1RY0A

Structure of prostaglandin f synthase with prostaglandin d2
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
319
structure length
319
Chain Sequence
b'QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of human prostaglandin F synthase (AKR1C3).
pubmed doi rcsb
total genus 118
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ry0A00
1M9HA 1J96A 2FVLA 1XGDA 2CLPA 2C91A 1HQTA 3R58A 1JEZA 2PDMA 3R43A 2I17A 1AFSA 3NTYA 4ASTA 3EB4A 3C3UA 4LBRA 4YVXA 2PDKA 2BGSA 2IQ0A 1RALA 2PDGA 3R7MA 2PDJA 3LEPA 5KETA 1Q5MA 2WZTA 2PDHA 3S3GA 3UZYA 4GIEA 1T40A 4LB3A 4XO6A 2DV0A 1AH0A 3LUTA 4H8NA 2J8TA 5LIKX 3UGRA 4YVVA 4JQ2A 2IPJA 4XZLX 1VBJA 1QRQA 3UWEA 3V0SA 1EL3A 1X97A 1AH4A 3LNMA 3UZWA 4WDTA 2ISFA 4YS1A 4GA8A 5LIUX 4FA3A 4GQGA 3N6QA 1K8CA 2IKIA 2PZNA 3M0IA 2QXWA 4LAUA 5DANA 3FX4A 2R9RA 3V0UA 2HVNA 3LENA 3R94A 2IS7A 4Q3MA 3H7RA 5M2FX 4FAMA 4PR4A 5LIXX 4Q7BA 1XJBA 2AGTA 4JTDA 4QBXA 4H7CA 2IQDA 2PDBA 5HA7A 2IPGA 2BP1A 1AH3A 1RY8A 4IGSA 5JH1A 1S2CA 4IJRA 4ZFCA 3Q67A 1Q13A 1QWKA 4JQ3A 3DOPA 1FRBA 4PUUA 1AZ2A 1ZSXA 4WEVX 3FJNA 3UZXA 3UYIA 4GACA 3H7UA 3LQLA 1PZ1A 2HE5A 3BCJA 4GABA 5LIWX 4XZHA 1T41A 3R8GA 3DN5A 3Q65A 3R6IA 4G5DA 3WBYA 3UFYA 1X96A 4QXIA 1PWMA 2NVCA 4JTRA 4YU1A 3LZ3A 3GHTA 4HBKA 4HMNA 2HVOA 1Z9AA 4YVPA 1US0A 2ACUA 3V36A 5LIYX 4IJCA 4JTAA 2PDXA 2F38A 4WDUA 1MZRA 3O3RA 4NKCA 3GHRA 3CAVA 4PUWA 2PDYA 2VDGA 4PRRA 3ONCA 5AZ0A 2PDCA 2IKHA 3CV6A 2ACRA 1Z3NA 4JIIX 1ZUAX 4FZIA 1PWLA 4XZNX 2PEVA 5C7HA 4JQ1A 3B3DA 3LZ5A 4QX4A 2ALRA 2INEA 2FZBA 1XF0A 3VXGA 1RY0A 1PYFA 2PF8A 1YE6A 2WZMA 1AZ1A 4EXAA 1SM9A 3G1RA 2FGBA 2PDWA 2ACSA 3UP8A 1MRQA 4JIRA 4JQ4A 1C9WA 4GQ0A 1S1PA 1IHIA 3WG6A 5JH2A 4DBWA 3H4GA 4PRTA 3CAQA 4LBSA 1LQAA 3BUVA 2BGQA 1MI3A 3ERPA 3U2CA 3V35A 3MC5A 1S1RA 3LBOA 3LD5A 2P5NA 1EKOA 4DZ5A 1EF3A 4L1XA 2HE8A 2HV5A 3R8HA 1YNQA 4XK2A 4EXBA 3QKZA 2HDJA 4R9OA 4WGHA 3M64A 4JQAA 4QR6A 1HW6A 2PDQA 1ZGDA 3M4HA 3EAUA 1PZ0A 3P2VA 2PDNA 3GHUA 2HEJA 4JTQA 1X98A 2I16A 4I5XA 3ONBA 2IPWA 4DBUA 4XAPA 4LAZA 3WBXA 1UR3M 4WDWA 3BV7A 3O0KA 3WBWA 4XO7A 3RX2A 1ZQ5A 3KRBA 3LQGA 2PD5A 2PD9A 5AZ1A 1Z89A 2IPFA 3F7JA 4F40A 1ADSA 1YNPA 2IKJA 1EXBA 3T42A 3RX4A 2ACQA 1R38A 4DBSA 3COTA 3CMFA 3WCZA 3D3FA 4WDXA 2PDPA 4XVEA 1S2AA 5HNTA 2A79A 2DUXA 3EB3A 4ICCX 2F2KA 3G5EA 4PMJA 3UG8A 1GVEA 3N2TA 3GHSA 2PDLA 2PDFA 4RPQA 3LN3A 4AUBA 1VP5A 1Z8AA 2DUZA 5HNUA 3MB9A 4XZMX 2FZDA 2NVDA 2R24A 4JIHA 1LWIA 3BURA 2PDUA 4MHBA 2INZA 3CASA 4WRHA 4FALA 4L1WA 1IEIA 4GCAA 4OTKA 3UZZA 2PFHA 2FZ9A 1OG6A 4LB4A 3CV7A 1YE4A 2FZ8A 4XZIA 2PDIA 4JTCA 3GUGA 4XVDA 1A80A 2IKGA 3V0TA 3RX3A
chains in the Genus database with same CATH superfamily
4O1FA 4W8BA 3DFTA 3GKFA 2GVJA 1TPWA 1DWGM 4X63A 1JCYA 5BOFA 3DFYA 2D0FA 4ASTA 3NQEA 3VZYA 1PAMA 4O15A 4YVXA 1HL8A 3W7IA 1F3EA 3OQ8A 4HHHA 4GX9A 5KETA 2OQYA 3L5MA 4JR5A 4BA0A 5BOOA 4MUPA 1M1BA 1J5SA 1OINA 1R7AA 1VKFA 1XG4A 5LIKX 3U7VA 3VIHA 4JQ2A 4KRTA 1UD2A 4QCFA 5I77A 2PLKA 5G1MA 2V30A 1Q7ZA 2XIQA 1RH9A 2NSOA 4P7RA 4JZ5A 3G1YA 1ZFJA 3TSMA 1XV8A 5HQMA 3B8TA 1QU4A 1I2NA 4WLCA 4QP0A 1QW9A 4LAUA 4JFUA 3OOQA 2OZ8A 1W56A 1A5KC 3WQEA 3VA8A 2FGZA 4JY9A 1ONEA 4IPNB 5I3IA 1DJGA 4P7LA 4YTQA 1H0IA 3CZEA 4XBKA 2E8ZA 5FEWA 2ZXDA 1XYLA 3LY0A 3SO7A 1V8EA 1UH4A 5D30A 1XL9A 2XVGA 3LMYA 1F74A 2IPGA 3RO8A 1GCYA 2BP1A 4JX5A 5G4EA 1FH8A 2GJLA 5D33A 1KGUA 3L12A 4O1DA 3S1XA 2WPBA 3SQSA 4MYAA 3MUIA 2WZIA 4ROQA 3LHYA 4JTSA 2DY3A 2CLKA 1TB3A 1XS2A 4I6KA 2DU2A 4HYVA 1OG0A 2VVSA 1OYCA 3O6CA 1LUCA 3BCJA 4RE3A 3VIGA 3RRAA 1JYXA 3DFQA 1R85A 4S2CA 4HPJA 1SZEA 3DUGA 4GE8A 3W26A 4IQEA 4V15A 4DY1A 1NFBA 2BB0A 1POKA 1PWMA 4L4MA 4EVZA 1ICQA 5K2ZA 4LUIA 3MSYA 2NT1A 1OX6A 1G69A 4PMZA 1E72M 3UWWA 3ZJKA 1FKXA 1IXNA 3PWAA 3LM7A 2D1ZA 2JK2A 3UA3A 3CHVA 1QK0A 4GX8A 2QUMA 3AIQA 4ATDA 1KM0A 3LV5A 1B5TA 4DJFA 2XSAA 1LLOA 4PUWA 5HULA 2WNZA 4AD4A 2BVDA 2XIBA 4M56A 5DXXA 3BL3A 4RXFA 2PMQA 3OZOA 2X30A 1GQLA 3N17A 3CV6A 1V3LA 4FMVA 2D0HA 3FSUA 4JTFA 4KEZA 3INPA 4D2JA 4IQDA 4LQ1A 1R3TA 1J2WA 2XWDA 3TYUA 5I09A 3LZ5A 4LAKA 3TTOA 5ABFB 2VZUA 4H9ZA 3S6OA 4HK5A 4QQ3A 4Y9NA 4DWSC 3QJAA 3G0SA 4HZMA 4US5D 1H1NA 3DHUA 4KT2A 3TLQA 3NWRA 3WG6A 1E4NA 1QOQA 1PV8A 2VUYA 2X16A 1D2KA 1E1EA 1QO2A 1Z48A 3G24A 4DWSD 2OWWA 1E0WA 1PX3A 1XSJA 2YA0A 1EP1A 4W93A 4FF7A 3MJYA 2DSVA 4ZSUA 1MNZA 3UYCA 3NQBA 3P0XA 4N6EA 2XJ7A 4M3PA 3L2LA 4U3CA 3A21A 2RHGA 1WZKA 4NZ3A 4PUDA 1GZGA 3WL0A 5LXXA 1MEWA 1EX5A 2H90A 2FVKA 3E0FA 1KTBA 1UZHA 3PPFA 4PA8A 4G56A 1QTWA 2O55A 2C3ZA 2YOCA 3BGGA 2CBIA 2I5GA 4HN4A 1WZAA 3MMWA 4QRNA 3EEZA 1U5VA 4JYFA 2BX7A 4R7OA 4DJEC 3W29A 4H6QA 1J0KA 2NUWA 5CEWA 2V6AA 1A49A 8A3HA 2XTKA 3CUFA 2X1UA 3FSTA 4UMBA 3GXNA 1TJPA 4QG6A 2WMHA 1PVNA 3WNOA 2VX4A 4LGXA 3PR2A 4Q8MA 3BW2A 5IHSA 3C2YA 5B80A 2JEPA 1D7KA 1BWLA 1P6WA 4H2CA 4P8WA 1UIPA 1Z89A 3MYOA 1R8LA 1CB2A 4K39A 4GGHA 4EF8A 1K9FA 1JFHA 3NL5A 1UBSA 1ZBVA 3WLTA 3OP2A 5GVJA 1DKWA 4J3WA 4KQNA 3CMFA 3NO3A 3OBAA 4ZENA 1LLWA 4W5ZA 2CHOA 4AD2A 1MYRA 2ON3A 4N4QA 4ZR8A 3OLDA 2CLIA 3A4XA 2AOSA 4HN8A 2A6LA 3NIYA 3BCFA 1I75A 3N25A 1GVEA 1W9VA 4K8GA 1AQ0A 2Q6ZA 1IGSA 1NVMA 4X2PA 4XAFA 2WSYA 2WMGA 3JZEA 3S83A 3CHCA 3AMLA 2PDFA 2UBPC 1IWPA 3CMJA 3VGHA 1UKSA 1LJYA 4MAZA 2IW0A 4AIUA 3EOEA 2I5QA 5K3VA 4MVAA 4F9JA 3IGXA 1ZCCA 1SYTA 1YQ2A 2VDIA 4YNGA 2GJXB 1KWGA 3MSGA 2FZDA 2QDEA 3QQWA 3GY1A 5I23A 1EA9C 5CZJA 4GD0A 1JI2A 2A3EA 2XH7A 4MB4A 4AMCA 1ELSA 5GPRA 3LERA 3AU6A 2JKEA 3GVQA 3ZVHB 2XINA 3BDKA 1V03A 1XIIA 4F8XA 2XVPA 3CV7A 2OCZA 2GQ3A 2QAFA 5CG7A 1BF6A 3H2NA 3E0WA 4ACZB 2ZUWA 2HNHA 5CXPA 3M0JA 1R0MA 4H19A 2XFFA 1SQ7A 3VZZA 4URIA 1DJZA 3KRUA 4FX7A 3PB2A 3STEA 1XIJA 4C91A 4IPPA 1UPPA 3ARYA 5I3HA 4IL0A 4MKVA 1QI3A 4GUIA 1XDMA 3CHEA 5F4WA 3PFMA 1DYSA 1L2UA 3L0KA 3R7MA 2W66A 1YDYA 2PDHA 3A23A 3DIPA 3GNRA 3GVGA 4LB3A 3M9YA 4B4FA 2ALDA 4HJFA 3FA3A 1V79A 2J8TA 1AUSL 3N34A 1Q6QA 1VC4A 3B8SA 1VYPX 4QG8A 3BJSA 4AWSA 4Z08A 5HINA 3C8FA 4GLEA 4GJJA 3HPAA 4XTDA 5G2WA 3CTLA 5I3DA 3PAOA 1TYGA 3DKLA 3W1AA 5CQ1A 4CN1A 1F7BA 4LYRA 2HISA 3GQYA 2FTYA 4DO4A 2ZUTA 3TN6A 2Y7DA 1BVNP 1E6XM 1O1ZA 4S3JA 1RLCL 3DGBA 2PE4A 5H91A 1G1YA 4DNMA 4CUCA 2V63A 3ISIX 3CLWA 1O12A 1W17A 2OFJA 4CQCA 5LNSA 3TQPA 4MFEA 1EJWC 2WHMA 3GDTA 4RE0A 3C56A 2YBVA 1KQZA 2QJJA 4O16A 1CXEA 1PTGA 1RD5A 1KXQA 1JYVA 2AKZA 3QLDA 1R2RA 1YXDA 3EDFA 4UCGA 1J01A 3O05A 4UTJA 1W1A1 3POHA 1UKQA 3R2GA 3CZKA 4XTIA 5DCEA 4GZ7A 3UW6A 1XIBA 3SAZA 3J7HA 4S3BA 1EGZA 1KNWA 4DI9A 5LIWX 2Z1WA 1BSIA 1E9ZB 1E5JA 1JDFA 2FDMA 3R8RA 3W25A 4DBDA 2YL6A 2VURA 1E56A 3NCOA 2QJHA 3GDRA 1IV8A 4UTFA 1UMLA 4UFKA 3BANA 4IFRA 1MWOA 4I3GA 4J4KA 2B4GA 1GOOA 3TYCA 3CL6A 2YW3A 2V81A 5EKYA 1NFGA 2HK0A 1ZP4A 1KFKA 3A5FA 2QGYA 3W00A 2OSWA 3S1VA 3TNOA 3AIEA 2DT3A 1UWQA 1XRVA 4QAIA 4IFKB 5ABGA 1E3ZA 1YXCA 3O9NA 3FS2A 2PDYA 3AJ7A 5AZ0A 7ENLA 2C71A 2OSYA 2EAWA 1BPLB 3FJ6A 2ZBTA 3UT0A 1ZUAX 1PXGA 8CGTA 4U33A 2OYMA 1VQTA 3VDAA 1JPIA 1Z6KA 2NQLA 3UY8A 1A5NC 3SI9A 5AC6A 4OFCA 4C6LA 1O60A 4A4AA 1RCXB 1XF0A 4MGGA 4LUTA 3U5UA 3AZSA 3S2NA 3W28A 3ES7A 2VP8A 1VFHA 3G1RA 4IP4A 1AD1A 3DZ1A 1NDWA 4GQQA 3WQFA 3HQPA 1UD8A 1KBBA 2ATSA 1B0IA 1DJIA 2H9AA 1KXHA 3CAQA 4E38A 3F5LA 3WH8A 1I9CB 3PZGA 4CVUA 1FCUA 4EP8C 1H1YA 4IHCA 4QTGA 1G94A 1PZ2A 2WXDM 5DX7A 3RPDA 2X1IA 1PIFA 4XG1A 1MQPA 2FFCA 1XIEA 4CN6A 3E2VA 3AHYA 1ALDA 3VUPA 4RE2A 4OWGA 2YLAA 1P43A 3DAQA 4C6DA 3NQAA 1UOZA 1VBUA 2HS6A 4I5UA 1TZ7A 2BG5A 2Y1HA 3HIJA 4XSLA 4KFNA 3QM3A 2ZKMX 6ENLA 1PZ0A 3MBDA 2DIEA 4W85A 3KCJA 5BU9A 1NWRA 2Z1BA 1MW1A 4CLMA 3PC0A 5SWUA 4I90A 1U22A 4DLFA 4LH8A 2ZDSA 3D46A 4JTJA 5KZMA 1TTJA 5I7GA 1ZB5A 1IT0A 4JX4A 1E1CB 3P14A 2J79A 3CYVA 4U3AA 3GZ3A 3TCSA 3WD4A 1HL2A 2NV1A 4UOJA 1I2RA 3M1ZA 3R25A 3M0YA 4Q33A 4NNAA 5G2IA 1D9EA 2EG6A 3UWUA 2YJQA 5I24A 3NZRA 1CCWB 1UYQA 3LPGA 1L6FA 3L9CA 2B0MA 4JKLA 2DUXA 3ANUA 1UWIA 4CNOA 2B81A 1UP2A 4XAGA 5TAOA 4K7VA 2WM0A 2OXNA 4MB1A 1T0OA 4I8YA 1EQPA 3WQ4A 2BODX 3QVQA 4UR8A 3TWBA 3CUHA 4B2DD 1W37A 3AYVA 3KFTA 3ANYA 4UCFA 3CHDA 4DWSB 4KESA 2ZADA 1LBMA 3GBEA 4XZWA 4AU0A 4RZ4A 3R1ZA 2O9RA 3K1GA 5JIPA 3LGGA 1PKMA 3MT1A 1VEMA 3AYTA 2VNCA 3OO2A 3FAWA 3UCCA 2ZE0A 3OYZA 4GCAA 4E2VA 1ISYA 1HXJA 3VUSA 2VR5A 3TU9A 3C2VA 3CLMA 1CX9A 3BARA 2Y5SA 5IBXC 1MQQA 4C1KA 3E0VA 4C6MA 1UKOA 2TYSA 1GVYA 3TTSA 1LRNA 1Q6DA 2CLEA 1UH3A 1FFQA 4AEOA 3TLLA 4ADUA 4QJ1A 1ZJBA 1X8CA 3TE9A 1MEHA 4KFPA 2PB1A 2I5IA 5I6SA 3EKLA 1T40A 2DV0A 3M7SA 2ZDRA 2D22A 5F2MA 2QV4A 4PBEA 2QLYA 5BRQA 3PTMA 1X7FA 2X0HA 4D6JA 2Z25A 1X6NA 5DLCA 2G3JA 5DY3A 5K9CA 4HNUA 2X40A 3QV9A 2BLEA 1WBJA 1E73M 3LU2A 3SM0A 3DERA 1KV5A 3VNMA 4RE4A 1JVNA 3H26A 1NU5A 2RUSA 3W24A 4B91A 3LM3A 3VM7A 1OY0A 4MMWA 3TA9A 4NZCA 5KZ6A 4WIWA 1MVYA 1K9TA 4ALDA 3IGHX 4FEZA 2YZ5A 2NWSA 1H49A 2VRJA 1C8QA 4M7TA 3W7NA 1XLLA 3B9DA 4HPGA 4J28A 3Q45A 4XD3A 4QBXA 4R5EA 1RSCA 3RJYA 3OVPA 2OX1A 4JICA 3C2FA 1QDSA 5KTLA 5CZTA 3TIMA 3KWSA 3CWHA 3KHJA 1BHGA 1ICPA 2YIHA 5D8WA 1Q13A 2PGFA 2V3EA 1FRBA 4S38A 5A3HA 4RZ5A 3TSDA 3MWAA 3AAMA 4H00A 3I3EA 4RDYA 1QPOA 3LHTA 3B8IA 3DI1A 4ZBCA 4AHOA 5A8PA 2YFOA 3ZFHA 4MF4A 1XM3A 2B31A 4DBEA 1QXLA 3AOFA 4S3CA 1J8VA 4NQ1A 4K8EA 3AWNA 4N9CA 1BVZA 3MW7A 1UB3A 3CBWA 4JTAA 1J5TA 1DV7A 4PODA 5M1TA 8XIAA 4FO4A 3O3RA 4H2HA 5DY2A 3G22A 3ZT7A 3QFWA 4IWWA 3VGEA 4ORIA 2A3AA 4MY9A 5GJMA 1M53A 2PDCA 5A6BA 1WAWA 3N2OA 4MWAA 3HA1A 3KL5A 5KZDA 3I7RA 2BOGX 3W7EA 4L4OA 4B9YA 2WNQA 2PTXA 2YXOA 5E09A 2QMJA 4OVXA 1XLAA 4GMEA 1AQFA 4V1XA 1VCFA 5BWAA 1RQHA 1Q3NA 1I2QA 3NUKA 1MW0A 1SO4A 4HTYA 2C14A 4E2DA 3THDA 4JIRA 2VC9A 4AYSA 4DLMA 1MZHA 3DI0A 3PF3A 3ABOA 1YBQA 1FUYA 2CESA 1LQAA 2E5CA 3G1XA 1UR1A 4BEUA 1CB7B 3B9AA 4W7UA 1PYMA 5JBDA 4QDMA 3A13A 5FF0A 2NZLA 2HMCA 3BMVA 3TNBA 3L7RA 1CNVA 5M03A 5LYRA 5AYIA 4A21A 1RPXA 1HKVA 5G2HA 1CXIA 2A2IA 2OO0A 5MHBA 1QUMA 1KA9F 2R91A 6XIMA 4EXBA 3B97A 1UWTA 4C5ZA 1MNSA 3MWCA 1ODZA 4Q8WA 1TZ9A 1UQYA 4JQAA 1THFD 1ZGDA 3AIUA 3M4HA 1SSGA 3F4CA 4L6OA 1H2JA 2GVGA 4AC1X 3VVGA 2ABBA 3L23A 4GUHA 3N6JA 1B9ZA 2Q8ZA 1Y5WA 1LT8A 2YXGA 3O07A 1L6WA 4CCDA 4C6EA 2FH6A 4LAZA 1TE1A 3WBXA 3K5XA 4GK8A 2ZTJA 5CPQA 1KC7A 1I4NA 2OO6A 3EOOA 7A3HA 4FIQA 3M5XA 3CZJA 4HPHA 3O15A 5BROA 1ZQ5A 3V1PA 2PD5A 1NM9A 3L5AA 1V08A 3UR5A 4K7YA 4JFTA 1PZ3A 1VFFA 5FL0A 1ZALA 3IARA 1XIDA 1V6TA 4M6UA 2DSKA 3GC2A 2AQVA 4KWWA 3TH6A 4CNSA 3SCVA 2ONEA 3EWWA 6REQB 5CGMA 1RD6A 2A7NA 3SUWA 3HGSA 3RG6A 4UNIA 3O7UA 2XVNA 1UZDA 3WMSA 4UTWA 1BFNA 3IV3A 2O9OA 5F1VA 3N12A 1CPUA 4Y6GA 4WXZA 4J40A 4MG4A 1RVGA 1GKPA 2FPVA 3NXFA 1V6VA 1JCXA 1Z8AA 2EGZA 4UTLA 1JAEA 2V5KA 4D6HA 1VBHA 2CZEA 5I79A 2R24A 2J88A 3LYEA 1XD1A 1Q85A 4PBGA 2E25A 3HJEA 2B7PA 4U31A 3C6CA 2J9XA 5A6AA 2PCQA 1OC7A 1OJXA 3RU6A 4O8AA 4UQBA 4Z1YA 5E0CA 2G97A 1FBAA 4HD5A 1I60A 4LVBA 3XISA 1H11A 3WQDA 1TE6A 3T40A 1IQ8A 2VOMA 3GIQA 3TN5A 4YPJA 4DWDA 3FV9A 3LPPA 3NEHA 3NZQA 1VHNA 4ADTA 1EJSC 3B4YA 3S5NA 2FVLA 5HR6A 1XYAA 1OF8A 1ONXA 1PHQA 3S9ZA 2UV8G 5CBBA 3ZR6A 1SO5A 2I17A 3MDWA 3SCSA 2PDGA 1RALA 1XPGA 3GNNA 1NELA 4J3ZA 5BXPA 2VZTA 3K8KA 3TN3A 5AVHA 1XDLA 5FD0A 1CW2A 5GNZA 1E4MM 1VFSA 2QF7A 2HBXA 2L5HA 2BY3A 3VKCA 2DW6A 2IPJA 3WDIA 4AZ6A 1ITCA 3V0SA 2WMIB 3PPHA 4GYJA 4HHPA 3S2JA 3B8UA 1UUOA 1YTDA 3LLDA 3MS8A 1WX0A 1NF0A 3WNPA 3TXVA 3D0CA 3TR2A 3M5VA 2F2HA 2REQA 2Y8KA 4YLWA 3M0IA 5CJ5A 2ZVIA 5HPCA 5DANA 3VIKA 3UR8A 3QYQA 2Z1VA 1O68A 1SO3A 4ERAA 4Q4MA 3ZOAA 4B5VA 4KS0A 3UWYA 1NSJA 3ITGA 4AEFA 1TVNA 4AH7A 1EXPA 1I0DA 3WKZA 3V1HA 5AC5A 1EZ2A 2W4XA 4PBFA 4H7CA 1XCWA 1TPDA 1LL4A 2GPTA 4AWUA 3GB6A 3UXDA 4QJ5B 2DUAA 1FHUA 1NTHA 1QNQA 4AEEA 1AH3A 3IJ9A 2E6YA 4IGSA 1ECQA 1H09A 1TRDA 1AZ2A 4WEVX 3W1RA 3N04A 3UG3A 1XHGA 5C70A 5I3FA 3KBMA 2NQ9A 2PGRA 4CU8A 3A4AA 1OFOA 4P8UA 4MWAB 4GABA 5IFTA 3LHVA 4ZXLA 3NQMA 4DZHA 3BMXA 5EFDA 1J10A 4WVXA 1WKYA 1PO9A 2ZUNA 3Q65A 2OLHA 2VCAA 1GYNA 3KBSA 4Q7NA 2F84A 4K36A 2WHKA 4ZEPA 2XGIA 3HURA 3PZVA 3W74A 3FY1A 2ACUA 1NOUA 3OGVA 1TMLA 4F0LA 1XRFA 2F38A 4IIGA 2FJKA 2VX5A 1NFPA 3VOHA 5CLTA 1S3HA 1XIFA 1H5YA 3DESA 3LSBA 2ZX5A 2XISA 1DJQA 1E5NA 3SCQA 1OT1A 1KM3A 1OB0A 4GWEA 3C3NA 5LNRA 1TCMA 4LUYA 4JTUA 2A7RA 1PTDA 3QW3A 4LEQA 3VXGA 5DO8A 3U2OA 2B7NA 2X41A 4PGLA 1RCOB 4IMAA 4F2BA 4Y90A 2X1SA 2PI6A 1TA3A 3NSXA 4MNKA 2X7WA 1JXJA 5LA1A 1GHRA 4PB4A 1Q66A 2XSXA 4EK7A 4HNVA 2G3IA 1SJDA 3PWGA 4BF5A 1ME7A 4NSBA 3O6AA 3VNZA 3QC3A 1DJHA 2QDDA 2E9LA 4AB4A 4XUGA 3ANVA 5K9DA 4JDBA 5CZKA 3TC3A 2A3CA 5FA5A 1GVSA 3C5QA 2QYGA 4CQBA 1S5NA 4DELA 1FWJC 3OHIA 3MA8A 2ZOXA 2Z1KA 5BNKA 3NEVA 1Y5XA 4B5UA 4AC7C 2GVEA 5CH9A 1E4IA 2E77A 3AHTA 2ZUMA 1MFVA 4NU7A 3P2VA 2FYMA 1GG1A 2CHNA 3OBEA 1GORA 2AGKA 5FEZA 2D3LA 4LS2A 2ZWZA 4I5RA 1W1IE 3L4UA 2Z29A 3A9BA 1G4PA 4GGBA 5FACA 3KX6A 2XZ9A 1ONWA 3RCNA 3XINA 3N2XA 1UR3M 3EB2A 4PCPA 1TPUA 3O0KA 3AC0A 4C6BA 4MZYA 3H6OA 2WNWA 1TVLA 3IV8A 3MKCA 3WEZA 1IT8A 3SN1A 5A2CA 3WDJA 4XO7A 1R2SA 1XPYA 1JZ2A 3UJSA 1R9YA 3KRBA 2WPGA 3IK2A 1IE7C 2VFDA 5D02A 1P5BA 4E4UA 1B3YA 3UG4A 1TWIA 1FP8A 3DYOA 2WSQA 3LXAA 3RPMA 4NZ5A 2VO5A 2ZC1A 4AWTA 3TZNA 2QKFA 3B9NA 2F6KA 1S2AA 4Z1AA 4CEUC 4Z2IA 5DRCA 4LSBA 3P0WA 3WJWA 4PMJA 1WZMA 1YDOA 3MZNA 5HDRA 1JUBA 1Q65A 4X3ZA 2VQTA 3USZA 3HO8A 1YDVA 1HF6A 3MB9A 2WQDA 1F8IA 2WJDA 3GXPA 1X1ZA 2P0IA 3GS6A 4JIHA 3BOFA 3V16A 1M04A 4QSHA 5LA2A 4FP1A 4HKPA 5BOEA 3RAOA 3RR1A 1F6KA 4MJ4A 1IXQA 4WRHA 3TJIA 3IK4A 1DIOA 3R89A 1B90A 4EWJA 3TROA 2XIIA 1BRLA 3BVJA 2FB3A 2G95A 3BOXA 1DBTA 2V5CA 3A6OA 3OW1A 1JQVA 5JIWA 4DIAA 1DP0A 3L0NA 3AWOA 1IEXA 3SR7A 1K77A 3GX9A 3AIWA 5CPTA 1EC7A 1RXOB 1EQCA 1XWYA 4IX0A 2HPIA 3NTYA 1OGSA 3KWXA 2IQ0A 4XWUA 1A5OC 3GH5A 1OK4A 2PODA 3P5YA 2B7QA 1EO5A 4L80A 1W31A 1YEYA 3BSHA 3TYZA 3ID7A 2Y7EA 4EE9A 1QHZA 1WA3A 3BW3A 3UF9A 1HKKA 3UGRA 1GPFA 3DGRA 1LTDA 3UWEA 1F3WA 3SUTA 3GK0A 1SVDA 3UZWA 3HMCA 3S6DA 2ISFA 4PUJA 2GGHA 3RUBL 3W37A 3RO6A 3SGGA 3L2IA 1A53A 1IEWA 3NQ6A 2BBFA 3I3DA 1CGWA 4KERA 5AYXA 3WQ8A 2WWDA 3T2PA 4GHRA 4WR3A 3AZRA 4AD5A 2YCJA 1K8ZA 2Q3RA 2QEZA 3REQA 2Y85A 3BSGA 3MO7A 5IHRA 4WSKA 4NNBA 1MDLA 3QPYA 4E8DA 4A3RA 1XRTA 2XPKA 4GINA 2ZYFA 3PZIA 1Q6RA 3POCA 3QTPA 3TZFA 1JCMP 3STGA 2OT1A 3G0XA 3SIMA 3BW4A 4M19A 1X1NA 4HIBA 3QGKC 1OC6A 4NZJA 2H9AB 4V27A 3IS4A 3EKZA 3QMRA 3RU8X 4D9PA 5DF0A 5F7UA 3ARTA 4OQVA 3KBJA 1BRLB 3H4XA 4HCLA 3DHDA 3O63A 1DVJA 3VCRA 1C7SA 4JOMA 1L0PA 1SR0A 5CJNA 3LQLA 4D71A 1UROA 4JTKA 3UERA 1QMLA 3TV8A 5HMFA 1V7YA 3FXYA 1M68A 1YW1A 3NL2A 1YDNA 1GNXA 3RK8A 2J13A 2VC5A 1KRBC 4NVTA 4H9XA 4IFKA 4PMDA 1EC9A 2JFEX 5A6SA 4PCTA 1W3KA 3BQ6A 3UBPC 4B3KA 2RAGA 1AMKA 4M6VA 1US3A 3NJ3A 4DVOA 2ZZ3A 3TTYA 2ESCA 4LNYA 4WDUA 4QROA 1BKHA 2GJNA 1BYBA 3NFUA 4IGMA 4CEXC 3CAVA 2E0PA 1L8PA 2MUCA 3KBWA 1PE1A 1Z3NA 2D24A 1QNOA 3LRMA 4Y8EA 1RQBA 1OFBA 2E28A 2G3NA 4UNLA 3S5ZA 2X1TA 1DWAM 5FCZA 2GSHA 3P82A 5T8GA 4DXKA 4H9VA 1HUVA 2OWCA 1P1XA 3T7VA 3L0GA 5D38A 4JAWA 1X6LA 4MY8A 4Q6XA 3TW6A 3ARPA 1P0DA 2PPGA 1QHOA 3BMWA 5LSMA 2GLKA 3GZAA 3N13A 2V67A 3PTDA 5LGZA 4GBUA 3KW3A 1EPXA 4GVHA 2BGQA 2Y70A 3KAOA 1KFLA 3UR2A 5AFDA 2OWXA 3FYPA 3BO9A 4NG3A 4DNHA 3T2QA 2V5BA 2PTWA 1WDRA 4W5UA 1GQNA 4QLJA 1EYWA 1S46A 3F4WA 3ZR5A 4A8IA 3ZJ8A 1ZHAA 4TTGA 4DZ5A 4FXRA 1Q6OA 4AX7A 4XQ6A 3R8HA 4W8LA 4MKSA 1QVBA 3QKZA 1S5VA 2QCGA 3IJ6A 3JUGA 4O17A 4QEEA 3SY5A 4QE4A 1QK2A 2BNJA 4YN5A 4C60A 5LHFA 2FFIA 4MNJA 4WQ6A 1HIZA 4I9MA 5EMLA 4WKFA 1JCTA 1I6NA 4OIFA 3VD3A 2WSRA 1QR7A 3BPWA 4AVNA 2R82A 4RV3A 1GQKA 2BHYA 2JEQA 2EJ1A 5DQPA 2FDSA 4XIMA 1J0YA 5D9NA 4AYGA 4DYKA 7XIMA 3G77A 3V18A 4MPQA 2C18A 3O6DA 1VLWA 2J62A 3PWIA 4ATWA 1RP8A 1R3WA 5M3WA 2JF6A 5PTDA 4WY0A 1XC6A 5BYWA 3VIFA 2W62A 4TO8A 3ALGA 3RN6A 1AL8A 2QZRA 2P0OA 4RL3A 3CEPA 1EBGA 3HV8A 4HMEA 1TJ0A 4HZ8A 4GH1A 5A6MA 1TG7A 1KTCA 1GTHA 1TIMA 2X2GA 1R9XA 3QYSA 4JCLA 5HNTA 2E3ZA 1W3LA 2F6UA 2WLZA 4ZQOA 1RPKA 1BTCA 3G8EA 3LLFA 2EQDA 3HB9A 2WCGA 2ZUSA 3WNMA 3W7GA 3T0AA 3W72A 3PS7A 4TU1A 5FOOA 5EMJA 3ZT5A 2GJXA 4LV9A 1DWJM 3P67A 3W87A 3II1A 4ZVJA 4IPJA 2ZUUA 3EDJA 3NDOA 4BJHA 3NQGA 2CZVA 3KTCA 1UZ4A 3IPWA 1A3XA 1HFBA 4C7FA 1KWKA 2BVYA 2Y63A 2C15A 3WEMA 1XFCA 2V3GA 3NURA 4ZE4A 2HJPA 1TO3A 4BWLA 2PP0A 4MB5A 3P7YA 4GBDA 3FN9A 5D9PA 5BCAA 3VCNA 2QUNA 4E3TA 2EF9A 2QUVA 3F5JA 3E9AA 5IBXA 1BYCA 3W82A 3VKJA 3TC7A 3GU2A 3KRZA 1XUZA 1JD7A 2XYLA 3DYPA 1QPQA 4LPCA 1Z42A 1DIDA 1KCKA 2R1LA 3P84A 1R30A 3WNNA 4BWLC 3HPZA 1M41A 4RW5A 3BLFA 4B5NA 3NAVA 2OLSA 2V5JA 2ZXQA 1YBQB 3R0DA 2A7PA 5CPNA 2REQB 5GJNA 3BH4A 1OADA 5LNVA 3SDOA 1XLIA 4JKMA 4DO5A 2J66A 3GUWA 5DT7A 1P1MA 2FGLA 2WOQA 3HG4A 1K3UA 3EKGA 1VCVA 2J7EA 5HNNA 4LF1A 3WH5A 1CI1A 2DDXA 5D04C 3MMDA 2YA1A 3WBAA 1FWDC 3TX9A 3VD4A 4LC8A 3N6QA 2XWEA 3USBA 3F4NA 4D6CA 3T09A 3W7PA 1QAPA 2C13A 3NM1A 1ZU8A 2ASHA 5HATA 1H7XA 4XX6A 4J9JA 1IEVA 1S38A 3MMUA 3GM8A 3DFNA 2YLLA 1SUXA 4WX2A 2ISSA 1R47A 2IS7A 5LNUA 4QIUA 3VMPA 5AYBA 1JIBA 4DZAA 3QMTA 4G7EA 4HOZA 3FCPA 2VQUA 2FHCA 4XSMA 1AD4A 2SFPA 4JGDA 1DIEA 5JVLA 4D6DA 1R3QA 3PZTA 2ANUA 5EBUA 1N8WA 1T5AA 3S4TA 4DJDC 3WQOA 3LI0A 4IOTA 4PTDA 7REQB 1VAHA 5ABFA 4TVCA 5AHIA 2GVLA 2OKOA 2TRSA 1TIWA 3W86A 1K8YA 3S1UA 1ZAHA 1ZBKA 3MY9A 1SZGA 3W1TA 1E1CA 1S5TA 3WLHA 4TIMA 1QOXA 1T41A 3TN4A 1E4LA 1ZPTA 4YJ5A 3KHDA 4JN6A 4F48A 1TTQA 2QR6A 4QXIA 3CIXA 4YYFA 4C6FA 2WW5A 2E7FA 1XUUA 4YU1A 4MLRA 1FTXA 4D6GA 4O8RA 2X05A 1WDDA 4NZ1A 4A2SA 4KFOA 3O1NA 5BXTA 3EWBX 2W3ZA 4IXHA 4S2BA 2VVNA 4JTLA 1JJKA 4DXVA 2J24A 4CU7A 1M7PA 3IUIA 2VCCA 4GYKA 2O4QA 2R1KA 3B0XA 5K4ZA 3MUY1 1GT8A 1BKSA 2PRLA 3T0BA 4GJ1A 2CKSA 1V4YA 1ZLPA 4GUJA 4AY7A 1DXIA 1X38A 4JHOA 2Q01A 5HQEA 3B3DA 3VGBA 1LL7A 2JIWA 1H60A 3TDFA 1EH9A 3UETA 3HBLA 2FH8A 4XKYB 2BVTA 1ZS2A 1V02E 2GDQA 2YX0A 3N18A 2BOFX 1GTEA 4IL2A 3VMOA 1PYFA 2D2HA 3C2OA 3MUAA 3CV1A 1SR9A 2VT0A 3ELFA 1J6OA 1OIFA 2V5DA 2ISWA 2VR2A 1BGAA 1UG6A 3N11A 3SEPA 2V0TA 1E0XA 3H4GA 3KVJA 4BI5A 4I7UA 2PA6A 2ZWYA 3U2CA 1KTNA 1QW7A 2BXYA 1TWWA 4WSJA 1V02A 1HKIA 1IIGA 1DQUA 5E5CA 1ITQA 4N2YA 3SY1A 1TPEA 2NX1A 3LS9A 2X09A 5G1YA 4PMUA 1FOBA 2YB1A 2DZVA 4F2TA 2OZ3A 2WMJA 1DTNA 1EF3A 5IXEA 4US6A 3PB0A 1XBVA 1B3VA 3B8VA 3G3DA 2FQIA 1XFBA 4EACA 3VOCA 1DIKA 3C8NA 3TW9A 5FJPA 1OFQA 2W92A 4ORMA 2VR4A 2RDWA 3DFSA 4ZOAA 3S5OA 5EGRA 3W71A 4FK9A 3I6TA 4LBUA 3UNTA 3P5ZA 2VX6A 1VFTA 1W8GA 4JTQA 1DWHM 1WOAA 4K1WA 3ITCA 3ZIZA 4HNNA 5G5IA 4DF1A 1A5AA 3P61A 4MADA 3SCPA 4A6GA 1GOKA 4JXCA 5I03A 2DVTA 3OZMA 4Z17A 5A6KA 4GH3A 4DZIA 3G6MA 3RLHA 3B40A 3SADA 2H6RA 3HJZA 2J74A 2JKPA 4UFLA 3E0IA 2ZRWA 1Q4WA 3VFCA 3G1AA 4X0VA 2R14A 4E3VA 4Z42C 2CETA 3AQUA 2XIMA 1M01A 2ZX9A 1EXBA 3COTA 1BYAA 2DSZA 5JBEA 3LOTA 1QOPA 4C6CA 1CGUA 5EMKA 3GFZA 3VIOA 3GD6A 3CQJA 4POCA 3IVUA 1JPKA 6A3HA 4K8HA 4JFVA 1WDQA 1PHWA 1E70M 5D05A 2VFEA 4YWSA 2G3MA 3RJXA 3VE9A 3KM8A 2WKGA 4O0QA 3GAKA 2O56A 4LYKA 3W2MA 3I7SA 2DUZA 4W84A 3C0LA 3REQB 4KWSA 2X1RA 4IMCA 1Q45A 3CU2A 3VFLA 3N2CA 2NX9A 5FSDC 3L4WA 4RCXA 3WIJA 3NXLA 4LWWA 3MO4A 3DC0A 2I1OA 2DH3A 4IMEA 3PBWA 1P0KA 4PRWA 1PCKA 4OTKA 2O0TA 1ADDA 2UY4A 1QBBA 2PDIA 4AVOA 2E4TA 1PSCA 2FVMA 4JTCA 2NSXA 2VWTA 1TMQA 3JS3A 2WHJA 3DG3A 1WAUA 2DP3A 3UXLA 4IG2A 1VLIA 3EWDA 1G7VA 5C7VA 3V0TA 4M80A 4KIRA 1JL8A 3W76A 5KINA 2PC4A 2YSWA 3AS0A 3QRHA 2Y7GA 2EPLX 4V1YA 5IDZA 3B0VC 4UZUA 3UVIA 4O12A 5A6LA 3U7BA 2PDKA 4I6VA 4UMCA 3RHGA 1NY1A 1ZJAA 3DC8A 2WZTA 4KWUA 1WE5A 3S3GA 9CGTA 1J11A 2PU0A 4NX0A 3UZ5A 2DT1A 3M43A 2QCCA 1DHKA 3QLLA 4B15A 4F2UA 1XD0A 3AS2A 3WLNA 4ML9A 3S5SA 3MYPA 4Q4RA 3TJLA 5C9WA 1XINA 2QIIA 4EWND 4BY3A 3I4KA 4H6KA 5C2CA 3PTKA 3LCHA 3CO8A 2WVTA 3WK3A 4H7ZA 1DPMA 4IP5A 3WH9A 5LKYA 3LXBA 2NV9A 2VFGA 5C2GA 4FOJA 3GE7A 4N9EA 3AXIA 4ZQPA 2XU2A 5CCZA 2YCLA 3WL1A 3M07A 4J3XA 4R27A 3IUHA 1FCQA 2OYLA 2OSXA 3CYJA 4UQ9A 2PWDA 1BF2A 4ZB5A 4PR4A 4UIOA 4CQAA 3N14A 3N3MA 3U2EA 5A6TC 4GUGA 4P2VA 2ZA1A 3E2QA 3W7HA 2CC0A 4WHBA 1WYIA 1MFUA 1P0NA 3OU8A 1S2CA 1EWDA 3BCDA 3V5FA 2YDRA 1QWKA 3GNXA 3DOPA 4LCRA 2OJPA 1SFLA 1FDJA 3ZR4A 1VEOA 3ALFA 3GR8A 4DO7A 4TMCA 1W1B1 3LX9A 5I00A 3CUXA 1ZAIA 4NX5A 1B31A 4H83A 4J3UA 4M82A 3ZJ6A 6TAAA 3QGAC 1LT7A 1JPMA 1JR1A 3EPMA 1OD8A 2XN0A 2AMGA 2WQPA 4YWIA 1T8QA 4RNIA 4Q6JA 3S1GA 3WDQA 4ERGA 3LZ3A 3CUJA 3TJXA 3CMGA 3WELA 3HPXA 3PUEA 3V36A 4CQ9A 5LIYX 2Y61A 3OZYA 3G2GA 4EF9A 2YBUA 3AYRA 2DVUA 4HSHA 1MZRA 4X22A 2JE8A 4O19A 5EFFA 4FLRA 3ZLFA 1FXPA 4N7QA 4FR6A 3KLKA 2WZEA 1UWRA 1EF2A 1GJPA 3HQOA 2ACRA 1TPVA 4JIIX 4DUOA 3NZPA 3AXMA 1R3VA 4ONVA 4TMBA 3WN6A 3GNOA 1U1JA 1P0EA 3ECQA 4MNLA 2INEA 2O7QA 3WBEA 4CU6A 4KWOA 4PMQA 1J4EA 1QI2A 3LCLA 1SM9A 1PKYA 3OG2A 2D3NA 1GKQA 1UR4A 5ENLA 4ECLA 1NOWA 2QPSA 2Z24A 1S1PA 3A5VA 2Y0FA 2QJMA 3W7RA 4B5WA 1HKWA 1VRXA 4LS0A 1S2VA 4LX4A 3SB0A 2BSLA 2ZTKA 3WLKX 5FEPA 2VC6A 3BUVA 2DIJA 4D8AA 4L7ZA 3QEZA 1BXCA 4UOZA 1QNRA 3CUZA 5FESA 4ZTXA 5AN7A 4BQ3A 1R86A 3W2KA 2WV8A 3W6LA 1IEQA 2P5NA 4UR9A 2ZA3A 3TYAA 1J12A 1CLXA 4D8LA 3EA3A 1U83A 2KX9A 3LG3A 1PUDA 4P7QA 1E6NA 4Y96A 3VNIA 5AOUA 4IJBA 3W2JA 3K8LA 2V2HA 1JPDX 1JAKA 3DYMA 4M51A 1SPQA 3ZVHA 3E0LA 1TMHA 4LY8A 5EMMA 1MUWA 1UUMA 1K70A 2G41A 2Q3OA 1W9PA 3MV01 1HVXA 4I5XA 9XIMA 4DJED 4GFSA 3C4UA 4GXMA 3H70A 4O1BA 3B0PA 3SN4A 3U5YA 4JKKA 3IIVA 2HNEA 4AXNA 3ABQA 4QM1A 3LDVA 1LWHA 2CLHA 3KOZA 4U2YA 1ZENA 2NWRA 5H8MA 1KM5A 1NIUA 5BXRA 1C9DA 1TR1A 2QNEA 1FWAC 3VNLA 1Q6FA 3W1LA 5XINA 3SSZA 4QCEA 4H6EA 4I9AA 4E4FA 2KZHA 3E3HA 4CN4A 4CD5A 4DX3A 4GYPA 3DCPA 2NVAA 3ITYA 4OKDA 2Z1SA 3CEUA 3ZYZA 1TPH1 1K7FA 3NVDA 1LRTA 2QUUA 3AFBA 2ADAA 1LROA 1Z44A 1CTNA 1W3TA 1E55A 4KPLA 1UR8A 5CBJA 3BSMA 1MUCA 4X60A 3T4CA 4NAEA 1W0MA 4AFYA 3ICJA 5JU6A 2H8XA 3NQ8A 2FZMA 1WDWA 2ZFAA 4XZMX 1UR2A 2J8GA 2BXZA 1SFTA 2FPTA 3H22A 1GVIA 3LRKA 1LWIA 5REQA 1FKWA 2VEKA 2XFYA 2EPNA 3P93A 4FNPA 5CPOA 2FTWA 5K4XA 4HU0A 3VNJA 8RUCA 2INZA 1DE6A 2AQWA 4IFOA 5CC5A 2V2CA 1UIOA 1SU5A 1XG3A 2V8ZA 4C6JA 3KS6A 3ZLGA 4R9XA 3OG3A 2OVLA 3PUGA 2PCEA 2E40A 2DSUA 4RNJA 1JDEA 3WDHA 1GHSA 3UWQA 2WNNA 4P7NA 3MUCA 1G01A 2V82A 3OYXA 3GNDA 4IXXA 1T6MA 4KIEA 4QS5A 1JPHA 3NA8A 4GYPC 1FXQA 3NL6A 1AG1O 2UZ9A 3GXFA 1M9HA 5D2WA 1EIXA 3FDGA 4NRRA 2UY2A 3LPFA 1G67A 2VEMA 5F2GA 4DI8A 4K6AA 4HPXA 2YW4A 3B0UX 3LK6A 1ML1A 1GVFA 1A3HA 4HA1A 4BCEA 1WPCA 3KOYA 1C29A 1CEOA 4M1BA 3G1DA 2E6DA 3NSMA 4GIEA 4N9DA 1HO1A 1CGTA 4WOQA 5FJOA 2G0WA 4H8NA 1UWAA 2Q8XA 3HQ1A 1EDTA 4YVVA 5I2UA 1Q6EA 3AO0A 1H1ZA 3LCFA 3FYOA 1DJXA 1UZ1A 1WP6A 1FWHC 1BWKA 4CKQA 1OWQA 1UA7A 1W5OA 1OX5A 3MUZ1 3QPEA 1XBXA 5F4SA 3N4AA 3A4WA 2PZNA 2BZNA 4BK9A 4WXYA 2EKCA 2CLFA 5HMDA 3LHZA 2C6QA 3GH4A 3VD9A 4WUIA 3CK5A 2INFA 4AX6A 3ZQ9A 1VFLA 1Q7MA 1UD4A 4UTKA 4XD4A 3PUDA 4E8GA 2B7OA 1FDZA 1MEIA 2YYUA 3E02A 4AMAA 1TSIA 1WDSA 4JTDA 3R0KA 2QCNA 1R3YA 3S46A 3PG9A 3CT7A 3M7WA 2V5LA 1XYFA 1XLHA 3WLMA 3EX3A 1W32A 2VI0A 5FIPA 1LUCB 1TJ1A 1LL6A 1XYBA 4K38A 3VIMA 3IVSA 4TUFA 3TUUA 4EKJA 1CGYA 4PUUA 3WD1A 3UYIA 5I06A 1Y8BA 5AY7A 3G1HA 4GKTA 3MHUA 3SJNA 3OHMB 1KRMA 4OU1A 1ENUA 4OUIA 4MZ1A 3THCA 4RNFA 1W9XA 3UXAA 4CVWA 1C90A 3LCIA 1H3GA 3WBYA 1X96A 4J3SA 2QJIA 3H7VA 1MQRA 2I7GA 3WLPA 1FWIC 3GWQA 4GXPA 3RXZA 4FXFA 4N42A 3PJWA 3ZXWA 2WVVB 3N4FA 2C79A 4HMNA 4YVPA 4S3AA 4I7VA 4PMVA 4IJCA 3UR7A 4OECA 3JU2A 3SUSA 4O18A 7ODCA 2CIPA 1OCQA 3SW6A 1KFEA 1JZ6A 1HG3A 1XLBA 2WCSA 2J7CA 1SMAA 1YXYA 3UPWA 1LZOA 5AHNA 1ZZMA 1KGXA 3FAXA 2Z6JA 1W5QA 3RM8A 4MPKA 4MUZA 1HN1A 1EC8A 2WJZA 7TIMA 1OEPA 3CV2A 6CGTA 4MWAE 4TX8A 3LRLA 4NJJA 2Z6IA 1B3OA 5HWMA 2HBVA 4E8CA 3UWZA 2EPMX 1X7IA 3W2LA 3GR4A 3JW7A 3W3OA 1A0DA 1R46A 3H2MA 1CGVA 3OA5A 4DBWA 1GZ1A 2YCKX 4NY2A 5CC3A 3EWZA 3ERPA 2D2GA 5JMUA 1NDVA 3HGJA 3A12A 1W3NA 3ABZA 1QASA 2JGYA 4A8NA 1AVAA 4HOXA 3LXCA 2PF0A 3MCOA 4EANA 2YPIA 1TV5A 4B90A 3PN8A 1H51A 4S1FA 1K6AA 1T8XA 3FHAA 1O5KA 1W9UA 4YHGA 5KMYA 3HG5A 1KLYA 4Q7IA 1X39A 5IRPA 1YMYA 5EA9A 5IOBA 4OV9A 1JUKA 3PSVA 4JN7A 2GK1B 1AQHA 1Q7QA 1OGBA 4ZQRA 2D73A 5E9AA 2RDXA 5FF7A 1RR2A 2PDQA 4ZO6A 3T8QA 3WF4A 1EHNA 2NXGA 1MW3A 4GISA 2OYKA 1X98A 2I16A 3TOYA 4UMAA 3HPFA 3R4IA 2P3EA 1A4LA 4V33A 2XGBA 4L64A 3QR1A 1AL7A 2MNRA 2DZUA 2EHHA 4KEUA 1IZKA 4HNCA 1M7XA 1G5AA 2VFIA 3ABXA 2J47A 4AZIA 3T05A 3CXOA 4Y7EA 2Z4GA 1CT5A 1GUVA 2Y8UA 2ZRYA 1EPVA 4RK8A 2OQLA 4QSFA 1SJCA 4H8UA 3NNTA 4WOZA 4EXQA 5D2YA 1ADSA 2DJLA 2Z26A 1GQJA 4WD0A 1R38A 2WVUA 2VCBA 1OFAA 2A4AA 4Z2LA 1FWGC 4ATLA 4PL2A 1W1YA 3W7DA 1ECEA 4MZ8A 3W7CA 4PFHA 3TYBA 2E09A 2XN1A 3PK7A 1GQIA 3WSUA 3WH7A 2CZFA 2FMOA 4E4PA 4MAVA 1GJUA 2PWVA 2W6RA 4X0NA 2WYSA 3DBNA 4IPIA 4A29A 2BXVA 2RGMA 3OGSA 2J9ZA 1EJXC 4DM1A 4M24A 4LCSA 3T8LA 3W22A 1FWEC 4Z1BA 3RM9A 3MSRA 4PCNA 3W7OA 1Q2SA 2VWSA 1O7AA 1E6QM 2GOKA 2DZXA 1XGZA 3L65A 4EAYA 3N9SA 4FALA 1J0HA 4L1WA 3W53A 1IEIA 3A24A 3BAYA 3QW4B 1ZRQA 4LB4A 1VFOA 4L5ZA 4HHLA 4GIRA 3PP7A 3TOPA 1DXFA 4XVDA 2Z7GA 3E12A 1C91A 3TTEA 4Q8QA 5CSYA 1EOMA 3Q37A 1GONA 1KFCA 2P88A 4HTBA 3BAJA 1ME9A 2ZZ6A 4HCHA 1FWFC 2DZSA 1GZJA 3EXRA 3FK4A 5D03A 4PUNA 2C91A 3T55A 1UC5A 1XRSA 1HQTA 1PS9A 1EX1A 3BAIA 1K7EA 3GYEA 3T07A 4RLIA 3D5HA 2HSAA 2BGSA 1VIZA 5HK4A 3B04A 5BU6A 3BGAA 1LQ0A 1ITUA 3IIOA 3VNDA 5G1TA 1JZ4A 7PTDA 5DEZA 1NWUA 1E0TA 1Q6LA 5TNVA 4F3HA 1LOSA 1JFXA 4NT0A 3APYA 3K4WA 1OZMA 1DEDA 3WD3A 3GG8A 4D72A 3W85A 4NXKA 4LF2A 1IIHA 3W75A 3W83A 1LBFA 3OB8A 4ZB0A 3SUVA 1CECA 2Y7FA 4G8TA 4AIBA 3W2NA 3DDMA 3VE7A 2RH9A 3SZ8A 1Q63A 3SCNA 1R6WA 2JF7A 4G6CA 1LG2A 3CQIA 3DG7A 4C65A 3KTSA 2BY1A 9XIAA 1MDRA 4MNMA 2FTPA 3L5LA 1FWBC 1RHCA 2Y24A 3VIPA 3GTNA 4XBSA 2CBVA 3R10A 3NQDA 5E93A 1XW8A 2EPKX 3OBKA 1F9CA 4UFJA 5GJPA 5LIXX 1YPIA 4GIAA 1HJWA 4XZ9A 1A4MA 4AF0A 1HVQA 1H50A 3TR9A 3OVQA 3QV7A 2IQDA 3UD6A 3VNKA 3GBDA 4O4WA 1O4UA 5D4YA 3E2SA 1HP4A 3IWPA 4UTMA 2WAGA 4CQDA 5H2ZA 2QCDB 1F61A 2NV2A 4S23A 3AI0A 5T26A 3URAA 4RW3A 1OQFA 2OGYA 1WKDA 3CUIA 4FLOA 3WMCA 5LHEA 1X1OA 5I3GA 4XBJA 2F9RA 4XZHA 4UFIA 4HVXA 1HP5A 1VJIA 3C52A 1RK5A 3IGUA 1XISA 1O66A 4FX6M 3ITLA 4C1NA 3EMQA 4LVAA 3NVTA 1WV2A 1K4GA 4P8VA 4AD1A 3HQNA 2WO5A 4LOCA 2WVSA 1Z9AA 3EWUA 5H6HA 2WBGA 4J7RA 4HPNA 2PDXA 4O1CA 2H3BA 1OT2A 5E70A 3KP1A 3QSTA 1PKLA 4FX8A 1QPRA 4NP7A 5ABHA 1L8NA 4GOAA 3KDNA 2VENA 5JBFA 3TFCA 1I2OA 1KBJA 3QGVA 3H2OA 2XM1A 1BLIA 4RNHA 4YTUA 3K4DA 3MKKA 4GY7A 5HQLA 3HOJA 1LBLA 5K9XA 4AZGA 1VHCA 2WWCA 3NQ2A 2ZA2A 2PEVA 2NUXA 3LMZA 3VNYA 4Z2GA 1EP2A 1V3JA 2YL9A 5D09A 3B0YA 2FHBA 2W63A 1KBLA 3MCNA 2FGBA 3W23A 3GVRA 4M29A 1XX1A 4R88A 3DKJA 1JDDA 4GQ0A 2C0HA 1EYEA 5CSSA 1JZ3A 1VJZA 4E2BA 3V35A 1JF5A 1B3XA 3FVDA 3VILA 3ES8A 3VKDA 3LD5A 1CYGA 1RBAA 3N19B 3LCXA 3S2CA 3MU7A 4D6FA 1ICSA 4WJ8A 1H7NA 4GY0A 5CGTA 2OQHA 4R3UA 3BAWA 2JALA 3BC9A 2HDJA 5CC7A 4FOKA 5CAHA 3CB8A 4KKXA 5CZSA 2GOUA 4C6NA 4WGHA 2QULA 1UP3A 2CITA 1DE5A 3HM7A 3ARSA 1JYWA 1QHPA 4Y9AA 4HB7A 3GIYA 4JFWA 3EX4A 4U5KA 4HNLA 1HNYA 2J27A 1WO2A 3F2DA 5K7JA 1OCBA 3AXKA 4UTHA 4AQLA 3S42A 1W5MA 4PFMA 3OA3A 2IPWA 5E6YA 1S5MA 4HT3A 4O14A 3WENA 3ARRA 4LRTA 2JKAA 1FDYA 3FNDA 4O0ZA 4DJFD 4FXJA 2GQAA 1RZMA 2G4FA 3SFWA 3OJGA 4NZ4A 1UR9A 3M46A 3M41A 1OM0A 4IX2A 1D8WA 4EPKA 3V7PA 3MVIA 4DF2A 1V93A 1MXGA 4AVFA 5LZLA 1JCJA 3F7JA 1K7XA 1F6PA 1FWCC 4IF2A 3PHAA 3N2BA 3RX4A 4DBSA 2C1HA 5CBIA 5A2BA 5BMXA 1GG0A 4TQTA 3K13A 3DH7A 3SRHA 2XFRA 2POTA 1NQ6A 4JD4A 1U1UA 3KE0A 3T6CA 1VFMA 4L1GA 3BG3A 4DXXA 4Z2JA 4AD0A 2AQOA 2YZRA 4I9JA 1NJJA 2VHLA 2P50A 4O57A 4DJDD 3NDZA 2H3DA 1KCZA 4HU8A 3AISA 4S3DA 1ISWA 2FPYA 3R12A 1EOKA 4NJIA 4ZMGA 4RV8A 3VPLA 2P8CA 1Z32X 1HJUA 4QEHA 3I6RA 3SQLA 4BI6A 2EPHA 5TF0A 1GVOA 2EXOA 3ITOA 1N82A 1IYXA 1QI5A 1CDGA 4MJMA 3W84A 3ENLA 2NQZA 4US5A 2PP1A 2XHYA 4DAIA 1YE4A 3P8JA 1SFJA 1K02A 3WLLA 2XUCA 3EX6A 4GVFA 2JIEA 3QOMA 3WDRA 3BLOA 4XB3A 3W9ZA 4ROPA 1GYLA 4GYFA 2Z2UA 3Q4DA 3PSWA 3W88A 5DMNA 4NZFA 2WMKA 1BSLA 1UD3A 3NGFA 2BY0A 4ZODA 1JG9A 3ZWTA 4IIFA 3URNA 3FW6A 3A22A 1VIWA 4QDWA 2GVYA 2X0YA 4RDZA 5A1AA 3PZMA 1M7OA 3B9OA 2AL2A 2VKZG 1DORA 1EJVC 1XLCA 3AUJA 1VPQA 1WDPA 4PTXA 1EL3A 2OELA 4IPLA 1N7KA 1AH4A 4IGNA 5XIMA 4IISA 5LIUX 3D6NA 2VRKA 1BVWA 5BW6A 2DZPA 4OGZA 1TWZA 1U5JA 3VTRA 3CH9A 3P60A 1AW1A 2QXWA 2DT2A 5CPSA 3VABA 4LU0A 3GXDA 2I9UA 2P10A 4OBSA 7CGTA 4CD7A 3GO2A 3DFHA 4PTVA 4O1EA 2ZE3A 4KH2A 2C7FA 3L2MA 3NQCA 4C6OA 4H01A 1E9LA 5HBFA 3UEQA 3W1QA 4B5TA 1Z69A 5M5DA 4O11A 4ZQMA 3M16A 3GDLA 1RQEA 1JDCA 1CXHA 2OR2A 2Z0IA 3U0HA 4N9BA 3H21A 2DZAA 4B92A 1A5SA 3FA5A 3Q67A 3EA1A 2PAJA 4Y8FA 1I8JA 2FZNA 5FEXA 3QKEA 2VYOA 3P8IA 3H23A 3VU2A 1B9BA 1TRIA 3THUA 1U5HA 1Y7VA 1AJ2A 1X8FA 3CB3A 4CCCA 4GACA 4LRSA 2AL1A 4M5PA 1IXPA 2WSKA 3TA6A 3LNPA 3UFYA 5J5RA 1LWJA 5J5DA 4Q8OA 2PGWA 3MHFA 3WF1A 3VKBA 2HROA 1FVPA 4ML4A 3BLPX 3CJPA 4HBKA 4HOWA 3UJFA 2HVOA 4D6EA 2IXVA 2O9PA 1YTKA 3LHWA 1EGMA 1UUQA 1FY6A 1UD5A 3IAPA 3IEBA 2BASA 4JIPA 5HJLA 3GH7A 3H8AA 5MKGB 4PRRA 4LEFA 2EG8A 3PZOA 4M1RA 2J6XA 4MM1A 3CUGA 4H4IA 4LT9A 3WJSA 2PTZA 1T7LA 3UZJA 1J0JA 2RGLA 3M5ZA 2QCMA 4RDVA 2CW6A 5GNXA 1EBHA 4UTWC 1P0BA 3VM5A 3S0CA 2ALRA 1Q8AA 3FA4A 3HN3A 2FZBA 3WD0A 5G4WA 3A4JA 4UTUA 3HZ3A 4JCMA 3DFPA 2OX4A 3PNZA 5EU9A 3FJ4A 1REQB 2X2YA 3K46A 3MI6A 1VZWA 3WFLA 5I07A 3H55A 2VX7A 3WQWA 3APGA 5A6JA 3CWOX 5G4HC 3AUOA 3MKVA 4LW7A 1VCGA 2DVXA 1MMFA 1UC4A 3EZ4A 1LOQA 3N9RA 2CNCA 4AAJA 1A5CA 3EOLA 1KW1A 1QFEA 2GYIA 1IXOA 2CXGA 1XIHA 5F2LA 4JDYA 2AL2B 3RITA 3ZWSA 5JXQA 1YNQA 2XH2A 4QG9A 4I8DA 1G7UA 1FCVA 4UC5A 1T99A 3QHMA 1J6PA 1WXYA 1H5VA 3CGTA 4JNYA 1LRQA 2HEJA 9RUBA 2QT3A 4UQAA 4XAYA 2WK2A 4OUEA 4HU3A 4HMDA 4NL1A 3FGCB 4BQ4A 4DBUA 4PEKA 1SJBA 1ONRA 3HV9A 3UCDA 5KSWA 3UQNA 3UY7A 3ITTA 2QCEA 4WDWA 3GTIA 4FF5A 2O9TA 4DYEA 2Y62A 2NLYA 4R7JA 4CNPA 1V6WA 2GUYA 2GJPA 2PU1A 3GW0A 3U4FA 3VC5A 3WUEA 2ZX7A 3KZPA 3C86A 3WLRA 4PMXA 3MI2A 3RM4A 2A0NA 2QHAA 4W4QA 1QWGA 3UXKA 1H7RA 3PBVA 3TJ4A 2HQAA 2NLIA 1OYAA 4ADSA 2JBMA 2PDPA 4AHQA 2XSBA 1P4CA 3RYSA 3S47A 3UGVA 5FSEC 2A85A 4UUIA 1TTIA 2WB5A 2GZXA 1W5NA 5HNRA 3TWAA 3D47A 1A3WA 5FAJA 5ABEA 1VP5A 5LNWA 1E9YB 4KRZA 1E6PA 4IIEA 2OOFA 1R3SA 3SCRA 4OHQA 1KCLA 1PDZA 4DJDA 3MI3A 5RUBA 1I0BA 1WB0A 3E6EA 4TVUA 4ES4A 2VXNA 1FWWA 1XICA 4O52A 3T9PA 2ZXAA 3T0DA 4MTVA 2JQXA 4ENLA 1F07A 2RDTA 5H1WA 1KBKA 3DENA 3THQA 2FHFA 3QF0A 1E9IA 4L56A 1HKMA 4GI9A 1O6IA 1IR2A 3QHOA 4GI8A 3ABRA 3AZTA 3AALA 5F1UA 1A80A 3PBUA 4WCJA 3DG6A 3CZ8A 1QCWA 2Y8VA 2VGIA 4MY1A 1TPB1 3I65A 3V5CA 1F76A 3LBMA 2XN2A 1XYMA 4M8UA 3W7KA 1WXZA 3GTXA 3U2ZA 4X9YA 4TX9A 2AAMA 4LBRA 1QO5A 5AYYA 1XCFA 4DPPA 3UESA 4Q4SA 2PDJA 4H3DA 4REQA 4JX6A 1IZJA 3NO1A 2BFGA 3LUTA 4JTEA 3FYYA 4H8HA 1RCQA 2J7BA 3CWNA 4QNWA 1OFRA 1OHLA 2FLIA 3GAYA 1HZYA 2YYTA 1KKRA 2P3ZA 4NUWA 1KRCC 3SCWA 4ZXOA 3LCWA 3BZJA 2EJAA 4ICNA 5I5RA 1BTMA 1K8CA 1R87A 4BQ2A 3Q58A 3GG7A 3MSDA 4GQBA 4IT1A 4FNTA 3QY8A 4PMNA 5ABTA 1VJSA 2QQ6A 4B16A 3OQEA 4NAFA 3QY6A 4D1IA 4PYSA 3ITVA 4XUYA 2I57A 1KBIA 3EMZA 2J7GA 3LENA 3N29A 1J79A 1FWTA 2GGEA 2QVHA 3E2RA 3WQVA 4RX0A 4LVDA 1JI1A 3W2UA 3PPCA 5AB3A 1CXFA 1XJBA 4LNCA 1F2JA 1M6JA 2O92A 2R8WA 4ACZA 3RRXA 1VD6A 3OEXA 5DN1A 1OFEA 2DJXA 1EIBA 2ZVRA 4FSAA 1V0KA 3GR7A 3IANA 4F9DA 4INFA 3EOSA 1LYXA 3PJTA 4IJRA 1XXXA 4JHZA 3WO8A 5D37A 4Y9PA 4PH6A 1ZSXA 3FJNA 3M44A 4QLLA 3SRFA 2P1FA 2OB3A 4B9ZA 4A05A 1TKKA 3T4WA 3QOKA 5DBUA 1O5RA 1RA0A 5HXMA 2HE5A 5A94A 3L68A 5FF4A 1SZFA 1HT6A 2OEJA 1DWIM 3W0KA 2VJXA 4MIMA 3CO4A 3CPRA 2BGNE 1J93A 3EDEA 4YIWA 1XKYA 4GO8A 4PB5A 4R34A 2QCHA 3VIJA 4BEQA 4Q8TA 5AC8A 2OZTA 5C0QA 4ZTYA 4ZB2A 1UPMB 3IIZA 4KBXA 1FWNA 2CWNA 3C0JA 3KDOA 1HJVA 3AU2A 3IRDA 4ZQNA 4A3HA 1QBAA 5IM51 4S3KA 3NZ1A 2GUBA 1U2YA 2P8BA 1R2TA 2GUUA 4YMZA 3SCTA 2Z2BA 3R0UA 1D7FA 4KWVA 3ARQA 4CGTA 3N4EA 2VGGA 5BRPA 4LALA 2DW7A 5E6ZA 5J04A 4XISA 1HTIA 3A3XA 2GQ9A 3LA4A 3OLIA 4HHMA 4B3ZA 4CD4A 4PN2A 2A21A 1YE6A 3NPWA 1YADA 2DSWA 3H12A 5HANA 2C1IA 4JTHA 4Z0SA 2BMBA 4PRTA 1CENA 1EEPA 2YDAA 4H9MA 4UTTC 5H8UA 4HYRA 1KM2A 2WMIA 4Z1CA 3VMNA 3I6EA 3M5YA 3CTTA 3TKFA 3FEQA 3WEOA 4F66A 3UPMA 2VGBA 2VMFA 4S3FA 2ZRVA 5EYWA 2XVLA 5A8QA 2P76A 1V3IA 2HV5A 3BICA 3PTQA 3M0XA 3LTYA 5XIAA 2QIWA 4F79A 2F8QA 4YTSA 5HR7A 1W1VA 4ZE5A 3A47A 2G37A 2X42A 3NOYA 2R1MA 3SRDA 1R5YA 2E5BA 1WNOA 5D2TA 1RJRA 4UXDA 1NDYA 1H7PA 5D9MA 3EDKA 1NWTA 4ZOBA 1L2QA 3SRKA 4UB9A 4MWAD 1V3HA 3WNLA 1O5XA 3OIXA 3EXSA 3BV7A 3P62A 2XZ7A 4FHAA 3WZ0E 2W61A 4NILA 1C7TA 3O8AA 3ITXA 4CNNA 3MCMA 1M5WA 1W54A 1ZAJA 3W1PA 3QV8A 3W81A 2G3FA 1U33A 2E8YA 4W7VA 5A95A 3AROA 5TQLA 1ZCOA 1ZBCA 3M47A 3PZUA 2WJFA 2VEIA 3CHFA 3RGTA 1KD0A 3B9EA 5D2VA 1D3GA 2BHZA 1TX2A 2YL8A 5EL1A 1ME8A 1KO0A 4OBTA 4PB3A 3WYZA 4ICCX 1PKNA 2F2KA 4G2DA 3N2TA 2G8ZA 4LAOA 1GW9A 1U30A 2PDLA 4IQJA 1M7JA 6REQA 1WQ5A 4AW7A 3AICA 3PAJA 5HUOA 4AUBA 3WF0A 2ZICA 2QMKA 1PIIA 1N8FA 4GVIA 2AMXA 3KUMA 1CBGA 3PBGA 2ISVA 2YL5A 3UJEA 4MDPA 8XIMA 1W91A 1IF2A 2NVDA 4KRUA 2WMFA 2GDUA 4ACYA 1JYNA 2F61A 3PZQA 1QJWA 3WQCA 3FXGA 1A5UA 3WLJA 3UPBA 4CQ8A 1N55A 3EEGA 3DHFA 3VK5A 4R33A 4ILSA 1W6TA 1OG6A 3V3WA 2A1YA 4JPGA 1G4EA 1NH6A 1UW9A 4GUFA 1FQ0A 2VRQA 2PRHA 2TPSA 3W7MA 7TAAA 2J78A 3SCOA 1UWSA 3CQKA 2ZCGA 1J96A 1DL3A 1XGDA 4A35A 4HSOA 3TEVA 1E0VA 2WCAA 2NQHA 1JEZA 3KOXA 3CAKA 3BG5A 4RJEA 2QJGA 2PDMA 2HXTA 4G9PA 3GFXA 4H8VA 1HL9A 3W4RA 4CCEA 4AZCB 1OX4B 3I3BA 3K30A 3NQ7A 4DQWA 3B06A 5DRIA 3VGFA 3CIWA 3RF9A 3VOIA 4YL2A 4AF0B 1NDZA 4HZ7A 2CXEA 4AIEA 1FFRA 1SJAA 3WQ5A 1ZJIA 3P3BA 1N2VA 2QGHA 1V0NA 4DJFC 2ZZ7A 3LNMA 5C5YA 1H63A 3SURA 1VBGA 4G1NA 3VDGA 1IWBA 3T81A 5I78A 4L9YA 2VEFA 3NPUA 3OPSA 4DRSA 2VFFA 2PWGA 1K4HA 6PTDA 2IKIA 4QHRA 1VF8A 3BQ5A 3FDKA 1A0CA 2DQXA 3O0FA 2NQJA 4LFYA 4W9TA 1ODUA 3C0SA 2EEXA 1BXNA 4N02A 4JYDA 3QH2A 1CZ1A 4AWEA 1E1FA 2HVNA 1KCXA 4AZBA 4MJ2A 4IUOA 4Q3MA 3ZSSA 1LDCA 4WGXA 1BD0A 4UQCA 4HYWA 4FAMA 2ZC8A 1B3ZA 3GU1A 1QT1A 1Q6GA 3U8GA 1YYAA 2TAAA 3TC6A 3N73A 5HA7A 4L9ZA 4M7SA 1VPYA 4AZ5A 1QNVA 1XLKA 3WQPA 1RAKA 4N6FA 1JCNA 5AC7A 4ZFCA 4LTSA 1KXTA 4JHMA 5IFPA 2D0GA 4PEEA 1VS1A 4JBRA 2D69A 3SGZA 1V51A 2RFGA 3ZM8A 3H7UA 3CH0A 4OOZA 3NG3A 3UJ2A 3ZO9A 4DUXA 5AYZA 2CLOA 2GWNA 3AHVA 4A8RA 2OPJA 1DWFM 5GQBA 3VKAA 4RKAA 3L4YA 3N9KA 4LS1A 3M0HA 3M0MA 4LCQA 5CPMA 2YDQA 1IT7A 2VDHA 1H41A 2NVCA 2R94A 2XVKA 1TV4A 1KFJA 1EHAA 1Q4NX 1B4EA 3HU7A 4XAZA 1JGIA 4FR1A 1Z7AA 4A3YA 1US0A 2OT0A 1B54A 5C9UA 5I3JA 3ZVIA 1S2UA 3GRIA 4O4VA 3K2GA 1OK6A 3HGOA 5D2XA 4NKCA 2PURA 4JY8A 2ZRZA 1FWRA 4J5NA 4HMCA 5D9OA 4TOQA 2V69A 1NP2A 4NIRA 3T0CA 2GWGA 4GO9A 2IKHA 3AMGA 1TZZA 5AKQA 4FZIA 3IJIA 1I2PA 4AY8A 1KXVA 3FGCA 1QI4A 2J77A 5FJTA 2HWGA 5C7HA 1V6UA 3QHNA 1KKOA 4H7VA 4KGJA 3RCYA 1RBLA 3LSCA 2WM1A 3H4WA 4H9UA 4DB7A 5E9XA 1K8XA 1W2VA 4P7OA 4U4MA 2C19A 4EXAA 4UR7A 2CCRA 3G6LA 4UZSA 2VELA 1FP9A 4PUKA 1IHIA 4PCFA 4Z1DA 3PZNA 4PULA 5F4XA 4NASA 4Y9MA 3CC1A 4HQVA 8TIMA 1MI3A 3IGSA 2NUYA 5M17A 3P74A 3DXIA 5AHEA 5FJUA 1XCXA 2DORA 3TTQA 2DQWA 1RV8A 3A3WA 3S2LA 4ZSTA 3QN3A 4UNKA 3IRSA 2WBKA 3MDUA 5AHLA 3KXQA 1P7TA 3BLIA 4J1OA 3W6MA 3EWXA 3OLEA 1REQA 1OFDA 3GG0A 4L61A 3E49A 3UNDA 5I02A 3H2AA 3P81A 1JXKA 1H0GA 1LORA 1OCNA 1GVQA 4XIAA 1UQZA 4P8XA 4FOUA 4J2PA 3RCMA 4UFHA 3QTGA 4I9TA 3UXIA 4NHVA 3ZS4A 1JNDA 2MANA 4DJEA 1JDAA 3Q2DA 1BQGA 1O94A 4C7DA 3KBNA 1XH1A 5C6MA 3IJ8A 3S6TA 3IJ7A 4J27A 3EGJA 3S2MA 4K2SA 5HOSA 5FKYA 4NJGA 1XIGA 3WBWA 2CLLA 3CL7A 4EAMA 3GVWA 4Y2WA 1BG4A 3ZLHA 1TV8A 3AS3A 3LQGA 4PSPA 1OBAA 5CGQA 1HGWA 2NT0A 3NM3A 4CCZA 1OIMA 5REQB 4F40A 3L4XA 2EPOA 3O6YX 2H8ZA 4WSHA 2ACQA 3KL3A 4OT7A 4GCXA 1NQKA 5A8NA 4NF7A 4WDXA 3EMCA 1JZ5A 2ZRXA 2DZTA 4DAFA 2UY5A 2PLCA 3HF3A 3FEMA 2F7FA 2VC7A 3GNPA 4H9TA 3AIVA 3UG8A 3WX7A 2QDGA 4JFSA 4K37A 3GHSA 3B05A 4WF7A 3VC6A 1I1XA 5T9BG 4CD6A 3R5EA 2PTDA 1EP3A 4Z2KA 3M6DA 5L9FA 3FJLA 2CHRA 1IR1A 4UTIA 1XC4A 4BKNA 1UASA 3BZGA 1AW5A 1CIUA 3N2MA 1H4PA 1UR0A 3LLXA 4ERIA 1GK8A 3MV11 5DCBA 4O28A 4Q8VA 3KZSA 3VX0A 2X8RA 1XLGA 3TVAA 3EA2A 3H53A 2PP3A 4ZA0A 3BLLA 2FZ9A 3OVGA 1A5MC 4NJKA 5E0FA 3BV4A 1W8SA 3YPIA 1MW2A 5DELA 3CAWA 3A3HA 3GUGA 4FLSA 1GEHA 4W7WA 3RIKA 2F6XA 1E43A 3QZAA 3APTA 1P7TB 4J2MA 4GVGA 2VZSA 2ZRUA 4F0RA 1R9ZA 2BY2A 3L4ZA 1RLDA 3AXXA 3W1UA 4MSSA 2Y4SA 1KQYA 3EPNA 3L21A 4DO6A 3QR3A 1S3TC 2YGYA 1XP3A 1AFSA 3EWYA 3C3UA 3U4AA 1MXSA 4PZVA 1JD9A 1Q5MA 3UZYA 5EMUA 2YCIX 3G8RA 1AH0A 3WD2A 3WQGA 3ABSA 1TTPA 2PBOA 3W27A 4XZLX 4GC4A 5DT5A 4DEFA 2Z28A 3KRSA 3LI1A 2G96A 1FH9A 2DGAA 1QPNA 3W7QA 1NF7A 3KOWA 1EZWA 5FJIA 3NPXA 4E5TA 3NSNA 3TYEA 4YS1A 4YXGA 1HJQA 3WJZA 4GQGA 1WKEA 4MYXA 2G50A 4HNTA 1D8CA 1WUFA 2OU4A 4G7FA 4XD6A 1B4KA 3AIBA 1G6CA 2QF8A 1AJ0A 3CPGA 3XIMA 4L65A 3U3HA 1WUEA 3V0UA 4BFAA 3BE7A 3R94A 1Q8JA 4OZOA 2PGEA 2D20A 1FHLA 3ARVA 1FCBA 5E0KA 4A8LA 1KM1A 2OKTA 1DJWA 2AGTA 3FVMA 2PDBA 2VZOA 3KOFA 3EWCA 2E68A 1NARA 4REQB 3NDYA 4C6KA 1G4SA 1G0CA 2A3BA 2VEGA 4GIYA 5JH1A 4FB7A 4JQ3A 3F4DA 3HG3A 2I14A 1KR0A 1F4HA 5FF3A 4HSNA 1SZRA 3DHPA 1PEZA 5U4NA 4TR9A 2QPUA 3TONA 2OGJA 1PJ9A 1XQKA 2HK1A 4CD8A 3AYSA 4IMDA 1W3HA 4G5DA 1GPWA 3FKRA 3EYPA 5C8BB 3R11A 1RP9A 5HUPA 2XGZA 2EKGA 3U6WA 4E0CA 2WLYA 3PG8A 1L6SA 3G3MA 1F5ZA 3AIRA 2ZZ1A 4JTTA 4PTWA 1OYBA 4KF1A 1RJPA 3GC5A 1VB9A 4OOUA 1IGWA 4O1AA 1B1YA 2YA2A 4LAMA 1WBHA 4UBPC 2E9MA 2IUZA 4YHEA 4PUMA 1AQMA 1EGVA 5FAGA 3TW7A 3VIIA 3BLDA 3PBMA 4O0KA 1K9EA 4WKHA 1EWEA 1NP0A 4NAEB 1OSEA 4NI8A 4TV5A 3RNDA 4J35A 3B03A 4C5YA 2DIKA 4LYPA 2GGIA 4JYEA 4UFMA 4C90A 1RY0A 2CYGA 1JUEA 4GY1A 1GGOA 2QUTA 3MQTA 2ACSA 3E96A 4GZJA 3S9YA 2RJHA 4Z0JA 1OX4A 5FJRA 1CGXA 3VYLA 4AZCA 2AAAA 3UWVA 2PBGA 1F73A 3VINA 3ZJ7A 3LBOA 2WC7A 3TQKA 2YB4A 4GXWA 4ZO9A 4IIBA 4PCSA 5CPLA 4FS9A 1PPIA 4JEQA 3EX2A 4L1XA 2HE8A 4FPSA 4AHPA 4NXSA 3PULA 1SFSA 1TJRA 4GNJA 4FIRA 2BOEX 1UOKA 4A3QA 4Q8PA 4FLQA 1PX8A 1G9HA 4LYQA 1UJPA 4GC3A 4GQRA 2OZ0A 1FA2A 6XIAA 1DXEA 2V3DA 3EAUA 3F5KA 3SGUA 4MWAC 1GYMA 1DQWA 1J18A 1C8YA 1TV7A 2V38A 4IP7A 3AS1A 4DPQA 3VI2A 2VL4A 2WHLA 4KW2A 4IG2B 4BI7A 4GZEA 4JIEA 3TSBA 2J25A 4LANA 3WDPP 2YFNA 4XZBA 2EBNA 4RPPA 3QBUA 4IIDA 4QDPA 1T96A 4W88A 3E38A 2PD9A 3HTWA 4QE1A 5C9RA 3QV6A 4WJXA 2IKJA 3UU0A 4C1NB 3LB0A 3CS2A 1QW8A 3WCZA 4DYJA 2E6FA 4WK9A 4D1JA 2A79A 2BDQA 4Q4PA 1HJXA 1DTUA 3HFTA 4HCDA 3FOKA 7REQA 1RUSA 1EUNA 3NGJA 3NYDA 4RPQA 5FF2A 4QAWA 4C6QA 3L67A 3AMCA 3MTWA 1Y5VA 3F4VA 3TMLA 3QC0A 1W1TA 2YR1A 1XYZA 5MKGA 3FLUA 3URBA 4X9SA 5A8OA 2XIJA 3PY2A 3TYDA 4W86A 4Q22A 3FKKA 1B57A 4TV6A 2XH4A 3G1SA 1ISXA 2V9DA 1F6YA 3CL8A 1DHPA 3RILA 1EEXA 1MUMA 2PFHA 4EOUA 3FHQA 3HGRA 3MHGA 1F3TA 3JZUA 4XZIA 4QLKA 1K1DA 4D8ZA 3B8DA 2ISDA 2NW0A 5D32A 1JRBA 1US2A 5C9ZA 4ZOEA 3RX3A 5AC4A 3C61A 4HGXA 3R13A 3PANA 1HJSA 2CLPA 2WKJA 2BWGA 3QZEA 2XIOA 1W9DM 2A3HA 3OTRA 4GG9A 3EB4A 3GLCA 2ZZ2A 3VOJA 1TUFA 3LEPA 3GIPA 4IZGA 2Y2WA 1ZL1A 3VKKA 1W5PA 3MP3A 1JZ7A 4MFDA 1NWSA 1ZJHA 4N4PA 4RR4A 1K03A 1BQCA 3K8MA 1X97A 2VUNA 5KITA 2PLMA 4MOZA 1S39A 4HK6A 4CNUA 4HA3A 4EPBC 1XBYA 2QS8A 2QJNA 4X61A 3KVMA 4FI4A 2J7HA 3O06A 1ADOA 1TPFA 3ME3A 3TQVA 1LLZA 3L4TA 4IM4A 3W38A 4GI4A 3IIPA 1JULA 2HRWA 4YTTA 5DBTA 5JQ9A 4H04A 1E6RA 3DX5A 3GC4A 3FX4A 3P6LA 3QQ1A 4HNOA 5AHFA 5CSRA 3M6YA 6ALDA 3NQFA 4RDWA 4WKAA 3IVTA 4GJIA 3TMQA 3V4BA 3W7LA 5CZ0A 5AVNA 3H7RA 5M2FX 2QVNA 2V3FA 4XV0A 3VGDA 4UOQA 1TWDA 3GXIA 5CG0A 1J2BA 2HCVA 4IMFA 4PSRA 3WUGA 3OGRA 1C3FA 2E1DA 4LUSA 3UG5A 3ZZ1A 1A50A 4GRSA 1EJRC 3EBVA 2JGQA 3TK7A 2I9EA 2QCLA 2PZ0A 2OLAA 3STFA 1XBZA 1BAGA 1ZP3A 4F0MA 1E0UA 2W79A 1EDQA 1W1PA 3W7JA 4Q8UA 4EX4A 1E6SM 2BS9A 1FHDA 2TMDA 1W3IA 3DN5A 3S5YA 4S39A 4MJZA 3RDKA 2QV5A 3SN0A 3S8HA 4MB3A 3MANA 1GOMA 4LUJA 4PUEA 4R85A 4M81A 2CBUA 4S3EA 1SW3A 2C0AA 3MUXA 2J75A 3BK0A 4QJ3B 3WFZA 2VGFA 4X2RA 3P80A 3RFAA 1XGEA 2FIQA 1LOLA 2OOGA 3WH6A 3ARZA 3PUOA 4C1LA 4B2DA 5F2IA 1PBGA 2AKMA 2Z27A 3LGEA 4HP5A 1RJQA 2O7SA 4XZNX 1TCDA 3VCCA 2PUZA 1TJ2A 1IZCA 1AMYA 3ARWA 1KR1A 1VPXA 1BG9A 3MJMA 2W9MA 1S2TA 1SZNA 1LM1A 5CJMA 1E3XA 1CXKA 1QATA 2PF8A 2D2JA 3L4VA 1GEQA 3QFEA 4DN1A 3VX1A 3UP8A 1TV2A 1C9WA 1QI0A 3BXWA 1KB3A 1UCWA 3MBFA 5FI8A 2BV9A 2ZQ0A 5LA0A 4D6IA 4LBSA 3DBPA 3M0VA 1UWUA 4KCWA 1S1RA 3RMEA 1X6UA 3MP4A 3ORWA 1XLMA 1TUXA 1EJUC 3BOLA 2J9YA 2QDHA 3MPGA 4LJ3A 4XD5A 2QPXA 1EKOA 1DOSA 3AJXA 4XK2A 2XDFA 4R9OA 4O50A 4KETA 1U1HA 3H2EA 3M64A 1F8MA 3ZSTA 1VYSX 1QNPA 1HW6A 3W1MA 3VDCA 1ISZA 4S3GA 2PDNA 1WKFA 4BZYA 1PCWA 3WMBA 1F4AA 2CZ5A 4J3VA 4XAPA 5ECVA 2GDVA 1KV8A 3ATYA 1OVDA 3QXBA 4RUBA 3BAXA 3GSMA 1OCJA 3I4EA 1D3HA 4J3TA 2GGGA 2TODA 3PNUA 1OGGA 4H9YA 1E6ZA 3KTXA 4GKLA 3W70A 1JGMA 5EBAA 3CNYA 4W87A 2WKLA 5AZ1A 4DHGA 2R1PA 1Q2RA 3T42A 2YCEA 1WOBA 4ZCWA 3RR4A 4DWSA 1MXDA 3D3FA 3QSRA 3RPTA 1EDGA 1KM6A 4F4RA 1VGAA 3STCA 2DEPA 2Q02A 3EB3A 4PTNA 3PZ9A 1LCOA 2J8FA 4H1ZA 1VFUA 3E1F1 2J4GA 2NXHA 1PTAA 5I3KA 3LN3A 2BHUA 1BXBA 1MO0A 2KAUC 4FNUA 4IH3A 4QFUA 1P6BA 3EPOA 2VOTA 2NX3A 1H7OA 1UJQA 4A2RA 2C8NA 3OIHA 5L6UA 4LY4A 3ARXA 2CBJA 5CC6A 3G1VA 3C0QA 3PPGA 4KEMA 1QNSA 2J6VA 4MLJA 5EY5A 4TVDA 3UJRA 4WJEA 3WLOA 3EX1A 2PWHA 1OF6A 5DMLA 4LUSB 2WJEA 2FZ8A 3GDBA 3NQVA 4M6QA 4JL1A 4RZ6A 4QE5A 3PBYA 4O54A 4EIVA 1TELA 3NOEA 5A69A 1TWSA 3WF3A 3VOGA 3AMKA 3SFKA 3LTPA 5BRBA 1J0IA 5J8LA 3I7QA 3QPZA 3I68A 1KLZA 1YNYA 1FHVA 2VD9A 4HJWA 1ZTVA 2V2DA 3I10A 3SY8A 1BYDA 1AK5A 2GQ8A 4LV4A 3CQ0A 4XKMA 2CKRA 4C6IA 2W67A 4NAFB 6TIMA 3T0TA 4PC8A 2I5