1RXPA

Structure of trypsin (orthorhombic) with 1-(4-tert-butylcarbamoyl- piperazine-1-carbonyl)-3-(3-guanidino-propyl)-4-oxo-azetidine-2-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solid-phase synthesis and SAR of 4-carboxy-2-azetidinone mechanism-based tryptase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rxpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rxpA02
1C5XB 1Y3UA 2PKAA 3BG8A 1E35B 4CRFA 1TMTH 1JIRA 1FQ3A 1MU6B 3F9GA 3PYHA 3QTOH 3LGWA 3UWIA 2HPPH 1YPJH 1SGFA 3P8OA 1UTNA 1CA0C 1ZJDA 4HGCA 2TGPZ 4B2BA 1BZXE 2WYGA 1XUKA 3ODDA 4FUBA 3SNEA 3BTEE 2VIVA 4X8UH 3RMOH 1MMJN 3RXRA 3UUZA 2H1UA 1ZRKA 2Y82A 3QZRA 1YPHE 4CH8B 4AGKA 1O2TA 2C8ZB 1O3DA 3PWBA 4NIVA 1GBDA 1MTWA 4UFGH 3UR9A 2O9QA 1O34A 1EZXC 1S0QA 1S6HA 1RRKA 4Y0ZE 1XUIA 4A6LA 4DIIH 1OOKB 2ASUB 1D9IA 2BDAA 2ZHEH 2PTCE 4MDSA 1BBRE 1TNIA 4NWLA 2RDLA 2ZDAH 4E06H 1O2VA 2CHAB 1PPZA 5FX6A 1G36A 2GP9B 1BTPA 4Y11E 1QB1A 5AVDA 1TB6H 2SGQE 1CA0B 3SN8A 1NRQH 4INLA 4O97A 1FN6A 4J1YA 4O3TA 5DP6A 2ZZUH 4KTCA 4K1TA 2Y5FA 3MU8A 2ZGCA 5EPNA 1P04A 2OLGA 4J2YB 1BHXF 3PWCA 2JH6D 1HAOH 1PQ7A 2G55A 1P2MA 3ZZ4A 3QX5H 3EDXB 1GHYH 1CBWB 1ELTA 2BZAA 1F0RA 1JWTA 1AIXH 4BOHA 1TOMH 2STBE 1AFEH 2ZHDA 2PKAB 2XW9A 4YESB 1C5TA 1HDTH 2ODYB 1GJBB 1O2QA 1O5DH 1IQEA 4H4FA 4Y8ZA 3A7ZA 3RXQA 3UNSA 4ABBA 4U32A 2FM2A 1GG6B 8LPRA 2GV7A 3ZVDA 1C5NH 1QBVH 1S85A 3MH5A 3ZZDA 5A0CA 1L0ZA 4WVPE 2OBQA 2J95A 3BTWE 3FANA 3UOPA 5JBTA 4RN6A 2A4GA 1DX5M 2XRCA 2AMQA 8ESTE 2G51A 2ODQA 4MVNA 3HKIB 2D8WA 1DUAA 4ASHA 3P6ZB 3PMJA 1A61H 4Y79A 5EU8A 1EKBB 1GJCB 2K1QA 4DIHH 2H2ZA 1IQNA 4MPUA 1YBWA 3PV4A 5FAHA 4ZKOU 2W26A 3E1XB 2F9PA 1QB6A 2A7JA 1B5GH 5CHAB 1XXFA 4GCHG 5HMAA 1P9UA 1DSTA 4INHA 5EG4A 1GGDB 1RTFB 3U8TH 1C2MA 1O5GH 1AD8H 5FXLA 2BD3A 5GXPA 2WPMS 4X2YA 3HK6B 2CJIA 1ELFA 1O3NA 1RD3B 3GY8A 1NRRH 1HJAB 4Y7BA 3LJOA 1LVOA 1G3BA 4E7NA 1LDTT 3OTJE 1TABE 1JIMA 4ISHH 1LHCH 3F68H 4Q80A 3RC4A 1HAVB 3O8BA 1FPCH 1BTHH 2FIRH 1YLCA 3RMNH 1O3BA 4GLYA 1DE7H 1HIAB 1ZTLA 3P92A 1P2QA 7GCHG 1VZQH 1C1QA 3D23A 3AW1A 5HXFA 2VWNA 1W10U 1QL8A 1TRYA 1SC8U 1UTMA 2ZCHP 1EX3A 2SGPE 3P70B 4AYVB 1S82A 3RXOA 1ANDA 1NZQH 1O2RA 1AB9C 4NFFA 1P2KA 1C1OA 3TGIE 1O33A 3BN9A 1TMUH 1MTVA 1O30A 1TGTA 3OX7U 3OSYA 1H9IE 3EA7A 1BB0B 1ETRH 1EB1H 4B2AA 2BY7X 3KQDA 3RU4D 2BQWB 1V2NT 3NWUA 1O3FA 4JZIA 2BB4A 3T5FH 2PGQB 1E37B 1IQFA 3A87A 3Q3KA 2OC1A 4ISIH 5LPRA 1G9IE 1F0UA 4Y7AA 3P95A 1ZPZA 4BTTB 1EXFA 1C5SA 2BLWA 4WF8A 2EI6A 3UFAA 3P8GA 4K3JA 3EGKH 4OS4A 2P59A 3M3SA 2AH4X 1IQHA 2GCHF 3G01A 4OS2A 1T8OA 4UE7H 2GDEH 5PTPA 6GCHF 4X8SH 4YT6H 3ZVAA 4B76A 4FUGA 3DD2H 3CENA 1MTNB 3S7HB 1GL1A 1O3OA 1TGSZ 1GHAF 1JRSA 1F5RA 3LH1A 1A0JA 1WBGB 1NFYA 2Y5GA 3MH4A 5LH8A 2ZGBH 2GCTB 1OWJA 2HOBA 1CT2E 1GWAA 4PROA 4X6OA 3M5MA 1UTPA 1NFWA 3K9XB 1C1NA 1IQGA 2PSYA 1WOFA 3SU6A 2ZHWH 3MU1A 1BHXB 3M5OA 2OC0A 3KQBA 2ANKH 2ZC9H 2DUCA 2ZCLP 1HAXB 1W0ZU 1AWHB 3VB6A 3E0PB 1FN8A 1NRPH 2WPJS 1GBLA 4NIWA 5K7RA 4YOGA 1O3JA 2Z9GA 1UVOA 1TNLA 3M7UA 2QV1A 4AZ2B 2KAIB 3NUMA 3ZZ9A 2ZPRA 2W7UA 1HAVA 1UTJA 2BDYA 2SNWA 3V7TA 3F1SB 1TPSA 4ABFA 1V3XA 1XUGA 1XXDA 1OKXA 5T6GA 2V6NA 1AB9B 4WXVA 2FI5E 4CHAC 2A2XH 3UR6A 2ZQ1A 4AFQA 4X2VA 1O2MA 1SGQE 4NG9H 1J16A 4R0IA 3GY4A 2C4FH 2ZTXA 1C2JA 5DGJA 3FFGA 1K21H 3RU4T 3SBKA 2ANMH 1E36B 1ZGIA 2BMGB 3A84A 4NFEA 4IS5A 4K69A 2FOGA 1CGHA 1D6RA 2G5NA 1MBMA 1EB2A 2PHBA 1QB9A 1UVPA 3SUDA 1AMHA 5C3NA 2GCTC 1WTGH 2F9NA 4XBDA 1G3CA 2G4UA 2OQUA 5I25A 3RXDA 1L4ZA 5JDUB 2Y7ZA 3ZV9A 2XC4A 3A7WA 3ZZBA 4NCYA 1DLEA 1C5LH 3A80A 3DHKH 2XC5A 3AASA 5E0HA 2Y7XA 1SGTA 3TNTA 2JETC 4X6NA 1C2KA 1ZMLA 1IHTH 1YPEH 2ALPA 1E38B 1GBKA 1Y5UT 3F9HA 3FAOA 3T29A 2W3KA 4BTIB 3K6YA 3VB3A 5GPIB 4FUEA 3TU7H 5EXLA 1KLJH 3ZV8A 1TPAE 2GX4A 1QGFA 1O36A 1K1OA 5SGAE 5ESBA 3SJOA 1C2IA 3P8FA 1XVOA 1YPHC 1O37A 3DUXH 2HWLB 3GY2A 1T4UH 1GCDA 1KLIH 3QO6A 1V2PT 1ZOMA 3RXJA 4ZHLU 1UVTH 3PROA 2BD9A 4MNVA 1QRWA 1AFQC 1TLDA 2ZU1A 2F9UA 1RJXB 1HCGA 2PGBB 1T8LA 1GDNA 3URDA 2WYJA 1VCQA 1C4V2 1ID5H 3S7KB 1FY8E 2TBSA 5A2MH 2F91A 1FV9A 4TPIZ 1LCYA 2VIPA 1IQLA 1NESE 2OINA 3DT0H 3LIWA 5DP4A 2Q6GA 4UFDH 2H9HA 3HGPA 3MWIU 5FHTA 2A4RA 3SV9A 1K1NA 3R3GB 5EW1H 1B7XB 1OPHB 4B2CA 1Z8RA 1GI2A 2Q1JA 2P3FH 3GY6A 2ZKSA 2QF0A 2QGRA 2RG3A 1HJAC 1BTZA 1YPGH 2CXVA 1HNEE 1O2SA 3ZZ6A 3V3MA 1KIGH 4IMQA 1O2NA 1Y8TA 2FMJA 1THSH 3QUMP 1ESTA 1GHWH 1LHDH 3LC5A 4LZ1H 2BDHA 3IWMA 3ATWA 2ULLA 1KSNA 1WU1A 4A92A 1BTWA 3D49H 1Z1IA 3M5LA 1UHBB 3KGPA 2PR3A 4LZ4B 2CHAC 3LGYA 5ESTE 1UK2A 1SFQB 3TK9A 2ZHFH 2BD8A 3U98H 1MKWK 4B75A 3KQEA 1BBRH 3SOSA 1BA8B 3RXMA 1G2MA 4Y6DA 2LNCA 3HKJB 3VEQB 1PPCE 3FVFB 3TNSA 1FNIA 1A0HB 1GCTB 2GZ9A 2BD4A 2M5TA 5HGGA 1DPOA 2ZTZA 2PTNA 3LH3A 1WAYB 1Y5BT 1P3CA 4K2YA 2THFB 1EAWA 3GDUA 9LPRA 1DXPA 3NK8A 4YO9A 2CV3A 2WPHS 2FOEA 3GOVB 1N6YA 2BM2A 3IG6B 1ZSLA 3ZZ7A 1V2LT 4GSOA 5C1XA 2AERH 1CA8B 3MNXA 1KTSB 2IOTA 4F49A 4MPWA 4IMZA 4TPYA 1L1JA 1OWEA 2FOBA 4I8LA 1X7AC 2CF8H 1EJAA 1GPZA 1EAIA 1K2I1 1O3KA 1LPGB 4MPXA 4IC6A 1QRZA 3M3TA 1O3AA 4E7RG 4HFPB 2VIOA 3S9BA 1PQAA 1TGNA 2ZEBA 2VIQA 4AOQA 1O2JA 3RLYH 1QQ4A 3MU4A 4LXBH 3KF2A 4U2WA 1G2LA 5K0HA 2UWLA 1GMCF 4X1RU 1QR3E 1NN6A 1KXBA 1PJPA 1TIOA 4Q7YA 1C4U2 1EAXA 4KP0A 2FO9A 1NFUA 2VIWA 2G81E 3SJ9A 2ZDVH 5A8XA 2HNTF 2H6MA 2QA9E 3T2NA 3ZVBA 1THRH 4FU7A 3AAUA 4ABIA 2WPLS 1FY5A 1MTSA 4TY7A 1P05A 3A88A 3O8CA 1AE5A 3PO1B 2AIPA 1PQ8A 3SNDA 3JZ1B 4MG3A 1HAGE 1P01A 2QN5T 3Q77A 1P3EA 2ZDLA 1DWCH 2AIQA 3BV9B 2HPQH 1QIXB 1HXFH 1OX1A 3GY7A 4XBCA 3MNBA 1HLTH 4X0WU 1V2WT 1TQ7B 2J9NA 2BY8X 1W8BH 2ZFRH 1O3HA 9ESTA 4OGYA 4Y8XA 4X1QU 4B74A 1Z1JA 5DPAA 1GJ4H 2OC8A 1BJVA 2P3UB 2PLXA 1M9UA 3RXHA 3BTDE 4KTUA 3QLPH 5GCHF 3HPTB 5EXNA 1A3BH 1YF4A 4YLUA 2ILNA 1A7SA 3KL6A 1P2OA 4UDWH 4AGJA 1MKXH 1QBOA 1S83A 1QL7A 1V2QT 3A7VA 1QTFA 3T25A 2WPIS 3SO3A 1ZPCA 2CGAA 1W0YH 1GL0E 3NXPA 3LGIA 1BMLA 1EATA 5A0AE 2P94A 2QAAA 2R3UA 1OP0A 1LQEA 1FAXA 1DLKB 1P0SH 1A1RA 2BOKA 4FVBA 1ELVA 3H7TA 4X8VH 1CT0E 1FY3A 1NM6A 1NPMA 1VGCB 2A5AA 1O5CB 2C90B 1MCVA 4X6PA 3TH3H 2FPZA 1AN1E 1TYNA 1V2RT 2R0LA 1O2PA 2OTVA 4OS6A 1C1WH 1HGTH 1A4WH 1EZQA 1W2KH 2R2MB 2Z94A 2UUFB 1XKBC 1GI3A 2BD5A 2QXJA 1DFPA 2WPKS 4CR9A 1HPGA 5F8XA 1K28D 5GIBA 3O8DA 1ANBA 3SHAH 1NY22 5DKMA 2R3YA 2B7DH 3SGBE 2BOHB 3SV7A 1S0RA 4WH8A 1UCYE 4X1NU 3SQHE 2D1JA 1Z8IB 4FVDA 1S5SA 1TNHA 2RA0A 1GHZA 4IN2A 3MOCA 1V2ST 4D9QA 3EA9A 3ATKA 2O8WA 2GGVB 1QURH 3V13A 1PPHE 4BXWA 1LPZB 1CT4E 3ZZ8A 1BUIA 1IQMA 1O2HA 1DITH 1C5RA 4FUHA 6CHAB 3LGTA 3SNAA 1ELDE 2ZCKP 3K6ZA 1TPPA 2VH6A 2RA3A 2C93B 2BVSH 4I8HA 1W3CA 1CE5A 1DS2E 1KTTB 2YNBA 2VJ1A 5DJ7A 1DY8A 5HM9A 1KXCA 3SHCH 4VGCB 1ELEE 1UK3A 2C8XB 1HJ8A 1MTNC 4FXGH 4LK4A 1YCPH 1C1SA 1ETTH 1UHBA 5C2ZA 1GJ5H 5LPEA 3A82A 1HV7A 2SGEE 3SUFA 1O3PB 1V2KT 1HUTH 1FUJA 4UFEH 1DSUA 1MU8B 2JH0D 2KAIA 4FUFA 1QJ7B 2UWOA 1SGPE 4MNXA 5LPFA 1DWDH 1WSSH 5T3HA 3SV6A 3HK3B 5J4SA 4X1SU 3C1KA 2FLBH 2NWNA 3PM3A 1JRTA 1DVAH 1TWXB 3M7QA 3PLPA 1D3QB 1TBQH 5L30H 1PYTC 1AQ7A 1JXPA 4AFSA 4CRBA 1FIWA 2BX3A 2FESH 3SUEA 1EASA 1OWDA 3LGVA 3BTGE 1MZAA 5G4BA 5BPEA 1QY6A 3ATLA 1E0FD 3UY9A 1GJ7B 1ELCA 4NA9H 1AI8H 4H42U 3SU3A 2PFEA 4MPVA 1QRXA 1V2JT 5T6FA 4Z0KA 3BEUA 3W94A 4ZUHA 2HNTC 3GCNA 1AVGH 1C2LA 2FOAA 4RKOB 1FZZA 1UTKA 4NA7A 4CRDA 5C5NA 2R2WU 4YLQH 2Z9IA 3U9AH 3GCTF 1PQ5A 2ZFPH 2PKSB 3LT3A 1BDAA 2HRVA 1J15A 1YKTA 2XNIA 4ZH8A 8GCHF 3NZIA 4JCNA 1BRAA 4Y0YE 1P11E 1ZSKA 1WV7H 2FYRA 1VCPA 2HVXA 1RGQA 2ZTYA 1GDUA 2OUAA 3MMGA 3QGJA 1A5HA 1YCPM 2V3OH 2FZZA 3EYDA 1DT2A 1O2WA 3BIUH 5GCHG 4B71A 1SQTA 2ZF0H 3RXGA 1AUJA 3TITA 1G32B 3AAVA 4U01A 4BTUB 2BLOA 1OWIA 1XMNB 1GJAB 1BRBE 1LO6A 1P9SA 1OYTH 3FZDA 1HIAA 1K1PA 1UTOA 1QFKH 7KMEH 1B0FA 1Y3VA 3UWJH 1BTUA 2VB0A 2AGGX 4ABJA 2WV4A 1MD7A 1L4DA 4XE4A 5FCKA 2PV9B 2ANYA 4CR5A 1DOJA 3Q76A 4DG4A 1BJUA 4DT7B 1MAYA 2G4TA 3GYLB 1GI7B 1AVXA 1DWBH 1AKSA 3SU1A 1XX9A 3SV8A 1C2HA 1SGIB 3MTYA 1D3TB 1Z6JH 2FX6A 1FJSA 1TGCA 3Q00A 3QK1A 3RXUA 1UK4A 1SGFG 4WY3A 5E2OA 1SR5C 3L6PA 1MQ5A 2C8WB 4FUCA 4BAMB 5ABWA 2ZGHA 3EE0B 3SI4H 2ZFTA 3I29A 4JK6A 1TPOA 1MZDA 1N8OB 1P06A 3LOXA 5EODA 2G8TA 2A7CA 4GHQA 4FU8A 3F9FA 1ELBA 4X8TH 3BG4B 2BDGA 1FI8A 1SB1H 2FLRH 3K65B 1ZHMA 1MAXA 1L1GA 1GVKB 3VGCC 2GMTC 6CHAC 2FDAA 4XBBA 3ZVCA 4YZUA 1JBUH 2P16A 1C1TA 2HLCA 1TMBH 2P8OC 4KKDA 1O3EA 2Z3DA 3RXLA 3ZYDA 2V3HH 3MO6A 3PMAB 4I8JA 1UCYK 4OS1A 3HATH 4AYYB 3LJJA 3RMMH 2F83A 4A5TS 1P8VC 1V2OT 2P93A 2ZPQA 2XC0A 2FXRA 2AS9A 1FXYA 4ABDA 2FOMB 4DOQA 3KN2A 4ZKNU 1HAPH 1TBRH 1C1PA 4Y71A 4K1SA 1GBBA 3RUOA 4O03A 3ZVFA 3OY5U 4X2XA 1NS3A 2AFQB 3VB7A 1SQOA 2WV5A 5T6DA 4MNYA 3ESTA 2GZ8A 2XWBI 2OC7A 4SGAE 1L2EA 3SV2H 5E0GA 1OSSA 1KXAA 2TGTA 1PPBH 4HI3A 4DCDA 3PO1C 3WY8A 1Y3WA 1IQJA 3ATMA 4BAHB 2FI3E 1AU8A 1DUEA 5GWZA 2ZWLH 6LPRA 2ALVA 1SBWA 1PYTD 1YP9A 2XBVA 4VGCC 1BMNH 3M35A 1C2GA 3SU5A 3D62A 1GJ6A 3GCHB 4Q7XA 1UVUH 5DP5A 1CGJE 2QF3A 1IAUA 1Z6EA 2Y80A 1W7XH 1XKAC 2PUXB 1P10A 1ZMNA 1VJ9U 3A81A 1C5UA 1A5GH 1P2JA 2PUQH 4UEHH 2EI8A 5FBIA 2XCFA 5IYTA 2DE9A 2B9LA 1ZHRA 4UFFH 1HBTH 1FY4A 3I78A 3A8BA 4FU9A 3TJVA 5JB8S 2ZU5A 5FPYA 1K1LA 3FP6E 1KXEA 1LHGH 1QCPA 2ZG0H 1VCWA 3M36A 4YT7H 3PLKA 2XXLA 1A0LA 4E05H 3A86A 3TPIZ 4CRGA 2A2QH 3TJUA 4BANB 1FPHH 2A1DB 4ABHA 1DM4B 1UVSH 5A8YA 5L2ZH 1H8DH 1EUFA 2OP9A 8GCHG 5F03A 1CHGA 2Y81A 1ZYOA 1Z71A 2GKVE 3AVZA 1SGEE 4DURA 4BNRA 2Y5HA 4ABEA 3HGNA 1LHEH 1BCUH 2VU8E 1GBJA 1TGBA 3AW0A 2Z7FE 1CSOE 1ZRBA 4NSVA 4M7GA 4Y76A 1BMMH 1C5WB 3DFLA 2FS9A 1SGRE 2AMPA 3VB5A 1ARBA 3UPEA 1G3DA 1O3GA 2J4IA 1P2NA 2Z6BD 4GUXA 1GHBF 2A0QB 1SGYE 4RKJB 2J92A 2FTMA 2A4QA 3GDSA 1VGCC 5EQQA 2IPHA 3Q3XA 1TRMA 4D7GA 1KDQB 3RU4E 1GBAA 3CP7A 1O2YA 3STIA 1E34B 1TRNA 2BHGA 2BQ6B 3TGJE 2ZHQH 3U1JB 3LC3A 1EPTB 3TJNA 1O3MA 1QQUA 3P17H 5FPTA 3QN7A 1AKSB 2BVRH 4A7IB 3RM0H 4X6MA 2QY0B 2A5KA 1PPEE 2NU4E 3SZNA 1EOLA 1F7ZA 1HB0B 2AYWA 1BTXA 4NZLA 1QJ1B 4ISOA 5FPSA 3RC5A 1WQSA 4H6TA 1TOCB 2NU2E 2PKSC 1TONA 1MH0A 1P03A 3UQVA 5TCAA 1EP5A 3BTFE 4OS5A 3B8JA 1GBTA 2WUBA 3M5NA 2ZI2H 2H9EH 4AFUA 4GAWA 5A09A 4CHAB 3UNQA 4B73A 3RXIA 4Q7ZA 1EP6A 1OS8A 5AHGH 3ZYEA 1P09A 2TGAA 2VNTA 1GI6A 4MLFB 4AB8A 3MH7A 2SFAA 1GBEA 1C1UH 5F8TA 2XCNA 3VFEA 3LKWA 3MFJA 5F8ZA 1YPLH 2O8MA 4NSYA 4WMFA 1UMAH 1TX7A 1GMHG 3BEIB 3RC6A 4AG1A 2OBOA 4LOYH 3UREA 3EQ0H 1Y3XA 3SU4A 2GCHG 5EOKA 4I8KA 2XYAA 1KLTA 1O2ZA 1KY9A 1NRNH 2ZU3A 2P95A 1O5FH 1ZTKA 2JETB 3LDXH 3TLOA 2R0KA 4JYVH 2XBWA 2CN0H 4NGAH 3MNSA 1GHAG 1O31A 3KHVA 1YC0A 1Q3XA 2UUKB 1LPKB 1IOEA 3ELAH 2ZGJA 1SSXA 1BQYA 3RXEA 3UNRA 4WWYA 2ZDMA 4CH2B 4QT8C 2BQ7B 3PMHB 2A31A 3E0NB 2CMYA 4JZ1A 1GMCG 2SGDE 5LGOA 3MH6A 3ODFA 3BIVH 1KXDA 1THPB 3NKKA 3U8OH 1WTHD 1O2XA 1TBZH 1W14U 2CF9H 4DW2U 5F6MA 1W7GH 1OYQA 2BX4A 3SNBA 3SUGA 1GMHF 1BT7A 1GJ8B 3KEEA 5EPYA 2C3SA 4HZHA 4XFQA 1CO7E 1GCTC 3RXBA 1AFQB 1LHFH 2B5TB 4UD9H 2ZU2A 3W95A 4YM9A 3ZZCA 1DDJA 5GJ4B 3SQEE 2VIDA 4OS7A 2V35A 2OCVB 2V0BA 1V2UT 2BY5X 2A7HA 4BAQB 5A0BA 2GV6A 2B8OH 1UCYH 1VJAU 3FZZA 5C20A 5JB9S 1SVPA 1ETSH 2XTTB 4O3UA 1HAHH 4NA8A 1BRCE 2FYQA 1DICA 4NIXA 1ZPBA 2ZIQH 2TGDA 1O0DH 4TWYA 1FONA 4OGXA 2ZDNA 3E6PH 4Y8YA 1AZ8A 4B1TA 4I7YH 1SPJA 4I32A 2ZA5A 4K8YA 4ZKRU 2AEIH 1T8NA 3M7TA 4I33A 5DG6A 1J9CH 3GICB 1GJ9B 3F6UH 2YOLA 1AVWA 1H9LB 1LQDB 2QC2A 3GY3A 3T26A 3VXEH 4AFZA 5AFYH 4K8BA 2GTBA 2A32A 4FUJA 1V2TT 3S9CA 1N1LA 1O38A 4YOIA 3L33A 2BDBA 2VGCC 1UJ1A 2I6QA 1QA7A 3P8NA 1IQKA 2STAE 1OXGA 1EJMA 1YGCH 2W5EA 4ZMAH 2W3IA 1NT1A 1TNJA 1WYKA 3VXFH 2Q6FA 3N7OA 1T31A 2Z9KA 1QA0A 4I31A 5DP8A 1GBCA 4BAOB 4GVUA 3DFJA 3BTKE 1J17T 3KNXA 4K5ZA 5I46H 1OP8A 1S6FA 1NTPA 1T7CA 2F9VA 4XOJA 3QGNB 2EA3A 4MNWA 1RS0A 1VR1H 5EXMA 3TIUA 1FMGA 1CHOF 4CRCA 1Q31A 2A4OA 2BXTH 5CE1A 3K2UA 5FBEA 4AX9H 1SQAA 5C5OA 1C5PA 4Q2KA 3STJA 3M3VA 4IN1A 3UOUA 3TK5A 1C1RA 1HFDA 1VITG 5J4QA 3RP2A 2BDIA 1TX8A 1DWEH 1C2DA 4X1PU 5E2PA 4ZKSU 1GBIA 1GI4A 2UUJB 1YLDA 3SORA 1QBNA 2J34A 3JZ2B 4Z6AH 3PLBA 3RXSA 4JZDH 1EPTA 1B0EA 1O3CA 1ELAA 1CQQA 2ZO3H 2J94A 1ZSJA 3T28A 1V2VT 3A8AA 2GDDA 1L1NA 4K60A 5B6OA 4WJG2 2QXHA 2HNTE 1LVYA 3RLWH 4A1TA 4NWKA 3MU5A 3RXCA 1SGDE 1XUFA 8KME2 1WQVH 1GHVH 3NCLA 4A1XA 1MBQA 1AY6H 2EC9H 2D26C 3RXPA 4ISLA 1N6XA 4ESTE 5DP3A 1EOJA 2FTLE 3LU9B 1GDQA 3B9FH 5C67A 3H7OA 1AUTC 5JBAS 1XUJA 1Z8JB 2BD7A 2VVVA 2B0FA 5ETXA 1IQIA 1EAUA 3M37A 1DY9A 1QNJA 3CS0A 5EGMA 3RMLH 1ZMJA 1C5OH 3E3TA 4KELA 5FCRA 1GBFA 5DP7A 3BTQE 1AGJA 2D2DA 3RXFA 1A2CH 1GBMA 5TCCA 3A8CA 1O5AB 2QIQA 1JMOH 3TK6A 1AE8H 1Y3YA 3T62A 5E8EH 4TY6A 2O8TA 2J2UA 4DY7B 2GVFA 1SFIA 2O8LA 3M61U 1D6WA 2SNVA 1GMDF 1GVLA 1QHRB 5IDKA 2R9PA 4AB9A 4D7FA 3S0NA 3SU0A 3A7YA 4KTSA 1MTUA 1C9PA 4AG2A 2H5DA 4INKA 3GCTG 3PB1E 3GISB 3QTVH 4MTBA 1YCPK 1ABJH 2VWOA 4FUDA 2ZNKH 1Z7KA 5JYIA 1XM1A 2AMDA 1VITH 1G3EA 1SOTA 2H9TH 5L2YH 1RTLA 4F4OC 5JBBS 1SLXB 1P12E 1LKBA 4AORA 3ZVGA 2VH0A 1DANH 1H8IH 4FUIA 2OQ5A 1CGIE 3SGQE 1F5KU 1FDPA 1YPMH 4THNH 1UO6A 1RFNA 2VVUA 1Y5AT 3SJIA 1HAYB 5A8ZA 3RXTA 1EPTC 3C27B 4CREA 1CU1A 3A7XA 2BY6X 4R8TB 1J14A 1O32A 3LGUA 7ESTE 2Z3CA 1DXWA 1NFXA 5FX5A 4CBOA 2FWWA 4ZXXH 2VGCB 1ABIH 2Z3EA 3GCHC 1SGNE 5H4IB 3PTBA 3BF6H 2YNAA 2SGAA 1SGCA 3S69A 5HM2A 1H1BA 1T32A 1WCZA 4GCHF 6ESTA 2ZECA 2EI7A 1KXFA 2JH5D 3PTNA 5AFZH 5DP9A 1ELGA 1D4PB 1GI1A 1BOQA 1S81A 3OU0A 2PW8H 1ZJKA 1C1VH 2BVXH 2BDCA 3UQOA 4JYUH 1HYLA 1LVMA 1OP2A 4U30A 3ZZ5A 3U8RH 3H5CB 2P3TB 1ANEA 2PSXA 3A83A 3MI4A 3SNCA 2FEQH 3V0XA 1C2EA 1UTQA 4ISNA 1PPGE 1GG6C 2F9BH 3FP7E 1CVWH 1C1MA 1C2FA 1OWKA 1SOZA 1EJNA 1T4VH 2ZPSA 1P57B 1F0TA 1W11U 3GDVA 4JMYA 4RSPA 3ZZ3A 3F9EA 4IBLH 2GD4B 5C1YA 3URCA 1IHSH 3ITIA 1ZLRA 1YYY1 1SMFE 1LVBA 3TVJB 1P02A 3NPSA 1ZGVA 2A5IA 1GI8B 4WXIA 3RXVA 4DVAU 1SG8B 2H5CA 2J38A 2FODA 3E8LA 3R0FA 4GHTA 2BD2A 1SI5H 3RDZA 1O3IA 5EQRA 1SHHB 1V6DA 1O39A 1ZR0A 2VWMA 3CS7A 1GI5A 3RXKA 3BTME 5DO4H 1N8OC 4ZHAA 2NU1E 1KDQA 3PMBB 1C5ZB 1QJ6B 1TNKA 1P2IA 4JYTA 1K1MA 1GHXH 1TAWA 4YTAA 3BTTE 2Z9LA 3TH2H 1PFXC 3E90B 4MQAA 4BAKB 4O9VA 7GCHF 2VWLA 3FP8E 3GYMA 5EW2H 2JKHA 4WMDA 5EQSA 1F92A 3KCGH 1SL3A 3OYPA 4HTCH 3ENSB 2NU0E 3ZVEA 1C5VA 1BTYA 1K1JA 3SJKA 1ZHPA 1AZZA 3TH4H 4CRAA 1BITA 1GI0A 5L6NH 1EZSC 5CHAC 2BLQA 4JK5A 4I8GA 4D8NA 3SJ8A 1TQ0B 3MNCA 1A46H 1FY1A 3RM2H 1FAKH 4BXSA 2BYAX 5CMXH 2G00A 1F5LA 1SLVB 1QL9A 2P8OB 2XBYA 1MQ6A 5E0JA 1MCTA 2GMTB 2G5VA 1NU7B 2FOFA 3QZQA 4H6SB 1C9TA 2HALA 1NROH 1TA2A 3RXAA 5JBCS 1CHOG 1FLEE 1BBRK 4ABAA 4AN7A 1ORFA 1Y59T 4JZFH 2TIOA 2VINA 2ZDKA 3MO9A 4D9RA 1RIWC 4D76A 2F9OA 1D3PB 3QWCH 1A3EH 4TYDA 4ZAEA 2Y6TA 3KQCA 2OXSA 1TALA 4NZQA 3UIRA 2WINI 3LPRA 3QDZB 4ZROA 2PWXA 4ZHMU 2QXIA 2DE8A 4GPGA 2QCYA 1Q2WA 1NRSH 2XBXA 1XUHA 3S9AA 4TWWA 1BMAA 4Y10E 1TX6A 1LTOA 2UWPA 1NU9A 1ANCA 1H9HE 3BG4C 4WMEA 1HAIH 1T8MA 3A7TA 1LKAA 2GT8A 1KYNA 2ZU4A 1GGDC 5BRRE 1LMWB 2QXGA 3EA8A 1HRTH 1SLWB 1RTKA 6GCHG 1ZZZA 4IW4E 4X2WA 5JPMH 2ESTE 4ZXYH 3SGAE 1J8AA 3E16B 3D65E 3E91A 2I6SA 1SHYA 1C5MD 3GCOA 2HGTH 4DJZB 1AO5A 4IC5A 3T27A 1C5QA 2ANWA 2Q6DA 3BSQA 1UTLM 3KIDU 2SGFE 4IGDA 1BIOA 1G37A 4WH6A 1GHBG 3EAJA 1D3DB 2G52A 2W7SA 1EZUC 1O5EH 1EQ9A 1MKWH 4SGBE 1W12U 2BLVA 4XSKU 1TFXA 5GDSH 3UTUH 4A1VA 1YM0A 1SLUB 3A8DA 1TNGA 2ZFFH 2ZP0H 1K22H 1W13U 4JZEH 1AHTH 2ZFQH 1A5IA 1ESAA 1C5YB 1BRUP 2LPRA 1TA6A 1ESBA 3I77A 3V12A 4UONA 1GI9B 1O35A 1F2SE 1NC6A 1C4Y2 1V2MT 1VITF 2Z9JA 2F3CE 1PPFE 3B23B 5TJXA 1OWHA 1RIWB 1Z8GA 1RXPA 3U1IB 5DK1A 4ABGA 3MU0A 1O2GH 3SI3H 3L3TA 2UUYA 2ODPA 1GMDG 3MO3A 2OD3B 2ZQ2A 5C1UA 1TE0A 1XVMA 3VGCB 1O2LA 2BZ6H 1ZTJA 3GY5A 3BTHE 5AF9H 2FS8A 1O2OA 4DGJA 2FOCA 2XWAA 3VPKA 3BEFB 2BY9X 3A85A 1MKXK 3DA9B 1INCA 3SW2B 2BTCE 3TGKE 2NU3E 2AGEX 1ARCA 2IN2A 1NO9H 5HYOA 3Q3YA 2ZGXH 3ATIA 4CBNA 1MD8A 2O8UA 4KGAA 2BXUH 1WUNH 2GZ7A 2RCEA 2WUCA 1F0SA 2EEKA 1O2UA 1GBHA 1K1IA 3A89A 1GVZA 1S84A 3OY6U 2FX4A 2QYIA 1AWFH 3IITA 1K9OE 2IJOB 4NIYA 1G30B 3VB4A 3TJOA 3O8RA 2A45B 3ZZAA 2GT7A 1O2KA 2FI4E 3SU2A 2TPIZ 4XDEA 7LPRA 2FP7B 1GJDB 1U6QA 2AGIX 1O3LA 1JOUB 3MHWU 2C8YB 1O2IA 2TRMA 1HXEH 1HAZB 1H4WA 1MUEB 1HJ9A 3LONA 2FOHA 3U69H 1FIZA 2ZFSA 1CBWC 4K1EA 4YOJA 1O5BB 2VVCA 1ACBE 3MYWA 1YPKH
chains in the Genus database with same CATH superfamily
1C5XB 1Y3UA 2PKAA 3BG8A 1E35B 4CRFA 1TMTH 1JIRA 1FQ3A 1MU6B 3F9GA 3PYHA 3QTOH 3LGWA 3UWIA 2HPPH 1YPJH 1SGFA 3P8OA 1UTNA 1CA0C 1ZJDA 4HGCA 2TGPZ 4B2BA 1BZXE 2WYGA 2HLDD 1XUKA 2KFWA 3ODDA 4FUBA 3VG8A 3SNEA 3BTEE 4TT3D 2VIVA 4X8UH 3RMOH 1MMJN 3RXRA 3UUZA 2H1UA 1ZRKA 2Y82A 3QZRA 1YPHE 4CH8B 4AGKA 1O2TA 2C8ZB 1O3DA 3PWBA 4NIVA 5C0UA 1GBDA 1MTWA 4UFGH 3UR9A 2O9QA 1O34A 1EZXC 1S0QA 1S6HA 1RRKA 4Y0ZE 1XUIA 4A6LA 4DIIH 1OOKB 2ASUB 1D9IA 2BDAA 2ZHEH 2PTCE 4MDSA 1BBRE 1TNIA 4NWLA 2RDLA 2ZDAH 4E06H 1O2VA 2CHAB 1PPZA 5FX6A 1G36A 2GP9B 1BTPA 4Y11E 1QB1A 5AVDA 1TB6H 2SGQE 1CA0B 3SN8A 1NRQH 4INLA 4O97A 1FN6A 4J1YA 4O3TA 5DP6A 2ZZUH 4KTCA 4K1TA 2Y5FA 2IJD1 3MU8A 2ZGCA 5EPNA 1P04A 2OLGA 4J2YB 1BHXF 3PWCA 2JH6D 1HAOH 1PQ7A 2G55A 1P2MA 3ZZ4A 3QX5H 3EDXB 1GHYH 1CBWB 1ELTA 2BZAA 1F0RA 1JWTA 1AIXH 4BOHA 1TOMH 2STBE 1AFEH 2ZHDA 2PKAB 2XW9A 4YESB 1C5TA 1HDTH 2ODYB 1GJBB 1O2QA 1O5DH 1IQEA 4H4FA 4Y8ZA 3A7ZA 3RXQA 3UNSA 4ABBA 4U32A 2FM2A 1GG6B 8LPRA 2GV7A 3ZVDA 1C5NH 1QBVH 1S85A 3MH5A 1E1QD 3ZZDA 5A0CA 1L0ZA 4WVPE 2OBQA 2J95A 3BTWE 3FANA 3UOPA 5JBTA 4RN6A 2A4GA 1DX5M 2XRCA 2AMQA 8ESTE 2G51A 2ODQA 4MVNA 3HKIB 2D8WA 1DUAA 4ASHA 3P6ZB 3PMJA 1A61H 1FX0B 4Y79A 1EKBB 1GJCB 2K1QA 5EU8A 4DIHH 2H2ZA 1IQNA 4MPUA 1YBWA 3PV4A 5FAHA 4ZKOU 1COWD 2W26A 3E1XB 2F9PA 1QB6A 2A7JA 1B5GH 5CHAB 1XXFA 4GCHG 5HMAA 1P9UA 1DSTA 4INHA 5EG4A 1GGDB 1RTFB 3U8TH 1C2MA 1O5GH 1AD8H 5FXLA 2BD3A 5GXPA 2WPMS 2YMSB 3F2FA 4X2YA 4FOUC 3HK6B 2CJIA 4TSFD 1ELFA 1O3NA 1RD3B 3GY8A 1NRRH 1HJAB 4Y7BA 3LJOA 1LVOA 1G3BA 4E7NA 1LDTT 3OTJE 1TABE 1JIMA 4ISHH 1LHCH 3F68H 4Q80A 3RC4A 1HAVB 3O8BA 2L74A 1FPCH 1BTHH 2FIRH 1YLCA 3RMNH 1O3BA 4GLYA 1DE7H 1HIAB 1ZTLA 3P92A 1P2QA 7GCHG 1VZQH 1C1QA 3D23A 3AW1A 5HXFA 2VWNA 1W10U 1QL8A 1TRYA 1SC8U 1UTMA 3SYJA 2ZCHP 1EX3A 2SGPE 3P70B 4AYVB 4I86A 1S82A 3RXOA 1ANDA 1NZQH 1O2RA 1AB9C 4NFFA 1P2KA 1C1OA 3TGIE 1O33A 3BN9A 1TMUH 1MTVA 1O30A 1TGTA 3OX7U 3OSYA 1H9IE 3EA7A 1BB0B 1ETRH 1EB1H 4B2AA 2BY7X 3KQDA 3RU4D 2BQWB 1V2NT 3NWUA 1O3FA 4JZIA 2BB4A 3T5FH 2PGQB 1E37B 1IQFA 3GS9A 3A87A 3Q3KA 2OC1A 4ISIH 5LPRA 1G9IE 1F0UA 4Y7AA 3P95A 1ZPZA 4BTTB 1EXFA 1C5SA 2BLWA 4WF8A 1YLNA 2EI6A 2IPQX 3UFAA 3P8GA 4K3JA 3EGKH 4OS4A 2P59A 3M3SA 2AH4X 1IQHA 2GCHF 3G01A 4OS2A 1T8OA 4UE7H 2GDEH 5PTPA 6GCHF 4X8SH 4YT6H 3ZVAA 4B76A 4FUGA 3DD2H 3CENA 1MTNB 3S7HB 1GL1A 1O3OA 1TGSZ 1GHAF 1JRSA 1F5RA 3LH1A 1A0JA 1WBGB 1NFYA 2Y5GA 3MH4A 3WW7A 5LH8A 2ZGBH 2GCTB 1OWJA 2HOBA 1CT2E 1GWAA 4PROA 4X6OA 5DSFA 3M5MA 1UTPA 1NFWA 3K9XB 1C1NA 1IQGA 2PSYA 1WOFA 3SU6A 2ZHWH 3MU1A 1BHXB 3M5OA 2OC0A 2F43B 3KQBA 2ANKH 2ZC9H 2DUCA 2ZCLP 1HAXB 1W0ZU 1AWHB 3VB6A 3E0PB 1FN8A 1NRPH 2WPJS 1GBLA 4NIWA 5K7RA 5IK2D 4YOGA 1O3JA 2Z9GA 1UVOA 1TNLA 3M7UA 2QV1A 4AZ2B 2KAIB 3NUMA 3ZZ9A 2ZPRA 2W7UA 3OEHD 1HAVA 1UTJA 2BDYA 2SNWA 3V7TA 3F1SB 1TPSA 4ABFA 1V3XA 1XUGA 1XXDA 1OKXA 5T6GA 2V6NA 1AB9B 4WXVA 2FI5E 4CHAC 2A2XH 3UR6A 2ZQ1A 4AFQA 4X2VA 1O2MA 1SGQE 4NG9H 1J16A 4R0IA 3GY4A 2C4FH 2ZTXA 1C2JA 5DGJA 3FFGA 1K21H 3RU4T 3SBKA 2ANMH 1E36B 1ZGIA 2BMGB 3A84A 4NFEA 2LELA 3NRLA 4IS5A 4K69A 2FOGA 1CGHA 1D6RA 2G5NA 1MBMA 2PP6A 1EB2A 2PHBA 1QB9A 1UVPA 3SUDA 1AMHA 5C3NA 2V7QD 2GCTC 1WTGH 2F9NA 4XBDA 1G3CA 2G4UA 2OQUA 5I25A 3RXDA 3WWBA 1L4ZA 5JDUB 2Y7ZA 3WWFA 3ZV9A 2XC4A 3A7WA 3OTPA 3ZZBA 4NCYA 1DLEA 1C5LH 3A80A 3DHKH 2XC5A 3AASA 5E0HA 2Y7XA 2QF4A 1SGTA 3TNTA 2JETC 4X6NA 1C2KA 1E79D 1ZMLA 1IHTH 1YPEH 2ALPA 1E38B 1GBKA 1Y5UT 3F9HA 1EFRD 3FAOA 3T29A 2W3KA 4BTIB 3K6YA 3VB3A 5GPIB 4FUEA 3TU7H 5EXLA 1KLJH 3ZV8A 1TPAE 2GX4A 2K8IA 1QGFA 1O36A 1K1OA 5SGAE 5ESBA 1SQRA 3SJOA 1C2IA 3P8FA 1XVOA 1YPHC 1O37A 3DUXH 2HWLB 3GY2A 1T4UH 1GCDA 1KLIH 3QO6A 1V2PT 1ZOMA 3DSPA 3RXJA 4ZHLU 1UVTH 3PROA 2BD9A 4MNVA 1QRWA 1AFQC 1TLDA 2ZU1A 2F9UA 1RJXB 1HCGA 2PGBB 1T8LA 1GDNA 3URDA 2WYJA 2JJ2D 1VCQA 1C4V2 1ID5H 3S7KB 2XNDD 1FY8E 2TBSA 5A2MH 2F91A 1FV9A 5B6LA 4TPIZ 1LCYA 2VIPA 1IQLA 1NESE 2OINA 3DT0H 3LIWA 5DP4A 2Q6GA 4UFDH 2H9HA 3HGPA 3MWIU 5FHTA 2A4RA 3SV9A 1K1NA 3R3GB 5EW1H 1B7XB 1OPHB 3N7EA 4B2CA 1Z8RA 1GI2A 2Q1JA 2P3FH 3GY6A 2ZKSA 2QF0A 2QGRA 2RG3A 1HJAC 1BTZA 1YPGH 2CXVA 1HNEE 1O2SA 1OHHD 3ZZ6A 3V3MA 1KIGH 4IMQA 1O2NA 1Y8TA 2FMJA 1THSH 3QUMP 1ESTA 1GHWH 1LHDH 3LC5A 4LZ1H 2BDHA 3IWMA 1WXRA 3ATWA 2ULLA 1BMFD 1KSNA 1WU1A 4A92A 1BTWA 3D49H 1Z1IA 3M5LA 5CHBA 1UHBB 3KGPA 2PR3A 4XD7D 2WHXA 4LZ4B 2CHAC 3LGYA 5ESTE 1UK2A 1SFQB 3TK9A 2ZHFH 2BD8A 3DCLA 3U98H 1MKWK 4B75A 3KQEA 1BBRH 3SOSA 1BA8B 3RXMA 1G2MA 4Y6DA 2LNCA 3HKJB 3VEQB 1PPCE 3FVFB 3TNSA 1FNIA 1A0HB 1GCTB 2GZ9A 2BD4A 2M5TA 5HGGA 1DPOA 2ZTZA 2PTNA 3LH3A 1WAYB 1Y5BT 1P3CA 4K2YA 2THFB 1EAWA 3GDUA 9LPRA 1DXPA 3NK8A 4YO9A 2CV3A 2V3MA 2WPHS 2FOEA 3GOVB 1N6YA 2BM2A 3IG6B 1ZSLA 3ZZ7A 5EJLA 1V2LT 4GSOA 5C1XA 2AERH 1CA8B 3MNXA 1KTSB 2IOTA 4F49A 4MPWA 4IMZA 4TPYA 1L1JA 1OWEA 2FOBA 4I8LA 1X7AC 2CF8H 1EJAA 1GPZA 1EAIA 2OK5A 1K2I1 1O3KA 1LPGB 4MPXA 4IC6A 1QRZA 3M3TA 1O3AA 4E7RG 4HFPB 2VIOA 3S9BA 1PQAA 1TGNA 2ZEBA 2VIQA 4AOQA 1O2JA 3RLYH 1QQ4A 3MU4A 4LXBH 2WV9A 3FO8D 3KF2A 4U2WA 1G2LA 5K0HA 2UWLA 1GMCF 4X1RU 1QR3E 1NN6A 1KXBA 1PJPA 1TIOA 4Q7YA 1C4U2 1EAXA 4KP0A 2FO9A 1NFUA 2VIWA 2G81E 3SJ9A 2ZDVH 5A8XA 2HNTF 2H6MA 2QA9E 3T2NA 3ZVBA 1THRH 4FU7A 3AAUA 4ABIA 2WPLS 1FY5A 1MTSA 4TY7A 1P05A 3A88A 3O8CA 1AE5A 3PO1B 2AIPA 1PQ8A 3SNDA 3JZ1B 4MG3A 1HAGE 1P01A 2QN5T 3Q77A 1P3EA 2ZDLA 1DWCH 2AIQA 3BV9B 2HPQH 1QIXB 1HXFH 1OX1A 3GY7A 4XBCA 5KGOA 3MNBA 1HLTH 4X0WU 1V2WT 1TQ7B 2J9NA 2BY8X 4XRNA 1W8BH 2ZFRH 1O3HA 9ESTA 4OGYA 4Y8XA 4X1QU 4B74A 1Z1JA 5DPAA 1GJ4H 2OC8A 1BJVA 2P3UB 2PLXA 1M9UA 3RXHA 3BTDE 4KTUA 3QLPH 5GCHF 3HPTB 5EXNA 1A3BH 1YF4A 4YLUA 2ILNA 1A7SA 2HVYB 3KL6A 1P2OA 4UDWH 4AGJA 1MKXH 1QBOA 1S83A 1QL7A 1V2QT 3A7VA 1QTFA 3T25A 2WPIS 3SO3A 1ZPCA 2CGAA 1W0YH 1GL0E 3NXPA 3LGIA 1BMLA 1EATA 5A0AE 1YWUA 2P94A 2QAAA 2R3UA 1OP0A 1LQEA 1FAXA 1DLKB 1P0SH 1A1RA 2BOKA 4FVBA 1ELVA 3H7TA 4X8VH 1CT0E 1FY3A 1NM6A 1NPMA 1VGCB 2A5AA 1O5CB 2C90B 2CK3D 1MCVA 3EE7A 4X6PA 3TH3H 2FPZA 4P00A 1AN1E 1TYNA 1V2RT 2R0LA 1O2PA 2EQNA 2OTVA 4OS6A 1C1WH 1HGTH 1A4WH 1EZQA 1W2KH 2R2MB 2Z94A 2GJGA 2UUFB 1XKBC 1GI3A 2BD5A 2QXJA 1DFPA 2JIZD 2WPKS 1HPGA 5F8XA 1K28D 4CR9A 5GIBA 1WDIA 2YMSC 1ANBA 3O8DA 3SHAH 1NY22 5DKMA 2R3YA 2B7DH 3SGBE 2BOHB 3SV7A 3KQ5A 1S0RA 4WH8A 1UCYE 4X1NU 3SQHE 4B6EA 1KMHB 2D1JA 1Z8IB 4FVDA 1S5SA 1TNHA 2RA0A 1GHZA 4IN2A 3MOCA 1V2ST 4D9QA 3EA9A 3ATKA 2O8WA 2GGVB 1QURH 3V13A 1PPHE 4BXWA 1LPZB 1CT4E 3ZZ8A 1BUIA 1IQMA 1O2HA 1DITH 3FN8A 5C94A 1C5RA 4FUHA 6CHAB 3LGTA 3SNAA 1ELDE 2ZCKP 3K6ZA 1TPPA 2VH6A 2RA3A 2C93B 2BVSH 4I8HA 3MQKC 5C0TA 1W3CA 1CE5A 1DS2E 1KTTB 2YNBA 1K0HA 2VJ1A 5DJ7A 1DY8A 5HM9A 3H09A 1KXCA 3SHCH 4VGCB 1ELEE 1UK3A 2C8XB 1HJ8A 2M2AA 1MTNC 4FXGH 4LK4A 1YCPH 1C1SA 1ETTH 1UHBA 5C2ZA 1GJ5H 5LPEA 3A82A 1HV7A 2SGEE 3SUFA 1O3PB 1V2KT 1HUTH 1FUJA 4UFEH 1DSUA 1MU8B 2JH0D 2KAIA 3N7DA 4FUFA 1QJ7B 2W6JD 2UWOA 1SGPE 4MNXA 5LPFA 1DWDH 1WSSH 5T3HA 3SV6A 3HK3B 5J4SA 1MABB 4X1SU 3C1KA 2FLBH 2KM0A 2NWNA 3PM3A 1JRTA 1DVAH 1TWXB 3M7QA 3PLPA 1D3QB 1TBQH 5L30H 1PYTC 1AQ7A 1JXPA 4AFSA 4CRBA 1FIWA 2BX3A 2FESH 3SUEA 1EASA 1OWDA 3LGVA 3BTGE 1MZAA 5G4BA 5BPEA 1QY6A 3ATLA 1E0FD 3UY9A 1GJ7B 1ELCA 4NA9H 1AI8H 4H42U 3SU3A 2PFEA 5T1VA 4MPVA 1QRXA 3W1EA 1V2JT 5T6FA 4Z0KA 3BEUA 3W94A 4ZUHA 2HNTC 3GCNA 1AVGH 1C2LA 2FOAA 4RKOB 1FZZA 1UTKA 4NA7A 4CRDA 5C5NA 2R2WU 4YLQH 2Z9IA 3U9AH 3GCTF 1PQ5A 2ZFPH 2PKSB 3LT3A 1BDAA 2HRVA 1J15A 1YKTA 2XNIA 4ZH8A 5DN6D 3NZIA 5GNDA 1H8ED 8GCHF 4JCNA 2KCOA 1BRAA 4Y0YE 1P11E 1ZSKA 1WV7H 2FYRA 1VCPA 2HVXA 1RGQA 2ZTYA 1GDUA 2OUAA 3MMGA 3QGJA 1A5HA 1YCPM 2V3OH 2FZZA 3EYDA 1DT2A 1O2WA 3BIUH 5GCHG 4B71A 1SQTA 2ZF0H 3RXGA 1AUJA 3TITA 1G32B 3AAVA 4U01A 4BTUB 3OEED 2BLOA 1OWIA 1XMNB 1GJAB 1BRBE 1LO6A 1P9SA 2KX4A 1OYTH 3FZDA 1HIAA 1K1PA 1UTOA 1QFKH 7KMEH 1B0FA 1Y3VA 1QZ8A 3UWJH 1BTUA 2VB0A 2AGGX 4ABJA 2WV4A 1MD7A 1L4DA 4XE4A 5FCKA 2PV9B 2ANYA 2XOKD 4CR5A 2KCYA 1DOJA 3Q76A 4DG4A 1BJUA 4DT7B 1MAYA 2G4TA 3GYLB 1GI7B 1AVXA 1DWBH 1AKSA 3SU1A 1XX9A 3SV8A 1C2HA 1SGIB 3MTYA 1D3TB 1Z6JH 2FX6A 1FJSA 1TGCA 3Q00A 3QK1A 3RXUA 1UK4A 1SGFG 4WY3A 5E2OA 1SR5C 3L6PA 1MQ5A 2C8WB 4FUCA 4BAMB 5ABWA 3OE7D 2ZGHA 3EE0B 3SI4H 2ZFTA 3I29A 4JK6A 1TPOA 1MZDA 1N8OB 1P06A 1YY3A 4F48B 3LOXA 5EODA 2G8TA 2A7CA 4GHQA 4FU8A 3F9FA 1ELBA 4X8TH 3BG4B 2BDGA 1FI8A 1SB1H 2FLRH 3K65B 1ZHMA 1MAXA 1L1GA 1GVKB 3VGCC 2GMTC 6CHAC 2FDAA 4XBBA 3ZVCA 4YZUA 1JBUH 2P16A 1C1TA 2HLCA 1TMBH 2P8OC 4KKDA 1O3EA 2Z3DA 3RXLA 3ZYDA 2V3HH 3MO6A 3PMAB 4I8JA 1UCYK 4OS1A 3HATH 4AYYB 3LJJA 3RMMH 2F83A 4A5TS 1P8VC 1V2OT 2P93A 2ZPQA 1NBMD 2XC0A 2FXRA 2AS9A 1FXYA 4ABDA 2FOMB 4DOQA 3KN2A 4ZKNU 1HAPH 1TBRH 1C1PA 4Y71A 4K1SA 1GBBA 3FKSD 3RUOA 4O03A 3ZVFA 3OY5U 4X2XA 1NS3A 2AFQB 3VB7A 1SQOA 2WV5A 5T6DA 4MNYA 3ESTA 2GZ8A 2XWBI 2OC7A 4SGAE 1L2EA 3DSGA 5E0GA 3SV2H 1OSSA 1KXAA 2TGTA 1PPBH 4HI3A 4DCDA 3PO1C 3WY8A 1Y3WA 1IQJA 3ATMA 3F0OA 4BAHB 2FI3E 1AU8A 1DUEA 5GWZA 2ZWLH 6LPRA 2ALVA 1SBWA 1PYTD 1YP9A 2XBVA 4VGCC 1BMNH 3M35A 1C2GA 3SU5A 3D62A 1GJ6A 3GCHB 4Q7XA 1UVUH 5DP5A 1CGJE 2QF3A 1IAUA 1Z6EA 2Y80A 1W7XH 1XKAC 2PUXB 1P10A 1ZMNA 1VJ9U 3A81A 1C5UA 1A5GH 5FL7D 1P2JA 2PUQH 4UEHH 2EI8A 5FBIA 2XCFA 5IYTA 2DE9A 5CDFE 2B9LA 1ZHRA 3PV5A 1HBTH 1FY4A 3I78A 3A8BA 4FU9A 4UFFH 3TJVA 5JB8S 2ZU5A 5FPYA 1K1LA 3FP6E 1KXEA 1LHGH 1QCPA 2ZG0H 1VCWA 2RDEA 3M36A 4YT7H 3PLKA 2XXLA 1A0LA 4E05H 3A86A 4ACAA 3TPIZ 4CRGA 2A2QH 3TJUA 4BANB 1FPHH 2A1DB 4ABHA 1DM4B 1UVSH 5A8YA 5L2ZH 1H8DH 1EUFA 4DT4A 2OP9A 8GCHG 5F03A 1CHGA 2Y81A 1ZYOA 1Z71A 2GKVE 3AVZA 1SGEE 4DURA 4BNRA 2Y5HA 4ABEA 3HGNA 1LHEH 1BCUH 2VU8E 1GBJA 1TGBA 3AW0A 2Z7FE 1CSOE 1ZRBA 4NSVA 4M7GA 4Y76A 1BMMH 1C5WB 3DFLA 2FS9A 1SGRE 2AMPA 3VB5A 1ARBA 3UPEA 1G3DA 1O3GA 2J4IA 1P2NA 2Z6BD 4GUXA 1GHBF 2A0QB 1SGYE 4RKJB 2J92A 2FTMA 2A4QA 3GDSA 1VGCC 5EQQA 2IPHA 3Q3XA 1TRMA 4D7GA 1KDQB 2RFKC 3RU4E 1GBAA 3CP7A 1O2YA 3STIA 1E34B 1TRNA 2BHGA 2BQ6B 3TGJE 2ZHQH 3PV2A 3U1JB 3LC3A 1EPTB 3TJNA 1O3MA 1QQUA 4AC9A 3P17H 5FPTA 3QN7A 1AKSB 2BVRH 4A7IB 2EY4C 2F4LA 3RM0H 4X6MA 2QY0B 2A5KA 1PPEE 2WPDD 5KEDA 2NU4E 3SZNA 1EOLA 1F7ZA 1HB0B 2AYWA 1BTXA 4NZLA 1SKYE 1QJ1B 4ISOA 5FPSA 3KYGA 3RC5A 1WQSA 4H6TA 1TOCB 2NU2E 2PKSC 1TONA 1MH0A 1P03A 3UQVA 5TCAA 1EP5A 3BTFE 4OS5A 3B8JA 1GBTA 2WUBA 3M5NA 2ZI2H 2QF5A 2H9EH 4AFUA 2YMSD 4GAWA 5A09A 4CHAB 3UNQA 4B73A 3RXIA 4Q7ZA 1EP6A 1OS8A 5AHGH 3ZYEA 1P09A 2TGAA 2VNTA 1GI6A 4MLFB 4AB8A 3MH7A 2J97A 2SFAA 1GBEA 1C1UH 5F8TA 2XCNA 3VFEA 3LKWA 3MFJA 5F8ZA 1YPLH 2O8MA 4NSYA 4WMFA 1UMAH 1TX7A 1GMHG 3BEIB 3RC6A 4AG1A 2OBOA 4LOYH 3UREA 3EQ0H 1Y3XA 3SU4A 2GCHG 5EOKA 4I8KA 2XYAA 1KLTA 1O2ZA 1KY9A 1NRNH 2ZU3A 2P95A 1O5FH 1ZTKA 2JETB 3LDXH 3TLOA 2R0KA 4JYVH 2XBWA 2CN0H 4NGAH 2KZ4A 3MNSA 1GHAG 1O31A 3KHVA 1YC0A 1Q3XA 2UUKB 1LPKB 1IOEA 3ELAH 2ZGJA 1SSXA 1BQYA 3RXEA 3UNRA 4WWYA 2ZDMA 4CH2B 4QT8C 2BQ7B 3PMHB 2A31A 3E0NB 1W0JD 2CMYA 4JZ1A 1GMCG 2SGDE 5LGOA 3MH6A 4YXWD 3ODFA 3BIVH 1KXDA 1THPB 3NKKA 3U8OH 1WTHD 1O2XA 1TBZH 1W14U 2CF9H 3PRBA 4DW2U 5F6MA 1W7GH 1OYQA 2BX4A 3SNBA 3SUGA 1GMHF 1BT7A 1GJ8B 3KEEA 5EPYA 2C3SA 4HZHA 4XFQA 1CO7E 1GCTC 3RXBA 1AFQB 1LHFH 2B5TB 4UD9H 2ZU2A 3W95A 4YM9A 3ZZCA 1DDJA 5GJ4B 3SQEE 2VIDA 2KCPA 4OS7A 2V35A 2OCVB 2V0BA 1V2UT 2BY5X 2A7HA 4BAQB 5A0BA 2GV6A 2B8OH 1UCYH 1VJAU 3FZZA 5C20A 5JB9S 1SVPA 1ETSH 2XTTB 4O3UA 1HAHH 4NA8A 1BRCE 2FYQA 1DICA 3F2HA 4NIXA 1ZPBA 2ZIQH 5HIYA 2TGDA 1O0DH 4TWYA 1FONA 4OGXA 2ZDNA 3E6PH 4Y8YA 1AZ8A 4B1TA 4I7YH 1SPJA 4I32A 2ZA5A 4K8YA 4ZKRU 2AEIH 1T8NA 3M7TA 4I33A 5DG6A 1J9CH 3GICB 1GJ9B 3F6UH 2YOLA 1AVWA 1H9LB 5KECA 1LQDB 2QC2A 3GY3A 3T26A 3VXEH 4AFZA 5AFYH 3DSOA 4K8BA 2GTBA 2A32A 4FUJA 1V2TT 3S9CA 1N1LA 1O38A 4YOIA 3L33A 2BDBA 2VGCC 1UJ1A 4B6FA 2I6QA 1QA7A 2J98B 3P8NA 1IQKA 2STAE 3U28C 1OXGA 1EJMA 1YGCH 2W5EA 4ZMAH 2W3IA 1NT1A 1TNJA 1WYKA 3VXFH 2Q6FA 3N7OA 1T31A 2Z9KA 1QA0A 4I31A 4Q4LA 1GBCA 5DP8A 4BAOB 4GVUA 3DFJA 3BTKE 1J17T 3KNXA 4K5ZA 5I46H 1OP8A 1S6FA 1NTPA 1T7CA 2F9VA 4XOJA 3QGNB 2EA3A 4MNWA 1RS0A 1VR1H 4OM9A 5EXMA 3TIUA 1FMGA 1CHOF 4CRCA 1Q31A 2A4OA 2BXTH 5CE1A 3K2UA 5FBEA 4AX9H 1SQAA 5C5OA 1C5PA 4Q2KA 3STJA 3M3VA 4IN1A 3UOUA 3TK5A 1C1RA 1HFDA 1VITG 5J4QA 3RP2A 2BDIA 1TX8A 1DWEH 1C2DA 4X1PU 5E2PA 4ZKSU 1GBIA 1GI4A 2UUJB 1YLDA 3SORA 1QBNA 4RT1A 2J34A 3JZ2B 4Z6AH 3PLBA 3RXSA 4JZDH 1EPTA 1B0EA 1O3CA 1ELAA 1CQQA 2ZO3H 2J94A 1ZSJA 3T28A 3SZEA 1V2VT 3A8AA 2GDDA 1L1NA 4K60A 5B6OA 4WJG2 2QXHA 2HNTE 1LVYA 3RLWH 4A1TA 4NWKA 3MU5A 3RXCA 1SGDE 1XUFA 8KME2 1WQVH 1GHVH 3NCLA 4A1XA 1MBQA 1AY6H 2EC9H 2D26C 3RXPA 4ISLA 1N6XA 4ESTE 5DP3A 4ASUD 1EOJA 2FTLE 3LU9B 1GDQA 3B9FH 2LP6A 5C67A 3H7OA 1AUTC 5JBAS 1XUJA 1Z8JB 2BD7A 2VVVA 2B0FA 5ETXA 1IQIA 1EAUA 3M37A 1DY9A 1QNJA 3CS0A 5EGMA 3RMLH 1ZMJA 1C5OH 3E3TA 2VBCA 4KELA 1UW7A 5FCRA 1GBFA 3FOAA 5DP7A 3BTQE 1AGJA 2D2DA 3RXFA 1A2CH 1GBMA 5TCCA 3A8CA 1O5AB 2QIQA 1JMOH 3TK6A 1AE8H 1Y3YA 2QE7D 3T62A 5E8EH 4TY6A 2O8TA 4M9FA 2J2UA 1W0KD 1E1RD 4DY7B 2GVFA 1SFIA 2O8LA 3M61U 1D6WA 3OFND 2SNVA 1GMDF 3OAAD 1GVLA 1QHRB 5IDKA 2R9PA 4AB9A 4D7FA 5EIYA 3S0NA 3SU0A 3A7YA 4KTSA 1MTUA 1C9PA 4AG2A 2H5DA 4INKA 3GCTG 3PB1E 4HG6A 3GISB 3QTVH 4MTBA 1YCPK 1ABJH 2VWOA 2AHME 4RI0A 4FUDA 2ZNKH 1Z7KA 5JYIA 1XM1A 2AMDA 1VITH 1G3EA 1SOTA 2H9TH 5L2YH 1RTLA 4F4OC 5JBBS 1SLXB 1P12E 1LKBA 4AORA 3ZVGA 2VH0A 1DANH 1H8IH 4FUIA 2OQ5A 1CGIE 3SGQE 1F5KU 1FDPA 1YPMH 4THNH 1UO6A 1RFNA 2VVUA 1Y5AT 3SJIA 1HAYB 3CNRA 5A8ZA 3RXTA 1EPTC 3C27B 4CREA 1CU1A 3A7XA 2BY6X 4R8TB 1J14A 1O32A 3LGUA 7ESTE 2Z3CA 2KR7A 1DXWA 1NFXA 5FX5A 4CBOA 2FWWA 4ZXXH 2VGCB 1ABIH 2Z3EA 3GCHC 1SGNE 5H4IB 3PRDA 3PTBA 3BF6H 2YNAA 2SGAA 1SGCA 3S69A 5HM2A 1H1BA 1T32A 1WCZA 4GCHF 6ESTA 2ZECA 2EI7A 1KXFA 2JH5D 3PTNA 5AFZH 5DP9A 1ELGA 1D4PB 1BOQA 1GI1A 1S81A 3OU0A 2KCAA 2PW8H 1ZJKA 1C1VH 3AK5A 2BVXH 2BDCA 3UQOA 4JYUH 1HYLA 1LVMA 1OP2A 4U30A 3ZZ5A 3U8RH 2JDID 3H5CB 2P3TB 1ANEA 2PSXA 3A83A 3MI4A 3SNCA 2FEQH 3V0XA 1C2EA 1UTQA 4ISNA 1PPGE 1GG6C 2F9BH 3FP7E 1CVWH 1C1MA 1C2FA 1OWKA 1T4VH 1EJNA 1SOZA 2ZPSA 1P57B 1F0TA 1W11U 3GDVA 4JMYA 1H8HD 4RSPA 3ZZ3A 3F9EA 4IBLH 2GD4B 4P02A 5C1YA 3URCA 1IHSH 3ITIA 1ZLRA 1YYY1 1SMFE 5EJZA 1LVBA 3TVJB 1P02A 3NPSA 5C17A 1ZGVA 2A5IA 1GI8B 4WXIA 3RXVA 4DVAU 1SG8B 2H5CA 2J38A 2W6ID 2FODA 3E8LA 3R0FA 4GHTA 2BD2A 1SI5H 3RDZA 1O3IA 5EQRA 1SHHB 1V6DA 1O39A 1ZR0A 2VWMA 3CS7A 1GI5A 3RXKA 3BTME 4Q63A 5DO4H 1N8OC 4ZHAA 3F3BA 2NU1E 1KDQA 3PMBB 1C5ZB 1QJ6B 1TNKA 1P2IA 4JYTA 1K1MA 1GHXH 1TAWA 4YTAA 3BTTE 2Z9LA 3TH2H 1PFXC 3E90B 4MQAA 4BAKB 4ZCNA 4O9VA 7GCHF 2VWLA 3FP8E 3GYMA 5EW2H 2JKHA 4WMDA 5EQSA 1F92A 3KCGH 1SL3A 3OYPA 4HTCH 3ENSB 2NU0E 3ZVEA 4Z1MD 1C5VA 1BTYA 1K1JA 3SJKA 1ZHPA 3UB0A 1AZZA 2WSSD 3TH4H 4ACBA 1BITA 1GI0A 4CRAA 5L6NH 1EZSC 5CHAC 2BLQA 4JK5A 4FETA 4I8GA 1NBME 4D8NA 3SJ8A 1TQ0B 3MNCA 1A46H 1FY1A 3RM2H 1FAKH 4BXSA 2BYAX 5CMXH 2G00A 1F5LA 1SLVB 1QL9A 2P8OB 2XBYA 1MQ6A 5E0JA 1MCTA 2GMTB 2G5VA 1NU7B 2FOFA 3QZQA 2JJ1D 1C9TA 4H6SB 2HALA 1NROH 1TA2A 3RXAA 3KYFA 5JBCS 1CHOG 1FLEE 1BBRK 4ABAA 4AN7A 1ORFA 1Y59T 4JZFH 2TIOA 2VINA 2ZDKA 3MO9A 4D9RA 1RIWC 4D76A 1S6LA 2F9OA 1D3PB 3QWCH 1A3EH 4TYDA 4ZAEA 2Y6TA 3KQCA 2OXSA 1TALA 4NZQA 3UIRA 2WINI 3LPRA 3QDZB 4ZROA 2PWXA 4ZHMU 2QXIA 2DE8A 4GPGA 2QCYA 1Q2WA 1NRSH 2XBXA 1XUHA 3S9AA 4TWWA 1BMAA 4Y10E 1TX6A 1LTOA 2UWPA 1NU9A 1ANCA 1H9HE 3BG4C 4WMEA 1HAIH 1T8MA 4RT0A 2L6OA 3A7TA 1LKAA 2GT8A 1KYNA 2ZU4A 1GGDC 5BRRE 5F53A 1LMWB 2QXGA 3EA8A 1HRTH 2K0QA 1SLWB 1RTKA 6GCHG 1ZZZA 4IW4E 4X2WA 5JPMH 2ESTE 4ZXYH 3SGAE 1J8AA 3E16B 3D65E 3E91A 2I6SA 1SHYA 1C5MD 3GCOA 2HGTH 4DJZB 1AO5A 3UAIC 4IC5A 5HIZA 3T27A 1C5QA 2ANWA 2Q6DA 3BSQA 1UTLM 3KIDU 3F2GA 2SGFE 4IGDA 1BIOA 1G37A 4WH6A 1GHBG 3EAJA 1D3DB 2G52A 2W7SA 1EZUC 1O5EH 1EQ9A 1MKWH 4SGBE 1W12U 2BLVA 4XSKU 1TFXA 5GDSH 3UTUH 4A1VA 1YM0A 1SLUB 3A8DA 1TNGA 2ZFFH 2ZP0H 1K22H 1W13U 4JZEH 1AHTH 2ZFQH 1A5IA 1ESAA 1C5YB 1BRUP 2LPRA 1TA6A 1ESBA 3I77A 3V12A 4UONA 1GI9B 1O35A 1F2SE 1NC6A 1C4Y2 1V2MT 1VITF 2Z9JA 2F3CE 1PPFE 2WZQA 3B23B 4F55A 5TJXA 1OWHA 1RIWB 1Z8GA 1RXPA 3U1IB 5HKKD 5DK1A 4ABGA 3MU0A 1O2GH 3SI3H 3L3TA 2UUYA 2ODPA 1GMDG 3MO3A 2OD3B 2ZQ2A 5C1UA 1TE0A 1XVMA 3F0PA 3VGCB 1O2LA 2BZ6H 1ZTJA 3GY5A 3BTHE 5AF9H 2FS8A 1O2OA 4DGJA 2FOCA 2XWAA 3VPKA 1VKYA 3BEFB 2BY9X 3A85A 1MKXK 3DA9B 1INCA 3SW2B 2BTCE 3TGKE 2NU3E 2AGEX 2J98A 1ARCA 2IN2A 1NO9H 5HYOA 3Q3YA 2ZGXH 3ATIA 4CBNA 1MD8A 2O8UA 4KGAA 2BXUH 1WUNH 2GZ7A 2J5UA 2RCEA 2WUCA 1F0SA 5EJ1A 2EEKA 1O2UA 1GBHA 1K1IA 3A89A 1GVZA 1S84A 3OY6U 2FX4A 2QYIA 1AWFH 3IITA 1K9OE 2IJOB 4NIYA 1G30B 3VB4A 3TJOA 3O8RA 2A45B 3ZZAA 2GT7A 1O2KA 2FI4E 3SU2A 2TPIZ 4XDEA 7LPRA 2FP7B 1GJDB 1U6QA 2AGIX 1O3LA 1JOUB 3MHWU 3ZIAD 2C8YB 1O2IA 2TRMA 1HXEH 1HAZB 3N99A 1H4WA 1MUEB 1HJ9A 3LONA 2FOHA 3U69H 1FIZA 2ZFSA 1CBWC 4K1EA 4YOJA 1O5BB 2VVCA 1ACBE 3MYWA 1YPKH
chains in the Genus database with same CATH topology
1C5XB 1Y3UA 2PKAA 3BG8A 1E35B 4CRFA 1TMTH 1JIRA 1FQ3A 1MU6B 3F9GA 3PYHA 3QTOH 3LGWA 3UWIA 2HPPH 1YPJH 1SGFA 3P8OA 1UTNA 1CA0C 1ZJDA 4HGCA 2TGPZ 4B2BA 1BZXE 2WYGA 1XUKA 3ODDA 4FUBA 3SNEA 3BTEE 2VIVA 4X8UH 3RMOH 1MMJN 3RXRA 3UUZA 2H1UA 1ZRKA 2Y82A 3QZRA 1YPHE 4CH8B 4AGKA 1O2TA 2C8ZB 1O3DA 3PWBA 4NIVA 1GBDA 1MTWA 4UFGH 3UR9A 2O9QA 1O34A 1EZXC 1S0QA 1S6HA 1RRKA 4Y0ZE 1XUIA 4A6LA 4DIIH 1OOKB 2ASUB 1D9IA 2BDAA 2ZHEH 2PTCE 4MDSA 1BBRE 1TNIA 4NWLA 2RDLA 2ZDAH 4E06H 1O2VA 2CHAB 1PPZA 5FX6A 1G36A 2GP9B 1BTPA 4Y11E 1QB1A 5AVDA 1TB6H 2SGQE 1CA0B 3SN8A 1NRQH 4INLA 4O97A 1FN6A 4J1YA 4O3TA 5DP6A 2ZZUH 4KTCA 4K1TA 2Y5FA 3MU8A 2ZGCA 5EPNA 1P04A 2OLGA 4J2YB 1BHXF 3PWCA 2JH6D 1HAOH 1PQ7A 2G55A 1P2MA 3ZZ4A 3QX5H 3EDXB 1GHYH 1CBWB 1ELTA 2BZAA 1F0RA 1JWTA 1AIXH 4BOHA 1TOMH 2STBE 1AFEH 2ZHDA 2PKAB 2XW9A 4YESB 1C5TA 1HDTH 2ODYB 1GJBB 1O2QA 1O5DH 1IQEA 4H4FA 4Y8ZA 3A7ZA 3RXQA 3UNSA 4ABBA 4U32A 2FM2A 1GG6B 8LPRA 2GV7A 3ZVDA 1C5NH 1QBVH 1S85A 3MH5A 3ZZDA 5A0CA 1L0ZA 4WVPE 2OBQA 2J95A 3BTWE 3FANA 3UOPA 5JBTA 4RN6A 2A4GA 1DX5M 2XRCA 2AMQA 8ESTE 2G51A 2ODQA 4MVNA 3HKIB 2D8WA 1DUAA 4ASHA 3P6ZB 3PMJA 1A61H 4Y79A 5EU8A 1EKBB 1GJCB 2K1QA 4DIHH 2H2ZA 1IQNA 4MPUA 1YBWA 3PV4A 5FAHA 4ZKOU 2W26A 3E1XB 2F9PA 1QB6A 2A7JA 1B5GH 5CHAB 1XXFA 4GCHG 5HMAA 1P9UA 1DSTA 4INHA 5EG4A 1GGDB 1RTFB 3U8TH 1C2MA 1O5GH 1AD8H 5FXLA 2BD3A 5GXPA 2WPMS 4X2YA 3HK6B 2CJIA 1ELFA 1O3NA 1RD3B 3GY8A 1NRRH 1HJAB 4Y7BA 3LJOA 1LVOA 1G3BA 4E7NA 1LDTT 3OTJE 1TABE 1JIMA 4ISHH 1LHCH 3F68H 4Q80A 3RC4A 1HAVB 3O8BA 1FPCH 1BTHH 2FIRH 1YLCA 3RMNH 1O3BA 4GLYA 1DE7H 1HIAB 1ZTLA 3P92A 1P2QA 7GCHG 1VZQH 1C1QA 3D23A 3AW1A 5HXFA 2VWNA 1W10U 1QL8A 1TRYA 1SC8U 1UTMA 2ZCHP 1EX3A 2SGPE 3P70B 4AYVB 1S82A 3RXOA 1ANDA 1NZQH 1O2RA 1AB9C 4NFFA 1P2KA 1C1OA 3TGIE 1O33A 3BN9A 1TMUH 1MTVA 1O30A 1TGTA 3OX7U 3OSYA 1H9IE 3EA7A 1BB0B 1ETRH 1EB1H 4B2AA 2BY7X 3KQDA 3RU4D 2BQWB 1V2NT 3NWUA 1O3FA 4JZIA 2BB4A 3T5FH 2PGQB 1E37B 1IQFA 3A87A 3Q3KA 2OC1A 4ISIH 5LPRA 1G9IE 1F0UA 4Y7AA 3P95A 1ZPZA 4BTTB 1EXFA 1C5SA 2BLWA 4WF8A 2EI6A 3UFAA 3P8GA 4K3JA 3EGKH 4OS4A 2P59A 3M3SA 2AH4X 1IQHA 2GCHF 3G01A 4OS2A 1T8OA 4UE7H 2GDEH 5PTPA 6GCHF 4X8SH 4YT6H 3ZVAA 4B76A 4FUGA 3DD2H 3CENA 1MTNB 3S7HB 1GL1A 1O3OA 1TGSZ 1GHAF 1JRSA 1F5RA 3LH1A 1A0JA 1WBGB 1NFYA 2Y5GA 3MH4A 5LH8A 2ZGBH 2GCTB 1OWJA 2HOBA 1CT2E 1GWAA 4PROA 4X6OA 3M5MA 1UTPA 1NFWA 3K9XB 1C1NA 1IQGA 2PSYA 1WOFA 3SU6A 2ZHWH 3MU1A 1BHXB 3M5OA 2OC0A 3KQBA 2ANKH 2ZC9H 2DUCA 2ZCLP 1HAXB 1W0ZU 1AWHB 3VB6A 3E0PB 1FN8A 1NRPH 2WPJS 1GBLA 4NIWA 5K7RA 4YOGA 1O3JA 2Z9GA 1UVOA 1TNLA 3M7UA 2QV1A 4AZ2B 2KAIB 3NUMA 3ZZ9A 2ZPRA 2W7UA 1HAVA 1UTJA 2BDYA 2SNWA 3V7TA 3F1SB 1TPSA 4ABFA 1V3XA 1XUGA 1XXDA 1OKXA 5T6GA 2V6NA 1AB9B 4WXVA 2FI5E 4CHAC 2A2XH 3UR6A 2ZQ1A 4AFQA 4X2VA 1O2MA 1SGQE 4NG9H 1J16A 4R0IA 3GY4A 2C4FH 2ZTXA 1C2JA 5DGJA 3FFGA 1K21H 3RU4T 3SBKA 2ANMH 1E36B 1ZGIA 2BMGB 3A84A 4NFEA 4IS5A 4K69A 2FOGA 1CGHA 1D6RA 2G5NA 1MBMA 1EB2A 2PHBA 1QB9A 1UVPA 3SUDA 1AMHA 5C3NA 2GCTC 1WTGH 2F9NA 4XBDA 1G3CA 2G4UA 2OQUA 5I25A 3RXDA 1L4ZA 5JDUB 2Y7ZA 3ZV9A 2XC4A 3A7WA 3ZZBA 4NCYA 1DLEA 1C5LH 3A80A 3DHKH 2XC5A 3AASA 5E0HA 2Y7XA 1SGTA 3TNTA 2JETC 4X6NA 1C2KA 1ZMLA 1IHTH 1YPEH 2ALPA 1E38B 1GBKA 1Y5UT 3F9HA 3FAOA 3T29A 2W3KA 4BTIB 3K6YA 3VB3A 5GPIB 4FUEA 3TU7H 5EXLA 1KLJH 3ZV8A 1TPAE 2GX4A 1QGFA 1O36A 1K1OA 5SGAE 5ESBA 3SJOA 1C2IA 3P8FA 1XVOA 1YPHC 1O37A 3DUXH 2HWLB 3GY2A 1T4UH 1GCDA 1KLIH 3QO6A 1V2PT 1ZOMA 3RXJA 4ZHLU 1UVTH 3PROA 2BD9A 4MNVA 1QRWA 1AFQC 1TLDA 2ZU1A 2F9UA 1RJXB 1HCGA 2PGBB 1T8LA 1GDNA 3URDA 2WYJA 1VCQA 1C4V2 1ID5H 3S7KB 1FY8E 2TBSA 5A2MH 2F91A 1FV9A 4TPIZ 1LCYA 2VIPA 1IQLA 1NESE 2OINA 3DT0H 3LIWA 5DP4A 2Q6GA 4UFDH 2H9HA 3HGPA 3MWIU 5FHTA 2A4RA 3SV9A 1K1NA 3R3GB 5EW1H 1B7XB 1OPHB 4B2CA 1Z8RA 1GI2A 2Q1JA 2P3FH 3GY6A 2ZKSA 2QF0A 2QGRA 2RG3A 1HJAC 1BTZA 1YPGH 2CXVA 1HNEE 1O2SA 3ZZ6A 3V3MA 1KIGH 4IMQA 1O2NA 1Y8TA 2FMJA 1THSH 3QUMP 1ESTA 1GHWH 1LHDH 3LC5A 4LZ1H 2BDHA 3IWMA 3ATWA 2ULLA 1KSNA 1WU1A 4A92A 1BTWA 3D49H 1Z1IA 3M5LA 1UHBB 3KGPA 2PR3A 4LZ4B 2CHAC 3LGYA 5ESTE 1UK2A 1SFQB 3TK9A 2ZHFH 2BD8A 3U98H 1MKWK 4B75A 3KQEA 1BBRH 3SOSA 1BA8B 3RXMA 1G2MA 4Y6DA 2LNCA 3HKJB 3VEQB 1PPCE 3FVFB 3TNSA 1FNIA 1A0HB 1GCTB 2GZ9A 2BD4A 2M5TA 5HGGA 1DPOA 2ZTZA 2PTNA 3LH3A 1WAYB 1Y5BT 1P3CA 4K2YA 2THFB 1EAWA 3GDUA 9LPRA 1DXPA 3NK8A 4YO9A 2CV3A 2WPHS 2FOEA 3GOVB 1N6YA 2BM2A 3IG6B 1ZSLA 3ZZ7A 1V2LT 4GSOA 5C1XA 2AERH 1CA8B 3MNXA 1KTSB 2IOTA 4F49A 4MPWA 4IMZA 4TPYA 1L1JA 1OWEA 2FOBA 4I8LA 1X7AC 2CF8H 1EJAA 1GPZA 1EAIA 1K2I1 1O3KA 1LPGB 4MPXA 4IC6A 1QRZA 3M3TA 1O3AA 4E7RG 4HFPB 2VIOA 3S9BA 1PQAA 1TGNA 2ZEBA 2VIQA 4AOQA 1O2JA 3RLYH 1QQ4A 3MU4A 4LXBH 3KF2A 4U2WA 1G2LA 5K0HA 2UWLA 1GMCF 4X1RU 1QR3E 1NN6A 1KXBA 1PJPA 1TIOA 4Q7YA 1C4U2 1EAXA 4KP0A 2FO9A 1NFUA 2VIWA 2G81E 3SJ9A 2ZDVH 5A8XA 2HNTF 2H6MA 2QA9E 3T2NA 3ZVBA 1THRH 4FU7A 3AAUA 4ABIA 2WPLS 1FY5A 1MTSA 4TY7A 1P05A 3A88A 3O8CA 1AE5A 3PO1B 2AIPA 1PQ8A 3SNDA 3JZ1B 4MG3A 1HAGE 1P01A 2QN5T 3Q77A 1P3EA 2ZDLA 1DWCH 2AIQA 3BV9B 2HPQH 1QIXB 1HXFH 1OX1A 3GY7A 4XBCA 3MNBA 1HLTH 4X0WU 1V2WT 1TQ7B 2J9NA 2BY8X 1W8BH 2ZFRH 1O3HA 9ESTA 4OGYA 4Y8XA 4X1QU 4B74A 1Z1JA 5DPAA 1GJ4H 2OC8A 1BJVA 2P3UB 2PLXA 1M9UA 3RXHA 3BTDE 4KTUA 3QLPH 5GCHF 3HPTB 5EXNA 1A3BH 1YF4A 4YLUA 2ILNA 1A7SA 3KL6A 1P2OA 4UDWH 4AGJA 1MKXH 1QBOA 1S83A 1QL7A 1V2QT 3A7VA 1QTFA 3T25A 2WPIS 3SO3A 1ZPCA 2CGAA 1W0YH 1GL0E 3NXPA 3LGIA 1BMLA 1EATA 5A0AE 2P94A 2QAAA 2R3UA 1OP0A 1LQEA 1FAXA 1DLKB 1P0SH 1A1RA 2BOKA 4FVBA 1ELVA 3H7TA 4X8VH 1CT0E 1FY3A 1NM6A 1NPMA 1VGCB 2A5AA 1O5CB 2C90B 1MCVA 4X6PA 3TH3H 2FPZA 1AN1E 1TYNA 1V2RT 2R0LA 1O2PA 2OTVA 4OS6A 1C1WH 1HGTH 1A4WH 1EZQA 1W2KH 2R2MB 2Z94A 2UUFB 1XKBC 1GI3A 2BD5A 2QXJA 1DFPA 2WPKS 4CR9A 1HPGA 5F8XA 1K28D 5GIBA 3O8DA 1ANBA 3SHAH 1NY22 5DKMA 2R3YA 2B7DH 3SGBE 2BOHB 3SV7A 1S0RA 4WH8A 1UCYE 4X1NU 3SQHE 2D1JA 1Z8IB 4FVDA 1S5SA 1TNHA 2RA0A 1GHZA 4IN2A 3MOCA 1V2ST 4D9QA 3EA9A 3ATKA 2O8WA 2GGVB 1QURH 3V13A 1PPHE 4BXWA 1LPZB 1CT4E 3ZZ8A 1BUIA 1IQMA 1O2HA 1DITH 1C5RA 4FUHA 6CHAB 3LGTA 3SNAA 1ELDE 2ZCKP 3K6ZA 1TPPA 2VH6A 2RA3A 2C93B 2BVSH 4I8HA 1W3CA 1CE5A 1DS2E 1KTTB 2YNBA 2VJ1A 5DJ7A 1DY8A 5HM9A 1KXCA 3SHCH 4VGCB 1ELEE 1UK3A 2C8XB 1HJ8A 1MTNC 4FXGH 4LK4A 1YCPH 1C1SA 1ETTH 1UHBA 5C2ZA 1GJ5H 5LPEA 3A82A 1HV7A 2SGEE 3SUFA 1O3PB 1V2KT 1HUTH 1FUJA 4UFEH 1DSUA 1MU8B 2JH0D 2KAIA 4FUFA 1QJ7B 2UWOA 1SGPE 4MNXA 5LPFA 1DWDH 1WSSH 5T3HA 3SV6A 3HK3B 5J4SA 4X1SU 3C1KA 2FLBH 2NWNA 3PM3A 1JRTA 1DVAH 1TWXB 3M7QA 3PLPA 1D3QB 1TBQH 5L30H 1PYTC 1AQ7A 1JXPA 4AFSA 4CRBA 1FIWA 2BX3A 2FESH 3SUEA 1EASA 1OWDA 3LGVA 3BTGE 1MZAA 5G4BA 5BPEA 1QY6A 3ATLA 1E0FD 3UY9A 1GJ7B 1ELCA 4NA9H 1AI8H 4H42U 3SU3A 2PFEA 4MPVA 1QRXA 1V2JT 5T6FA 4Z0KA 3BEUA 3W94A 4ZUHA 2HNTC 3GCNA 1AVGH 1C2LA 2FOAA 4RKOB 1FZZA 1UTKA 4NA7A 4CRDA 5C5NA 2R2WU 4YLQH 2Z9IA 3U9AH 3GCTF 1PQ5A 2ZFPH 2PKSB 3LT3A 1BDAA 2HRVA 1J15A 1YKTA 2XNIA 4ZH8A 8GCHF 3NZIA 4JCNA 1BRAA 4Y0YE 1P11E 1ZSKA 1WV7H 2FYRA 1VCPA 2HVXA 1RGQA 2ZTYA 1GDUA 2OUAA 3MMGA 3QGJA 1A5HA 1YCPM 2V3OH 2FZZA 3EYDA 1DT2A 1O2WA 3BIUH 5GCHG 4B71A 1SQTA 2ZF0H 3RXGA 1AUJA 3TITA 1G32B 3AAVA 4U01A 4BTUB 2BLOA 1OWIA 1XMNB 1GJAB 1BRBE 1LO6A 1P9SA 1OYTH 3FZDA 1HIAA 1K1PA 1UTOA 1QFKH 7KMEH 1B0FA 1Y3VA 3UWJH 1BTUA 2VB0A 2AGGX 4ABJA 2WV4A 1MD7A 1L4DA 4XE4A 5FCKA 2PV9B 2ANYA 4CR5A 1DOJA 3Q76A 4DG4A 1BJUA 4DT7B 1MAYA 2G4TA 3GYLB 1GI7B 1AVXA 1DWBH 1AKSA 3SU1A 1XX9A 3SV8A 1C2HA 1SGIB 3MTYA 1D3TB 1Z6JH 2FX6A 1FJSA 1TGCA 3Q00A 3QK1A 3RXUA 1UK4A 1SGFG 4WY3A 5E2OA 1SR5C 3L6PA 1MQ5A 2C8WB 4FUCA 4BAMB 5ABWA 2ZGHA 3EE0B 3SI4H 2ZFTA 3I29A 4JK6A 1TPOA 1MZDA 1N8OB 1P06A 3LOXA 5EODA 2G8TA 2A7CA 4GHQA 4FU8A 3F9FA 1ELBA 4X8TH 3BG4B 2BDGA 1FI8A 1SB1H 2FLRH 3K65B 1ZHMA 1MAXA 1L1GA 1GVKB 3VGCC 2GMTC 6CHAC 2FDAA 4XBBA 3ZVCA 4YZUA 1JBUH 2P16A 1C1TA 2HLCA 1TMBH 2P8OC 4KKDA 1O3EA 2Z3DA 3RXLA 3ZYDA 2V3HH 3MO6A 3PMAB 4I8JA 1UCYK 4OS1A 3HATH 4AYYB 3LJJA 3RMMH 2F83A 4A5TS 1P8VC 1V2OT