1RXJA

Crystal structure of streptavidin mutant (m2) where the l3,4 loop was replace by that of avidin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
115
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAKRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural elements responsible for conversion of streptavidin to a pseudoenzyme
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Unknown function
total genus 25
structure length 115
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1rxjA00
1SWCA 1LUQA 2RTOB 5IRWA 2JGSA 4Z2VA 4Y5DA 2IZLB 3RDXA 1I9HA 1WBIA 1VWRB 4Z2PA 1Y55X 4BX5A 1AVDA 1MK5A 1RXKA 1NBXA 1SWOA 1SWBA 1AVEA 3X00A 1STSB 3SZHA 4BBOA 3MM0A 5K68A 2RTCB 3PK2A 2BC3A 1PTSA 1VWHB 2IZFB 1Y53X 1SLDB 2IZEB 1VWIB 4EKVA 3VHMA 5B5FA 5IRUA 2RTRB 1VWFB 1NC9A 3RY2A 1RXHA 1VWCB 1Y52X 2ZSCA 5K67A 2IZGB 1KL3A 1SWHA 1RXJA 1VWMB 3MG5A 4GD9A 1MM9A 1VWBB 2IZAA 1SWLA 2OFAA 2UYWA 1SRHA 4BX5B 2WPUA 2IZDB 1LDOA 1N4JA 1SRGA 1SWRA 1SLFB 1SWDA 2OFBA 2CAMA 1N9MA 5JD2A 4I60A 2FHLA 1SWNA 4BX6B 1VWLB 4DNEA 1HQQA 2IZKA 2RTIB 2A8GA 4JNJA 1NQMA 4GDAA 2OF9A 3EW2A 1RSTB 1SWPA 2C1QA 1VWKB 5B5GA 4BX6A 2OF8A 4GGZA 1SWFA 1NQNA 2RTNB 4OKAA 3T2WA 1MOYA 3SZJA 1RAVA 1SRIA 1SWTA 1N7YA 1HXZA 5F2BA 2IZCB 3WZQA 4CPHA 4Z27A 1SRJA 1SRFA 3RDSA 3RDUA 4BCSA 2RTAA 2IZIA 1SWSA 3FDCA 1SLEB 1HXLA 2Y3EA 4Z6JA 1SWGA 2IZHB 3SZIA 3WYPA 4U46A 4GJVA 1STRB 2Y32A 1KL5A 2RTHB 4JHQA 4CPIA 2C4IA 1VWPB 1SWKA 2RTBB 4BX7B 4Z2OA 2QCBA 3VHIA 4GGRA 1N43A 2RTQB 3T2XA 4Z28A 1SWJA 1N9YA 2RTPB 2Y3FA 4BX7A 4Y59A 4BJ8A 4CPEA 1VWAB 4CPFA 1LDQA 2A5BA 4JO6A 2C1SA 3RDOA 3RY1A 4CPHB 4GJSA 3EW1A 2RTKA 4YVBA 1SWQA 1VWJB 4IRWA 3T6FA 4GGTA 3RDMA 1SLGB 1RSUB 1SWUA 2UZ2A 3T6LA 2RTGB 2GH7A 2F01A 1HY2A 2FHNX 3WYQA 3RE5A 2AVIA 2RTJA 1IJ8A 1SWAA 1VWNB 1LCWA 3WZNA 1NDJA 2RTLA 3RDQA 1STPA 1SREA 1VWEB 1MEPA 5L3YA 2A5CA 3WZOA 2RTMA 1VWOB 1VWDB 1VWQB 2RTDB 2IZBA 2G5LA 1KFFA 3VHHA 3WZPA 1LCVA 1VWGB 1KL4A 2RTEB 1DF8A 2RTFB 1VYOA 5CHKA 5CSEA 3RE6A 5IRAA 2MF6A 1SWEA 1LELA 1LCZA 3VGWA 2IZJA
chains in the Genus database with same CATH superfamily
4CDFA 2RTOB 1CRBA 3FA6A 4Y0QA 4UU3A 4Z2VA 1L6MA 3S5XA 2MWHA 3RDXA 1I9HA 2HLVA 5B5GA 3STKA 3WJDA 2HZRA 1E5PA 1MUPA 4YKOA 4CK4A 1EPAA 4EEJA 3G7XA 3EBKA 5EEDA 1STSB 2QMIA 3HWFA 3PEDA 3P6EA 5HZ6A 3F8AA 3B2LA 3RKGA 5IO7A 5LJCA 2BS5A 1Y53X 4IMOA 3ZW2A 1GX8A 2FS7A 4EKVA 3OBLA 4Y0RA 5IRUA 3VHMA 2RTRB 2CBSA 1HBQA 1FE3A 3MBTA 4KCAA 1RXHA 1N0SA 3KQ0A 2L67A 1NGLA 2JN3A 4NLJA 1U17A 2X45A 1KT3A 3MG5A 3RWXA 1MM9A 2HZQA 1VWBB 2RCTA 5HZ9A 3APVA 1GT3A 4GNWA 3TZSA 1SWRA 2OFBA 1SLFB 1Y9TA 2BHVA 3BS2A 3BY0A 1ACDA 2CAMA 3STMX 4I60A 1JQPA 2N93A 3ZW1A 1UYOX 2FHLA 2Z4IA 5D45A 5B27A 4AZRA 2ANSA 4DNEA 3O2YA 5H9KA 2KT4B 3CQNA 1O1VA 1XCAA 3NP1A 2OF8A 1O8VA 3QQ2A 4KT5A 5JR8A 3T2WA 1YIVA 4LKTA 3O19A 3SZJA 1ZNLA 1LIBA 1SWTA 4CPHA 2IZCB 4O3XB 1S2PA 2QM9A 4O3ZA 4Z27A 1VYGA 2ZAGA 4GDZA 5HCCC 4O4SA 2OY1O 2W2AA 1LF7A 3D9WA 3LTWA 4HPBA 4ON1A 4OS8A 1QY0A 3CKGA 2RTAA 2GC9A 1KXOA 3EMMA 3P02A 2QOMA 3FDCA 1ZRYA 4CSBA 2GJ5A 1EW3A 3B2KA 3D4RA 1KL5A 4YKMA 2R74A 3S5VA 1B4MA 3ZUOA 1SWKA 4HFOA 4Z2OA 2X56A 4U3QA 4BOEA 2K62A 2OZQA 2X34A 4FGIB 2RTQB 4GGRA 4Z28A 3VHIA 4YGZA 5EZ2A 4OS3A 2E4JA 1VWAB 3RDOA 5H9NA 4AZQA 3RY1A 2IFBA 2AT5X 2Z4HA 3EBWA 3FA8A 4QGXA 2BS6A 1HBPA 1QABE 3CBSA 1DC9A 3OD9A 4INNA 4ZGFA 3APUA 4NV8A 2KTDA 4GGTA 3I17A 4KC8A 5HTEA 1KZXA 5B11O 1SWUA 2UZ2A 3T6LA 4NYRA 4I3BA 4GNYA 5F1EA 4ML7B 5EEEA 4RUNA 4EQAC 1BM5A 1SMPI 2CM4A 1CBIA 2G8CO 5F6ZA 3P6CA 4RUUA 1SWAA 1PEEA 3APWA 4GKCA 1B56A 1LCWA 4HWMA 1NDJA 1IFBA 1QFTA 3RDQA 3WZNA 1EUOA 1ZNKA 4LKPA 3WJCA 5LJEA 5L3YA 3B2IA 1OBQA 4YDBA 2RTMA 4XMCA 1VWOB 1BEBA 1EPBA 1MX7A 3LHNA 3NQ3A 3PQSA 3VE1A 4A1YA 1KFFA 5HAEA 3WZPA 2Q2MA 1NP4A 3PH5A 4MVIA 1AQBA 3WBGA 1A2DA 4XMDA 4ARHA 3ZWEA 2AT0X 4IB7A 3H3IA 3HWEA 3OJYC 4NP1A 4XMHA 4KC7A 3ELZA 2OY7A 3VGWA 4AW8A 4EDEA 3N91A 1I4UA 4ZFXA 2IZJA 1JV4A 1BRQA 1SWCA 1BBPA 3HWDA 3APXA 1BWYA 4A60A 3HTYA 1DFVA 3P6GA 4KH8A 1AVDA 3P24A 3WVMA 2X55A 1PBYA 1SWBA 2OFMX 2OL8O 1AVEA 1MDCA 4I95A 4O3WA 4BBOA 3EC5A 1DZPA 3HK1A 2RTCB 4GRJA 2CZTA 2F73A 2RD7C 1X8QA 5EPQA 1PTSA 1VWHB 2IZFB 3P6HA 3UEVA 1IFCA 1SLDB 1I78A 4I3CA 2FT9A 2LA7A 4NV7A 5HTDA 1JZUA 4AYHA 4ZHHA 1VWFB 3NQ9A 3RY2A 2QOSC 1VWCB 2JU3A 1ZNGA 1DZMA 2OVAA 5HBSA 2OY8A 3VG4A 4FBRA 1OEEA 4TKBA 1KL3A 5H9LA 4ZHGA 1G85A 1JMXA 1JJUA 2OFRX 2IZAA 1SWLA 2OFAA 2UYWA 4IB6A 1YWAA 4BX5B 2IZDB 5DPQA 1E06A 1DV9A 2X8TA 3WJGA 1SXYA 2MHDA 1D2UA 2ALLX 2CZUA 2NNDA 3BX8A 4NYQA 3VG2A 1N9MA 4ID2A 5JD2A 1A57A 1KQXA 5LJHA 4I9SA 4ZJ0A 2KD2A 5LJKA 1BRPA 1SXUA 4ZR2A 2IZKA 4JNJA 4TNNA 2AT8X 4GDAA 4YDAA 2OF9A 1LNMA 3EW2A 4MVEA 4ALBA 4AZNA 1RSTB 2C1QA 4YCHA 1QY2A 5D48A 3VE2A 4BX6A 2WQAE 2RTNB 1IKEA 2A13A 2NNQA 4MEEA 4HPAA 1SRIA 4I6SA 1N7YA 1HXZA 3VU1A 1D3SA 4GUZA 3WZQA 2GTLM 1KZWA 5AEOA 3ZQ3A 3S60A 5HCDC 4LQZA 1VPRA 3D97A 3RDUA 4QGVA 3WJBA 4QGWA 3FIQA 4FBVA 5DG4A 4I9RA 1O1UA 2LBAA 3FENA 1QG5A 3BLGA 4IB8A 4TKJA 1SWSA 4LZUA 4UU2A 3UEUA 1SA8A 2Y3EA 3FR2A 1IW2A 3FA9A 2M4LA 1STRB 2RTHB 2FKGA 4AZPA 2G79A 1QQSA 1VWPB 4NLIA 1RBPA 2L5PA 2L9CA 2RTBB 3BRNA 1E2TA 2QCBA 1GX3A 5CE4A 1JMZA 2BLGA 1N43A 1VYFA 1ML7A 3BU9A 4BX7A 3CQRA 2RA6A 2ZAIA 3FW4A 4BJ8A 2VDFA 2ACPX 3I0AA 2A5BA 4JO6A 4KIIA 4GJSA 5EDBA 1UZ2X 2OL7A 3T1DA 3IA8A 3STNA 3VG7A 1WUBA 1GKAA 2YMSA 1QWDA 1RLBE 3RDMA 3NR3A 5AJCA 5AQ6A 1W4TA 3ZUIA 5KIDA 3P6DA 2R73A 1W5RA 1ZNEA 2L68A 3JS1A 2K23A 4YFQA 1GT4A 1ERBA 2AVIA 1IKJA 4BQUA 1IJ8A 4WFVA 4K19A 4GU8A 4NNSA 4YH0A 1HMRA 4IAWA 2KW1A 1SY2A 5D8JA 3RBYA 4N7DA 3DTQA 5EDCA 3D95A 1ZNDA 4GETA 5F6BA 1VWDB 4ORYA 4YGHA 2I5VO 5FQ8E 3OE3A 2Q4NA 5F58A 1B0OA 2LFOA 4PSQA 1HMTA 3VHHA 1E02A 1K3BA 1LCVA 1OPAA 1NP1A 1TW4A 2RN4A 2RTFB 3ZW0B 1Z24A 2HKDA 4ORWA 4PJ2A 5BVSA 5IXGA 1CBSA 1EI5A 3B2HA 4OMWA 2AKQA 4NW4A 2WQ9A 1GXAA 1ADLA 2MJIA 5HCEC 2JGSA 5IRWA 4Y5DA 1X89A 1U0XA 1X71A 1WBIA 2DJFA 1ALBA 4Z2PA 1Y55X 4OMXA 4BX5A 1RXKA 3KVNA 1EQDA 4QRLA 1SWOA 3BDRA 1HMSA 3X00A 2JU7A 1T0VA 3MM0A 3UAQA 4AZMA 2BC3A 4AZOA 1BSQA 1K24A 4FQBB 2AMMX 1H91A 4IB9A 2OY5O 1JJJA 1JYDA 4U9CA 2IZEB 4ZGUA 5B5FA 2OVSA 4OELA 2FR2A 5AJBA 4M6SA 1GGLA 1Y9LA 1Y52X 2ZSCA 5BVQA 1GT1A 1LIDA 3WJFA 4YBUA 3U9PC 4IABA 1R0UA 1LPJA 1CJ5A 4CDEA 1EIIA 3NADA 1VWMB 4GD9A 4DQ3A 1X8UA 2POAA 3FR4A 4A1HA 1JIWI 1S44A 4ZHFA 1EIOA 1KT6A 1SRHA 4ZH6A 5C0NA 1JBHA 1LDOA 1N4JA 1SRGA 1DZJA 1HQPA 1SWDA 1A18A 4N7CA 1OBUA 1X8OA 2WR6A 4CV7A 4YFPA 3LV4A 2X8SA 1VWLB 3L4RA 2A3FX 2OVDA 2AT3X 1HQQA 2RTIB 3IFBA 2A8GA 3ELXA 1NQMA 1BSYA 4U8UN 4BVMA 4XMFA 3CBCA 1SWPA 3CMPA 4JGLA 1VWKB 5CYBA 2X32A 4OKAA 4GGZA 1SWFA 1NQNA 4OEMA 2ACOA 2G7BA 4ZHDA 1MOYA 3V8UA 3CWKA 4U8UM 2NNEA 2OVEA 4YBPA 3MVFA 4GE1A 5FAZA 2JOZA 3FEPA 2AF5A 1SRJA 4TKHA 4C5PA 1GT5A 1SY3A 2A2GA 2P8GA 4O4UA 4BCSA 4EFGA 2G78A 5LKFA 2VFCA 5L8IA 3JSQA 4TQ2A 3F9DA 3Q34A 1SXWA 1YP7A 2FR3A 3NX1A 4M7MA 3C77X 1HXLA 5KHPA 2FKJA 1SWGA 2IZHB 3SZIA 2VFBA 4A8ZA 3WYPA 4EXZA 2X4MA 1DZKA 2W2BA 3C76X 4WFUA 4JHQA 2BT9A 1LICA 1SY1A 2C4IA 2HNXA 2KTSA 3B2JA 3JQOA 5HA1A 3TGAA 3BSZE 3NQKA 3TGCA 1KT5A 5K06A 3CR6A 1FENA 1N9YA 2GTLN 2RTPB 3FLLA 4Y59A 4MISA 3SLJA 1PBOA 1YP6A 1LDQA 3HOEA 1FJ1E 1SXXA 4IBAA 3PP6A 3NBXX 5LJGA 4YFRA 2RTKA 4YVBA 3TGBA 2MO5A 3NX2A 2MM3A 3UEWA 5BVTA 4IRWA 3PH6A 1XKIA 3U0DA 1U18A 3DSZA 4GZVA 2OYBO 3FEKA 2RTGB 2ASNX 3FA7A 2GH7A 2F01A 1HY2A 4IMNA 3AUMO 3WYQA 4ZHCA 1SY0A 3KFGA 1JYJA 2AT6X 2FTBA 2WWPA 4QAEA 1OEKA 3CKFA 2FS6A 3C78X 1S7DA 1ZNHA 2RTLA 3BX7A 5B29A 1ICNA 1I04A 1TOUA 2JW1A 1A3YA 1SREA 5KICA 1MEPA 2FLJA 2HMBA 4ORUA 3WZOA 2PI3O 2FGSA 4BGFA 3FYFA 3SOTA 2IZBA 3GAQA 3HPEA 5B2AO 4XMEA 4ES7A 2Q39A 3P6FA 1VWGB 2RTEB 5CHKA 2FWVA 1VYOA 1OSPO 5IRAA 2EU7X 3E3CA 3FIDA 3KZAA 1E00A 1LELA 1BSOA 3ZI8A 5FQ6E 3T6FA 1LUQA 3U03A 4I3DA 4CDCA 1G5WA 3Q6LA 4DCBA 1LFOA 1QY1A 3UEXA 2IZLB 1VWRB 4ORXA 4YCEA 1MK5A 3KFHA 1LKEA 1NBXA 1OBPA 3QKGA 4HPCA 5HZQA 4D6BA 1G74A 5LJDA 3SZHA 2AL0X 2DJGA 1I05A 3PK2A 4QZTA 5K68A 3WJEA 2WSJA 4L1NA 5FQ7E 3BU1A 1P6PA 4NNTA 1DF3A 3WOVA 1B8EA 3EM0A 1VWIB 1PM1X 5FFHA 1NC9A 5B3MO 1KQWA 1YUPA 3F6ZB 3FR5A 1T8VA 3HWGA 4ORSA 5K67A 1YWCA 1UREA 2HYSA 1LIEA 2QO6A 2IZGB 5D4AA 1SWHA 5BYPA 5FENA 1RXJA 1TXLA 2RCQA 4MVLA 3TF6A 1X8NA 2FRSA 2XSTA 4B55A 2X8FA 2JMBA 2BSZA 1YWBA 2WPUA 3S26A 1LIFA 4QQ1A 3FW5A 3SLTA 1IIUA 3PECA 4MVKA 4TLJA 2WEXA 4QYPA 3VPJE 1BLRA 2WUTA 2O62A 4ZCBA 1EALA 2CM9A 2LKKA 5L8OA 1YWDA 1MX8A 1SWNA 4BX6B 4TJZA 2GTFX 1AELA 5HWZA 2A2UA 3FELA 1KOIA 3EYCA 3AEHA 2LB6A 2RQ0A 1FTPA 1RAVA 3GE2A 5H8TA 2A0AA 1JJXA 5F2BA 1ERXA 1KT7A 5HZ5A 1KT4A 3RDSA 1SRFA 2PY1A 3SAOA 1FEMA 4D6AA 2Q2PA 4YMYA 5IO6A 1UYNX 1GM6A 4WBKA 1Y0GA 4WHIA 2IZIA 4ORRA 5IO5A 1SLEB 4Z6JA 4QZUA 3PQUA 3ZW1B 2I5ZO 4U46A 4GJVA 4Y0PA 2Y32A 1BJ7A 3HOLA 4CPIA 5F7GA 3VG5A 4BX7B 3NPOA 4L3RA 3ZZVA 1T68X 4U8UO 1W6FA 3PPTA 3RSWA 3T2XA 4R0BA 1SWJA 2W2FA 2Y3FA 4O3YA 2QO5A 2DM5A 5HA0A 2OL6O 4ALOA 4CPEA 4CPFA 1QFVA 4GK9A 1GKAB 2C1SA 4O9SA 4CPHB 4Y0SA 3MX7A 4IAXA 1EXSA 3EW1A 4DQ4A 3FMZA 3AKNA 4ODDA 1SWQA 4YGGA 5B10O 4OS0A 1VWJB 3SLOA 4COTA 2R56A 1TOWA 4LZVA 4GH7A 3D96A 1SLGB 1PMPA 1RSUB 4FBOA 1HN2A 3PDFA 2JU8A 1ICMA 3KFFA 2FHNX 1I06A 4QNIA 2WEWA 1FELA 1TVQA 4O49A 3RE5A 2RTJA 1X8PA 3RZYA 1VWNB 2CBRA 4XMGA 1FDQA 4ZH9A 1CBQA 1STPA 3VG6A 1VWEB 3KFIA 2A5CA 2AH7X 5HZ8A 3VG3A 1AB0A 1VWQB 2QO4A 4QYNA 2RTDB 2LBVA 2F09A 2GTLO 4HPDA 4MIRA 3K3LA 2Q9SA 2G5LA 2YG2A 4O4OA 4O4XA 5LKEA 1AVGI 1OPBA 5LJBA 2X46A 1KL4A 3AKMA 1DF8A 1CBRA 3O22A 5CSEA 1KGLA 3RE6A 1GX9A 4CDDA 5L8NA 2MF6A 5D47A 1G7NA 2NP1A 1OEJA 1SWEA 2XKLA 1LCZA 1MVGA 5H9AA 3WXQA 3ZW0A
chains in the Genus database with same CATH topology
1SWCA 1LUQA 2RTOB 5IRWA 2JGSA 4Z2VA 4Y5DA 2IZLB 3RDXA 1I9HA 1WBIA 1VWRB 4Z2PA 1Y55X 4BX5A 1AVDA 1MK5A 1RXKA 1NBXA 1SWOA 1SWBA 1AVEA 3X00A 1STSB 3SZHA 4BBOA 3MM0A 5K68A 2RTCB 3PK2A 2BC3A 1PTSA 1VWHB 2IZFB 1Y53X 1SLDB 2IZEB 1VWIB 4EKVA 3VHMA 5B5FA 5IRUA 2RTRB 1VWFB 1NC9A 3RY2A 1RXHA 1VWCB 1Y52X 2ZSCA 5K67A 2IZGB 1KL3A 1SWHA 1RXJA 1VWMB 3MG5A 4GD9A 1MM9A 1VWBB 2IZAA 1SWLA 2OFAA 2UYWA 1SRHA 4BX5B 2WPUA 2IZDB 1LDOA 1N4JA 1SRGA 1SWRA 1SLFB 1SWDA 2OFBA 2CAMA 1N9MA 5JD2A 4I60A 2FHLA 1SWNA 4BX6B 1VWLB 4DNEA 1HQQA 2IZKA 2RTIB 2A8GA 4JNJA 1NQMA 4GDAA 2OF9A 3EW2A 1RSTB 1SWPA 2C1QA 1VWKB 5B5GA 4BX6A 2OF8A 4GGZA 1SWFA 1NQNA 2RTNB 4OKAA 3T2WA 1MOYA 3SZJA 1RAVA 1SRIA 1SWTA 1N7YA 1HXZA 5F2BA 2IZCB 3WZQA 4CPHA 4Z27A 1SRJA 1SRFA 3RDSA 3RDUA 4BCSA 2RTAA 2IZIA 1SWSA 3FDCA 1SLEB 1HXLA 2Y3EA 4Z6JA 1SWGA 2IZHB 3SZIA 3WYPA 4U46A 4GJVA 1STRB 2Y32A 1KL5A 2RTHB 4JHQA 4CPIA 2C4IA 1VWPB 1SWKA 2RTBB 4BX7B 4Z2OA 2QCBA 3VHIA 4GGRA 1N43A 2RTQB 3T2XA 4Z28A 1SWJA 1N9YA 2RTPB 2Y3FA 4BX7A 4Y59A 4BJ8A 4CPEA 1VWAB 4CPFA 1LDQA 2A5BA 4JO6A 2C1SA 3RDOA 3RY1A 4CPHB 4GJSA 3EW1A 2RTKA 4YVBA 1SWQA 1VWJB 4IRWA 3T6FA 4GGTA 3RDMA 1SLGB 1RSUB 1SWUA 2UZ2A 3T6LA 2RTGB 2GH7A 2F01A 1HY2A 2FHNX 3WYQA 3RE5A 2AVIA 2RTJA 1IJ8A 1SWAA 1VWNB 1LCWA 3WZNA 1NDJA 2RTLA 3RDQA 1STPA 1SREA 1VWEB 1MEPA 5L3YA 2A5CA 3WZOA 2RTMA 1VWOB 1VWDB 1VWQB 2RTDB 2IZBA 2G5LA 1KFFA 3VHHA 3WZPA 1LCVA 1VWGB 1KL4A 2RTEB 1DF8A 2RTFB 1VYOA 5CHKA 5CSEA 3RE6A 5IRAA 2MF6A 1SWEA 1LELA 1LCZA 3VGWA 2IZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWC A;  1LUQ A;  2RTO B;  5IRW A;  2JGS A;  4Z2V A;  4Y5D A;  2IZL B;  3RDX A;  1I9H A;  1WBI A;  1VWR B;  4Z2P A;  1Y55 X;  4BX5 A;  1AVD A;  1MK5 A;  1RXK A;  1NBX A;  1SWO A;  1SWB A;  1AVE A;  3X00 A;  1STS B;  3SZH A;  4BBO A;  3MM0 A;  5K68 A;  2RTC B;  3PK2 A;  2BC3 A;  1PTS A;  1VWH B;  2IZF B;  1Y53 X;  1SLD B;  2IZE B;  1VWI B;  4EKV A;  3VHM A;  5B5F A;  5IRU A;  2RTR B;  1VWF B;  1NC9 A;  3RY2 A;  1RXH A;  1VWC B;  1Y52 X;  2ZSC A;  5K67 A;  2IZG B;  1KL3 A;  1SWH A;  1RXJ A;  1VWM B;  3MG5 A;  4GD9 A;  1MM9 A;  1VWB B;  2IZA A;  1SWL A;  2OFA A;  2UYW A;  1SRH A;  4BX5 B;  2WPU A;  2IZD B;  1LDO A;  1N4J A;  1SRG A;  1SWR A;  1SLF B;  1SWD A;  2OFB A;  2CAM A;  1N9M A;  5JD2 A;  4I60 A;  2FHL A;  1SWN A;  4BX6 B;  1VWL B;  4DNE A;  1HQQ A;  2IZK A;  2RTI B;  2A8G A;  4JNJ A;  1NQM A;  4GDA A;  2OF9 A;  3EW2 A;  1RST B;  1SWP A;  2C1Q A;  1VWK B;  5B5G A;  4BX6 A;  2OF8 A;  4GGZ A;  1SWF A;  1NQN A;  2RTN B;  4OKA A;  3T2W A;  1MOY A;  3SZJ A;  1RAV A;  1SRI A;  1SWT A;  1N7Y A;  1HXZ A;  5F2B A;  2IZC B;  3WZQ A;  4CPH A;  4Z27 A;  1SRJ A;  1SRF A;  3RDS A;  3RDU A;  4BCS A;  2RTA A;  2IZI A;  1SWS A;  3FDC A;  1SLE B;  1HXL A;  2Y3E A;  4Z6J A;  1SWG A;  2IZH B;  3SZI A;  3WYP A;  4U46 A;  4GJV A;  1STR B;  2Y32 A;  1KL5 A;  2RTH B;  4JHQ A;  4CPI A;  2C4I A;  1VWP B;  1SWK A;  2RTB B;  4BX7 B;  4Z2O A;  2QCB A;  3VHI A;  4GGR A;  1N43 A;  2RTQ B;  3T2X A;  4Z28 A;  1SWJ A;  1N9Y A;  2RTP B;  2Y3F A;  4BX7 A;  4Y59 A;  4BJ8 A;  4CPE A;  1VWA B;  4CPF A;  1LDQ A;  2A5B A;  4JO6 A;  2C1S A;  3RDO A;  3RY1 A;  4CPH B;  4GJS A;  3EW1 A;  2RTK A;  4YVB A;  1SWQ A;  1VWJ B;  4IRW A;  3T6F A;  4GGT A;  3RDM A;  1SLG B;  1RSU B;  1SWU A;  2UZ2 A;  3T6L A;  2RTG B;  2GH7 A;  2F01 A;  1HY2 A;  2FHN X;  3WYQ A;  3RE5 A;  2AVI A;  2RTJ A;  1IJ8 A;  1SWA A;  1VWN B;  1LCW A;  3WZN A;  1NDJ A;  2RTL A;  3RDQ A;  1STP A;  1SRE A;  1VWE B;  1MEP A;  5L3Y A;  2A5C A;  3WZO A;  2RTM A;  1VWO B;  1VWD B;  1VWQ B;  2RTD B;  2IZB A;  2G5L A;  1KFF A;  3VHH A;  3WZP A;  1LCV A;  1VWG B;  1KL4 A;  2RTE B;  1DF8 A;  2RTF B;  1VYO A;  5CHK A;  5CSE A;  3RE6 A;  5IRA A;  2MF6 A;  1SWE A;  1LEL A;  1LCZ A;  3VGW A;  2IZJ A; 
#chains in the Genus database with same CATH topology
 4CDF A;  2RTO B;  1CRB A;  3FA6 A;  4Y0Q A;  4UU3 A;  4Z2V A;  1L6M A;  3S5X A;  2MWH A;  3RDX A;  1I9H A;  2HLV A;  5B5G A;  3STK A;  3WJD A;  2HZR A;  1E5P A;  1MUP A;  4YKO A;  4CK4 A;  1EPA A;  4EEJ A;  3G7X A;  3EBK A;  5EED A;  1STS B;  2QMI A;  3HWF A;  3PED A;  3P6E A;  5HZ6 A;  3F8A A;  3B2L A;  3RKG A;  5IO7 A;  5LJC A;  2BS5 A;  1Y53 X;  4IMO A;  3ZW2 A;  1GX8 A;  2FS7 A;  4EKV A;  3OBL A;  4Y0R A;  5IRU A;  3VHM A;  2RTR B;  2CBS A;  1HBQ A;  1FE3 A;  3MBT A;  4KCA A;  1RXH A;  1N0S A;  3KQ0 A;  2L67 A;  1NGL A;  2JN3 A;  4NLJ A;  1U17 A;  2X45 A;  1KT3 A;  3MG5 A;  3RWX A;  1MM9 A;  2HZQ A;  1VWB B;  2RCT A;  5HZ9 A;  3APV A;  1GT3 A;  4GNW A;  3TZS A;  1SWR A;  2OFB A;  1SLF B;  1Y9T A;  2BHV A;  3BS2 A;  3BY0 A;  1ACD A;  2CAM A;  3STM X;  4I60 A;  1JQP A;  2N93 A;  3ZW1 A;  1UYO X;  2FHL A;  2Z4I A;  5D45 A;  5B27 A;  4AZR A;  2ANS A;  4DNE A;  3O2Y A;  5H9K A;  2KT4 B;  3CQN A;  1O1V A;  1XCA A;  3NP1 A;  2OF8 A;  1O8V A;  3QQ2 A;  4KT5 A;  5JR8 A;  3T2W A;  1YIV A;  4LKT A;  3O19 A;  3SZJ A;  1ZNL A;  1LIB A;  1SWT A;  4CPH A;  2IZC B;  4O3X B;  1S2P A;  2QM9 A;  4O3Z A;  4Z27 A;  1VYG A;  2ZAG A;  4GDZ A;  5HCC C;  4O4S A;  2OY1 O;  2W2A A;  1LF7 A;  3D9W A;  3LTW A;  4HPB A;  4ON1 A;  4OS8 A;  1QY0 A;  3CKG A;  2RTA A;  2GC9 A;  1KXO A;  3EMM A;  3P02 A;  2QOM A;  3FDC A;  1ZRY A;  4CSB A;  2GJ5 A;  1EW3 A;  3B2K A;  3D4R A;  1KL5 A;  4YKM A;  2R74 A;  3S5V A;  1B4M A;  3ZUO A;  1SWK A;  4HFO A;  4Z2O A;  2X56 A;  4U3Q A;  4BOE A;  2K62 A;  2OZQ A;  2X34 A;  4FGI B;  2RTQ B;  4GGR A;  4Z28 A;  3VHI A;  4YGZ A;  5EZ2 A;  4OS3 A;  2E4J A;  1VWA B;  3RDO A;  5H9N A;  4AZQ A;  3RY1 A;  2IFB A;  2AT5 X;  2Z4H A;  3EBW A;  3FA8 A;  4QGX A;  2BS6 A;  1HBP A;  1QAB E;  3CBS A;  1DC9 A;  3OD9 A;  4INN A;  4ZGF A;  3APU A;  4NV8 A;  2KTD A;  4GGT A;  3I17 A;  4KC8 A;  5HTE A;  1KZX A;  5B11 O;  1SWU A;  2UZ2 A;  3T6L A;  4NYR A;  4I3B A;  4GNY A;  5F1E A;  4ML7 B;  5EEE A;  4RUN A;  4EQA C;  1BM5 A;  1SMP I;  2CM4 A;  1CBI A;  2G8C O;  5F6Z A;  3P6C A;  4RUU A;  1SWA A;  1PEE A;  3APW A;  4GKC A;  1B56 A;  1LCW A;  4HWM A;  1NDJ A;  1IFB A;  1QFT A;  3RDQ A;  3WZN A;  1EUO A;  1ZNK A;  4LKP A;  3WJC A;  5LJE A;  5L3Y A;  3B2I A;  1OBQ A;  4YDB A;  2RTM A;  4XMC A;  1VWO B;  1BEB A;  1EPB A;  1MX7 A;  3LHN A;  3NQ3 A;  3PQS A;  3VE1 A;  4A1Y A;  1KFF A;  5HAE A;  3WZP A;  2Q2M A;  1NP4 A;  3PH5 A;  4MVI A;  1AQB A;  3WBG A;  1A2D A;  4XMD A;  4ARH A;  3ZWE A;  2AT0 X;  4IB7 A;  3H3I A;  3HWE A;  3OJY C;  4NP1 A;  4XMH A;  4KC7 A;  3ELZ A;  2OY7 A;  3VGW A;  4AW8 A;  4EDE A;  3N91 A;  1I4U A;  4ZFX A;  2IZJ A;  1JV4 A;  1BRQ A;  1SWC A;  1BBP A;  3HWD A;  3APX A;  1BWY A;  4A60 A;  3HTY A;  1DFV A;  3P6G A;  4KH8 A;  1AVD A;  3P24 A;  3WVM A;  2X55 A;  1PBY A;  1SWB A;  2OFM X;  2OL8 O;  1AVE A;  1MDC A;  4I95 A;  4O3W A;  4BBO A;  3EC5 A;  1DZP A;  3HK1 A;  2RTC B;  4GRJ A;  2CZT A;  2F73 A;  2RD7 C;  1X8Q A;  5EPQ A;  1PTS A;  1VWH B;  2IZF B;  3P6H A;  3UEV A;  1IFC A;  1SLD B;  1I78 A;  4I3C A;  2FT9 A;  2LA7 A;  4NV7 A;  5HTD A;  1JZU A;  4AYH A;  4ZHH A;  1VWF B;  3NQ9 A;  3RY2 A;  2QOS C;  1VWC B;  2JU3 A;  1ZNG A;  1DZM A;  2OVA A;  5HBS A;  2OY8 A;  3VG4 A;  4FBR A;  1OEE A;  4TKB A;  1KL3 A;  5H9L A;  4ZHG A;  1G85 A;  1JMX A;  1JJU A;  2OFR X;  2IZA A;  1SWL A;  2OFA A;  2UYW A;  4IB6 A;  1YWA A;  4BX5 B;  2IZD B;  5DPQ A;  1E06 A;  1DV9 A;  2X8T A;  3WJG A;  1SXY A;  2MHD A;  1D2U A;  2ALL X;  2CZU A;  2NND A;  3BX8 A;  4NYQ A;  3VG2 A;  1N9M A;  4ID2 A;  5JD2 A;  1A57 A;  1KQX A;  5LJH A;  4I9S A;  4ZJ0 A;  2KD2 A;  5LJK A;  1BRP A;  1SXU A;  4ZR2 A;  2IZK A;  4JNJ A;  4TNN A;  2AT8 X;  4GDA A;  4YDA A;  2OF9 A;  1LNM A;  3EW2 A;  4MVE A;  4ALB A;  4AZN A;  1RST B;  2C1Q A;  4YCH A;  1QY2 A;  5D48 A;  3VE2 A;  4BX6 A;  2WQA E;  2RTN B;  1IKE A;  2A13 A;  2NNQ A;  4MEE A;  4HPA A;  1SRI A;  4I6S A;  1N7Y A;  1HXZ A;  3VU1 A;  1D3S A;  4GUZ A;  3WZQ A;  2GTL M;  1KZW A;  5AEO A;  3ZQ3 A;  3S60 A;  5HCD C;  4LQZ A;  1VPR A;  3D97 A;  3RDU A;  4QGV A;  3WJB A;  4QGW A;  3FIQ A;  4FBV A;  5DG4 A;  4I9R A;  1O1U A;  2LBA A;  3FEN A;  1QG5 A;  3BLG A;  4IB8 A;  4TKJ A;  1SWS A;  4LZU A;  4UU2 A;  3UEU A;  1SA8 A;  2Y3E A;  3FR2 A;  1IW2 A;  3FA9 A;  2M4L A;  1STR B;  2RTH B;  2FKG A;  4AZP A;  2G79 A;  1QQS A;  1VWP B;  4NLI A;  1RBP A;  2L5P A;  2L9C A;  2RTB B;  3BRN A;  1E2T A;  2QCB A;  1GX3 A;  5CE4 A;  1JMZ A;  2BLG A;  1N43 A;  1VYF A;  1ML7 A;  3BU9 A;  4BX7 A;  3CQR A;  2RA6 A;  2ZAI A;  3FW4 A;  4BJ8 A;  2VDF A;  2ACP X;  3I0A A;  2A5B A;  4JO6 A;  4KII A;  4GJS A;  5EDB A;  1UZ2 X;  2OL7 A;  3T1D A;  3IA8 A;  3STN A;  3VG7 A;  1WUB A;  1GKA A;  2YMS A;  1QWD A;  1RLB E;  3RDM A;  3NR3 A;  5AJC A;  5AQ6 A;  1W4T A;  3ZUI A;  5KID A;  3P6D A;  2R73 A;  1W5R A;  1ZNE A;  2L68 A;  3JS1 A;  2K23 A;  4YFQ A;  1GT4 A;  1ERB A;  2AVI A;  1IKJ A;  4BQU A;  1IJ8 A;  4WFV A;  4K19 A;  4GU8 A;  4NNS A;  4YH0 A;  1HMR A;  4IAW A;  2KW1 A;  1SY2 A;  5D8J A;  3RBY A;  4N7D A;  3DTQ A;  5EDC A;  3D95 A;  1ZND A;  4GET A;  5F6B A;  1VWD B;  4ORY A;  4YGH A;  2I5V O;  5FQ8 E;  3OE3 A;  2Q4N A;  5F58 A;  1B0O A;  2LFO A;  4PSQ A;  1HMT A;  3VHH A;  1E02 A;  1K3B A;  1LCV A;  1OPA A;  1NP1 A;  1TW4 A;  2RN4 A;  2RTF B;  3ZW0 B;  1Z24 A;  2HKD A;  4ORW A;  4PJ2 A;  5BVS A;  5IXG A;  1CBS A;  1EI5 A;  3B2H A;  4OMW A;  2AKQ A;  4NW4 A;  2WQ9 A;  1GXA A;  1ADL A;  2MJI A;  5HCE C;  2JGS A;  5IRW A;  4Y5D A;  1X89 A;  1U0X A;  1X71 A;  1WBI A;  2DJF A;  1ALB A;  4Z2P A;  1Y55 X;  4OMX A;  4BX5 A;  1RXK A;  3KVN A;  1EQD A;  4QRL A;  1SWO A;  3BDR A;  1HMS A;  3X00 A;  2JU7 A;  1T0V A;  3MM0 A;  3UAQ A;  4AZM A;  2BC3 A;  4AZO A;  1BSQ A;  1K24 A;  4FQB B;  2AMM X;  1H91 A;  4IB9 A;  2OY5 O;  1JJJ A;  1JYD A;  4U9C A;  2IZE B;  4ZGU A;  5B5F A;  2OVS A;  4OEL A;  2FR2 A;  5AJB A;  4M6S A;  1GGL A;  1Y9L A;  1Y52 X;  2ZSC A;  5BVQ A;  1GT1 A;  1LID A;  3WJF A;  4YBU A;  3U9P C;  4IAB A;  1R0U A;  1LPJ A;  1CJ5 A;  4CDE A;  1EII A;  3NAD A;  1VWM B;  4GD9 A;  4DQ3 A;  1X8U A;  2POA A;  3FR4 A;  4A1H A;  1JIW I;  1S44 A;  4ZHF A;  1EIO A;  1KT6 A;  1SRH A;  4ZH6 A;  5C0N A;  1JBH A;  1LDO A;  1N4J A;  1SRG A;  1DZJ A;  1HQP A;  1SWD A;  1A18 A;  4N7C A;  1OBU A;  1X8O A;  2WR6 A;  4CV7 A;  4YFP A;  3LV4 A;  2X8S A;  1VWL B;  3L4R A;  2A3F X;  2OVD A;  2AT3 X;  1HQQ A;  2RTI B;  3IFB A;  2A8G A;  3ELX A;  1NQM A;  1BSY A;  4U8U N;  4BVM A;  4XMF A;  3CBC A;  1SWP A;  3CMP A;  4JGL A;  1VWK B;  5CYB A;  2X32 A;  4OKA A;  4GGZ A;  1SWF A;  1NQN A;  4OEM A;  2ACO A;  2G7B A;  4ZHD A;  1MOY A;  3V8U A;  3CWK A;  4U8U M;  2NNE A;  2OVE A;  4YBP A;  3MVF A;  4GE1 A;  5FAZ A;  2JOZ A;  3FEP A;  2AF5 A;  1SRJ A;  4TKH A;  4C5P A;  1GT5 A;  1SY3 A;  2A2G A;  2P8G A;  4O4U A;  4BCS A;  4EFG A;  2G78 A;  5LKF A;  2VFC A;  5L8I A;  3JSQ A;  4TQ2 A;  3F9D A;  3Q34 A;  1SXW A;  1YP7 A;  2FR3 A;  3NX1 A;  4M7M A;  3C77 X;  1HXL A;  5KHP A;  2FKJ A;  1SWG A;  2IZH B;  3SZI A;  2VFB A;  4A8Z A;  3WYP A;  4EXZ A;  2X4M A;  1DZK A;  2W2B A;  3C76 X;  4WFU A;  4JHQ A;  2BT9 A;  1LIC A;  1SY1 A;  2C4I A;  2HNX A;  2KTS A;  3B2J A;  3JQO A;  5HA1 A;  3TGA A;  3BSZ E;  3NQK A;  3TGC A;  1KT5 A;  5K06 A;  3CR6 A;  1FEN A;  1N9Y A;  2GTL N;  2RTP B;  3FLL A;  4Y59 A;  4MIS A;  3SLJ A;  1PBO A;  1YP6 A;  1LDQ A;  3HOE A;  1FJ1 E;  1SXX A;  4IBA A;  3PP6 A;  3NBX X;  5LJG A;  4YFR A;  2RTK A;  4YVB A;  3TGB A;  2MO5 A;  3NX2 A;  2MM3 A;  3UEW A;  5BVT A;  4IRW A;  3PH6 A;  1XKI A;  3U0D A;  1U18 A;  3DSZ A;  4GZV A;  2OYB O;  3FEK A;  2RTG B;  2ASN X;  3FA7 A;  2GH7 A;  2F01 A;  1HY2 A;  4IMN A;  3AUM O;  3WYQ A;  4ZHC A;  1SY0 A;  3KFG A;  1JYJ A;  2AT6 X;  2FTB A;  2WWP A;  4QAE A;  1OEK A;  3CKF A;  2FS6 A;  3C78 X;  1S7D A;  1ZNH A;  2RTL A;  3BX7 A;  5B29 A;  1ICN A;  1I04 A;  1TOU A;  2JW1 A;  1A3Y A;  1SRE A;  5KIC A;  1MEP A;  2FLJ A;  2HMB A;  4ORU A;  3WZO A;  2PI3 O;  2FGS A;  4BGF A;  3FYF A;  3SOT A;  2IZB A;  3GAQ A;  3HPE A;  5B2A O;  4XME A;  4ES7 A;  2Q39 A;  3P6F A;  1VWG B;  2RTE B;  5CHK A;  2FWV A;  1VYO A;  1OSP O;  5IRA A;  2EU7 X;  3E3C A;  3FID A;  3KZA A;  1E00 A;  1LEL A;  1BSO A;  3ZI8 A;  5FQ6 E;  3T6F A;  1LUQ A;  3U03 A;  4I3D A;  4CDC A;  1G5W A;  3Q6L A;  4DCB A;  1LFO A;  1QY1 A;  3UEX A;  2IZL B;  1VWR B;  4ORX A;  4YCE A;  1MK5 A;  3KFH A;  1LKE A;  1NBX A;  1OBP A;  3QKG A;  4HPC A;  5HZQ A;  4D6B A;  1G74 A;  5LJD A;  3SZH A;  2AL0 X;  2DJG A;  1I05 A;  3PK2 A;  4QZT A;  5K68 A;  3WJE A;  2WSJ A;  4L1N A;  5FQ7 E;  3BU1 A;  1P6P A;  4NNT A;  1DF3 A;  3WOV A;  1B8E A;  3EM0 A;  1VWI B;  1PM1 X;  5FFH A;  1NC9 A;  5B3M O;  1KQW A;  1YUP A;  3F6Z B;  3FR5 A;  1T8V A;  3HWG A;  4ORS A;  5K67 A;  1YWC A;  1URE A;  2HYS A;  1LIE A;  2QO6 A;  2IZG B;  5D4A A;  1SWH A;  5BYP A;  5FEN A;  1RXJ A;  1TXL A;  2RCQ A;  4MVL A;  3TF6 A;  1X8N A;  2FRS A;  2XST A;  4B55 A;  2X8F A;  2JMB A;  2BSZ A;  1YWB A;  2WPU A;  3S26 A;  1LIF A;  4QQ1 A;  3FW5 A;  3SLT A;  1IIU A;  3PEC A;  4MVK A;  4TLJ A;  2WEX A;  4QYP A;  3VPJ E;  1BLR A;  2WUT A;  2O62 A;  4ZCB A;  1EAL A;  2CM9 A;  2LKK A;  5L8O A;  1YWD A;  1MX8 A;  1SWN A;  4BX6 B;  4TJZ A;  2GTF X;  1AEL A;  5HWZ A;  2A2U A;  3FEL A;  1KOI A;  3EYC A;  3AEH A;  2LB6 A;  2RQ0 A;  1FTP A;  1RAV A;  3GE2 A;  5H8T A;  2A0A A;  1JJX A;  5F2B A;  1ERX A;  1KT7 A;  5HZ5 A;  1KT4 A;  3RDS A;  1SRF A;  2PY1 A;  3SAO A;  1FEM A;  4D6A A;  2Q2P A;  4YMY A;  5IO6 A;  1UYN X;  1GM6 A;  4WBK A;  1Y0G A;  4WHI A;  2IZI A;  4ORR A;  5IO5 A;  1SLE B;  4Z6J A;  4QZU A;  3PQU A;  3ZW1 B;  2I5Z O;  4U46 A;  4GJV A;  4Y0P A;  2Y32 A;  1BJ7 A;  3HOL A;  4CPI A;  5F7G A;  3VG5 A;  4BX7 B;  3NPO A;  4L3R A;  3ZZV A;  1T68 X;  4U8U O;  1W6F A;  3PPT A;  3RSW A;  3T2X A;  4R0B A;  1SWJ A;  2W2F A;  2Y3F A;  4O3Y A;  2QO5 A;  2DM5 A;  5HA0 A;  2OL6 O;  4ALO A;  4CPE A;  4CPF A;  1QFV A;  4GK9 A;  1GKA B;  2C1S A;  4O9S A;  4CPH B;  4Y0S A;  3MX7 A;  4IAX A;  1EXS A;  3EW1 A;  4DQ4 A;  3FMZ A;  3AKN A;  4ODD A;  1SWQ A;  4YGG A;  5B10 O;  4OS0 A;  1VWJ B;  3SLO A;  4COT A;  2R56 A;  1TOW A;  4LZV A;  4GH7 A;  3D96 A;  1SLG B;  1PMP A;  1RSU B;  4FBO A;  1HN2 A;  3PDF A;  2JU8 A;  1ICM A;  3KFF A;  2FHN X;  1I06 A;  4QNI A;  2WEW A;  1FEL A;  1TVQ A;  4O49 A;  3RE5 A;  2RTJ A;  1X8P A;  3RZY A;  1VWN B;  2CBR A;  4XMG A;  1FDQ A;  4ZH9 A;  1CBQ A;  1STP A;  3VG6 A;  1VWE B;  3KFI A;  2A5C A;  2AH7 X;  5HZ8 A;  3VG3 A;  1AB0 A;  1VWQ B;  2QO4 A;  4QYN A;  2RTD B;  2LBV A;  2F09 A;  2GTL O;  4HPD A;  4MIR A;  3K3L A;  2Q9S A;  2G5L A;  2YG2 A;  4O4O A;  4O4X A;  5LKE A;  1AVG I;  1OPB A;  5LJB A;  2X46 A;  1KL4 A;  3AKM A;  1DF8 A;  1CBR A;  3O22 A;  5CSE A;  1KGL A;  3RE6 A;  1GX9 A;  4CDD A;  5L8N A;  2MF6 A;  5D47 A;  1G7N A;  2NP1 A;  1OEJ A;  1SWE A;  2XKL A;  1LCZ A;  1MVG A;  5H9A A;  3WXQ A;  3ZW0 A; 
#chains in the Genus database with same CATH homology
 1SWC A;  1LUQ A;  2RTO B;  5IRW A;  2JGS A;  4Z2V A;  4Y5D A;  2IZL B;  3RDX A;  1I9H A;  1WBI A;  1VWR B;  4Z2P A;  1Y55 X;  4BX5 A;  1AVD A;  1MK5 A;  1RXK A;  1NBX A;  1SWO A;  1SWB A;  1AVE A;  3X00 A;  1STS B;  3SZH A;  4BBO A;  3MM0 A;  5K68 A;  2RTC B;  3PK2 A;  2BC3 A;  1PTS A;  1VWH B;  2IZF B;  1Y53 X;  1SLD B;  2IZE B;  1VWI B;  4EKV A;  3VHM A;  5B5F A;  5IRU A;  2RTR B;  1VWF B;  1NC9 A;  3RY2 A;  1RXH A;  1VWC B;  1Y52 X;  2ZSC A;  5K67 A;  2IZG B;  1KL3 A;  1SWH A;  1RXJ A;  1VWM B;  3MG5 A;  4GD9 A;  1MM9 A;  1VWB B;  2IZA A;  1SWL A;  2OFA A;  2UYW A;  1SRH A;  4BX5 B;  2WPU A;  2IZD B;  1LDO A;  1N4J A;  1SRG A;  1SWR A;  1SLF B;  1SWD A;  2OFB A;  2CAM A;  1N9M A;  5JD2 A;  4I60 A;  2FHL A;  1SWN A;  4BX6 B;  1VWL B;  4DNE A;  1HQQ A;  2IZK A;  2RTI B;  2A8G A;  4JNJ A;  1NQM A;  4GDA A;  2OF9 A;  3EW2 A;  1RST B;  1SWP A;  2C1Q A;  1VWK B;  5B5G A;  4BX6 A;  2OF8 A;  4GGZ A;  1SWF A;  1NQN A;  2RTN B;  4OKA A;  3T2W A;  1MOY A;  3SZJ A;  1RAV A;  1SRI A;  1SWT A;  1N7Y A;  1HXZ A;  5F2B A;  2IZC B;  3WZQ A;  4CPH A;  4Z27 A;  1SRJ A;  1SRF A;  3RDS A;  3RDU A;  4BCS A;  2RTA A;  2IZI A;  1SWS A;  3FDC A;  1SLE B;  1HXL A;  2Y3E A;  4Z6J A;  1SWG A;  2IZH B;  3SZI A;  3WYP A;  4U46 A;  4GJV A;  1STR B;  2Y32 A;  1KL5 A;  2RTH B;  4JHQ A;  4CPI A;  2C4I A;  1VWP B;  1SWK A;  2RTB B;  4BX7 B;  4Z2O A;  2QCB A;  3VHI A;  4GGR A;  1N43 A;  2RTQ B;  3T2X A;  4Z28 A;  1SWJ A;  1N9Y A;  2RTP B;  2Y3F A;  4BX7 A;  4Y59 A;  4BJ8 A;  4CPE A;  1VWA B;  4CPF A;  1LDQ A;  2A5B A;  4JO6 A;  2C1S A;  3RDO A;  3RY1 A;  4CPH B;  4GJS A;  3EW1 A;  2RTK A;  4YVB A;  1SWQ A;  1VWJ B;  4IRW A;  3T6F A;  4GGT A;  3RDM A;  1SLG B;  1RSU B;  1SWU A;  2UZ2 A;  3T6L A;  2RTG B;  2GH7 A;  2F01 A;  1HY2 A;  2FHN X;  3WYQ A;  3RE5 A;  2AVI A;  2RTJ A;  1IJ8 A;  1SWA A;  1VWN B;  1LCW A;  3WZN A;  1NDJ A;  2RTL A;  3RDQ A;  1STP A;  1SRE A;  1VWE B;  1MEP A;  5L3Y A;  2A5C A;  3WZO A;  2RTM A;  1VWO B;  1VWD B;  1VWQ B;  2RTD B;  2IZB A;  2G5L A;  1KFF A;  3VHH A;  3WZP A;  1LCV A;  1VWG B;  1KL4 A;  2RTE B;  1DF8 A;  2RTF B;  1VYO A;  5CHK A;  5CSE A;  3RE6 A;  5IRA A;  2MF6 A;  1SWE A;  1LEL A;  1LCZ A;  3VGW A;  2IZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...