1RXSA

E. coli uridine phosphorylase: 2'-deoxyuridine phosphate complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 86
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, a, b, c, d, e, h, i, j, k, l, m, o
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxsA00
3OZDA 4TTAA 4DARA 3OCCA 1V2HE 4R31A 1OV6A 2B94A 3BSFA 1NC3A 3EUFA 3BGSA 1OTXA 2HSWA 5CXQA 3OOHA 1PR0A 4JWTA 1PR6A 1I80A 3KVRA 4WKOA 2A0YA 4QASA 1LX7A 1PWYE 4G41A 1K3FA 1Z35A 1T8RA 1U1CA 2I8AA 2BSXA 4YNBA 4GMHA 1PR5A 3EEIA 4I2VA 3FUCA 2A0WA 1Z37A 1T8SA 3KU4A 1T0UA 1SJ9A 3U40A 4TXJA 3ODGA 2RJ3A 3P0FA 5CCEA 1Y1RA 1ODLA 1RXCA 4MARA 2GUWA 3ONVA 3LGSA 1A9RA 1Y1SA 4TYMA 1Z5NA 4TXLA 1PF7E 1Z38A 1PK7A 4OF4A 1YQUA 4L6IA 1YBFA 4LDNA 1JDTA 4YO8A 5F7OA 1OVGA 1U1EA 4OGKA 3OZEA 3GB9A 1JDUA 4D8XA 2OXFA 1T8WA 1V48A 1ODJA 1V41E 5F76A 5B7QA 1WTAA 2A8YA 1RCTE 4DABA 4BMYA 1LVUA 3FAZA 1Z39A 1TCUA 3INYA 3LA8A 2A0XA 1K27A 5I3CA 1A9QA 3UAVA 1CG6A 5ETJA 1PR1A 4WKNA 3O6VA 1V4NA 3NM6B 2OC9A 4L5AA 5F77A 2AI1A 4OJTA 1V45E 4E1VA 1RR6A 1NW4A 1TGYA 3K8OE 4OGLA 3UAXA 5CYGA 5F7JA 4TXMA 4TXNA 1PR2A 1OU4A 4QFBA 3DPSA 4EB8A 5F7XA 1Q1GA 1TGVA 1VHJA 2XRFA 3OZCA 1JE1A 4EARA 1FXUA 1PK9A 4KN5A 3D1VA 5B7GA 3OZBA 1SQ6A 4D8VA 3BL6A 1NC1A 1RYZA 4QATA 4LNAA 4RJ2A 3IEXA 1G2OA 3NM5A 1RXYA 4BN0A 1A9PA 4H1TA 1JPVA 2HN9A 4LKRA 3UT6A 5F7ZA 4X24A 5B7NA 4G8JA 2OECA 4DA0A 1ODKA 1ULBA 3KVVA 3E9RA 5B7PA 3FWPA 4D98A 1TCVA 1QE5A 3OOEA 3E9ZA 1A9OA 1JP7A 3EMVA 4PNPA 1U1GA 3E0QA 3FB1A 1SD2A 4P54A 2I4TA 3OPVA 4BMXA 4ECEA 1Y6RA 1JYSA 3MB8A 4TTIA 3F8WA 3PNSA 3FNQA 3PHCA 5KB3A 4IP0A 2OC4A 4M3NA 4BMZA 1JE0A 3OF3A 4K6OA 1OTYA 1C3XA 2QTTA 1Y6QA 5IFKA 5F73A 5IU6A 2AI2A 1TD1A 1PBNA 4QEZA 1RT9A 1JDSA 4JP5A 4DA7A 2HRDA 3DJFA 1RSZA 2AC7A 1B8OA 5CXSA 4UC0A 4M1EA 2IQ5A 4R2WA 1PW7A 2ISCA 4G89A 1ECPA 1Z33A 5C80A 2QPLA 1OUMA 3DP9A 3UAYA 5F78A 4DA6A 1RXUA 3K8QA 1K9SA 4D8YA 4F2WA 2PGAA 3C74A 2AI3A 3ENZA 4M7WA 4NSNA 5EUBA 5EFOA 1VMKA 1LV8A 1SD1A 4TTJA 1A69A 4MCHA 1JDZA 3EUEA 2Q7OE 1RFGE 4F3CA 4GKAA 3DDOA 3KUKA 1N3IA 5EPUA 4LZWA 1Z5PA 4D9HA 1Y1QA 4WKBA 3PHBE 1RXSA 3GGSA 3UAWA 4FFSA 5DK6A 2HWUA 4F1WA 1YQQA 2QTGA 5JPCA 1PR4A 4NY1A 1XE3A 3KHSA 5CYFA 4YJKA 2ON6A 4JOSA 3FOWA 4R2XA 3NM4A 4MCIA 1V3QE 4QAQA 4GLFA 1U1FA 4U2KA 3DF9A 4TS3A 1CB0A 4L5YA 3TL6A 4DA8A 1JDVA 3BJEA 1YRYE 3PNPA 3UAZA 3KVYA 4L0MA 5K1ZA 1M73E 5FAKA 1YR3A 1A9TA 2H8GA 1ZOSA 5CCDA 3O4VA 4YMLA 4OEHA 3LBAA 1VHWA 4GLJA 4PR3A 3P0EA 1Z34A 2QSUA 4L5CA 4WKCA 4LNHA 3T94A 1Z36A 3MMSA 3IOMA 1ODIA 1Y1TA 4F2PA 1ULAA 2P4SA 4OY3A 4F3KA 4DAOA 4NS1A 1T8YA 3QPBA 1VFNA 1B8NA 1U1DA 2QDKA 3SCZA 4DANA 1PKEA 1Z5OA 4TS9A 4QARA 4TXHA 3NBQA 4WKPA 1A9SA 1ZL2A 4DAEA
chains in the Genus database with same CATH superfamily
2I2BA 4NBSA 2IE0A 4IWYA 3UJ8A 3OCCA 1W94A 3E15A 4OQDA 2P9TA 2WHYA 2ZB2A 5AICA 1OV6A 4OQLA 3G13A 5JOQA 1V6SA 2UXBB 1PLJA 4DCPA 5K05A 3FHTA 4X7BA 1N8TA 4DSOA 1FFYA 3S40A 5E9AA 3FFAA 3WK8A 1ZIOA 2MOKA 5IJ0A 1IN4A 1WZUA 5C5CA 1LBTA 4N3AA 3PQCA 3ZGXA 1I3MA 2GAIA 3ETDA 2L69A 1FTNA 2EJBA 1U9IA 3MYYA 3UXYA 1T2DA 4EY7A 1JEYB 4ZAFA 3E70C 2JLAA 4GOXA 1K6MA 1VCMA 3WL4A 4DG5A 2FUG6 1IB6A 2M98A 2F62A 1SWVA 1Z3CA 3MWDB 4JNCA 4N49A 2WUEA 4UNNA 2R7LA 5FOUA 4FLMA 2X7XA 4FE4A 4G0XA 1EVYA 1L7OA 1VCIA 4KYUA 1ZK3A 4IIBA 5A62A 1H8ED 1JSLA 4RMGA 1II9A 3NBUA 4BN5A 4DCSA 4GHWA 5BN4A 4BXOA 1WDKA 2ZSDA 3LPNA 4AMYA 1H8EA 4G41A 1K3FA 2BM1A 2L18A 2A57A 5LCXA 1Q7EA 4OATA 5JDCA 1CNMA 1U1CA 2XOKD 2W83A 4H0NA 4JYPA 4U2BA 3RHZA 5JJ5A 4Q1EA 4B3JA 4AI6A 4YNBA 4AD8A 1PR5A 2A78A 2QMUA 1L7PA 3OT1A 2QZ9A 4ZEMA 4P4SA 4X9XA 1W49A 1SKBA 3F97A 5CT5A 4CKZA 1GHTA 3N7UA 1ZOPA 2NO5A 4WJZA 1M0EA 2UU9B 3PUKA 3OE5A 1Z4OA 1GNRA 2CXQA 4N54A 5LXTF 3RRXA 3TZHA 4DLWA 1XYYA 1VE1A 2HJVA 4BKQA 1B2LA 1DEAA 3KUCA 5AW1A 4LEIA 3FBTA 4TUYB 3DYBA 4WN9A 1KSHA 2ODQA 1N6LA 1SC1A 1U3GA 2O3JA 1T25A 2XQVA 3QU5A 5CHEA 5TQVA 1RE0A 3VKFA 1T0UA 3DB1A 3I3SR 4DY6A 2MCFA 3SSOA 4BKUA 1XAHA 5AT1A 5A03A 5ADVA 4BQRA 5CDGA 4ZQCB 1ORDA 4DV4B 5ELXA 5LMZA 1K8ZB 2VJMA 3AEZA 4MUJA 1DHTA 1KK2A 2PX6A 1ISSA 4NF2A 3E6AA 2AVDA 3AF3A 4EZBA 4YPOA 3S8EA 4GLLA 1RXCA 3KZKA 1Q21A 2PKXA 3ML1A 4ZJYA 1H1TA 3JVIA 4D9JA 3KXKA 4BU0A 2PRKA 1KKUA 2GYUA 3CT4A 4JC8A 5DNEA 5CNKA 5JO9A 5LLSA 1ZD8A 4WK2B 2R8XA 1P2SA 4PYIA 5KPDA 1A9RA 1P1CA 5LBUA 4Q4AA 3VZSA 5IDVA 1V7CA 2FAXA 2WU8A 3ROFA 1MP0A 1FFCA 5CG2A 2ZRDA 5DXJA 5AXBA 4RU1A 4TXLA 1RABA 2MSKA 4ZKDA 3ILSA 1G2PA 2Q2OA 4HEJA 3UWPA 4J0FA 4TLBA 5DSZA 3TOXA 5EMKA 4BNNA 1TJ5A 2IP4A 2JEZA 3BWCA 3SIXA 6LDHA 5GMOA 3BORA 2HWXA 2OHXA 5G4KA 1U1EA 2IU4A 3L1UA 3LV8A 5K5EA 4BBPA 4B48A 5KREA 2J9ZB 1S3GA 4OU4A 4LJ4A 3P45A 1E2EA 3IALA 1S8AA 2OYRA 2VJOA 3CG0A 5JDIA 5B30A 1AGYA 2A9FA 4UW9A 4KQ2A 3O8OA 3CLHA 2JGKA 5DTJA 3SHOA 5CEEA 2O2GA 1F4LA 2BN4A 2YN2A 3H5NA 1VQ1A 3QYPA 5K3SA 4M0UA 4CM8A 4E88A 4DABA 1R1DA 3VNRA 4ETNA 2RGCA 1JMVA 1TZKA 2WWVD 5HILA 1ZVJA 3SFZA 3KEGA 5KEIA 4W7IA 2NUPB 3IELA 5ER9A 3WSWA 2QYHA 2DMRA 3C8HA 3D5TA 4O5OA 5IDYA 5CFPA 1PWZA 1VM6A 1N1EA 3MG9A 4FVTA 2EZTA 4NEHB 4C07A 5TMDA 1XK7A 4PE5B 4BAGA 4ZFNA 2XDWA 1G6Q1 5TB5A 1L4EA 1TF5A 3EVCA 4O25A 1BE6A 3P9PA 2BP7A 4GYWA 4JJAA 3VU8A 1FSSA 3BMNA 1R5BA 3WMFA 3KBBA 1LY1A 4JMPA 1V4NA 1M2JA 2NTEA 1WNTA 1XLUA 2PXHA 5BYAA 4L72A 1YIOA 5L3QA 1CQWA 1JHUA 2QN9A 4BZXA 3CZAA 1Z13A 3BHJA 4EP1A 3VNVA 3RAPR 5LXTB 1C3VA 5FI5A 1ADJA 1RNLA 3MOGA 1NDHA 4MUBA 4XM0A 1SC6A 2ZBGA 3W5SA 3F67A 4BY9E 4XB2A 2YFYA 4QLOA 3MLBA 4C7BA 4C88A 1MJFA 2ST1A 2B0CA 3T9FA 3UAXA 2C4TA 3WMGA 4DM4A 4JI1B 1Q20A 3RUCA 3WTBA 1QHGA 3B13B 4YEDA 3WXBA 3JALA 5F7JA 1W5EA 1NVVR 4JX9A 4JLOA 5CGQB 2NXNA 1YJCA 2OQ2A 3FMGA 4WWHA 4D4GA 1Y7PA 4BNMA 5DULA 4EGSA 1H9CA 1X92A 3AKCA 4A15A 3LCUA 3B7WA 2ATIA 2BFCB 3RIEA 5K4HA 3LW8A 2B36A 3OX2A 1R6UA 2CEKA 3UUGA 1UZLA 1QX3A 5ICMA 1FQOA 1RYBA 1ZOLA 4P53A 4Q12A 5D2CA 2JNWA 5DO9A 4CNBA 1UBNA 3FDIA 2GK7A 1KBZA 3EW7A 1NC1A 4TWRA 3EA0A 2LTAA 3LNTA 4MI1A 2PMBA 1LK0A 3KR9A 3ZBQA 4AB1A 3OEHD 4FN5A 5H4HA 4G5XA 5BO5A 4EG0A 5CIYA 3C8DA 4GDFA 4P82A 5CLIA 2UYCA 3ZVMA 3WYBA 3AUXA 1G59A 3B38A 1Z6PA 2A1UA 3G8AA 1XU4A 3LCCA 3VM6A 1ZNQO 3T7RA 5KSPA 2PGIA 1MA0A 1YTLA 4ZDKA 2VYVA 3C7DB 2I2WA 1V96A 1C8KA 3GRRA 1VJCA 5L3ZA 4X90A 4EJSB 3R7AA 3F6EX 3LRTA 4OUDA 3T9DA 1PIWA 3IPLA 1F4VA 1WIWA 2CCKA 3E84A 3QJ5A 1XXHB 3H16A 4BWVA 3O3NB 3G0OA 3KK0A 1F8XA 1WOYA 5IH3A 4J4HA 3TTUA 4M9SA 3UG6A 3VTZA 3W8DA 1GUBA 2JFWA 4J9VA 4B6FA 3THRA 4C4RA 5JTUA 2DEUA 2WYHA 4M9QA 4COOA 2RI1A 3TBKA 3SD7A 3U7GA 4RGYA 5FBVB 3LLCA 1KEKA 4P4LA 3QELB 3V9AA 3G8YA 2BFDA 3OFKA 1IN7A 1HG0A 1OROA 3FVRA 1Y48E 3KFLA 3TRKA 3V9PA 3IL2A 1X7DA 4U9HS 1YVRA 2QAGC 2ZJ7A 1J20A 3IT1A 2NO4A 2BFMA 3N6VA 2ZE7A 5AIAA 4DV3B 3GO4A 4JJKA 1X9IA 2JI7A 2VDQB 4JP3A 3OHMA 4WVLA 1W1WA 2AKEA 1WW2A 1N2BA 1CNEA 2RHOA 1ZWKA 4L74A 3TB4A 3V4SA 3UT0A 4ZIRA 1FW6A 2V54A 2ZXUA 2LP4Y 3C14C 3OZWA 4AJJA 1UWVA 2PT9A 4QTYA 2BGLA 1ABBA 4LYHA 1W4BA 2Y1XA 2JD1A 4HQRA 3MT7A 3V2UA 1EM8A 4JENA 4UTXA 2XWSA 2GLXA 4RK4A 3B12A 3K73O 4QAJA 5I45A 5KB3A 1CEEA 2RK4A 4FQ7A 4QOHA 3L8GA 3BJMA 2XVYA 4A1OA 2HIMA 2IUSA 4KWTA 3DD5A 1FP6A 1RYFA 2O2DA 5IFKA 1UDWA 4C6TB 3L9XA 3JD2A 3NC0C 2PV0A 4WSOA 2WTMA 1O2DA 3F1LA 4M9CA 2ZGVA 3QSYA 2VDKB 1GXSB 1LDGA 4WNIA 4XR4A 4DYVA 3GLFA 4BB9A 3SQXA 3IDAA 3OM1A 1NN5A 3DHEA 4JBGA 4LZPA 3A1WA 4RTOA 4LC1A 5JMPA 4D0GA 5DNUA 2ZSUA 2OYCA 1CLUA 2JFZA 2O2EA 1OBOA 5FBRB 4JP5A 4EG4A 1IPEA 5LD2B 4ZQGA 3CVVA 1XVTA 2VOJA 3EAQA 2QY9A 4PIMA 1DINA 4RF5A 4D45A 2ISSD 3STUA 5J2TF 1O0CA 1LV7A 3JQBA 3VPCA 2QWXA 3BMQA 3NHPA 3SHQA 1VBMA 4Z7OB 1U6JA 1X7ZA 2A9PA 2WU4A 2Z9BA 1Z8FA 1N5LA 3GCZA 4L8WB 3X0DA 1U7UA 1KBQA 5ITZB 3M6IA 4K05A 4PO9A 1GAWA 4D43A 1GPWB 1UMDB 4M21A 3NRJA 4DBLE 3MAGA 1VSTA 4KNVA 4NQRA 5ANRB 1PSWA 4P3KA 5G40A 2ENUA 1OUMA 2XZDA 1Q1AA 2QD3A 3P4YA 4NG5A 10MHA 4HL6A 2X0JA 4EPRA 1BS2A 2JHCA 4Q3OA 4ZMBA 2HA4A 4R9VA 4LE1A 2H11A 3GBVA 1ARZA 2J9YB 2WOOA 4LDQA 2OK7A 3PWZA 1IQUA 3O4RA 4XWKA 4X3PA 4OLHA 2YMPA 3OAAA 3M0EA 1B93A 3AEQA 1E6CA 4V2IA 4YT5A 4FW9A 4ZT6A 3FVTA 2FRDC 4UBIA 2ZIVB 5JSYA 1DAFA 3NHBA 3M3DA 1H3FA 5LBIA 1EIZA 2GDZA 3UG7A 3ONWA 4CM4B 1O0SA 2V3WA 3NJ8A 5CTAA 2FWBA 2WMDA 5JCOA 3NH6A 4LF7B 2L19A 2R00C 5BUSA 1H8HA 3AX6A 1L4LA 4HY3A 4ZVLA 1V7PC 1LU9A 4LRSB 5T5QA 4XJSA 1JDZA 3M49A 1LVGA 4JV5B 1T5SA 1C9JA 3C1AA 1WX1A 2D59A 2ZT8A 3E9YA 3EZNA 4GP6A 4WXMA 3WICA 1ETHA 4B7CA 1I6KA 2Q0SA 1GADO 5D84A 1Z5PA 3CZMA 3G79A 4GX0A 3E53A 1P18A 1FQJA 1H05A 1I24A 1T6XA 5BPHA 4RTPA 1KU6A 5IJ9B 2WJAA 5E8RA 1HYGA 1F0YA 5LP1A 5CJJA 1UDBA 1XXLA 1S8OA 3P20A 3EJ6A 2VP2A 3IBCA 3ZTWA 2DH5A 2G4VA 5B37A 3CUSA 4C7OB 2WUDA 3IAM6 4TWBA 1LW7A 1W5FA 4H3HB 4NY1A 5BSFA 4MW9A 3V3TA 3EULA 1BDIA 3J7AC 2WG2A 4BHTA 1JL3A 3DZFA 4GX5A 3H4IA 3LC1O 1Y5RA 1BD3A 2HU5A 1A4RA 2Q1YA 1SVWA 1QVAA 2W8BB 2X0NA 4IZOA 5ALOA 1HE3A 3RVPA 2C2KA 1UPTA 1T5DX 2A86A 3FCUB 3I30X 3L8YA 3WJAA 1PT7A 5JAUA 1V3QE 3FCYA 4LMPA 1C8BA 3OD5A 1E6EA 3OJWA 1EX6A 4IJKA 4K9LA 3T5AA 2JFXA 3JZFA 4HNAA 4JHXA 2DHRA 5AKHA 3HR8A 3AR2A 3R1IA 2DHDA 3K16A 4OOEA 1OXTA 2OPBA 1N34B 5I7AA 4JYBA 2JL1A 3F6CA 3TDMA 4UMEA 1GNQA 5CH3A 2QUHA 1RQNA 4ZVMA 5GAJA 1UWCA 3TL6A 3CPJB 1P6QA 4CLEA 3RAGA 5IJXA 1UMDA 4I6EA 1L5HB 2ODNA 4WZBB 2YV4A 5SZHB 1PGQA 3VFDA 4DDHA 4W5QA 1I8TA 1YRYE 1KIMA 1YZLA 3QEKA 5KTTA 3HVRA 4Q3NA 2WSYB 4QJ5A 1TQ6A 1HTWA 2AZ4A 2WA1A 2XCIA 3KT3A 1AF7A 3DEIA 3JSXA 1KDOA 3U81A 4MB6A 3LY7A 3ELWA 1D2GA 1AQNA 4RENA 4PPYA 1EB8A 2BW0A 3RS9A 3BYZA 2C57A 5EEHA 1LI5A 2C0CA 4OHPA 3N28A 3LQFA 4OM8A 4WNAB 5CB0A 3WYGA 4EH1A 2LWIA 2GRJA 2RGRA 2ZZKA 5T4EA 5AXAA 1E69A 4EVQA 3HXMA 1P1RA 1KMCA 3NTVA 4QT0A 1G6KA 4NH4A 4TTPA 3GPLA 2HPVA 1SVSA 4BP1A 4BWFB 2JLUA 3ACBA 2C4UA 4ESOA 1Y7LA 5F3RA 1G3QA 1K0UA 4ZO6A 5A71A 2P9CA 3GPCA 2AFHE 2O5EA 1T3ZA 5HUHA 3JYHA 3D6NB 4GXQA 1CBUA 3SJAA 3W04A 2F3RA 3NC1C 1W59A 5LQNA 5ADWA 4BX0A 1D0VA 2RHJA 2C2HA 3KLBA 1ACJA 5C37A 3LYHA 1KEUA 1MO2A 1PGNA 1FTQA 3FUTA 3UK0A 4BNDA 3C3BA 3KQTA 1EDZA 4KQ1A 3IP5A 3K7EA 2UXDB 2QLBA 5REQB 5B3KA 3B2QA 2F1RA 5HTKA 4MB0A 5I7SA 1YVEI 3FJYA 1IBKB 1XROA 2BY4A 1WU7A 1Q1EA 1KZ9A 3HCPA 4L4RA 4CV0A 2DETA 5CDFA 4ZI7B 1ZH0A 4NS1A 1U7HA 3QPBA 4GMXA 5A9RA 5IRCD 3S1SA 1I7LA 4X6YA 5BMOA 4D57A 2R85A 3DXYA 3W4JA 3DA8A 4RFVA 4XEUA 3U17A 1EH5A 3DQPA 4OUKX 5JTTA 2Y27A 3BBPA 4UAJA 3SR4A 4Y9SA 3FTDA 2H31A 1T4CB 5ALIA 4L8LA 3MJEA 4NK4A 4D79A 1ZL2A 1YJ8A 5LJLA 1U63A 3EDMA 3H1GA 3ZWXA 3EASA 2COUA 1L8OA 2Z58A 1N75A 1Y5NA 3DBRA 3M1LA 1I4EB 1U11A 2GPTA 1CUZA 1QP7A 3RDPA 5D00A 1OC4A 3OMXA 4Q9LA 1G5HA 1RQGA 4EJSA 2Z2JA 3WHKA 5IAOA 1KYQA 4AXBA 4DJEC 1N2SA 1V35A 1BWRA 3GEIA 4HUQA 4WGFA 4LWOA 5TMEA 5BMVF 2CYAA 3M1YA 1J2TA 3PUHA 4PS0A 4AUMA 2QP4A 4FI3F 3L0SA 1YS1X 3R5XA 1YA4A 3L9WA 4GBED 4A3SA 2KSQA 2NMVA 1XU7A 3GWGA 1NR7A 1M3SA 3AHEA 4I1RA 4WZBE 4BZWA 4A82A 3TXAA 5LR6A 4G8BA 3WIOA 1KQPA 3GLHE 1UC8A 3KKPA 1XKQA 4F8YA 3QKRB 4F3NA 3EFBA 2WWGA 5L45A 4D4KA 4DY4A 1GTJ1 4IILA 1SK8A 1QBGA 6CHYA 4HLNA 1JMKC 3NBAA 4K1LA 2WMYA 4NBVA 3AR5A 5K0BA 1ST3A 3KQSA 1E8DA 1IATA 3GP5A 1NVXQ 2CVHA 4H60A 4IIJF 4YAFA 4E5VA 3M6AA 4JR0A 2LR0A 2B4RO 3E3NA 1W34A 2JGMA 4BWYA 2JEOA 2ZAIA 5AH0A 4PF1A 3Q8LA 3N9IA 5HYVA 3FLEA 4FFPA 2IHNA 2WI8A 3RBXA 4JJ7A 4I2VA 2E4AA 4K6KA 3AUJB 4P5DA 2FOLA 3KRTA 4Q3EA 4WCDA 1PTJA 3VGPA 1JU3A 2H2HA 1DQRA 2O5RA 3O8BA 3H9QA 5CG1A 5BN5A 3M83A 4AY4A 4WMLA 3DXXA 2O7RA 1YJAA 2JZOA 1T0JB 1QQ7A 3E3LA 4B43A 3RYCA 1XP8A 2CB0A 4UNRA 2X19A 4JH0A 3BQMB 2IV7A 1G8YA 4E5MA 3R5TA 2ZANA 3TKYA 3D8TA 3SJUA 3GFVA 3P9KA 4RGQA 2XUDA 2ZBPA 4DLPA 3AV0B 3ZOKA 4W7HA 4LPKA 1PT9A 2J5QA 3ABZA 3Q4GA 2QRKA 2NGRA 5FPSA 2LDXA 3FZYA 1Y1RA 2A4KA 5AVOA 2K5UA 3I9NA 2GRAA 1VHTA 3AIOA 3T9EA 3GJZA 4MEBA 2YWEA 3ZIDA 4MW5A 4BMSA 2ILTA 2Y0BA 1EWTA 2R48A 5A4JA 2PSJA 4YS6A 1NJ6A 3CMMA 2Z08A 1PDVA 3P0HA 3W6PA 5L6LB 2P2NA 4RACA 1UWKA 3ZWDA 4DV0B 3FDZB 4BLQA 3GN1A 1K89A 4ALMA 2QL5A 1VTKA 4QLBA 4EJMA 2Q2NA 3GLIA 2PA0A 5DYYA 3R6TA 4X7RA 5IYZA 2C2WA 4CETA 2V7WA 2AYYA 4GP9A 1TYCA 2WJYA 4LECA 2IW1A 2OHVA 4HH3C 2YJ4A 4E6EA 4CTMA 1X8XA 2XUZA 4JYAB 4LY6A 5EQDA 4G5QA 3IEMA 1AZLA 2IDZA 5HF6A 1AUOA 3EZ9A 5ILQA 3ZI4A 4BIIA 5CDFE 2P40A 3C48A 3ZG6A 1EK6A 3K0CA 3LQ2A 5CYPA 3TIIA 3UJPA 4ROTA 1ENOA 5KTNA 4EF6A 3HP1A 2QN8A 4KGZA 4PBTA 4ZKEA 4DCCA 4EPVA 4RM3A 3W2GA 5A6SA 2OFWA 2V7BA 2WNHA 1R6TA 5JJCA 1ABFA 3KOUA 4UNQA 3ID6C 4I9FA 5E7JA 3ZHBA 1BX0A 3EVFA 5AESA 2WB2A 2ZJFA 3NAGA 3OPNA 1BO6A 3KTFA 3HM9A 3S0JA 1VPEA 2C3UA 2NYVA 1OXSC 2TYSB 4GLOA 4RQAA 3SAJA 4HLDA 4Q05A 1MQSA 3DZJA 2H0AA 1SCUA 5I6DA 4RVNA 1KXZA 1ZMBA 3LA8A 3PKJA 4D8UA 4RD4A 1U28C 3K05A 4CQMA 3OESA 4HDNA 4S35A 3LPLA 4D1YA 5JHHB 2EKQA 5CTJA 1VP9A 3SSAA 4ZCIA 5BYKA 1LQUA 2ISQA 4IUBS 4MV6A 1SHLA 4OXNA 1FP7A 2ZTHA 4BFTA 4L22A 4EBFA 3RC8A 1MH9A 1FJ2A 1KEEB 1E61A 1KH2A 1LLDA 1ZKMA 2PKQO 3H1BA 4P86A 3TSWA 5MGBA 1ZRMA 4F85A 3I2FA 3MSXA 5AK5A 1IYZA 3I53A 3GELA 1AB6A 4AP5A 1YBAA 5EZYF 2C1XA 1B1CA 1W5TA 2Q21A 1FP2A 3AFHA 5DLPA 2P9HA 1TGYA 2PWPA 2J41A 5IZCA 3O74A 3K8OE 4MKZA 1Y7HA 1QLHA 5K9ZA 2EW2A 2B8NA 4KPFC 5F1YA 3R3XA 1G41A 2EC5A 3KQWA 2L0XA 3IBYA 5A3VA 3BBLA 1ZOIA 2P7IA 4J4TA 5IT4A 2DFDA 2FPXA 4D74A 4BEWA 4FNMA 3OCYA 3P2MA 4RNDB 3TX6A 4HB4A 2HIGA 4RK6A 4ZI3A 1KEVA 4TS4A 2I67A 4Q7JB 1DC4A 2PK3A 2AV6A 3ZDZB 1H22A 1KK3A 3LQ4A 5DHSA 3O3OB 4P7GA 3GJRA 4A8JA 3THYB 1GPBA 3GJTA 2DPMA 3GEEA 3PIDA 3TG2A 1FVXA 1CY6A 2HGZA 4A92A 1VHJA 2M9MA 1R4NB 1XEXB 3L06A 2VUUA 4XVCA 1IJBA 1E7MA 2Q4EA 4L8YA 1KAHA 2HC9A 4EARA 1UDCA 1RAIA 2AQ8A 1SUCA 2FUG1 2QLFA 2QW8A 3QKTA 3R5FA 4I55F 2J31A 4JA0A 4ZAWA 5JG7A 4FT2A 4D8VA 4WIAA 5FBZA 3PDUA 3W2FA 3NHSA 2J32A 4GWGA 3DOHA 8ABPA 1OX6A 5C8XA 2QD2A 3P4XA 4U1RA 4XPIA 1R4MA 2QAGA 3FNBA 4XSVA 2WJHA 3OJCA 3RR2A 1X8KA 2E6UX 3FF4A 1L7QA 3FYSA 4MRMB 1SFRA 2H1FA 2WK1A 4QTXA 4ZICA 1MEJA 2YVLA 5EXDA 3SBEA 2ZR7A 1XRSB 4A6EA 3L6BA 4NMMA 2QU7A 1PUJA 3FWZA 4MPJA 1U5AA 1BAPA 2XZLA 2DHQA 1AX9A 1NX6A 3HCDA 5T3YA 3HXPA 3TJZA 4QEKA 4DUGD 4ND1A 2VR1A 1IWOA 1ZJZA 1XZNA 2JEYA 3TCNA 1MAAA 3HJUA 1ILEA 1JGTA 2G9UA 1W4CA 2V7VA 3H9EO 4C04A 4YGXB 3M2PA 3Q0TA 1N3BA 1D03A 1WSDA 1A98A 2QROA 4J1TC 2NOAA 3D3WB 2NVWA 4PGFA 5KI6A 5B7PA 1N4DA 1UXOA 5JFOA 1V8FA 3FJ1A 1L8QA 3I12A 3N53A 4H3VA 4XOUA 1L8XA 2CSXA 5JFTA 2Q9UA 1SUFA 4B3RB 5A3QA 2HNKA 1JZTA 1Y5LA 3LT1A 1RQ2A 1XXHA 1JH9A 1O9HA 2ZRGA 3LO8A 3QF7A 2A58A 5CEJA 2BVNA 1GZ3A 3ANXA 4DWJA 4EA8A 3QEMA 4XIGS 3R7SA 4OI2A 3KYIB 3D9QX 3KFVA 3FB1A 2CDRA 2P11A 3L4KA 4HGYA 2ZZMA 1R64A 3LA6A 5CDYA 2NUTA 1U65A 5JZOA 3AJ9A 4BUJA 1VIMA 2W6IA 3SDZA 2XKJE 1TKBA 3NWOA 1XCPA 4KQHA 1KMIY 2PCLA 1AV7A 1KE1A 4YB8A 1KS9A 1K6EA 3EBOA 3GFFA 4LHVA 3UB4A 4BRSA 2ZCJA 1OE0A 2ZT7A 1RCUA 3Q1LA 4G25A 1E66A 2WWFA 3ZNNA 4CG1A 3VMFA 3QJGA 4Z0PA 3PF9A 1P7ZA 1YO6A 1JNYA 4YP1A 4JUAA 4CPDA 2D1RA 5AKJA 4HT3B 4YAUA 1N92A 3OLYA 5JR3A 4MUHA 4WNCA 2Q50A 3EUWA 4DR7B 4KQFA 2JAOA 2PD4A 1Y6FA 3QWHA 2AWOA 3QVTA 1AZTA 3EGDB 2GTHA 3IRUA 1E1CA 3MOSA 3DCNA 5LOVA 4RLHA 3B52X 4BNJA 4K6HA 3ENKA 3OU6A 4R2JA 5DM70 5HP4A 1VZ3A 3BJRA 3KVOA 4G26A 3H8VA 4LOLA 4JKIA 2AJTA 3CLSD 3TKLA 2FN4A 5EWMA 3U7QA 1ODSA 1MAVA 4YX9A 2IHTA 1IY9A 1PJ3A 3EXHA 1JDSA 3BDAA 3KV3O 2FF7A 5HKOA 3JQ7A 3NEAA 3OCZA 4P4TA 1H69A 1K8QA 1LW6E 1GQQA 2XNJA 3DMHA 1RSZA 1X1DA 4UXHA 2OILA 3AY0A 5E7IA 5CXSA 2V4UA 2YNMA 5KVQA 1U3FA 3BHNA 1TA4A 2NQTA 1Y5IA 1M6HA 4PG8A 2A7XA 3QE9Y 3VO9A 2EP8A 2PX2A 4X85A 3RD5A 1R0LA 1GZUA 1GG5A 4HK4A 3R5HA 1L7BA 1SZPA 2Z0MA 1QFXA 4Q1VA 4OH1A 5TC4A 1HFKA 4EKNB 3TGPA 5C5EA 2QZPA 2PGLA 4ZAVA 2IITA 3KQNA 1O96A 2I4NA 5FR1A 4GPD1 1QRTA 4K9RA 1N2CB 1YQGA 2FG5A 1L1RA 3KOYA 4P4NA 3V7UA 4YT2A 3D4LA 5JJBA 4MPDA 3GLTA 1T6YA 4LRWA 5JDIC 3IXMA 1GL6A 1H9AA 1QHXA 4LNUA 3RVBA 3UW1A 5IJZA 3PD7A 1NF3A 4QUIA 3EH2A 1B42A 1C7JA 1K0FA 3AHFA 3IOEA 3QVJA 4OREX 5DK4A 3W77A 4EB3A 4NDNE 3USES 2HIAA 4NSNA 3ZE2B 5EUBA 3VX4A 2HDNB 5GY7A 1Z4JA 2J6CA 2RHDA 3BICA 3KR2A 2M6LA 3A6KA 3BRCA 3B9RA 1RZVA 3JQ9C 4QBHA 3C8ZA 3DH0A 4IX9A 5EE0A 3NANA 3FOAA 4RCVA 5HS6A 3CNBA 1SA0A 3CU5A 2WIAA 3AONB 4NK5A 2Q2VA 1ZMTA 4MR8A 3KR1A 4GKAA 2V9ZA 4A8JB 2GXAA 2O3SA 2JAUA 4JHLA 5A4IS 3DQZA 1EVQA 2OCPA 3EMKA 3PNVA 3IV9A 1DMRA 4PSAA 3K9FC 2FZWA 5ECGC 3JQ8B 4IZIA 4WD3A 3RARA 1DJQA 1Q19A 2XE4A 2G7ZA 3VRHA 4HAIA 1NVDA 2P6PA 1I30A 2K4MA 2ZR9A 3KLOA 4O29A 2ZI7A 4WESA 4ISBA 4A0HA 5ALZA 4Y18A 1Y1KE 5TJHA 4GOKA 1GV0A 3D5QA 5BUQA 3D1LA 1SGWA 2PH1A 2WVAA 2YWDA 1FIUA 3E18A 2A0KA 4O0LA 4HEHA 3D3JA 4BLWA 1J7KA 4JLUA 1HFJA 3GR6A 1T36A 4GM4A 3IAAA 4EG1A 5I4BA 1BMFA 3SDSA 4C30A 4HMOA 2GEUA 3G3EA 5BNZA 2ON6A 1DXHA 4X1IB 3AF5A 1GZ6A 1DTWB 1T34A 4N40A 2O1WA 3BC1A 3LRPA 4W6ZA 2A5GA 2W22A 4BJ1A 2CE7A 5H80A 3NVDA 4U2KA 5DMHA 2I2XB 3DF9A 2YRFA 3PQ4A 4MYUA 5LNK1 4LPSA 2G80A 1VJ0A 2OV8A 2HV8A 1A7KA 1GU7A 1BN7A 4FINA 4ARCA 2JIPA 4E4YA 5JD3A 3W5VA 1WY5A 2GZHA 3U7IA 3GLHB 1M1YE 3IEIA 1O6ZA 1DEOA 3W3ZB 4CM7A 1TF2A 1V11B 2HX1A 3EF0A 3KB6A 2DFNA 4W1PA 1I33A 3TLGA 3ZLJA 1B1AA 3PL5A 2O8CB 1NP6A 2PY6A 4JGIA 2FDRA 2WHQA 6GPBA 2PMFA 3DMPA 4G5FA 3ODPA 2I3GA 3EY4A 5D3QA 3MS2A 1P1FA 2C5EA 2D62A 1V1RA 4JJZA 1JHQA 5IXYA 1K7SN 2HFJA 3AERB 3ILXA 2FG7C 4MGKR 2XEXA 1OX5A 3PGXA 2W90A 4D9MA 1MX1A 1IHXA 2F2TA 2H4FA 3D7MA 3QEAZ 4Q1FA 4BZPA 5CB6A 2NSLA 3GG2A 1EUCB 5IDWA 4QOGA 4ETIA 1EBFA 1GPUA 3A1FA 3TIVA 3WDLA 2DM6A 5IT0A 2I55A 2BFAA 1EAYA 1ODTC 3H11A 1GYPA 4Y9UA 1CVIA 5BSVA 4A2QA 5TVGA 4J3JA 3OT4A 4HAWA 5I9SA 3C8MA 1W1IA 4DG8A 4ZOQI 1ZUNB 3RF7A 4CCWA 5BRJA 1MUUA 1Z0IA 2Q4BA 3HSYA 1NBIA 1WPRA 3DCYA 4YHHB 1RRPA 1SKUA 5C7LO 2V6IA 2WB4A 2WU0A 2ZE8A 3DE2X 1UJ6A 5B1HA 3U7EB 4NU0A 4OHMA 4Z99A 2B5VA 1WF6A 2HTFA 4QFDA 1DAOA 5HM8A 2W2LD 4MSUA 1H6AA 5B3AA 4ITRC 3K15A 1WCIB 2IYVA 2J5XA 5JQGA 1I6LA 1MVLA 3MCTA 4JLBA 2NUAB 3HY3A 2HF2A 4IRMA 4XX0A 2VQ6A 3DKRA 3V6LA 2O3QA 3PC8C 3HMQA 1NMYA 2D1SA 1UODA 1W96A 3CUYA 4ZV7A 4DANA 2PT6A 5DCWA 4ZAGA 1RYHA 1RS0A 2D13A 1QO7A 3GFBA 4ICIA 4KQXA 3M8KA 5AM4A 3I5XA 2O23A 4B6GA 4MVJI 3UV7A 2W6CX 2F43A 3NHWA 3BL8A 3VJKA 2VP4A 5LA6B 5GONB 4JI7B 3BXFA 2AR7A 5K3FB 3VSBA 3UMYA 3JQDA 5J9FA 3A2LA 2C4NA 2WEKA 3FGNA 1PL0A 1Z2CA 1GYRA 2RCYA 1L5GB 1KK0A 1U99A 3M4ZA 4EKYA 2XGOA 2YY6A 4MUKA 5CDSA 2JFHA 1KF0A 3KJFA 4MYTA 3QTBA 1KY4A 1Q7GA 4YN3A 1ZWLA 3P0IA 1NVTA 3AFIA 1XDGA 4N5DA 3R8CA 3AU9A 3TRFA 4N0MA 1NC3A 4LJ7A 4LYYA 2Y1FA 4Q6WA 4X8HA 3DOIA 3ZHUA 3EX7C 1QTIA 5JH7A 2FW8A 2B2CA 1TIBA 2RGYA 2NSHA 2H4ZA 2Z8YA 3EUFA 4HQ0A 5CH8A 3I6ZA 5ALLA 1P45A 2BEVB 3GD7A 4MQBA 5JEDA 1I94B 4ZVUA 3FNRA 2P9JA 4V0OA 1LEHA 3TL3A 3JCZA 6NULA 1TLLA 3USCS 3UOGA 1JIJA 1L4FA 4JYZA 3T7AA 1JXOA 1X1QA 3ESBA 4ILKA 2WG1A 3HWRA 2KE5A 3A1TA 3IB3A 2WOJA 4JLVA 3UEOA 2P5SA 3U2QA 4C4OA 3QOFA 5CA0A 1FRFS 2CV1A 2VTDA 3R7NA 1OASA 3UTDA 1T43A 2ZJ3A 4GI2A 4URZR 1XZLA 5J1SB 4Y6LA 1E32A 3RVKA 1TI7A 4PSVA 2I4RA 2FWRA 3NVMB 2MHCA 3UXEA 3NALA 1BWSA 3A4VA 3RYHB 4X64B 5K8CA 3I6YA 1EXVA 3BTVA 1GQFA 1QGUA 1XVAA 2OLEA 5JWHA 2B1RA 1UOPA 3FD8A 2BZSA 3FDJA 1Z37A 2DFTA 4KMOA 4BGEA 1FF9A 4L9RA 4YJ2B 3X1KA 4AS2A 3M1AA 2MMCA 3H9CA 1ZCFA 3RYHA 3TLMA 4S1TA 4CCSA 1KJZA 5IK2D 4RTNA 1TC2A 2ZUEA 1O03A 3VH3A 1REQB 5DTRA 2G0AA 1JILA 3F7OA 2QX6A 4GO1A 4DILA 2QN1A 3N6XA 5A4MS 3EZGA 2LCFA 4IVPA 5KYTA 3QELA 1K8RA 2KX7A 2YJZA 3UO8B 2W71A 3GJQA 2ONKA 5CA0B 5BVGA 4IDHA 3ODGA 2CNWD 2YBDA 3GVHA 2HF7A 4LJAA 3VDRA 4A23A 5KAPA 5EJGA 2XWJI 4JC5A 1I7SB 3AVQA 3O73A 2O8NA 3UMCA 3G2JA 5C53B 2QXYA 1D3AA 1Q22A 3MTGA 1XX6A 4WCFA 1EB9A 4J29A 2GN0A 2TMDA 5BSEA 3TTXA 4D99A 2G76A 1W87A 3I4FA 4I4LA 5BMVA 2V6GA 5C34B 4BJ3A 1KFKB 3TS1A 3DDCA 4KWCA 5CNIA 2VOEA 4ADSG 3NCTA 4F5YA 2BEJA 2PU7A 4D4MA 4RAOA 4N0EA 5HK8A 1Z5NA 1NP7A 3U4IA 5KS2A 2W4MA 4JEIA 3KB2A 4REQB 5JS2A 5JISA 2X1HA 4ND5A 2DE0X 1U0FA 1J24A 1YUNA 2AOXA 5FO1A 2FVYA 3WGJA 2NVUB 4X44A 4IWXA 4QT4A 3Q3IA 5ICCA 2ZIGA 3HGQA 4GGMX 3HB4X 3QBDA 1LSSA 1G3RA 1C81A 2AUNA 3Q2OA 3QLJA 3HDHA 4RLFA 2ZSEA 4WNAA 5GONA 5JRJA 4DR2B 3WIEA 4U4AA 4ZQHA 2J9FB 3A25A 1O97D 5EINA 1Z74A 4AMUA 2ZTUA 4UDXX 4RHCA 4ABTA 3BWVA 4LJLA 1MXFA 4LGVA 1LA2A 3KXDA 4G2TA 5FOSA 4F4DA 2RIRA 1V41E 4FC7A 4CG0A 3C1OA 1Y3DE 4O1MA 3E03A 1YRQA 3E9MA 3HU3A 4Q3DA 3M6LA 1UBGA 4H35A 1X74A 5I4IA 3BERA 4ZRMA 5FRDA 4BNZA 3RVSA 4OHXA 2WM9B 3R3SA 4ZU6X 1IY2A 3N3BC 4QBGB 4R0VA 5CURA 4BMYA 3LUFA 4UOZA 3Q10A 2G63A 4RMIA 2OXCA 5FNVB 2N0SA 2GKGA 2PLNA 1OV4A 3EDCA 4RVCA 3MEQA 2CD9A 2X58A 4AS3A 3LZCA 1KORA 2WIDA 3S1AA 3NLLA 3VU1A 2VRCA 1XKXA 4O8ZA 1E1LA 2BGKA 5A0TA 2BCGY 3RYIA 3A1CA 2ESRA 3EXFB 1C41A 1LC0A 1IVYA 3KZVA 4RSMA 4PHTA 2Z04A 1DV2A 2PUVA 1DFHA 1L5WA 2P77A 3H3XA 3TMKA 1CHNA 3SFVA 5BSHA 4QM6A 3GEGA 5H81A 3LUJA 3PXXA 1UQRA 2WHRA 4OHUA 3B7GA 3FAKA 1ZH6A 5ALXA 4P92A 4E46A 1HI9A 4RWZA 1VLZA 3VYVA 4DMLA 2A30A 4FGUA 1RHRA 2AI1A 3R3VA 3QOYA 3HUUA 2JAHA 3U49A 5HW0A 1IBMB 4DF3A 2C5BA 4OJQA 3A4YA 1NW4A 4XASA 5CIQA 1JWBB 3SQOA 3VU9B 1NQOA 5JARA 4BO0A 2JARA 4IIUA 1D2EA 1ECGA 2NU9B 1WQ3A 1GNLA 3ZZTA 3WGIA 1KMNA 5JBIA 3C3DA 5K0GA 2O2JA 2ZYIA 3D64A 3AI1A 5DVZA 2HFKA 3NHRA 1A7AA 3D6JA 3DTVA 4E7OA 1L0BA 3SZOA 5T7BA 2BELA 4CMBA 4RD2A 2EVWX 1ML4A 2Z2IA 3F2VA 3PV0A 4FYKA 1K5HA 1HF3A 1HDZA 3EWSA 3RT9A 4E5NA 4YO7A 2R6DA 1JPNA 3K0FA 4HAZA 3PLNA 1DCFA 4MW4A 3F73A 3D6VA 3G02A 1YQ9A 1EYZA 1N1GA 4F04A 1N78A 1WL8A 1QFSA 4DSTA 3TGLA 4YAOA 1JJBA 1J2RA 4ARZB 5B57C 5LYJA 4HCJA 3ANTA 3D8NA 4ENUA 2CNKA 2Z1MA 4L9SA 1XA4A 2G4CA 2YH2A 3QBTA 3RBZA 4KHPB 2NACA 3OVMA 2NVOA 4ZT2A 4ZYVA 1K1EA 2X3FA 1D07A 3VH1A 1PL8A 2DWUA 4WUTA 4EG5A 1BHSA 3BF8A 4ZP1A 4D4LA 3VA7A 5I9LA 2YQ4A 4XYMA 4DNXA 4KFCA 5JYBA 3WC4A 3I9KA 4DQLA 1F2DA 3AB3A 1M2OB 5CT6A 1LFDB 4LTDA 4JI4B 2D5BA 2GF2A 4G84A 2RGNC 2BUAA 4MCAA 5EMJA 2O50A 3O03A 2Q07A 1KKLA 2BI8A 3H84A 3RVOA 5DTMA 4MV9A 5KVVA 2ZYAA 1KI7A 2WPNA 4Y6GB 3SXUA 3TDNA 2J3EA 2MSWA 4COKA 4TYNA 4N3GA 3N1UA 4YGYA 3CR7A 5GM1A 3FZQA 4DMFA 2NLOA 3FPAA 3NKLA 2P65A 4OBXA 1Q2UA 3RFXA 1C14A 2HJSA 3LIIA 2CZQA 3SMVA 1LWNA 1DC6A 3TVTA 4YMWA 5ADUS 1LZKA 3LTEA 3AEUB 1WMFA 2Y1OA 4WK4B 2I2DA 1IG0A 3TFOA 3RU9A 2FYTA 1XTKA 4IGIA 2VSFA 3DBLA 3E0QA 4PGGA 1BRMA 4CMIB 3SNHA 1E89A 3BVPA 3U7HB 1G9SA 3CKMA 5LLDA 3RJTA 4MA5A 4DV1B 1XT6A 1G8GA 2LXNA 2NAPA 2Y6VA 1ES9A 3OPVA 3OX3A 2PUDA 2P2CA 2HBRA 1ZOOA 4UUQA 5K01A 3K70D 1BDBA 1R0CA 3ET5A 4UD6A 4IM7A 1TQ8A 3JVDA 4LE0A 4NFLA 3OKAA 1RWVA 4XCQA 3C3KA 5FIUA 3WRVA 3GT0A 4CDGA 2C7PA 1IONA 2GJKA 5TT1A 4NYMQ 4HWKA 4ENVA 1D6SA 1JFRA 4G1VA 1II8A 1W25A 2VZ0A 3L0YA 4HVTA 5CBKA 1UK9A 4CL0A 4Q3LA 1FTSA 1UBTS 2G82A 3D1JA 1IWPB 2YWXA 3Q6IA 3HNRA 5ALKA 3BD6A 1CS4C 4N39A 3HG7A 4FFWA 2VCYA 4TSFD 5D6NA 4EO4A 2HMAA 4FFVA 5CM2Z 1XG5A 3W7AA 3DV2A 1UMBB 5CA0F 5DISB 3K31A 2H4HA 3WFZA 5P21A 5G1PA 3JAKA 4PHCA 5LKAA 1G4HA 2Y6UA 1EU1A 3ZXYA 1GV1A 4P7BA 5JVDA 3DEHA 1YMQA 3F96A 3O95A 3V4ZA 1NT4A 5BVHB 1NBOA 4UOQA 5K6AC 3R20A 1AQJA 5E7QA 5ALEA 3R3WA 3ZE6A 5AVVA 3RIHA 4WNYA 2XMDA 1GPMA 2FUEA 5F1PA 2QLJA 2HRDA 3G7NA 3R9XB 2VHCA 4EG3A 2V45A 4LHSA 3SE7A 2PMEA 5SZJA 1KPGA 2A35A 2D4HA 2PKWA 4X61A 3UHFA 3TBHA 4DTCA 1BEEA 2DCMA 1VJRA 1V5EA 4JUBA 4RIIA 5ECYA 5KOHB 1V8DA 4WHMA 3U7QB 2WJZB 3CRQA 2VK8A 4AAYA 1X3LA 4A91A 3AZOA 4UQOA 3JQPA 2CUZA 3GAFA 1G16A 4FIZA 1NAIA 4IIEA 1UANA 3G2KA 3FWYA 2HLDA 5B3JA 4A8HA 2IXBA 4OUDB 5DLEA 4HX2A 5LWQA 4LXYA 4MIOA 1RXUA 3E48A 5EMLA 4TPKA 2ASVA 2JIMA 3CZ9A 2C20A 3Q1KA 4K9MA 5TJ9A 3IP1A 4V3CA 1JQLB 1GA1A 4UHDA 3VDQA 4PBRA 2ZVDA 1IJEA 4LXQA 4MPRA 1Q57A 4AUKA 3OC0A 1YF3A 1BE1A 2OZLB 4TV8A 3I0MA 3H5AA 4G56A 4XIYA 2I91A 5KNCA 5EKUA 3EQ8A 2X0EA 4AMBA 2GSDA 4TT3D 1VECA 4DLAA 4RGVA 2HRCA 4WY8A 1A69A 1CE8B 2Y05A 5CUQA 3THXA 4BFVA 5B1DA 4CUKA 1GPYA 1T5BA 2QG9A 5CB4A 2EEPA 2D3WA 1J0EA 4WDRA 2W93A 4Y1FA 1T2AA 3UMSA 3MW8A 2OGTA 1PDWA 4C22A 3F4KA 1MDBA 2GYYA 3SEAA 1QDEA 5GONF 3HKDA 4HADA 1KMMA 2BLNA 3VI4B 4GPIB 4RZ3A 2ZEJA 2J3QA 1A5ZA 3WWCA 5TPWB 4CVNA 4U7TB 5DK6A 4BQOA 5A5VA 5KMGB 4KLRA 3A1SA 4LTNA 2HWUA 3AFOA 4GRAA 4JUIA 3JTMA 2H3EA 1RWBA 5DB4A 5CJPA 1PQWA 1VMEA 1JKMA 3ER6A 5CVVA 3QTLA 5E4TA 1WZ2A 4FT4A 1UKZA 4MVCA 4P3NA 4BJ6A 1PS0A 2YMQA 3JRWA 4EFMA 5K51A 4PYRA 1M0SA 4KXFB 4BO1A 1MC1A 1WUKS 4UU0A 2CLFB 1LQ2A 1U9ZA 2OV6A 2YZ2A 1OT5A 2ZUUA 3AXTA 3RQIA 1OXMA 1FLAA 1PX0A 3IV7A 3FPLA 2J4DA 5JVDB 4C08A 4EUFA 2FSIA 1EVLA 4GX2A 4WA7A 5JNLA 4QGAA 1LVHA 2B69A 2FNAA 1K2WA 3DLAA 1AGRA 4WV3A 3ZDRA 3IUEA 5D86A 5KTSA 2HWYA 1Z5ZA 4QAQA 1GSIA 1MA3A 3H0KA 2IVZA 1QHSA 3IB6A 2G6TA 5JCZA 1ZHOA 2XZOA 3B53X 3RUFA 1IG3A 2H1WA 4KRYA 4Q9IA 3G2QA 5EKXA 2G72A 2NT4A 2XD4A 3FPCA 3H2KA 4E1AA 5HNKA 2FMIA 1NURA 1Y1LA 2XEDA 5I7RA 2FQXA 4D56A 2AQHA 3FN4A 1U80A 2AOTA 4NJEA 4KK3A 4JC0A 4F2HA 2QTWB 2Y3IA 1F48A 3GH3A 3Q3GE 5BNTA 4N6GA 1Z8NA 2XAAA 3VZPA 1U5BB 3B9QA 4XM2A 1NXVA 1FE8A 2X0DA 2IYSA 5LLTA 2OGSA 1E2PA 1BE8A 2EL9A 2W43A 3CLTC 3K9WA 3SJBA 4RELA 1FRVA 1C1XB 1KBOA 2FH5B 2X5JO 4NFSA 4QGHA 1TUIA 5TPWA 1XQVA 2EX1A 3LCMA 3PTLA 4MA0A 3MINB 5BSTA 2DBVO 3E3MA 4CKEB 5BQFA 3G5UA 2DY1A 2CWWA 3E1KA 4WBSA 5EAIA 1XI2A 4G0OA 1J06A 5IW8A 4BEJA 3P0EA 3ZTTA 2WJPA 4P2GA 4PXYA 2GHTA 2PLWA 1ACLA 3QSGA 5IG2A 4K8RB 1GT6A 2IKSA 3FHOA 2JA1A 2PCJA 5DHTA 3F1KA 4OB6A 2BR4A 3SM3A 1SHUX 1DCMA 3ZK7A 2IDMA 1BFKA 4WADA 4I55A 1IC6A 4YRBA 1VDZA 3A1VA 5FFNA 2XB2A 5JJIA 3G7SA 4IDAA 1GPDG 2CVQA 4LI0A 4FYPA 3SLGA 3AR9A 4F2PA 2VHZA 1ZNYA 7ABPA 1NKVA 2OOSA 2VNHA 1GN9A 3TUJC 2ZSHA 1VXOA 4NTZA 4QBKA 2F3QA 3O91A 5AVZA 1ULAA 2OMKA 3O2SB 1F1BA 5F64A 2O6HA 3FGPA 4RJIA 5TT0A 4IY1A 4KIFA 4C0AC 4D9KA 5K3DA 5AVUA 5BORA 2IYLD 3K9QO 3T5TA 3WK5A 5FOXA 1CUIA 2QM3A 1E6KA 3E3OA 3IUPA 4FDVA 1B15A 1XTUA 3NTOA 3QY0A 1CUUA 3B6JA 4IJMA 4IOLA 4YR7A 2PXCA 1E2FA 2GD0A 2I0FA 4FQ5A 4IEIA 5EMMA 4IQFA 1GR0A 1LS1A 2QY6A 1FVHA 5JZVA 3FOEC 1LBQA 2AF3C 1TMGE 1PKEA 4I50B 1V5FA 1SQ5A 2B3TA 3IMCA 3EARA 1A71A 1Q0UA 2H2GA 2XUAA 3E8SA 4FMCF 4TS9A 1WKBA 4TUYA 3VVCA 4EDFA 1BQ3A 1PK8A 2HQ1A 4GI7A 3UGKA 2B1GA 5IABA 4ER0A 3ZCSA 2K7FA 2X8JB 1L4HA 5I48A 3MNFA 1XLTC 3LXMA 1D4OA 4W9NA 2VEDA 1M7BA 1WO8A 4QEDA 5BSUA 1RPTA 2JG3A 3JVVA 2H5EA 2JPDA 3H1FA 3OPQA 3H6KA 4P6VF 1MVNA 4R31A 3TOVA 1QYVA 2BHNA 3H7IA 3E7DA 3L92A 2MR6A 4FW8A 4OD0A 1E3LA 1EVKA 2P6UA 2WFLB 3H04A 5FNVF 2HNBA 1E2IA 3ANLA 4J1NA 4Q9DA 4HXFB 2QZ4A 3TNLA 2I1QA 1AGXA 3B3GA 3ELBA 3P97A 4J1QA 3GLIB 4W8OA 3AK4A 3K9NA 2QPOA 4K2HA 4QYTA 2V5UA 1OPRA 1XKTA 1ZMRA 2EDCA 4G3XA 1D5CA 5AI9A 3DBOB 1O1YA 1OTXA 4D6PA 4JELA 4BUCA 2ZUCA 3QUBA 3WLPA 4OK3A 3S5JA 2H92A 3U6KA 1RWXA 5E3JA 4KREA 1G3UA 4HXEB 5EGSA 2Q62A 2F7SA 1YZHA 2QIOA 3UHPA 3QYAA 4Z3OA 1IBRA 4NBUA 2FZ5A 4OJYA 3BREA 2ODTX 3GOQA 3QBEA 5D5QA 1SU4A 4JQYA 4UEJA 1YASA 4E5DA 4ZYZA 2KM1A 3DEFA 3EZ2A 3H0EA 3HJGA 3DGFC 1F06A 4E22A 3AWIA 2R96A 2D7CA 4N4AA 3T3GA 3TTYA 3LBFA 2ZBFA 2NXJA 1T8RA 3MUFA 3VR4A 1G8AA 1NMQA 1Q5PA 2PX8A 3ND9A 3ZHXA 4P4UA 1JLSA 4YAWA 1OF1A 4YAIA 3EEIA 4M1WA 4Y2YA 1IAVA 4XJVA 3FA2A 3O4GA 2PBRA 5DU2A 2PUBA 4YT8A 1PFWA 1B8UA 4ZOCA 5I9BA 4IICA 4W6QA 4X8MA 3VZQA 5AKLA 4C03A 1Z4PX 3IAM1 1QE3A 3FUCA 3NH9A 4XIFA 4DG9A 3W1EA 2ZIWB 4QVIA 1RRGA 4AX4A 2QKYA 3CEAA 4QG3A 4XUEA 2OHIA 3UXHA 2E4ZA 2OXEA 1V2GA 2WABA 3IUBA 3FIJA 3HE3A 3K53A 3CW9A 3KU4A 3QWFA 2XCQA 3T7KA 4CBVA 2GETA 4OP1A 3RUAA 3OZVA 2PSDA 4H1VA 4HTAA 2ZI3A 4QQ8A 3GT4A 3FY4A 4K46A 1K7EB 4E03A 4OXQA 2BPOA 2WM8A 3B3QA 1P0PA 2FPOA 4TXJA 3WBBA 2TMGA 4UM9D 1I9GA 1JJIA 2Q5JA 3A14A 4IKOA 4UTRA 3SXPA 1D0SA 3EG5A 1E2UA 4RYDA 3ADDA 2GUWA 4RQBA 1V8ZA 4HBZA 5AM1A 3WL8A 4CU5A 1HMPA 4D92A 1B6SA 4IV8A 2NX2A 2JCBA 1DC7A 3BPSA 3IAS1 4B85A 4D9IA 3PPIA 1LDNA 2VK2A 1TVKA 2IYFA 1TM2A 5FWXA 3RS7A 4DDMA 3B48A 3VNSA 1BTOA 3OIWA 4XWAA 4QBFA 2I6XA 3ZY4A 4HUQB 1BXRB 2O6LA 2WHPB 3F8SA 1GTL1 4RHXA 4G4SO 5ALUA 3IMEA 3JAWB 4ZO8A 4D97A 1ZN7A 2K2WA 4NAVA 1SC9A 3N7AA 3RSLA 4YR9A 4OQEA 4B0PA 4BX3A 4RMHA 5KJ6A 4H6VA 4LOAA 1M0TA 2DPHA 4HAYA 2J30A 1YNSA 2VI5A 3AFNA 2EBUA 1XSEA 4BFUA 1IU9A 1A0OA 4YO8A 4Q4JA 3EVNA 3GLFE 4ZGGA 4QOJA 4DIBA 1VL0A 4PYJA 4CIXA 2MU1A 1M6WA 2EGGA 2XR1A 1D7OA 3UANA 3UMMA 2R751 4DB4A 5CDTA 3RWMB 4EW2A 1H0HA 4AWAA 1S2OA 3CONA 4NLLA 3TH5A 1PZFA 3T5PA 2SCUB 3DZBA 3EGOA 5LBTA 3DE6X 2Q3HA 3OLWA 2CJPA 3F98A 4FEGA 4D4HA 1R5JA 4XDHA 1Y34E 3LY5A 2ZZNA 1NJFA 5DNDA 2WNSA 1DRJA 2JS7A 4YCSA 3PNBA 1USGA 5KOYA 4CNQA 4W7SA 1G5RA 3C87A 2B8WA 5I5EA 3G7UA 4E14A 3IFSA 4BE9A 2E4WA 3CV3A 1ZI9A 5DGHA 2IH4A 4LF5B 4MDFA 3G0GA 1FP1D 4OBBA 3L7LA 4MI6A 4QICA 1R6XA 3NDRA 3QVLA 5EYPB 3VYWA 1E3IA 1W19A 2AN5A 2FSSA 2MMGA 2PUJA 3OFVA 5FOWA 1C0EA 4XARA 4CM6A 1W9HA 3R3ZA 1AKVA 1A7JA 3OEEA 1XL1A 3I76A 4B9EA 5J5CA 1I3KA 4BAZA 3PQ8A 2ZRNA 3O4IA 2BEKA 1GEEA 1U0SY 4QL3A 4UFNA 4UUBA 1KYTA 2ASEA 1EJBA 5CFLA 2WWTA 2GN9A 1P5JA 4J0QA 2OP1A 1MJ5A 2OGUA 2QK4A 2XGGA 1UEIA 3FNGA 4C7JA 1HORA 1OFTA 1QR2A 5BP7A 2FW1A 4HDCA 4QKQA 1H1LA 4MQ6A 3I42A 2NO9A 3AWDA 4YV1A 4AKGA 4WK0B 3CURA 4D6YA 2DUMA 2Y71A 4NV0A 3UGJA 5ISMA 5TQJA 4FLFA 2YUIA 4M0MA 4OI0A 4W8HA 2O14A 3Q7PA 1OLXA 1NRJB 1GT91 2GAOA 3L7DA 4JJ6A 4WQMA 5FQOA 5DH9A 2PNFA 5DX0A 5SY6A 3RUHA 1TYEB 1RAAA 1QS0A 4IHJF 3S29A 2ZTMA 1JFFA 1E1RA 1CP3A 1Z2NX 3AESB 4NZYA 3SEFA 4ZGWA 5ERYA 3P9YA 4MRNA 1Q1GA 3SYMA 4AW9A 3ESXA 4KI7A 3SDBA 2CVOA 4LOKA 2HJ9A 1U9YA 2AJDA 1JW9B 2OENG 4RSHA 4JASB 2CXOA 4Y98A 1UXKA 2ZDGA 4RVGA 1PZHA 2ZDQA 3HVIA 3KPWA 2P8JA 2Z43A 1FXUA 1VFPA 2ZYDA 1TECE 3ZBUA 4YMIA 1CUHA 5KDDA 2D2EA 2DPGA 5B2FA 3OH8A 3K5PA 2CDAA 4UHHA 4YRPA 4Y2VA 1QDUA 5HF8A 1HNXB 1CF2O 3R6WA 1V3VA 3LH5A 1JPJA 1M66A 1G2OA 3P71T 3W9YA 2CNOA 3M9WA 4LTMA 3VKGA 1D6NA 1YB5A 3T3IA 1Z2PX 4TTSA 5BRNA 1Z6QA 2OFPA 5KOIA 3JQEA 4LSWA 1IQPA 4IDBA 3PK0A 4LKRA 3UT6A 1E3TA 1TKCA 2IS6A 2B99A 3G6KA 4X24A 4YWHA 5B7NA 3SLKA 5LU9A 2ECKA 4TKVB 4Y7CA 4O4IF 4UXIA 4XA8A 4BBZA 3KUUA 1KC3A 2OP0A 4PO8A 3F9CA 3WP0A 3WSVA 3ZJYA 1WAMA 2CEAA 4PPGA 2WHEA 4HDQB 2OECA 3F5MA 3ETGA 1THMA 1A72A 1ZP6A 2HJHA 3L4JA 3KSDO 4JI6B 1SBNE 4XSGA 1A04A 1EWQA 4X3OA 2RHBA 1HYHA 4R40A 4IQGA 4PO3X 2J3KA 1Q0TA 1B14A 4CFSA 2IHZA 5C1DA 2OB2A 2Y1GA 4JYMA 5L3VA 4IIJA 1E7WA 1GUDA 3I04M 4CCAA 1EUCA 3OE4A 4I50A 1DAIA 4N76A 4GXNA 1FPQA 4ARSA 2O1EA 5AI0A 3KPJA 3G2IA 3F4BA 5KWSA 1E1MA 3DYIA 3F5SA 5DDIP 2XXAB 1WVIA 2GWRA 3I04A 1XDDA 1SD2A 2VYFA 3IVGA 4GIBA 4X84A 3OWOA 5LIPA 1JI3A 3AF2A 3JD4A 4G9EA 4UVGA 2WD7A 1ZNXA 3IKMB 4P81A 2XCTB 1SOVA 4XLLA 4YUAA 1Y4UA 2UUOA 4FONA 3OTIA 1ZD3A 1Y6RA 5I01A 1C2YA 2VDRB 1QP8A 1L5KA 1T24A 1YI0A 4KLNA 2ZW9A 4K0KB 3K94A 2GXUA 2FUKA 3CISA 3L8CA 3V8PA 3HI6A 2YZ7A 2ZSFA 3TZLA 5J4VA 1DGQA 3PCRB 1NV8A 5IM4A 2WF8A 4EO7A 1LC3A 5F4ZA 4C4XA 3SJZA 2HMWA 3HZHA 1E2DA 1BU5A 5G0VA 1NQAO 1X1AA 1EFRD 3N2NA 3N76A 5E4JA 1HEIA 4WUVA 1T5LA 4JD5A 3CNOA 4E2YA 3MVEA 5FL7A 2UVPB 3CC8A 2RGNA 2RHWA 3T5DA 4RETA 4XWTA 3SEQA 2FSGA 4HMQA 3RC2A 3U09A 3LXUX 4DA4A 3BFVA 3LUAA 4PZDA 3F3KA 3ASZA 2R8BA 1CRZA 4INAA 2CXRA 3QE4A 2NTVA 1SHTX 3MINA 4GR4A 2EZ9A 4CKEA 5LP6C 1EXDA 4ME6A 5FH9A 2B9VA 4XAQA 5K3FA 1KVUA 1XTTA 3ZJVA 5FPPA 3V4OA 3AT1A 4F4FA 3FPFA 5LZ8A 4FS3A 4RKRA 1T2CA 2PMDA 3FVVA 1M83A 1X7YB 5JUWA 4O33A 3Q12A 3RC3A 3B36A 2FQ1A 4ID9A 1BDJA 2C2OA 4FFLA 2EWVA 4M1TA 4E7PA 4Z6KA 2WFZA 2F8LA 3QX8A 3WGTA 3AQIA 4DIMA 1UBJS 1ESZA 3GCXA 3E9NA 3RSSA 1VI2A 3T7JA 1YRAA 5C32A 2I03A 2BSAA 1KJIA 1P29A 1SM4A 4Z9BA 2W2LA 3O2QB 5EEGA 3UAYA 1ISJA 1K9SA 1LTKA 2WHPA 2ZYVX 1R6VA 3KEMA 5C7YA 1SEVA 3FGZA 5IASA 4ZVTA 2PS0A 4YYZA 5H1YA 1E1QA 4YCJA 2Z3WA 2ZI6A 2ZPUA 3LXXA 2BFPA 2AB0A 2WZBA 2QNRA 1J00A 4IF4A 2GEKA 1NX9A 5COBA 2J0VA 2IIPA 1O87A 4OMFG 2XUIA 1T5OA 2AJCA 3PB3A 4NARA 4KXXA 3RJZA 4U7JA 1VE9A 4J7AA 4PAOA 5C5IA 2BMWA 4ZQFA 1EGMB 2X9LA 2LZ0A 4P32A 3G68A 3TLBA 5AJVB 1SAYA 1B4DA 3RRYA 3S27A 1YUMA 1P2GA 1N2CA 4GZMA 1FFAA 1GG8A 1OXBB 1WY7A 3L93A 4FILA 4LJKA 4W99A 3UMRA 3PR2B 5FPKA 4MWCA 4X1YA 5CVDA 1XP5A 3DPIA 2D06A 3E5NA 3CEPB 4B7ZA 1G66A 3N0TA 1VE5A 5GIPE 4FNAA 2P4UA 7MDHA 1L3CA 5J5VA 2AK2A 4FE7A 1MC5A 1ORHA 2EF0A 3RG2A 3IS3A 1M1XB 3MMNA 1ZH8A 4LRYA 3WI7A 2V58A 3K6JA 2VAMA 2CHUA 3VBEA 4PZLA 4MV4A 1OH7A 3ESDA 4KBYA 4N5HX 4BASA 5KHAA 4CKWB 2NO7A 4JI0B 1OVMA 2UVQA 4GQAA 4MCJA 3VR5H 2B0JA 2O48X 3EXG1 2CXHA 2QRLA 4K8OA 4N3CA 3T4UA 3ZIAD 4A2WA 4WTOA 2QSJA 2HUPA 4G0UA 5CYFA 1N36B 4OIMA 1LDBA 4IXTA 2GDJA 1L7VC 1XCOA 4JOSA 2A14A 4KZKA 1O94C 2PYZA 2HRQA 4FZRA 1YOVA 4EGJA 1M6VA 1OREA 3C4VA 3T3NA 4WN3A 1K98A 3JXEA 3GT7A 4NL4H 3C45A 4E0BA 1SN7A 1JQ5A 4K9PA 3LBYA 3ZU3A 4XTRA 4MTCA 2CUTA 1X7HA 3UK6A 4L02A 1ISHA 3CNNA 2GA8A 3DTTA 3H2HA 1AKNA 2G9RA 4QDXA 3MJDA 4R84A 3T38A 4EG7A 3NB0A 1ZM9A 1B74A 4DM7A 4DR6B 4A0FA 3FHLA 2OPHA 3PG5A 3V8QA 4FTWA 1O54A 3UAZA 4L75A 1W85B 2JKZA 3FWHA 2OV3A 2WWRA 1ADCA 3AEXA 3LFUA 3O82A 5FFFA 1EFPB 1UPXA 1RWOA 4YDQA 1VHLA 1L8AA 2E5LB 4HEA1 4PYMA 3NWBA 4L1KA 3WLNA 1A9TA 1DKOA 4K9NA 1Z6AA 4L85A 4FZ3A 2BKEA 1DOHA 4KH0A 1TDJA 2WSIA 3H0CA 3B6IA 4ON9A 4RCZA 2Q5IA 1MO3A 2Q1WA 2B25A 1WTCA 1NHGA 1QIJA 1W85A 2OT3B 3GZNB 3FNFA 5G1NA 3ZR4B 1MN6A 4M6WA 2QRNA 1WVGA 5J5AA 3UCFA 2ZATA 2C3PA 3I3OA 1Q77A 1GPJA 3D54D 4MR8B 2VIIA 3IPAA 4ZTZB 2JCYA 4Q3AA 5EE5B 4MI3A 4GR5A 4QJIA 1DQYA 5TF4A 3AHJA 1CQIA 1ZUD1 1TAQA 3C2QA 3R23A 4QUJA 1NRIA 3R7DA 4DL9A 4PWZA 2FEOA 4Y2RA 1FFSA 3EEYA 1KAGA 3LDAA 4OKSA 5DSXA 1M1YB 1X80B 2QN2A 1FDVA 1CIPA 2BBOA 2Q3JA 2VPZA 4E5PA 5KKCA 2MR5A 3VH4A 1HT2E 2JJ1A 4TL8A 1C4XA 4ER5A 4N9WA 3O7MA 2QJRA 4MWDA 1JN0A 3GEMA 4MW6A 5DBIA 3D8BA 3LYAA 2JHGA 4D42A 1X8LA 2VH2A 1RKQA 2ZVJA 3INRA 4LXIA 4LQCA 4P2BA 3ZDYB 5DM60 5EJ4A 3KYBA 1TT7A 1XYGA 4GMGA 1UT5A 1FX0B 3R5SA 1FJGB 2ZJAA 3QEOA 3VJLA 3V4LA 1CZNA 4DAOA 1TYBE 3U0BA 3M2TA 1GVNB 3JQ6A 1IEVA 2EJCA 1ORIA 1MNAA 3SCZA 4D4IA 1ZQ1A 3BTOA 4IMRA 2D54A 3ELYA 4OB8A 4E2ZA 1DT3A 3FG9A 2IIQA 3OFJA 1GFSA 1Z5OA 4UARA 5BSWA 2PRSA 2G1KA 3HXKA 4QHSA 1QIEA 1WCV1 3OKCA 4B5LA 1JA9A 2Z30A 2QVGA 1PVVA 2IX9A 3A6EA 1VJTA 4RDXA 2WR8A 3VR3D 5DW0A 3EVTA 3EXIA 4BEVA 2GCEA 1G3MA 3UUFA 3FLBA 5BRAA 1JKJA 4BQSA 4PZYA 3H18A 3N8GA 1DPFA 3ZN2A 4B7XA 1SIUA 4FDTA 4RSGA 3GN2A 3TX2A 4JI8B 3EXIB 1MPTA 4GKVA 1KL7A 3TOCA 4ARUA 2WAYA 1CR4A 1JMYA 3UF0A 3I6BA 1LUAA 3ZLVA 4XGNA 4HPWA 1G8FA 1LDEA 5L4SA 4TM7A 2BMEA 4DUZB 4DBLC 1PTJC 1TT5B 2BCJQ 2ALJA 3R7WA 3DOCA 2Q5OA 3EGDA 2XITA 4KVGA 1EA5A 3U1VA 4YALA 3OTOB 1UFVA 2QQ0A 2VT3A 3EIUA 5A0FA 4TVOA 1JBEA 4RL6A 1EGVB 5HK9A 2PO7A 2F8SA 3NW9A 5ERGB 2HU2A 3H83A 3LF2A 3CW8X 1IM5A 4Q3CA 3P7MA 2VSXA 1Y4ZA 1XRQA 1TUBB 1C9EA 4TKMA 3GMSA 4B3FX 4M6WB 4NDZA 3GRVA 1QIKA 1AT1A 2PLAA 4J7UA 2FSUA 5HKLA 1PAUA 4ZRNA 1F4PA 2A9QA 2DQKA 1X7YA 5KO2A 3AJAA 3T5CA 2X2PA 3BQNB 3IKJA 3GP3A 1BVYF 3AOEA 1K3UB 5EIBD 2M6KA 4Z4EA 1RKXA 4LCEA 1Q12A 4TTQA 3TFQA 4ATNA 4F97A 4TLLB 3H1PA 1CYEA 3DDNA 1BN6A 2HK8A 4Q48A 1NNSA 2EKPA 1RRMA 1UL1X 2PIDA 4OYHA 1C1DA 2CT8A 5KCZA 1KAQA 3EVZA 3AW8A 3IQGX 4U39A 5BUCA 4DCOA 1NFFA 5BQOA 2DU8A 1G17A 3QFTA 4AROA 2UZ4A 2QUIA 3QVOA 3U4DA 3OLXA 2BI7A 5IC5A 5WRFA 3ZNQA 1EX1A 1JSCA 1VIAA 3SIRA 1XNGA 1GQYA 2A6PA 3NX4A 3VHRA 3I6QA 4NATA 4DWWA 3B89A 2HHHB 3JARB 1AA6A 3HYNA 3O38A 3QOXA 1FLVA 4PZ0A 2BKUA 3D02A 4MGIR 3AB8A 4YRTA 1T5HX 2X42A 2XE7A 5JZSA 3BGWA 1OILA 1T15A 1Y8AA 1ZR4A 4PN3A 1AGNA 1ZRNA 2GD1O 3MWDA 5EE9A 3KQQA 1E5LA 4LOHA 4LQDA 1A8SA 3D0RA 1H23A 3QNMA 5AHRA 2QRVA 1AO0A 4HGPA 3KUDA 1JI0A 4KDCA 4PICA 1AS3A 3FMOB 1ZM2A 3JQFA 3JWJA 4J1SA 4YDRA 3U13A 3LY9A 3TBFA 5JSZB 4QJ4A 3JRXA 1RBYA 5KDOA 1QFZA 3JWPA 3AUKA 4BB6A 3HXOA 2ZRFA 1P4HA 1HL3A 2E1RA 1HA3A 2EP5A 3H86A 2QTMA 2C83A 2Q6KA 5AKXA 3HA7A 4RPLA 3IHKA 4W5WA 1F8YA 4XFDA 2YW2A 1UAAA 5DP2A 1NV9A 5LWHA 4IFTA 1VCHA 5F1KA 5CB4F 4JOQA 2G6BA 3STXA 3KPYA 1GKLA 3MRTA 3R40A 4FFBA 3COJA 1L5YA 2BH2A 2ZAYA 1AXEA 2LD4A 4RIEA 4BV3A 4CKWA 3KB1A 4OLBA 3KJZA 4HZUB 3EJWA 1T8WA 2PQ2A 3BTUA 3LVBA 5CVEA 5BYJA 3RS4A 3HFRA 4CKBA 2HXGA 4F9FA 1B23P 2DULA 1ZMOA 2FMFA 3PEUA 4MYSA 1Z63A 4MRVA 2YZNA 3Q11A 5CD1A 4JI3B 1V8BA 4IXMA 5IM5A 1UJ4A 5A02A 2H1OA 2VHTA 1T6NA 4YAJA 3LO5A 3INYA 4HDOB 4K9KA 3RHFA 3U37A 3S70A 5B4VA 4MHTA 4LKOA 1JVBA 1Z5GA 2OV2A 1T26A 3I34X 4F8JA 1C7QA 1R6DA 2QHXA 3E8XA 3HH8A 2H8KA 1RWQA 3DL4A 1A9QA 1PJBA 3R3YA 2QL9A 4ERXA 2Z2ZA 1QMPA 2WP0A 3C7KA 4KP7A 2RHHA 1YQDA 4CMKA 4Z4CA 3WA6A 2VVTA 5ETJA 3UJNA 4EKIA 3KQPA 4MKIA 1SU7A 2ZBDA 1ATIA 2EZUA 1I0ZA 3WLRA 2H51A 4QDKA 2G1PA 1W52X 3CG4A 4F71A 5JD5A 2C5FA 2NTYC 1GGKA 1KOFA 1GP2A 1IPFA 3ANMA 2H9IA 3B82A 4PXAA 2R00A 4GG1A 3N8NA 2F1HA 4I1PA 1TJNA 1CZKA 1REQA 2AFIE 2WJ3A 2ADOA 2IHVA 1YDWA 1G8SA 3NT2A 3E7XA 1NYTA 1HT1E 3MJRA 5B2ZA 4B6OA 4D5EA 3GGGA 3DJYA 2RKBA 3KL2A 4AZVA 2OXRA 3X43A 3NKVA 1OTHA 3CXUA 1NRXA 5DW3A 5HZHA 1E7SA 4K5QA 3GRKA 3MMXA 1AMUA 5F1OA 2X9QA 3FIUA 1CUSA 1QH8B 1UXGA 3C1UA 3O2NA 2QENA 4FFDA 3RSGA 2GZRA 5KTKA 1RQRA 1FMJA 1GGMA 3I6IA 1C3OB 1TGVA 4DLZA 4QNNA 4YASA 4MOWA 2B83A 2IT1A 5ENDA 4FQ8A 3O5AA 1PFVA 2GK3A 1WPQA 1QO0A 2IQIA 2XRFA 2W2XA 3CX7A 4ZOLF 1M8GA 4D0RA 3ASUA 4KUGA 5H3LA 5K8IA 1SOWA 4DDVA 2W98A 2VCEA 3D1VA 3LLMA 4N8SA 3FPKA 3B70A 2P67A 1CR2A 2FPIA 1CNFA 3ZWVA 4C14A 1VG1A 4PC6A 1G63A 2BGIA 2VPWA 1PG0A 2XDQB 3IIJA 3OLQA 4PLGA 2NU9A 2WV7A 5DCYA 3GD5A 2FGKA 4DXAA 1QFJA 4LAFA 4MJXA 1AK9A 2JFNA 4CM9D 4A73A 4L5JA 3R2JA 1IUNA 2ET6A 4K9OA 1E0SA 3SGLA 4ENSA 5IF9A 4RJKA 2N3ZA 1D9XA 2P78A 3W5DA 4I4TA 3IXQA 3N2ZB 3X1JA 1EVIA 2ZE6A 1JR3E 2EG5A 1YK0A 4V0QA 2R6GA 3THSA 1OU0A 1BVRA 4MJ7A 4ECAA 5AW6A 3E4CA 3TSYA 3EIWA 3TAUA 3VISA 5M04A 4KPEC 4OHBA 1HYEA 1P91A 1E18A 3UW3A 3IPCA 3FETA 1JLLA 2BFBA 3E7WA 4M53A 3GDGA 4OSPA 3VC2A 3U60B 2UYQA 1DPGA 2YQ5A 3KAPA 3PDWA 5EJAA 1NQTA 2ZU6A 5E6RA 4HC4A 1C1HA 2VPQA 3K5IA 4ESVA 1T91A 3CX8A 3OO0A 1M8KA 3EMBA 4DC0A 3D7RA 3K0BA 4BLSA 5AVQA 2Z83A 1NF2A 1WMBA 1F2TA 2ZJ5A 1KY5A 4KNYA 3CJRA 2ES4A 3H6GA 3JD0A 1E92A 2D00A 5JNWA 1GEGA 1TADA 3F49S 4D3SA 3AFMA 1PHRA 4LZOA 4CMAA 1CJMA 3A9SA 3HBAA 5DI9A 3GRYA 1QOZA 3WKAA 4ECEA 3Q8MA 1XLTA 4QIHA 1HK7A 3L0OA 2N1BA 4RF3A 1MCZA 4RPHA 2OV1A 3A6DA 4DPKA 3PNSA 2DWQA 2P5UA 3ZVRA 5MFZA 3LQRA 5HFAA 4PIPA 1F6DA 1Z47A 4J0HA 1QNLA 3ZDFA 5ABPA 4IP0A 4RGBA 3TSAA 2ZXFA 3WIDA 2WSMA 4RWEA 2JC3A 3CNQS 1YHNA 4KXUA 3HYSA 4MQ5A 2EKLA 3RJ5A 1QGZA 3C98A 1RYMA 3Q7IA 2D74A 2JB9A 2OAQ1 4OVKA 3TOZA 5HDBB 5H4GA 1I7PA 1MGPA 2BGNA 3SHVA 5EGNA 1EDEA 2QD1A 3O4HA 3UH0A 5ALNA 2W4IA 4MS3B 2PMWB 3NO4A 1ZJ4A 4C0LA 2PWAA 1H1DA 2AI2A 2XYQA 1SRQA 5DHQA 4RD6A 4ZT3A 5COAA 2AOWA 3HQ4O 1KFCB 1OIXA 3DMGA 2Q27A 1TD9A 1C1YA 1E5DA 1G7CA 3CH4B 3HSSA 3IDZA 1Z56C 4FOPA 3ZGYA 2RHMA 4LJYA 3LP8A 3CW2A 1OBHA 2RGEA 3SYTA 4PG6A 4CIVA 2Q29A 1NW5A 4KLAA 2EKDA 3FCSB 2I29A 4O6VA 1GUAA 2Q99A 3MTBA 3FVQA 2CL0X 3KNZA 5IH7A 2FPKA 3UBMA 1EUDA 4NZ9A 3EEOA 3ZCVA 4B4VA 1XIVA 2HGSA 1NY6A 4KXYA 1V11A 4OLAA 2YCLA 1XYVA 4C05A 4RPIA 2VP3A 3KYCA 3LHKA 4JDPA 2OQIA 4HQFA 1G18A 1CCWA 2OKGA 3DMDA 5TR9A 1B41A 2JFQA 2AZTA 2OB1A 4DHWA 2FRXA 3A2MA 4Q15A 3TW6A 3MGBA 5C80A 5EHZA 3SVLA 3AM1A 4BX2A 2M32A 4A5SA 1IB0A 1RM4A 2RKOA 2ZE5A 3G8BA 4WKGA 2QLTA 5F78A 1D2CA 3FHCB 2R6ZA 2BF4A 3KT8A 1SBYA 2ZI5A 4UNPA 5ALQA 1YJBA 5LNK6 1PL6A 1Y5MA 1NTOA 3CGWA 3R7BA 1E79A 4F6CA 5DNAA 1S01A 2CY0A 2YIVX 3HDTA 4K03A 1IZYA 2ZROA 1LSJA 2NSJA 4RKWA 1CDEA 3JZDA 2D0PB 1I13A 3LLSA 1WXDA 3IKVA 2F3PA 3EHDA 4HOYA 4JIGA 3KTDA 5DWDA 2I6TA 3MUNA 3TI7A 5AW2A 4YXFA 2PR2A 2VAXA 1R8SA 3AKDA 4X6UA 5IUNC 3U9TA 1P3JA 1PLKA 2I6GA 3PP8A 3QH4A 2YRWA 2IYOA 1A88A 1X6VA 3VAAA 1JJAA 4R8MA 4C1NA 3L04A 4CEIA 2QE7A 4HH0A 4HJXA 4GL2A 1ZLYA 3ZW7A 4LE2A 4DPMA 1YKGA 3WWDA 4MRPA 2P6RA 2GBPA 4DSZA 4KFSA 3OEYA 4D9HA 1WABA 3NV7A 3PNQA 3T3DA 2D1TA 2VWPA 3CRZA 4M99A 2C9ZA 3F74A 2ACKA 3LHFA 3SSNA 3KKMA 2JKVA 4QUDA 1N57A 3EIFA 3FHJA 5HMMA 1P8AA 1YULA 1ZS9A 4LYDA 2UZ0A 4XJTA 2I1LA 2XX3A 2RFLA 3AZPA 2IYWA 3L0CA 1BEZA 3DZ8A 1UMKA 3H1EA 1W36C 3B2EA 1NZDA 1T3GA 2RBKA 1NN1A 4MUNA 1RWMA 3D6AA 5B58C 1YR1A 4KW7A 1BDMA 3LZ6A 4Q5IA 2X8WA 2GEFA 4LBWA 4LK3A 7REQB 1AU9A 3KJIA 3PUYA 4WOKA 5FUXA 2W6ZA 4JB0A 5J63A 5A4KA 3NM4A 1Y8RB 2FSVC 1RM5A 3MOIA 3AEKB 4JFRA 5DNWA 4ZYWA 3K4QA 4ZI2A 1RYYA 2WVJA 3PRHA 5BNIA 2WNIA 5JSFA 2AMVA 2EDAA 3QYFA 1H4TA 1CFZA 1W1UA 2W8BA 1QRDA 2Z98A 1GYQA 3MXOA 1MX9A 4TS3A 1AZWA 1RAGA 2VZEA 5GWXA 2YNMD 3WGNA 5JNRA 1NVVQ 2BFDB 1XFAA 4U2FA 3GJ8A 1M6NA 3A32A 1EM8B 4AMVA 1ADFA 2FKNA 2VPIA 3C3XA 3PFNA 4NFHA 4YLGA 1GLVA 3TINA 3WL5A 3TZKA 4F3RA 1E2MA 3NR2A 5EUCA 3PPWA 3QE2A 3RUPA 3EZYA 1N6OA 4RPJA 1U2DC 5CLHA 3UGQA 1C3EA 2Q46A 4RDCA 3T1QA 1G7RA 4MYCA 2N1MA 2HOQA 4ZIRB 2RH9B 3R0XA 1L7MA 3BGIA 3HZOA 1I7NA 1KNXA 1KVRA 2FR8A 3MBKA 4TX1A 4AK9A 2MWMA 2DG2A 4H6PA 3L40A 4IJ6A 4EUSA 1COWD 5IJWA 4GLJA 3LGXA 1DWUA 3OHPA 4HAUA 3ICEA 2PT7A 3W6NA 3ZQKA 3QHAA 3Q3VA 3LUKA 3N39C 1JQEA 3MJTA 3ECAA 3JR7A 3PDIA 5C1IA 3OEHA 2YMLA 2YXPX 5K0EA 2YWHA 4AY3A 2JFOA 1BA3A 2P6OA 5NULA 8GPBA 1N0WA 1OMOA 3ZX4A 4PWYA 1JNXX 2J85A 1Y1TA 4GEKA 4EX7A 2FPSA 1E2JA 2VP6A 3BK1A 3HK2A 1KARA 5BWNA 3PICA 1W36D 1IUPA 3FR7A 4Q6BA 4C4TA 1C3JA 2POCA 3H2GA 4LC9A 4CMJA 4V1CA 2ZCVA 1TAUA 1MC4A 2FFJA 4ND6A 1PT6A 2JRLA 1C7IA 1MFZA 3M7IA 5GOZA 3UN1A 3WYEA 3WBKA 3LZDA 5AJZA 1ZGZA 1BOOA 2H5LA 2YVAA 1XZ8A 1HC7A 1F9EA 3ZX5A 5FWYA 1BU8A 4GDMA 1FVFA 3W3AD 4HWTA 3D3KA 3F90A 4MMZB 3ZWAA 1E0AA 5IPFA 3GLQA 3WFJA 1R18A 4NI5A 2FPPB 4E3ZA 1RJ9A 2ZUTA 1RZ3A 1ZONA 2PZLA 3M33A 3V48A 5CXUA 5EWMB 3TE7A 1XCLA 2CC2A 3BSWA 4GL4A 1MG0A 3F46A 5KNBA 4B45A 1KMHA 4K7JA 3NIFB 4PS1A 4X93A 2OR3A