GJQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...