1RY0A

Structure of prostaglandin f synthase with prostaglandin d2
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
319
structure length
319
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structure of human prostaglandin F synthase (AKR1C3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 118
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ry0A00
3WG6A 3WBYA 3CAVA 3UGRA 3GHTA 2A79A 4JTAA 4XVEA 2HDJA 5JH2A 2BP1A 3CAQA 4GABA 3WCZA 4NKCA 1X96A 4L1WA 4DZ5A 4XZLX 3ONCA 5AZ0A 2PDGA 2IKIA 4JTCA 3S3GA 4XZNX 3H4GA 3H7UA 2HVNA 4PRRA 2HE8A 4PUUA 4JIRA 1JEZA 4WEVX 5AZ1A 4XZIA 1YNQA 2PDUA 5DANA 3M0IA 1S1RA 2FZDA 1RY0A 3D3FA 2I17A 1AZ2A 4WDTA 4PUWA 2PFHA 3LEPA 2HV5A 2PDBA 2FGBA 3DOPA 1Z9AA 2IKJA 2F2KA 2PDHA 3VXGA 2ISFA 2PDFA 1LWIA 2ACQA 4LAUA 3UZZA 3N6QA 1X98A 4XZMX 4ZFCA 4I5XA 2PDMA 4LBRA 4YU1A 3R94A 4YVVA 4LB4A 5LIKX 5KETA 3G1RA 1GVEA 1Q13A 3LBOA 3CV7A 4YS1A 1Q5MA 2ACRA 1EL3A 3DN5A 1AFSA 2IKHA 4XVDA 2PF8A 2P5NA 2IPGA 2BGSA 4JTRA 3C3UA 1IEIA 4AUBA 1ZSXA 3LN3A 2I16A 3UP8A 3KRBA 4WDUA 3R58A 3H7RA 2FZ9A 3RX2A 4JIHA 5LIYX 1S2AA 2PDKA 3UG8A 4DBUA 1Z3NA 2DUXA 3EAUA 3B3DA 1PWMA 4QBXA 2IPWA 2PDQA 1OG6A 4F40A 3ONBA 3RX4A 5JH1A 4LAZA 4YVXA 3O0KA 1LQAA 2VDGA 1XJBA 3CV6A 3BCJA 3QKZA 3ERPA 1A80A 1RALA 3LZ5A 4JQAA 2WZMA 3R6IA 1ZGDA 5M2FX 4ASTA 3V35A 5LIWX 4H8NA 2QXWA 3UZXA 2PD9A 2WZTA 3LD5A 2IPFA 3MB9A 1ZQ5A 1S2CA 1X97A 4RPQA 3BURA 2PDLA 3FX4A 4PMJA 4XK2A 3Q65A 2PZNA 2NVDA 3BV7A 4FALA 3R8GA 4EXAA 4IGSA 2CLPA 5HNUA 1ADSA 2ACUA 3UYIA 2FZBA 1XGDA 2HVOA 4Q7BA 2FZ8A 4JIIX 1ZUAX 1IHIA 2PEVA 1MRQA 4XO7A 4QX4A 3BUVA 4LBSA 3V0SA 3UZWA 4Q3MA 1Z8AA 3GHRA 1US0A 4JQ2A 1UR3M 2IQ0A 4YVPA 4DBSA 1AH3A 1R38A 2IKGA 4FZIA 3LUTA 4IJCA 2PDIA 4GCAA 4WGHA 3P2VA 3EB3A 1QRQA 4GACA 4HBKA 1XF0A 3V36A 2IS7A 4R9OA 5HA7A 1T41A 3UFYA 2J8TA 3MC5A 2INZA 4GA8A 2PDJA 1YE6A 4H7CA 3UWEA 4JTQA 3WBWA 2HE5A 1PZ1A 4EXBA 4LB3A 4WDWA 3UZYA 1VP5A 1EXBA 4JQ4A 4XAPA 4WRHA 4FA3A 1C9WA 4IJRA 3LQLA 3V0TA 2DV0A 3U2CA 1AZ1A 3RX3A 1HW6A 2DUZA 2BGQA 1Z89A 3FJNA 4GQGA 3R7MA 2IPJA 4G5DA 4HMNA 3O3RA 4GQ0A 4PRTA 2PDWA 4PR4A 3GUGA 1J96A 1K8CA 1QWKA 1M9HA 3CASA 3M64A 4OTKA 2FVLA 1VBJA 2PDYA 3LQGA 4ICCX 2PDNA 1AH0A 4JQ3A 1PYFA 4QR6A 1YE4A 1S1PA 3WBXA 4GIEA 1AH4A 2ALRA 3GHSA 2PDPA 1T40A 2PDXA 1FRBA 3LZ3A 1PZ0A 5LIUX 3NTYA 1RY8A 1MI3A 2IQDA 3R43A 3R8HA 3LNMA 1HQTA 1SM9A 1MZRA 2R24A 3GHUA 4JQ1A 4L1XA 2ACSA 5C7HA 4WDXA 2C91A 3M4HA 1EKOA 2NVCA 4JTDA 1EF3A 4XO6A 3N2TA 3EB4A 4DBWA 3T42A 2R9RA 1PWLA 2INEA 3LENA 2PDCA 4FAMA 1YNPA 2PD5A 5HNTA 3F7JA 4MHBA 4XZHA 2AGTA 3COTA 3Q67A 2F38A 3V0UA 3CMFA 5LIXX 3G5EA 4QXIA 2HEJA
chains in the Genus database with same CATH superfamily
3M7WA 3HBLA 3F4CA 2YW4A 4HCLA 1W1YA 1AMYA 2QJIA 2X42A 1WUFA 4XVEA 1MW3A 4RDVA 1O95A 4F8XA 3N9SA 2YA0A 2YFNA 3SRDA 5TQLA 3WNOA 3WCZA 3G24A 2G50A 3KBWA 3WLJA 4GH3A 1IEWA 1UD2A 4XZLX 3FGCB 2XWEA 3TW6A 1POJA 2QF8A 2QS8A 2GL5A 3C8FA 3BAIA 4O53A 4LJ3A 4ZODA 3UF9A 3SRFA 1NTHA 3GU1A 4GYKA 3W70A 4K36A 3TZNA 3W28A 4F4RA 1U2YA 2FHFA 5DANA 3U5UA 1JCXA 3NQ2A 2Y8UA 1ZS2A 5AY7A 4X61A 5DCEA 5CH9A 3HV8A 2RUSA 2RGMA 2PURA 3UT0A 3PFRA 3BICA 3T08A 1P43A 3SURA 4WLCA 1RA5A 3O16A 3EOUA 3F2DA 3CHDA 3VDGA 4B5VA 5JMUA 3V16A 3N9RA 3FFSA 2YYUA 2CXEA 1QK0A 2VZOA 3L4UA 2DQWA 4Y7EA 1RK6A 1Q6DA 1PIGA 3SRHA 3T6CA 2FVMA 3CYJA 4I7UA 1Q6QA 2ZUVA 4M6PA 5TNVA 3G0SA 4O12A 1KR1A 4DM2A 1GGOA 4W86A 1Y8BA 3UWYA 4XUYA 1F73A 5C9UA 1YTEA 3MKCA 4IFKA 1J2WA 2Z29A 2X1SA 4KEVA 4BI5A 3W1TA 1TPDA 4NAEB 1RD6A 2C19A 1QPQA 3MDWA 3B3DA 3O63A 2D24A 1ME9A 1RXOB 2P88A 2WANA 3WLQA 1OG6A 2XFYA 4PB4A 2DW6A 2J7HA 2PLJA 4PFMA 1KBLA 3OBKA 3K4DA 4HN8A 3PNUA 4ZE5A 5CPOA 3N12A 1XXXA 1U22A 6REQB 3PTQA 3ITTA 2BDQA 5AHMA 3BL3A 4ZO9A 3S2MA 3BG3A 3F4WA 1JGMA 4JN8A 4QG8A 4OT7A 1XYZA 2VC5A 3PTMA 1A80A 2FMNA 1KXTA 1CEOA 4D1IA 2BVTA 2CCRA 2EHHA 2Q8LA 2DH2A 1WQ5A 3V35A 2OR2A 1DIKA 3S0CA 3C56A 1LOSA 5E1QA 1OX4B 1VRXA 4H8HA 1SJBA 3S2CA 4KWUA 3EX2A 4H1ZA 4DXVA 1W5OA 3P7YA 1EWEA 3WMBA 2CKSA 3VX1A 1BSIA 1O5RA 7PTDA 4ATLA 4S39A 4EAYA 2FPTA 1ZLPA 5CQ1A 3S1GA 4DN1A 3DU0A 1XS2A 4B5XA 1UMYA 5D37A 3VOJA 2YB1A 5A95A 3CUJA 1NY1A 3IIPA 4NIRA 3CPRA 3QRHA 1I2PA 2QCGA 4PB3A 2QULA 4IL2A 4H6KA 2D3NA 3TNBA 3DIPA 3KWXA 3DG7A 1S38A 2NV9A 5FJJA 2GVEA 4L56A 5I00A 1DJWA 3PBYA 4UWMA 2VGGA 4UZUA 3MV11 3C6CA 5E9XA 4XO7A 3BUVA 4O8AA 3AHYA 2ZRYA 3T1GA 3CQ0A 5ENLA 1HO1A 2Z2UA 5G1TA 2O7QA 3HO8A 3LUTA 4IMAA 3SCTA 1B57A 2JIWA 4HB7A 3O6YX 3M46A 3PJWA 4MDPA 1NH6A 1D9EA 3R0KA 4K38A 1JYNA 3GDMA 2W79A 1OFEA 5GPRA 2J7EA 4OV9A 1FH8A 1FWCC 1DJYA 5TF0A 2XDFA 4EVZA 2PBOA 4FLOA 3W83A 3WQPA 4E4PA 3FK4A 3ITGA 5CG7A 2ZX6A 1EJSC 3CM4A 3LSBA 1ZJIA 1O94A 4IXHA 1TVLA 4A3HA 2RGLA 3UXDA 5IM51 1QVBA 1GONA 3AYVA 3TR2A 3F03K 3TC6A 4NX5A 1Z42A 3C0QA 1EXBA 4XAPA 4TU1A 1H61A 1C9WA 4IJRA 4PODA 1YDOA 4ZB2A 5B7YA 4MF4A 1Z89A 1QHOA 5GNYA 3I68A 3IJ9A 3R2GA 1OCNA 4JPGA 4HOZA 4U3CA 1JXKA 2F6XA 3OW1A 4DO7A 2V5JA 4H6QA 3K5XA 2ZUTA 4LAOA 2TPSA 3NCOA 3GY1A 1SJCA 4LUJA 5SWUA 4Z17A 3AXIA 2RAGA 4MDOA 3QEZA 4Y96A 3JS3A 4LCRA 2WSRA 2E25A 3QYSA 1OB0A 1FDJA 4Q4QA 3LX9A 1RBOB 1E5JA 2HNHA 3GIQA 3TIMA 4DWSA 1V02E 3AFBA 5CSYA 1LBLA 4QTGA 2AKMA 3R8HA 4RJEA 3T2QA 3WQCA 2E40A 4AEEA 1RP8A 4E2BA 2YDRA 5I24A 4IMFA 1IR2A 1GUVA 1DE6A 1B3XA 1PE1A 4LYQA 1PX8A 1R3VA 3HQOA 1QI3A 1RQBA 1XH0A 1TWZA 4C6JA 3T2PA 3RF9A 4OFCA 5FAJA 3CMJA 5DRIA 3WNNA 4H83A 4FO4A 1VEPA 1AVAA 3U6WA 2QCFA 3P0WA 4AD0A 2R9RA 3WQGA 3S83A 1LP6A 3TVAA 1VLWA 1PDYA 1JJKA 2INEA 4YL2A 3UVIA 1UWUA 1JCMP 2Y5EA 1YBQB 3HF3A 4NAFB 1SJAA 4AZGA 3CZEA 3MSGA 5BWAA 2VRJA 3PZNA 3WNPA 3AZRA 4H4IA 1SZEA 2L5HA 3WN6A 1REQA 2J66A 1BGAA 3ZYZA 4WY0B 3U3HA 4KKXA 1PYMA 2BS9A 1NU5A 1XIIA 3TTYA 3W7KA 3D5HA 5C0QA 1XLHA 3NGFA 4IX0A 3SGUA 1Q8JA 3SFKA 4MWAD 2CBUA 5EBAA 1F5ZA 2PLKA 3LMYA 3B8UA 3BOFA 4OOUA 5AHLA 5IHSA 2EG8A 2OU4A 1ZAIA 2BVYA 2WM0A 1UP2A 1UD6A 3H7UA 2E67A 2VQUA 5CPSA 2RJHA 4MM1A 3M7SA 5DT7A 1F7BA 4WEVX 5AZ1A 3QV9A 1IZKA 1UG6A 3VGHA 3CL6A 1RY0A 4MPKA 1VS1A 4UC5A 1FWTA 1VHCA 1YKWA 2CIPA 5AVHA 5BMXA 3T4WA 2Y7GA 1PTAA 3GW3A 3W1NA 4Z2HA 2PPGA 5D9MA 3W7DA 3MDUA 3OIXA 3SN4A 4LS1A 1ISVA 1LWIA 2ACQA 3UZZA 1R87A 3NQ6A 4CCDA 4GX9A 4JHZA 1NWSA 1KWGA 3S9IA 3EEGA 1RJPA 1UA7A 3WUFA 1RBAA 3TYAA 3DG3A 4GXPA 4XD5A 2A1YA 4IPJA 3IPWA 4E4FA 1GVEA 1UD3A 3UU0A 1XIJA 4JNYA 3DFHA 1LDCA 1JAEA 3EXRA 3GRIA 3VNJA 2HZGA 5REQA 3S5ZA 1HP4A 5I03A 1J6PA 3H53A 1US3A 3N2CA 3T0BA 4L80A 2P5NA 4KH2A 4IMDA 3RJYA 3XIMA 4FXJA 4MSSA 4Z1CA 3KBMA 1H3GA 2ZX8A 3E96A 3CPGA 1YNYA 1M7PA 4EIVA 2FZ9A 4Q8PA 1XLFA 2XIBA 2NXGA 3H12A 1R3TA 2VR4A 2BTMA 2VELA 4RZ5A 3GC2A 3QFEA 2G5WA 3T0TA 3ARSA 3VMOA 4ALDA 3V1PA 1DIEA 3MA8A 2WZEA 2REQB 1TIWA 3QV6A 2E9LA 4C6KA 1R46A 3KTCA 1SO4A 5HANA 5HQEA 1F8IA 3N19B 4LC8A 2BFGA 3B8TA 2JF6A 4TR9A 1KCKA 4F0HA 2W62A 2YBVA 3PNZA 3G1VA 1R3SA 4NJGA 3VNIA 3UEQA 6XIAA 4NJIA 4ASTA 1OWQA 3LU2A 1L6GA 2QJJA 1LL6A 3C0SA 4AZ6A 1NP2A 1SO3A 2PWUA 3WNKA 1TYGA 1X97A 1LLOA 4PMJA 3VDBA 3DYMA 4XK2A 4E0CA 4OUIA 1PKLA 4BY3A 2QUUA 2J27A 2ZX9A 1KM4A 4TXEA 1XX1A 2QCMA 1W5PA 4UTTA 5CPTA 4JN6A 1V6VA 4KFPA 3A5FA 1XC6A 4HNTA 2WVVB 2Z2AA 4OWGA 1TPVA 2HVOA 1IIGA 1WZKA 4UCFA 3BLOA 1WOAA 1UBSA 2O9PA 4BJHA 4HPJA 3UJ2A 4JQ2A 3QF0A 2XFFA 1B2YA 3OP2A 5EU9A 1XG3A 1YTDA 4CUCA 2OB3A 2R8WA 2IKGA 4FNSA 3WQEA 3AXMA 1UWIA 4K8GA 4I7VA 1FCBA 4Z2KA 2BVDA 4YWIA 4HU8A 3WQ5A 4Q33A 4WOQA 4NI8A 4RPPA 1F05A 3SQLA 3URNA 3GXTA 1UWRA 3R12A 4HSNA 3AS1A 4Z08A 2ASHA 3BAJA 4M0XA 3B9EA 4K37A 2J8TA 1XGZA 3WKZA 3RGTA 5JVLA 3BMVA 3UWUA 1RQHA 2ZCGA 4UTUA 1CXEA 3PULA 5BOFA 1JPIA 4LYPA 4HZ7A 4PTDA 3H23A 3SO7A 3ALFA 4R88A 3UZYA 5EMLA 1V08A 3UWVA 1UJQA 1ZJAA 2BODX 3IJ7A 1EIXA 3V0TA 1EF2A 1W9BM 2CPUA 4LGXA 5I7GA 3U2OA 3UZ5A 5E9AA 3M0VA 1IXPA 1T99A 1VR6A 4LOCA 4CD8A 3TW7A 3G0XA 2Z1WA 1G7VA 1DL3A 2QW5A 3F5KA 1YQ2A 1GPWA 2PRLA 3NVDA 1EXPA 1MEHA 3AJXA 4OTKA 4NX0A 3VKCA 1F3EA 5FEZA 2ONEA 5G1YA 2PGEA 1S5VA 1HXJA 1ISXA 4X3ZA 3EPOA 3NPUA 1G9HA 3VMNA 4IMEA 3U5YA 1H7RA 1LORA 4KRTA 1S46A 4B5NA 1YE4A 4W8BA 1Y0EA 3N1AA 2ALRA 3QFWA 4MOZA 3UESA 3L5AA 3NGJA 3CQHA 5EFFA 1PL9A 4A3YA 3SY8A 2A3LA 4UFHA 3KDNA 1KWKA 1DWGM 2NXIA 1G4SA 4B15A 4L65A 2HS8A 2NQLA 3ITLA 8TIMA 2Z26A 3M0LA 2WVTA 5DELA 3S2NA 3TN4A 1GOXA 3MHFA 5DLCA 1I45A 3QR3A 1Q2RA 7XIMA 1BD0A 2VR5A 5IDZA 2ZZ5A 4UTFA 2C79A 3L23A 1VEOA 4PBFA 3U2ZA 1JL8A 4DAIA 3BLPX 1F8MA 4AMAA 4Z1BA 5CPLA 3WQ6A 1OM0A 3CL8A 3V75A 1NIUA 3VO0A 3MYPA 1UWSA 1NM9A 1CCWB 4A29A 1EPVA 5D38A 5A6AA 2GJXB 3WG6A 1RBLA 3IAPA 5TAOA 4FNUA 4AF0A 4HNOA 3VOCA 2BP1A 4KIRA 4BQ4A 5B80A 2E3ZA 4RXFA 2V5BA 3KVKA 4LALA 5JXQA 4GABA 1ESWA 1X96A 5FJPA 2P10A 1WAUA 4JCLA 5LXXA 1VBRA 3KP0A 3W73A 4DZIA 4AC1X 1SJDA 1EDQA 3SIMA 4K1WA 4DELA 3EA1A 3TW9A 2IKIA 5I09A 3M6YA 1VBGA 3GR8A 1SVDA 3WK1A 5H91A 4ES4A 4AD3A 2HVNA 1YDYA 4WJ8A 4WSHA 1FKXA 2G3IA 3TN5A 4H41A 2DIJA 1EH9A 4PUJA 4C6QA 4TV6A 3CHFA 1IXOA 4OBTA 5EB8A 3URBA 2IKJA 1O4UA 2WMJA 1LRQA 3VM5A 3CZJA 1A3XA 5H8PA 1UKOA 3XINA 2DEPA 4RLIA 4S3DA 4ZFCA 4CU7A 1E9ZB 3JUGA 3TK7A 4AD1A 2CETA 2E77A 1X6NA 4HP5A 4IHCA 3ZT7A 2WMKA 4JIPA 4C7DA 4GO9A 1OGBA 3SCRA 3W71A 3FY1A 4X2PA 1PIIA 2ZICA 1DV7A 5B7ZA 4MIMA 4D6JA 1J93A 1JF5A 1M5WA 3D3AA 1SO6A 4RR4A 4M1RA 3LM3A 1FFRA 3W7PA 5A6BA 4GIYA 1HUVA 1XKJA 3LHVA 5AYXA 1Q7ZA 3MMWA 2J77A 4JTKA 4FP1A 5G2WA 1BYBA 3HMCA 1XSJA 3SJ3A 4GNJA 4MB5A 4O4VA 4ROQA 2WC4A 4LV9A 1XV8A 3F1QA 2XGBA 3UNDA 1M7OA 1BQGA 4EK7A 3S2JA 3QPEA 5K4XA 3DFNA 4HMCA 5HQMA 1JD7A 4ZL1A 4JX5A 4UNLA 1VBHA 1ECQA 1K9DA 3WDRA 1U33A 2ZX5A 2YSWA 1N8FA 3QKZA 1JZ5A 4IP5A 3TQPA 2WZMA 4D1JA 5JQ9A 4HJFA 1QNSA 1VCFA 3CGTA 3SN0A 4H8NA 3MMDA 2ATMA 2X7WA 1X39A 2VC6A 2QXWA 3BSHA 4IFKB 3ARZA 2DZUA 3N2XA 1GVOA 3TTQA 2D2HA 5FL1A 3FX4A 1UR0A 4V33A 4HOXA 3R8RA 5C8BB 4AQLA 1ISYA 1ENUA 5KINA 3MCOA 1OQFA 3IS4A 5BW6A 3MZNA 5T26A 2JFEX 3VFLA 1SFLA 3OZMA 4UQAA 4EXAA 4IGSA 4FIRA 1DJQA 5BZAA 4AWTA 2YBUA 3CZ8A 3W9ZA 4ZSUA 5I3IA 2CLFA 1WE5A 3EXTA 4ZSTA 5PTDA 3OGRA 1IHIA 4X63A 2XHYA 1MRQA 3MO4A 1J9YA 1NWRA 3GDTA 3GXNA 5DMYA 3GX9A 2XH2A 4PSRA 3EB2A 2ADAA 2JK2A 4Q6JA 1P7TA 4Q8OA 1HKMA 2Y0FA 1MFUA 4YVPA 3GW0A 3M5XA 3GIYA 4HK5A 3UR8A 3IEBA 5JBEA 4JTHA 4F3HA 3TJIA 5XINA 2QJMA 5T8GA 1E0UA 1KLYA 2A85A 3UWQA 3SCQA 3FN9A 5DQPA 1JG9A 3AALA 1QI4A 3PUDA 2C18A 3WBAA 4W84A 4J3ZA 1PEZA 4Q7NA 1DQUA 3DHFA 2I5IA 1GEQA 3MUY1 1Y5XA 2BSLA 2OZ8A 3G8RA 3WBWA 4GYPA 3RU8X 5TBOA 3W7OA 4X9SA 1YPIA 1W9DM 1PZ2A 1VP5A 2NQ5A 5AYZA 4C90A 1M04A 4L7ZA 1DHPA 4O1FA 3VD9A 4CU6A 3GC4A 2IPJA 1ZP4A 4ZFMA 3JZUA 4MLRA 3MUAA 3BZGA 2DZSA 3HG3A 4S3EA 2LLEA 4DZHA 3VGFA 5LXEA 3QC3A 3CUGA 4I9AA 5G2IA 4KS0A 3GVVA 4KWSA 1FWNA 2ZC1A 4ZB0A 4TTUA 2PDNA 1AH0A 2HCVA 5D2XA 5FI8A 3THQA 4S3BA 1D7FA 3GXPA 1EOMA 1PYFA 3WLLA 3MSRA 3B8SA 4A3UA 2WHMA 1ICSA 2DORA 4IGNA 2X2GA 1QPOA 4C1LA 2FPYA 3PR2A 2D2GA 1TPH1 2OEKA 2OO6A 1V0MA 1B90A 3LNMA 3L4TA 2E4TA 2ZXDA 3CUHA 1EC8A 3CUXA 1AQMA 1KD0A 3GWQA 2EPMX 3WF3A 2VZUA 1EUNA 5FJOA 4UTMA 5JU6A 2BY2A 3VVGA 4ZXOA 2QPXA 3RM4A 3UR2A 3G3MA 3L21A 3EB4A 5IFTA 4HD5A 5LGZA 4DF2A 4S3JA 4C6LA 1FWSA 3ATZA 4MWAE 2WB5A 5C5YA 2W5FA 4DNMA 4JX4A 2ZUUA 4B3ZA 1JPMA 2B0MA 3NDYA 1GTEA 2DIKA 3M0ZA 1YW1A 1RPXA 5FESA 5AC6A 3TTSA 3W26A 3H7VA 3EWWA 4ML9A 5CZTA 3UCDA 3V0UA 1RR2A 2ZVIA 4C7FA 4DWSB 1ONRA 1D2KA 1M53A 3WBYA 1ZL1A 2V67A 1M1BA 3P82A 1V3IA 2ESCA 1ZB5A 1NOFA 3BLFA 4UTWA 5CGTA 4AVFA 1TR1A 5CC3A 2NWRA 2XYLA 3ARTA 5HQLA 4JTIA 4K3ZA 3GO2A 3WF4A 3DFTA 3PAJA 1KM6A 2XPKA 4H2CA 4AC7C 1CGVA 3E74A 4JTCA 2QPSA 5EYWA 3WH6A 2PWFA 3OVRA 3CQIA 2E09A 4W8AA 3MT1A 1M3UA 3GKAA 3AQUA 5A8OA 4CQBA 2E6YA 2JALA 2HQAA 4QJ5B 1EYWA 1E55A 2R1PA 2WV8A 3WD4A 1HFBA 3SQSA 3R13A 1UH2A 4FLQA 5A8PA 1REQB 1CGUA 2PA6A 1RUSA 5C2XA 1CB7B 2EQDA 2NQHA 4QE5A 3OG2A 4NZ3A 1K02A 1KTBA 3B9NA 2PDMA 5ABGA 1XG4A 3DFSA 1DWAM 1SU5A 4GNKB 1UD4A 3EOSA 5BRBA 1WDPA 3N2MA 3ZIZA 4ADUA 1V6XA 4UTTC 3RLGA 4XSLA 3C5QA 4QSFA 4QLKA 5GNZA 1HIZA 1XIMA 1D8CA 1WKFA 1KM0A 4KWWA 5U7SA 1LM1A 1L8PA 2HK1A 2IW0A 1AQFA 1B9BA 1W3NA 1MWOA 5HWJA 3W74A 4D6FA 5AYBA 2VT0A 2WXDM 3AHZA 5DRCA 2IXVA 4CNSA 4Q32A 1AK5A 3IRDA 1VBUA 1DWJM 5E93A 2XIQA 2GWNA 4QJ4B 3N2OA 1VQTA 3NIYA 4QBXA 3KOZA 2OO0A 3W0KA 2FPVA 4MNMA 3CL7A 4H7VA 1V03A 3CMGA 4J2MA 1J0KA 4ZTXA 3FOKA 2VFDA 3NSMA 4RKAA 5J04A 1TRIA 3NURA 5REQB 2QKFA 4GNVA 3LZ5A 2JE8A 4ERIA 2DZBA 4K7VA 1TWIA 4B2DD 1V0NA 2Y61A 1FHDA 4M24A 5LIWX 1E9IA 4OOZA 2WK2A 5HPCA 1GJWA 5KMYA 2B4GA 2ZZ2A 3ZVHA 5IBXA 3HPFA 3APYA 2PBGA 2TSYA 3I7QA 3N18A 1E4IA 1ISWA 4Y9OA 2GOUA 2Q6ZA 1PIFA 3ENLA 4XZBA 3S6OA 4FNTA 1PX4A 3OODA 4ORIA 3H8AA 4RNJA 2HXUA 3O6DA 1XUZA 2Y88A 3GG8A 3TJLA 5AC8A 4Q7BA 3W88A 1H60A 4M7SA 1TQXA 1K9EA 5M5DA 3HFTA 3AIVA 4LBSA 3BARA 1Y7VA 4TQTA 2CLOA 3C2FA 3RMJA 2O0TA 4XZWA 2IQ0A 3N6JA 1B54A 1GQKA 1E4MM 2FTPA 3M16A 3AMLA 1U5HA 4QE4A 1G6CA 2GVLA 4H8UA 5JIWA 2HVMA 5BNKA 5CCZA 1JFHA 1GYMA 1JVNA 5C9ZA 4JNMA 1XF0A 1QPRA 2OWXA 4REQA 1TX2A 3ABXA 5D02A 3AYTA 1XCXA 2D23A 2UY4A 1EIBA 1GK8A 1GOOA 1ONEA 4C91A 1EHAA 2Q3RA 2VGFA 2VQTA 4UFJA 1P1XA 1ZRQA 3GYEA 5ABEA 1OK4A 1PZ1A 3F4VA 5EBUA 2WQDA 2V81A 4QAIA 4L4OA 3QGKC 1XGEA 2DU2A 1O5QA 2CWNA 3TR9A 2FVKA 3GZ3A 1TVNA 2QDDA 2CZFA 1L0PA 2FZNA 4LVBA 1DXIA 5BXTA 1R9ZA 4FA3A 2FTWA 1Q6GA 2E68A 3LCIA 4UUIA 1NEYA 4MKNA 2VEIA 1RV8A 2D2JA 1PUDA 1W54A 2JEPA 1GHSA 3GVGA 4MYXA 2W6RA 1EPXA 4GJIA 2R6OA 4AXNA 2C0HA 2YLLA 1J18A 3VGBA 4LSBA 1EA0A 4HK6A 3OBAA 3I65A 3N4FA 2O4QA 4P5UA 5CC6A 2NQZA 3N13A 2OZTA 3VUPA 3STFA 1Q65A 1HO4A 3TX9A 1A0EA 4MJZA 5F4WA 3KCOA 4M5PA 5EFDA 2VZVA 3GU9A 2O9TA 3CZLA 3K8MA 3IJ8A 4XG1A 3H2MA 4S3KA 3EWZA 3BV4A 5HNNA 2YCEA 3UG3A 2V3DA 1FRBA 2ZUWA 3I4KA 1FWIC 1FUYA 2CC0A 5LIUX 1JUBA 3A4WA 5L6UA 2IQDA 4ZE4A 4MB4A 3LYEA 1W1ZA 2B7OA 1K7EA 1V0LA 2Q8XA 4UXDA 5DCDA 4W89A 3BZJA 5DT5A 4RV8A 4J3TA 2XVPA 1Z6KA 4XO6A 5GQBA 1B3OA 1JGIA 1PCWA 1O68A 4LEFA 1W3LA 3SSZA 3W22A 1F4AA 2O56A 3B4YA 4JKMA 3H2FA 5BYWA 5HBFA 2X09A 2GQAA 1GQIA 3L12A 1L6FA 1XP3A 3UGRA 3RDKA 1BFNA 3F2CA 2JKEA 4XIMA 3TSMA 3VC6A 3AYRA 1EC9A 5D2YA 1K4GA 1B30A 4QE1A 1KKRA 3UA3A 2QDEA 4J3WA 4C5YA 4AZHA 1LWHA 2GUUA 1VENA 4IG2A 3R1ZA 1HN1A 1LQ0A 1R2RA 3PUGA 3F5JA 2QUTA 4Q8QA 3FJ4A 1KTNA 1A0CA 5JUVA 3CTLA 3FAWA 3OOQA 1TWSA 4XZIA 4H04A 3THAA 1WAWA 4HYWA 3P5YA 4GI9A 4DI8A 1K7XA 3VCRA 3EX3A 4AF0B 2BLEA 1FQ0A 1HJWA 4AU0A 2O55A 2ISFA 2VFGA 4E38A 4J4KA 3N6QA 3OLIA 2YDAA 1KA9F 1TTPA 3VIKA 1ICQA 4DXXA 4JIQA 4KRUA 3P6LA 4I5XA 1H5VA 1W5QA 4WVXA 4Y9MA 4LBRA 1LF1A 1GVIA 4YU1A 1OEPA 2Z28A 5F2LA 4LB4A 3MUXA 4V2XA 4BK9A 3G1RA 5HR7A 2VFHA 3O9NA 3B0VC 1PKMA 1OVDA 3BVJA 1TV4A 3WJSA 4W7VA 3B4UA 2EEXA 3FVDA 5G1MA 3WD3A 4I90A 1OG0A 2WHKA 1J2BA 3AC0A 1J01A 3WMSA 3M0MA 1F2JA 2NX3A 5LA1A 1PBGA 1YPFA 4E4UA 3A4AA 2GSHA 3W7HA 4IM4A 1H5YA 4GO8A 1DYSA 1P6BA 2BY0A 2CKRA 3MJMA 4W9TA 4GGBA 1ZJHA 3I3BA 4US5A 1SZFA 1FWJC 1Q45A 1A5KC 3KWSA 4OBSA 3LHTA 2PUZA 2FKPA 1YHTA 4JOMA 2DZPA 2CU0A 3TV8A 2DW7A 2D20A 1JCNA 1NSJA 1CGYA 2VX7A 2F2HA 2G3FA 1KQZA 3GXFA 3ERPA 2PAJA 4GYPC 3WF2A 3TAOA 4YWSA 4Y8FA 2J9YA 4GZIA 3B0PA 3VZYA 2YGYA 4WY0F 4UTHA 2GJRA 1PDZA 3DI1A 4H9UA 2FQIA 2NSOA 1ZQ5A 3W7EA 1ONWA 4RPQA 1EC7A 2XIOA 2PDLA 3FW6A 4ZOBA 3TSDA 3I3EA 1KRCC 1V3LA 1EUAA 4Q4RA 1ADSA 3MUCA 1QI2A 1DHKA 1JUEA 2C1IA 1QNRA 1XGDA 4MZ1A 4RE3A 3DFPA 2P3ZA 4QDWA 1EJVC 1J0YA 3V0SA 1GT8A 3VD5A 1Q2SA 4QITA 4Z2LA 5KTLA 2C8NA 1E71M 3GG7A 3DKLA 1K8XA 3TC7A 4CLMA 3AXKA 3G1XA 1PKNA 3ALGA 1E1EA 1R47A 3SECA 4P8XA 2NLYA 2V2HA 3PWGA 4XKYA 1Z48A 2CLEA 3JW7A 1KC7A 5CJ5A 4GXWA 3LGGA 3G3DA 2A7PA 3ZR4A 4QISA 4QS5A 2WHJA 3RITA 1UWAA 1J5SA 3E3HA 5IDIA 2PTWA 1UR8A 1N8IA 1D3GA 1YE6A 4Q4SA 3PPCA 4DM1A 2C7FA 4FXRA 4EXBA 5HMSA 3L2LA 2VZTA 4L9YA 5HOSA 1EFZA 4X60A 4LX4A 1XLCA 1TMHA 2QAPA 1XRSA 3PSWA 2WKJA 2SFPA 3N29A 2Y7DA 5AYYA 3GYCA 3BLLA 2NT1A 5AKQA 3E6EA 3RN6A 1P7TB 2DV0A 3CS2A 4GRSA 1UA3A 1DORA 4UTWC 3ZWTA 1V3MA 1Q6EA 1MUWA 3GUGA 4H19A 5FCZA 1E43A 4LY4A 2PCEA 4M6VA 5K9XA 3FV9A 4PFHA 1A5SA 3K2GA 1X6LA 1OT2A 4GVGA 1U1JA 2RFGA 2DZWA 1QPNA 1T5AA 5D04C 1JCLA 1MMFA 1VYRA 5A6TC 1VF8A 1GVSA 1WZAA 4ZA0A 3OZYA 5FD0A 3NJ3A 4K39A 1Q6OA 1A0DA 2X40A 4O15A 5AVNA 4O1DA 4HHHA 1IV8A 5DBTA 3NEVA 3SB0A 3W02A 2J8FA 3KBVA 2QV5A 4DJED 2DT3A 3THDA 1JF6A 4TTGA 3AUOA 3GHUA 1VFTA 1FCVA 5C7HA 4UBPC 3N14A 4EE9A 4WXYA 4WSKA 3Q58A 3QLDA 3HQ1A 4NZFA 1UUMA 3PZIA 3FXYA 2ISWA 3KZSA 2BHUA 1A3WA 1A5BA 1XIHA 1OCJA 3PZUA 1YDVA 1YNPA 4M3PA 2VDHA 3L4WA 1HL9A 3IUIA 1OGSA 4D71A 4DYEA 3H26A 4DUVA 2EF9A 3K1GA 4QXIA 4CCEA 1OK6A 2ZE0A 3ARRA 1WPCA 2AMXA 2YZRA 3GKFA 3GHTA 2A79A 3PZVA 3GD6A 4XTDA 5I3HA 4JTFA 2YR1A 3MHUA 4JEQA 1CIUA 1N7KA 3B97A 4AZIA 3W07A 1AA1B 1QTWA 4PMXA 5TD4A 4M82A 1XCFA 1BTMA 3HGRA 3WMLA 1L6YA 2AL2A 4IIGA 1V02A 3KS5A 1D8WA 1CGTA 2NV2A 4N7QA 5ABTA 3H2AA 2ZRWA 4IUOA 1K4HA 4DY1A 4ZXLA 3FEMA 5G4HC 1FWEC 3EWUA 3JRKA 2NSXA 2VWSA 1F3XA 3TFXA 2J74A 1VPQA 4QAWA 1IF2A 3CH0A 4IIDA 1ADDA 3K8KA 4RCXA 3VMPA 1F74A 1VRDA 4UFIA 3LBCA 4JX6A 3KTSA 3VUSA 2I5GA 5J5DA 1W37A 3Q37A 4HSHA 2F2KA 3EKGA 2J88A 4LRSA 1V93A 3CLMA 1F6YA 2YCJA 5IBXC 2E8YA 5KEZA 6CGTA 4FIQA 3L67A 4TMBA 4BQ3A 3LTYA 3OHIA 3M9YA 4PL1A 7TAAA 2HPMA 1EJ7L 3F5LA 2V9DA 1VFOA 2WAGA 4MKSA 3ZO9A 1Q5MA 5A2BA 1EL3A 2BX7A 2PU1A 3R4IA 3UJFA 4LCSA 3PBUA 2IKHA 3TWAA 1DVJA 2PF8A 1HVQA 3L5MA 4KIEA 1QDSA 5FF3A 2OGJA 4LVDA 2ZOXA 4PBGA 3Q4DA 4JFUA 1ZSXA 1DWHM 2I16A 1E56A 3S2LA 3AWNA 4IFRA 3C61A 3GNXA 3ZS4A 3PPFA 2INFA 2FGZA 3E0IA 2E9MA 2ZRUA 1GW9A 3S6TA 2PDKA 3RLVA 1DKWA 4QNEA 1KFLA 3WDHA 4NRRA 3WH5A 2WOQA 3G6MA 1MQPA 4LEQA 1TG7A 3BQ5A 3M44A 3KE0A 1JZ8A 1SGJA 4MY9A 4PCNA 3MVTA 3QW4B 1XL9A 4HYVA 3LLDA 1F9CA 1XLGA 2P0OA 2WMFA 3CEUA 1I2RA 1CLXA 2YZ5A 4PEEA 4LS2A 3MSDA 4HGXA 1KBBA 2BXYA 2XISA 3G1SA 3LI0A 3QZEA 3LD5A 1CXLA 2IPFA 4POCA 2C13A 1TWDA 3HGOA 5I07A 1NP0A 1M65A 1ONXA 3PP7A 4PUEA 1JYXA 2BNJA 4FALA 3VIJA 5HJYA 3F4DA 2C6QA 3WQOA 1TJPA 1I9CB 2TODA 3EDFA 1H50A 2DPEA 1W8SA 3W1XA 1VPXA 1KV8A 4YYCA 3EKZA 4O19A 2J78A 2V6AA 3GTNA 3DGBA 1PB0A 2AQOA 1ME8A 2VD8A 3UYCA 3CUIA 4UCGA 1NJJA 3BAYA 4FX8A 4S2CA 1CTNA 4U5KA 4QG6A 4ZENA 1SR0A 4LQ1A 3T55A 1DJIA 2NUYA 1IEVA 2QJGA 2QMJA 2CLMA 2H8ZA 1JNEA 4I7WA 4NXKA 1UP3A 3ZVHB 3E12A 2OJPA 4GUIA 2X41A 4LUIA 3T7VA 4LVAA 5FSDC 1UMLA 3W29A 2Q02A 4L64A 5D9NA 1VFMA 3VTRA 5BROA 1T41A 3AYSA 1KV5A 1XQKA 5AHEA 3ZJKA 1LUCA 1CGXA 4UQCA 4R27A 4HPHA 1NFBA 1YX1A 3PTDA 3QKEA 1G69A 4RX0A 5CSSA 1GPFA 2XSAA 5CPNA 1NFPA 3S5OA 1EGVA 4RDWA 1ZFJA 5FACA 5HWMA 4WRHA 3VGGA 3LNPA 4CN4A 2D3LA 3MZ2A 5I0DA 2BXVA 3A64A 2JKAA 2DDXA 5HJLA 4DPQA 1XIEA 1AJ2A 5DBUA 4PA8A 5A8NA 4G5DA 3GVQA 4TMCA 1FWHC 3N3MA 3NQ8A 4PRTA 4DJDD 2E8ZA 4U33A 1H09A 2WSKA 3PS7A 2H3DA 4REQB 2WZHA 1UPPA 3AISA 3IUHA 4K8HA 5I2UA 1R0MA 2X0SA 1JI2A 1M68A 1T8XA 3W7IA 4F48A 1V4YA 3UD6A 3WBXA 1R5YA 1W3TA 1E4LA 4AX7A 2FDSA 2XVLA 4YTUA 3LRKA 2UZ9A 4NU7A 2NX1A 3GLCA 3MMTA 2GZXA 4GUFA 3SCNA 3SCOA 3EEZA 5EL1A 1BPLB 2R24A 1CBGA 1SUXA 4L1XA 1O12A 1ML1A 1JCJA 1I2QA 1D3HA 1G7UA 3C0LA 3KBNA 3PG9A 3CU2A 3GR7A 5CJNA 2XVNA 5F4SA 2WNNA 1W17A 3CAKA 3HQPA 3MUIA 3HPZA 3UG5A 2Z0IA 1QOPA 1DTUA 1AQHA 3DENA 1DJHA 3RLHA 4JYDA 1XDLA 2YDQA 1TZZA 3P8IA 1SW3A 5TIMA 4CEUC 1B4EA 3GH7A 2QPUA 4DO4A 3SCSA 3RPMA 1TE6A 3A3WA 5HMEA 2Y8KA 2AAAA 4AHOA 1RK5A 4GIAA 1EP2A 4ICMA 5LIXX 3FHAA 1S2WA 3AHVA 1VFHA 2HEJA 3AMCA 3QGAC 4AMCA 2QCDB 1J12A 4PTXA 4RXGA 1HL2A 2GVYA 1PJ9A 3N17A 2X05A 3WJZA 4PTVA 1JNDA 1W3KA 4IP4A 4NVTA 3V4BA 4DQWA 1OGGA 2Q71A 1GOIA 2XUCA 3S1UA 2JF7A 2YDSA 3W1PA 1V6UA 1OHLA 2YLAA 3DKJA 1T96A 1I2OA 1TX0A 1Q6RA 2Z1XA 5JBFA 5CEWA 1LROA 3AIEA 2VURA 4GBDA 5LKYA 4XBKA 2YCIX 3EMQA 3P0XA 5HWNA 1XIGA 3DCPA 3OA3A 2R1LA 3SFWA 1UJPA 4N4PA 3HPXA 3AMDA 4UTIA 1TWWA 1WCGA 2GGEA 2CFFA 1UW9A 4YHEA 4WDTA 1F3TA 1E9YB 1K77A 4U5IA 4YPJA 1Z9AA 4LFYA 1BG9A 4PRWA 1P1MA 1Q6CA 3IIOA 4FX7A 1ZY9A 1HJXA 3RR1A 1LOQA 4Q4KA 1X98A 4XZMX 2CHOA 3EBVA 4A2RA 4J35A 3SQMA 4DJFD 3VIPA 4AEFA 4L4LA 2ZKMX 3GTIA 3NQEA 1VIZA 3ITCA 4IG2B 4PCFA 5D4YA 3CB8A 3TXVA 3DC0A 1R9XA 1FWWA 4DUOA 3WO8A 1P6WA 4GVIA 1YRRA 3BMXA 2DZAA 4XVDA 3ZJ8A 2B7QA 4XX6A 3THCA 1MQRA 1HJUA 1N82A 3VIHA 1S5TA 1FCQA 4L6HA 2WWCA 3E2RA 2NX9A 1ITCA 2R14A 3WLSA 1KBJA 1BTCA 3WUBA 4KGLA 3W1RA 3JR2A 3ZR5A 1TRDA 3BW2A 3TMQA 1VJZA 1ZALA 4GBUA 4GG9A 4ZO8A 2X0HA 1XSIA 4OIFA 2X1RA 4GX8A 1R2SA 4UMAA 1HTIA 2YXGA 1S5NA 1CGWA 1ODZA 4YN5A 3NSNA 2WJEA 1TPUA 1XCWA 2PZ0A 1GKRA 4JTSA 2Z6IA 1MZHA 3B06A 4H9TA 5D05A 3C86A 1KFJA 3UQNA 4OBRA 4J1OA 3A12A 3WEMA 4JN7A 3WL0A 1WZMA 1UYQA 4JYFA 3W72A 1T7LA 1S2CA 4NL1A 3ABSA 3N11A 2UBPC 1XM3A 2WW5A 4GCXA 3GC5A 1HJQA 2HK0A 1GG1A 2YCKX 1OFAA 1QPKA 1QU4A 3AS3A 3FJ6A 6PTDA 3CAWA 4DO6A 3IVTA 2X1TA 2V3EA 3IGXA 3ITOA 5EY5A 2HS6A 4GUGA 4OU1A 3WLOA 3DI0A 1WV2A 2RH9A 4XBJA 4GYJA 4LW7A 4IQJA 4WXZA 3OO2A 1Q8AA 3QPYA 2XG9A 3L4VA 3TUUA 2Z2BA 3N34A 4IGMA 3LM7A 2WSPA 4EPEC 2PLCA 1GZGA 1RVGA 1VZWA 3N6HA 7REQA 4WSJA 1VPYA 3IGHX 3VOIA 2WHLA 4O52A 1EJXC 4GCAA 3LHWA 4DUWA 3VK5A 1H11A 2GDQA 3CO4A 3WX7A 3OZPA 4FR1A 3W3OA 3QH2A 4EANA 2VR2A 3NL5A 2XIMA 1ZBWA 1ZU8A 4J3VA 3DHUA 1PV8A 2HMCA 5I79A 4TVCA 2QJHA 4GC4A 4Q8VA 2I9UA 4M8UA 4QP0A 4R7OA 3P5ZA 5BXPA 4C7GA 2I5QA 1JI1A 3HQNA 3I4EA 1TE1A 1NDYA 1OX6A 4F0MA 2G97A 2PWGA 3UA4A 3U2CA 1G4PA 3GZAA 3BPWA 2ZUNA 1C92A 1X7FA 3L2MA 4MFDA 4DLFA 1ZENA 5D2TA 4XKYB 1X7IA 2BASA 5DCBA 4FMVA 2GQ8A 4M51A 3I6EA 4MAVA 1NOUA 4CQCA 3BOLA 2G3MA 4C6MA 1AW2A 4WUIA 1UIPA 1ALDA 3WDQA 3AIQA 1M9HA 5HMFA 2PB1A 1JPHA 3C2RA 4C6DA 3G1YA 4AXKA 4C1KA 4IP7A 1R6WA 2X2YA 1AJZA 4D8AA 4IL0A 3GHSA 1TR9A 2PDPA 5C2CA 4P8VA 4FB7A 2J9XA 8CGTA 3GFXA 3QYQA 4I5UA 3R43A 3SIZA 3U7VA 4GZJA 4P7LA 3G1DA 2NUXA 3KLKA 3T2OA 3CHVA 1LT7A 3BLEA 4X9YA 1B5TA 5AHIA 4E6MA 1XSKA 4IQLA 2YOCA 3AIWA 4BF5A 3EKLA 3VM7A 1WZLA 3M4HA 2NVCA 4JTDA 3NOYA 5C6MA 3LA4A 4KWOA 3T42A 2A7NA 4K68A 3MUZ1 1Q4NX 1A50A 4JICA 3E2VA 4HJWA 3FJLA 5HMDA 3WFAA 1W5NA 4XB3A 5BRQA 4QM1A 3WQ8A 3QPZA 1J5TA 3AS2A 1RQEA 4LAKA 3V5CA 4P8WA 2F38A 3CMFA 2OSYA 9CGTA 1DWIM 1NQ6A 3GB6A 2Y89A 1UOKA 5CZJA 2OLAA 2JGYA 4KT2A 4FNQA 3VKDA 4TOQA 4G56A 1UZHA 4CCCA 5KITA 3TTEA 4PULA 4F0LA 3GFYA 3K46A 1ZTVA 1K9FA 1J0HA 2WMIA 4U2ZA 1TJ0A 2FFIA 7ENLA 1SMDA 3CLWA 4UOZA 1TFVA 5M03A 3RXZA 4GOAA 2GGJA 3TKFA 3QC0A 1WBHA 4PTWA 2HE8A 4HVXA 3IVSA 1LYXA 2YW3A 3W7JA 4EXQA 1G01A 2CXGA 1KCZA 1YNQA 2PGFA 4AY1A 4M80A 5FF0A 2Z1KA 1V7YA 1HKIA 4HU4A 4MWAA 3EXSA 4R53A 3CK5A 3V5OA 2ABBA 4XWUA 1E6QM 2GVGA 1FP9A 4RZBA 3MI3A 4MUZA 3B8IA 4BEQA 3H2NA 4AY7A 2AL2B 1JPKA 3ISIX 2YKKA 3MVIA 4QLJA 3NEHA 3HU7A 4CNUA 2VGBA 3KVJA 3KXQA 3CHEA 2GDUA 2ACRA 2F84A 4R5EA 4E2VA 2QT3A 3QTPA 3EMCA 4Z2GA 2R1NA 2F9RA 2IUZA 2VO5A 3C52A 4US6A 3USZA 1H41A 4HCHA 2BGSA 1XPGA 2P76A 4AUBA 4C65A 3C2EA 1UOZA 3VA8A 2GFTA 3R10A 3LN3A 4FXSA 4ZR8A 2XN0A 3H70A 1SYTA 3R58A 2V82A 3G22A 3EDKA 3VNMA 4W87A 1E6XM 3UG8A 3IGSA 1Z3NA 3BE7A 5EMYA 3EWDA 1RJQA 4L61A 3VDHA 3BAKA 3PC0A 2NXHA 4TX6A 4P7NA 4URIA 2PDQA 4WKHA 2VEKA 2QCCA 3HIJA 3U9IA 2G96A 4FOKA 3DEQA 4PUMA 3VOHA 3IJQA 1XC4A 4ZOAA 2XH0A 3A4JA 4FOUA 3HMJG 1R3YA 1W0MA 3BANA 3D46A 3OPSA 4FX6M 1EP1A 3BCJA 3B40A 4S3FA 4JQAA 3GTHA 3GVWA 3CIVA 1I0BA 2ANUA 3IJ6A 1LTDA 2YX0A 3CBWA 4W85A 2A21A 3SGZA 5CBBA 4B4HA 1DXFA 4ATDA 1XYLA 1FP8A 4OV4A 6TIMA 3UXKA 1G4EA 1BG4A 2KAUC 5I77A 3A5VA 2Y85A 4F2TA 2VEMA 3OYZA 1Q4WA 3AZSA 1R85A 1OY0A 1UCWA 4RDZA 4LVFA 4HOWA 3WD2A 4HMEA 1K7FA 2E5CA 3FA4A 3ABQA 4UR8A 2WNWA 4O50A 3QQWA 2DVTA 4OZOA 2V63A 4HHLA 4P61A 1N55A 3QM3A 4D6DA 5IOBA 3N3TA 2NUWA 4MGGA 2VGIA 3GVRA 1SFSA 2ISDA 2CNCA 4NNAA 3TDFA 3GS6A 1O1HA 3TEVA 1TV3A 3LBMA 4G8TA 3DBPA 4CNTA 2E5DA 3ABOA 4ZEPA 1W9PA 3EA3A 4IPIA 1I2NA 1T0OA 2P8CA 1QATA 2QQ6A 4O13A 1QWGA 3RJXA 2WBKA 4A22A 3BH4A 4FNRA 3QV7A 3VIOA 5H1WA 4JTGA 3AICA 3PN8A 2XZ9A 2PF0A 3CV1A 3LDVA 1VAHA 2XN1A 3PZ9A 1JRCA 5FEPA 4MJ4A 1BYAA 5CAHA 3VDAA 2ICSA 2OQYA 4YJ5A 3V5FA 5LZLA 1BWLA 3RUBL 4JQ4A 1A5UA 3HPAA 5FJIA 4MAZA 2CHRA 4IPNB 3KEHA 3TN3A 3TA9A 3NA8A 3EYPA 3NQGA 3TQVA 4JKLA 3O05A 1ZZMA 4OQVA 2O92A 2XINA 3O3RA 3HTWA 4C1NA 5IFPA 1PHQA 2FIQA 4Q8UA 3VIFA 4UB9A 4CNNA 3UXAA 3WJXA 3A13A 1K8CA 2XH4A 1QWKA 1HJSA 3A9IA 4OHQA 1FX6A 2B31A 4O28A 1BWKA 2BHZA 3MBDA 1LUCB 5JBDA 3VGDA 3R0DA 1MW0A 1B3WA 4B92A 2O7SA 1RD5A 1VFSA 4Q8WA 5CZ0A 5HUPA 1EHNA 1KFKA 2PDXA 3W1UA 1KO0A 4G7EA 3DYOA 5EMMA 4QQUA 1YXDA 5I06A 1IWBA 3H21A 3A21A 1PXGA 3MV01 3LXCA 2X1UA 1KXHA 3WELA 3RILA 1CZ1A 4BI6A 3HM7A 1VFLA 1MZRA 3WF0A 3DX5A 1OCQA 1XWYA 1CECA 1V51A 4O14A 4AIBA 4NP7A 1H1NA 1EF3A 1Q7QA 3KDOA 3WD1A 3PJTA 4D72A 3S5NA 2VOMA 2UY2A 1C90A 3BO9A 1OFPA 3OHMB 3OQEA 2OG9A 1QUMA 2OOFA 2PD5A 3UXLA 3P74A 1E6ZA 1X8FA 3L66A 1M03A 1HKWA 4MHBA 4CQAA 2VYOA 1LLWA 3G5EA 3SUTA 2VTFA 4BEUA 3CAVA 1FDZA 2ZDSA 3EOOA 3BOXA 4JFVA 4JTAA 3LERA 2V2CA 4Z0SA 1ZBVA 2X8RA 5CJMA 4KEUA 3BG5A 3BW3A 4WCJA 2RDWA 4XIAA 2BXZA 4HHMA 1WKYA 1YPXA 2ZA1A 2CZDA 3BSGA 4C6EA 4N9BA 2BG5A 3DERA 3RO8A 1YXCA 3OLDA 4WJXA 3NPVA 3OA5A 3H4GA 1K03A 3R0UA 1U5JA 3MMUA 4E5TA 3W53A 2BGNE 4GC3A 1A5CA 1XBXA 2TYSA 1JEZA 3U7BA 2WMHA 5CLTA 3IK2A 4CN6A 1O5KA 2DJLA 4O1AA 1B4KA 3QHNA 1S1RA 5H2ZA 2ZRZA 1VJSA 3UPMA 2HV5A 5G5IA 1C8YA 5K2ZA 4A8LA 4JGDA 2YBTA 3WH9A 2PGWA 6TAAA 2PDFA 3H4WA 3AU6A 3FYPA 1OSEA 1V5XA 1Q7MA 2OELA 3ECQA 3MHGA 2NW0A 2OT0A 1OD8A 3W7CA 4L1GA 3IGUA 3KCJA 4GJJA 5BU6A 4TO8A 1CWYA 5E0KA 4UIOA 1IZJA 3L4XA 3TQ0A 1OFQA 2ZZ7A 3ZMRA 3FA5A 3PK7A 3VNDA 1TSIA 5CLWA 3C8NA 1ICPA 1W1VA 3C3UA 3WLRA 2FJKA 1A4MA 4ZOEA 3NQMA 1C8XA 2HNEA 3A3HA 4NYUA 3ZVIA 1OC6A 3H2CA 6ALDA 2VEPA 3CQKA 4XV0A 3CUFA 1TUFA 1DIDA 4IUGA 5LIYX 1S2AA 3WD0A 1TPWA 1SSGA 2CW6A 3VINA 1EBHA 4MZ8A 4ZOCA 5LSMA 2QMKA 3R11A 6A3HA 1VB9A 1MNZA 2WSQA 4PSPA 2JQXA 3LCHA 1WDRA 4YVXA 1H7OA 3C2OA 3AUJA 5AHNA 4GPNA 3V18A 2WZIA 2EXOA 2BOFX 1J8VA 3NR0A 3GSMA 4V1XA 2WCSA 2ZWZA 3ANYA 2A4AA 4GY1A 4IQDA 1J0JA 1OABA 4NF7A 4NT0A 1EZ2A 1KW1A 4J2PA 1K70A 2MNRA 1XLMA 1KRBC 3SY5A 2DT0A 3N9KA 2G4JA 3KOYA 5AYIA 1BYDA 1W32A 9XIMA 2QCNA 2CESA 2J13A 4XTIA 3I3DA 4IICA 4F79A 1H7XA 2EKGA 3L5LA 3M5VA 4JHOA 2Z6JA 2GSEA 1M41A 2PP3A 1JD9A 2V5CA 2PTZA 3MWAA 4BI7A 1J10A 5HAOA 2VX4A 4BZYA 5HNUA 3QHOA 4PMNA 1LBFA 4H6EA 4NJKA 2XTKA 4DF0A 4HA0A 2Q8ZA 4GVHA 2ISSA 1GOMA 3LV5A 3P61A 3CTTA 4DEFA 2QVNA 2OEMA 2A3BA 3TWBA 1JUKA 1H7WA 1UPMB 3WLPA 4KPLA 3GHRA 1QNQA 4FNPA 4JKKA 3EWBX 3E2SA 4PE8A 1Q63A 1DJNA 5H8MA 4IPLA 2CERA 3ICJA 2V38A 3MANA 4O18A 2DZXA 3E02A 4R7WA 1K6WA 2UY5A 5D30A 4HNCA 5F7UA 1U30A 4HBKA 1R9YA 4Z0JA 3B05A 1CW2A 3BGJA 2BY1A 3IARA 1FWGC 3KZPA 1DWFM 3SUVA 4KMQA 4DBEA 1NF7A 4GY0A 2INZA 4MTVA 3A4XA 4D6EA 1XDMA 2J7BA 3K1DA 3WZ0E 3VKJA 3S6DA 1KFCA 3NOEA 4QDPA 3STCA 4E8GA 3S42A 2VDIA 1EJTC 2X16A 1X6UA 2XGIA 1DQXA 4NZ1A 5IRPA 2XM1A 3BK0A 4R3UA 4KEMA 1B3YA 1POKA 3MW7A 2DUZA 1PCKA 1IIHA 5HR6A 3FJNA 3BJFA 4H9MA 7REQB 3DYPA 3W75A 4AIEA 4BF7A 4ICNA 3B0YA 5H8UA 3SCPA 3IIZA 1IT7A 4KETA 2TRSA 3MKKA 1HZYA 3DXIA 4PB5A 1GVRA 4BHYA 1E0WA 1UD5A 4IIBA 4JFSA 3KAOA 1I4NA 4JQ3A 3FLUA 2NV1A 2Q3OA 3FDKA 4QFUA 1XYBA 3BLDA 3O06A 1QBBA 1YLVA 1BXBA 4Z1AA 5KSWA 4QNWA 1V3JA 2ZWYA 4ZQCA 2VCAA 2PC8A 1LOLA 4JYEA 2CLHA 1CXHA 4HU0A 1GCYA 3LCWA 1UUOA 2EPHA 3RU6A 1XYFA 3V3WA 1OFBA 2V68A 3AHXA 1XYCA 4TVUA 2ACSA 4WDXA 2EPKX 4IOTA 3TN6A 4AYSA 3UJRA 4NI3A 3NZPA 1TPC1 1GOQA 5MF5A 4Y8EA 4KWVA 2YA2A 4G1KA 4FAMA 1E6PA 3BAWA 5DO8A 4H00A 2B7PA 4UTLA 4KGJA 3MQTA 3APGA 3EWXA 4WR3A 2VUNA 1OZQA 4UFLA 3CC1A 1QK2A 2W92A 1ZAHA 3GUWA 3S5SA 2O4MA 1NQKA 4S3CA 3C0JA 3KOFA 2J7DA 3CT7A 4O57A 1MXGA 1LT8A 1UASA 3P93A 4ZCWA 3WYZA 3I10A 3K8LA 2ZA2A 3P62A 3WQWA 3ONCA 3PG8A 3B8VA 4K1GA 2OEJA 3OB8A 4P7RA 4ZTYA 5FOOA 1WKEA 1W31A 3IIXA 4PH6A 4JIRA 4XKMA 3JVAA 2ODOA 4I9TA 3K4AA 2NZLA 3T40A 2QUVA 5I3KA 2V8ZA 1R3RA 3URAA 1AZ2A 3FAXA 2PDBA 3HN3A 1CT5A 3LV6A 5BRPA 3UCQA 2F7FA 4H2HA 3NO3A 3OZOA 3VFCA 5MHBA 2ZTKA 3ZT5A 2WMIB 3PB0A 3W01A 2R91A 5CBIA 3UPBA 3NUKA 4OE7A 4YVVA 3M43A 8A3HA 1Q13A 3AROA 1XLJA 3APTA 4U4MA 4CEXC 1E70M 4DWSC 1KLZA 1AJ0A 5E6ZA 4N0RA 4YTTA 3KBJA 3W38A 2IPGA 4QROA 4Q4MA 3XISA 1QBAA 1XQLA 4UOQA 4PMDA 1UC5A 3QMTA 4M19A 1RH9A 1E9LA 3RAOA 1MRAA 3KRBA 1BRLA 2WBGA 4MNKA 3TOPA 4MWAB 4DX3A 4JTJA 4CU8A 1Q66A 2NQJA 4KF1A 5F2GA 1WUEA 3N04A 4HK7A 2ZRVA 3U8GA 3VD7A 1U1UA 4TVDA 3STGA 2DT1A 4DPPA 3B03A 4HNLA 3P80A 1VH7A 1VIWA 3GNNA 5AC4A 1G1YA 3ELFA 5ABHA 1WXYA 5JH1A 2YIHA 1QI5A 2XIIA 3LCLA 1LQAA 2VDGA 3TCEA 4L4PA 2PWHA 1O66A 3FXGA 3QSRA 4S3AA 4WKFA 2P1FA 4AVOA 2BOEX 1H62A 4HSOA 2WLZA 3O6AA 3TYCA 3UZXA 2WCGA 4GHRA 3DG6A 1EP3A 2PMQA 3SSJA 4C6IA 2J6XA 1R30A 2PLMA 4PBEA 4LU0A 1UKPA 4AISA 5BXSA 2ZXAA 3VKKA 1W1A1 2RHGA 3MP4A 1FKWA 4EKJA 1KXQA 1O7AA 2J25A 4ATWA 1JAKA 4B2DA 1W2PA 1FXQA 2OLSA 1NARA 4CQDA 4LNCA 2PWEA 3EZ4A 1E15A 5A8MA 5T9BG 1O60A 1HJVA 3GDBA 2O9RA 3UCCA 3MSYA 3E38A 5C55A 4QX4A 3NQDA 4DB7A 4RNFA 3ANVA 3MP3A 2GDVA 1VYPX 2A2IA 4ZQPA 3DBNA 4FR6A 4UZSA 3WF1A 1HKKA 1R8LA 1SFJA 5C71A 4GQQA 4GWEA 2ZUMA 4FZIA 1K1DA 1PSCA 3RRXA 1I60A 3USBA 3IIVA 1EJRC 4LUTA 2OVLA 1EO5A 4LF1A 4QLLA 2OKOA 3N4EA 1T6MA 3KFTA 3OQ8A 3WLHA 2HPIA 4IH3A 5M3WA 1JZ3A 3MC5A 4O54A 4GA8A 4FXFA 4S1FA 2QGHA 4EACA 3QY6A 5FSEC 4AG0A 4DWDA 3ATYA 3FCPA 4CQ9A 2X7VA 3H55A 1RJRA 3KOXA 2OX4A 3N15A 2ZYFA 2Y7FA 1KM1A 2A3HA 2W0UA 2OQHA 1LRNA 4I5RA 4UMCA 1LBMA 2PDWA 4S2BA 3SM0A 3W7MA 3NSXA 4RUBA 3R89A 3WSUA 3TMLA 2PGRA 5F2MA 2ZC8A 3CNYA 3CUZA 1CLKA 2V30A 5AOUA 3WK2A 3EMZA 1BKSA 2QLYA 3AMGA 3KL5A 1MDRA 1Z41A 3TA6A 1T40A 5FAGA 4O10A 1NWUA 3HG2A 4H7ZA 4EWND 5ABFA 2CBVA 1GJUA 4PCSA 3UVAA 3G18A 2Y1HA 3RCMA 4IXXA 3NZQA 4F0KA 1JIBA 4N2YA 1ZJBA 3W23A 1GW1A 4C1NB 1QJWA 2W67A 2G3NA 3NL3A 1HL8A 1UROA 4PMZA 4DAFA 4JY9A 1U1HA 3NNTA 1LRTA 3CT2A 2V3GA 3LENA 2FJUB 4JDBA 5FJTA 4BF9A 2OWWA 1OFOA 2EPNA 3II1A 2Z7GA 3WL1A 1OBAA 3PJUA 4HPXA 3NXLA 5F4XA 3P81A 1QW9A 1K8YA 2VX6A 4IISA 1HG3A 2YFOA 3KCLA 4G7EB 3LSCA 4LY8A 4UNKA 2DZTA 4KCUA 4YLWA 2XZ7A 1DEDA 5K3VA 2VKZG 1N8WA 5L9FA 5JH2A 2D22A 2J7FA 3UJSA 3QZAA 1CYGA 4KCWA 3PBMA 2WJZA 1XYMA 4IIFA 1E0TA 2F61A 2I56A 7A3HA 1PX3A 1U83A 3GTFA 2Z24A 3GBEA 2DUAA 1V7AA 4FF7A 2IXUA 1KFBA 1QNOA 3MCNA 3IUDA 2Z7KA 1XLKA 1H0IA 2VX5A 3UPWA 1G0CA 4D6IA 1XW8A 4CVWA 4IMGA 2PCQA 2PI6A 1XR2A 3TC3A 2I7GA 1CLVA 4XD3A 2QCEA 4ZQRA 4JL1A 3HJZA 5AB3A 1NFGA 4O1EA 1BYCA 4NZCA 5DMNA 1BF2A 2J7CA 3BMWA 4H9XA 3WNMA 3M0JA 3EDJA 2FFCA 4AZBA 1YADA 1M6JA 4HN4A 4UOJA 3VKAA 3W00A 1H0GA 5ECUA 2FYMA 4DUXA 1V77A 4G7FA 1WO2A 2RDTA 1EDTA 4PYSA 5CPMA 5I23A 5E0FA 4L6DA 4M1BA 1BVWA 1XLBA 4YS1A 1MO0A 4DVOA 3W7GA 3GH4A 3DN5A 1QNPA 1QW8A 4O17A 2V5LA 2HRWA 4W5ZA 3T0AA 1QMLA 1IT0A 3P84A 1RAKA 1V79A 3M47A 1EYEA 4NZJA 5MKGA 1AODA 2FH8A 4AVNA 3QR0A 4J7RA 2A3CA 1XLEA 1JQXA 3GH5A 5A3HA 2ATSA 4XBSA 3F2BA 3C2YA 3AIRA 3GE7A 3H7RA 3S4TA 4JIHA 3BC9A 2WPBA 4LYKA 3EAUA 3LI1A 3PTKA 3MCMA 5KZEA 2WCAA 2W91A 3DC8A 4L9ZA 4Z42C 3ONBA 1QO5A 2RJGA 4LUYA 4D8ZA 3SAZA 3RG6A 1XHGA 2E5BA 3GNRA 1ZBCA 2G37A 3L2IA 4LAZA 5A6JA 3W1AA 2GJPA 2A5HA 3AXHA 3ZLGA 5I02A 4TIMA 4JFWA 2GJNA 3J7HA 1CNVA 2IMRA 1E3ZA 2OXNA 4PCPA 5I6SA 1BGGA 1WX0A 1PS9A 3ZSSA 3UY8A 4N9CA 4NZ5A 3M0XA 4BA0A 5HPOA 4J28A 1PTDA 5HDRA 3BURA 3E1F1 3QGVA 1G94A 2G0WA 5DXXA 1FWDC 2PZNA 2NVDA 3BV7A 3T09A 3W86A 3MI2A 4E3TA 3OVQA 5J5RA 1NDZA 3OLEA 2ACUA 1PHWA 2P3EA 3BWWA 3UYIA 1WXJA 1J6OA 2D73A 4J3SA 1GQJA 2QVHA 5CZSA 2QCDA 1CB2A 4BQ5A 1V0KA 5FJUA 3FYOA 2WJFA 2CBJA 1FWRA 2OCZA 2PWDA 1EBGA 1IQ8A 3SZ8A 4WJEA 1EQPA 1US0A 1A5OC 2NLIA 3VGEA 1CPUA 1EZWA 3WH7A 1W5MA 4DBSA 1OC5A 3P60A 4M7TA 4B4FA 1RZMA 4Y2WA 2PU0A 1QW7A 1UWQA 4F9DA 3ZXWA 3UW6A 3CWOX 3P2VA 2J7GA 1CXIA 1IGSA 4GACA 1IR1A 4RV3A 4ZO6A 3NL6A 1F3WA 1A5NC 1FA2A 1XICA 4FI4A 5CBJA 1B1YA 1R3QA 4H7CA 1GVYA 1KRAC 4PMQA 1VKFA 3A9BA 1R86A 3SRKA 4I6VA 3UR5A 2EJAA 3E0LA 4FPSA 1X38A 2A6LA 2WVUA 3W2NA 3HOJA 2QAFA 4PTNA 1UR4A 1AZ1A 4GY7A 3IK4A 1HW6A 3TYZA 1XBYA 3QQ0A 4I9JA 1S2VA 4ZBCA 4HMNA 3SUWA 2HWGA 4DWSD 2VC9A 5T91A 2W9MA 4NNBA 1EOKA 4NYYA 4W7UA 4PEKA 5EMUA 1XLIA 3DFQA 1J96A 1QI0A 3MPGA 3TTOA 3N2BA 2CZEA 2W66A 1CXFA 3BCFA 1ZP3A 3PZOA 1VBJA 2Z1SA 3QXBA 4ONVA 3CIXA 4E8CA 3U4FA 1L8NA 4Q7IA 4PMRA 1E4NA 1DTNA 1MXSA 2PSNA 4IPPA 1MEWA 4JTTA 3URQA 2A7RA 4K8EA 1NF0A 3IJLA 3NYDA 2YPIA 3NXFA 2WWDA 3KLLA 3TLQA 4HA1A 1ITQA 4ZO7A 1S2UA 4LS0A 3OLGA 3NPXA 1C29A 4N6FA 5BMWA 3KRZA 4M56A 4H3DA 1XFCA 4DYJA 5EMKA 5HATA 4D6GA 1CXKA 3DAQA 1H7PA 1E0XA 1W1TA 1BSLA 4P2VA 4DBWA 3W1QA 4ZQMA 5DN1A 5AC7A 1FWBC 3TROA 4MLJA 2A3AA 3S1VA 3AI0A 2PWVA 4V1YA 4U3AA 4FF5A 1UKQA 4PMYA 1BXNA 1AW1A 1EWDA 1O5XA 4X2RA 1VFUA 1MW1A 1TA3A 3IAQA 4O0KA 3A22A 2QYGA 4DJEA 3B0UX 3VNYA 4YNGA 4PZVA 3CO8A 3A6OA 2VP8A 2QIWA 1FOBA 2ZA3A 4PTMA 3CZKA 1SR9A 3BLIA 4D8LA 3G77A 4HZMA 4HTBA 4B5SA 1Q6FA 3WLIA 1BHGA 4CCZA 2FZMA 4LTSA 1HX0A 1W9VA 2P50A 1Y65A 3VE9A 4YTSA 3QR1A 4ZB5A 3PWIA 1C7SA 5A5WA 4IZGA 1TPFA 1WYIA 4O1BA 1V6TA 1IWPA 3AIBA 4IIEA 3SUSA 3WLMA 1BAGA 2WPGA 4BWLA 2Y24A 1TKKA 3CWHA 1SMAA 3LPGA 5K4ZA 3WMCA 2EAWA 4EP8C 2ZIDA 4G2DA 3TJXA 2ZZ1A 2FMOA 4KFNA 2YB4A 3WNLA 4QRNA 3TSBA 2ZXQA 1E5NA 4LWWA 5A94A 4J5NA 3N73A 3QTGA 1WKDA 1GKQA 1VC4A 2I17A 9XIAA 2J24A 3LLFA 2Z1BA 3CIWA 1FFQA 1XYAA 2A3EA 1QNVA 3EX1A 2WSYA 4R85A 5E5CA 1W1PA 3BXWA 5F2IA 3VI2A 1J4EA 4GZEA 4QDMA 4JFTA 4KQNA 4LPCA 2GWGA 3SEPA 4ENLA 1XPYA 1SW7A 1P0KA 2ZZ4A 5I3JA 1GNXA 5BOOA 1TVPA 4RL3A 4UQBA 3ZOAA 2C3ZA 3FDGA 3GG1A 4MB3A 3KRSA 3EDEA 2ZZ3A 1TJRA 3BGGA 1RCXB 5CSRA 2OGYA 4JTRA 1KGWA 2Q09A 2VNCA 2GK1A 5C54A 3O07A 5G4WA 1S3HA 2VFIA 4JTUA 3LPOA 1KXVA 1A5AA 1CENA 1W1B1 3EWCA 1WNOA 1GYNA 1HT6A 4D6CA 3A47A 1TO3A 3F4NA 2HBXA 3RX2A 4PMOA 2FB3A 4O8RA 2CYGA 3LY0A 4KW2A 1B3VA 3DHDA 2XU2A 1SW0A 1HNYA 3W2KA 1H2JA 1UUQA 5BU9A 2E6AA 1O6IA 2VENA 2H3BA 4GUHA 3PB2A 4LH8A 4N6EA 4IQEA 1XLAA 1AMKA 4A3RA 4C6OA 4AY8A 3S46A 3ZLFA 3NM1A 2TMDA 4XD4A 2WMGA 3E0VA 1QHZA 1VD6A 4XAZA 4WOZA 2Y62A 3UG4A 3G1AA 1DBTA 2V0TA 1F07A 3PY2A 2C14A 5HNRA 3QW3A 3EOEA 3PSVA 5FF7A 3WJWA 4A05A 1BRLB 3T0DA 1MVYA 5F1UA 2HSAA 3HB9A 5U4NA 1YTKA 2JEQA 3MB9A 5D9PA 3T78A 4XZ9A 1LCOA 2ZVRA 3K30A 1UQZA 2PODA 3VZZA 4WX2A 3SCVA 3M1ZA 3LXAA 3IJDA 3TZFA 2GGHA 4B9YA 2CLPA 3GDRA 1TJ2A 2VOTA 5GNXA 1OD0A 1XI3A 5CKSA 3AS0A 3RK8A 2HBVA 4RE0A 4LV4A 1E72M 3UNTA 2J8GA 2PEVA 2J9ZA 3M6DA 1C7TA 4HNUA 2FTYA 1QCWA 1GQLA 5E70A 3VOGA 2ABAA 3OG3A 2OLHA 3PHAA 2D0HA 3NQCA 2PDIA 1WDQA 3WDIA 1J11A 3S5YA 2XM2A 3NO1A 1W8GA 1BWVA 3SDOA 4L9XA 2ZADA 4AEOA 2IS7A 1F61A 4MJMA 4PUNA 2W4XA 3UWZA 1NVMA 5D09A 4XAYA 4FLRA 1KBKA 4KEZA 5DX7A 2ZQ0A 2YL8A 1WXZA 2QUNA 2R94A 1AG1O 4HT3A 4AAJA 5DMLA 3IV8A 3W24A 4HTYA 4N42A 4UTKA 1PZ3A 2OOGA 4ZQNA 4N9DA 4AHQA 1XRVA 5LNRA 2G3JA 5GJNA 3PBGA 1GVQA 3QJAA 1GZ1A 3UETA 3S1WA 4GJ1A 1RLDA 1KCLA 4FSAA 4B5WA 4GQ0A 1F76A 4L5ZA 4PUKA 3RCYA 2H9AA 4LUTB 3RPDA 2CITA 2VI0A 2EG6A 3W81A 3W2LA 4EF9A 4GZ7A 2FVLA 2Y4SA 2YL6A 3OVPA 4RDYA 4MZYA 1GOKA 1A4LA 4DXKA 3TE9A 4Q8NA 2OYMA 3GIPA 1TCDA 4B91A 4DJDA 1AH4A 2BV9A 3AU2A 3BTNA 4AD4A 4XUGA 4CKQA 3ZZ1A 4BS0A 5LGXA 3NTYA 4DNHA 2E28A 4K6AA 3HURA 1HQTA 1SM9A 5GJPA 2V5KA 2Y5JA 1K9TA 4Z1DA 3HZ3A 3PZGA 4O0QA 3ANUA 5FKYA 2C91A 3WLTA 4OGZA 3A24A 3ARWA 2V3FA 5HULA 3N2TA 1C93A 2OFJA 3M41A 1S5WA 2YJQA 1VYSX 1PWLA 2HTMA 2WYSA 1TELA 3E2QA 2PDCA 2I57A 3KX6A 3OVGA 3NQ7A 2XJ7A 5HNTA 2CLIA 1TTJA 3F7JA 4XZHA 3RHGA 2F8QA 1TTIA 3ARVA 4HNNA 3ZJ7A 1TIMA 4OJYA 4LNYA 3U0HA 4Q8TA 2DT2A 5ABFB 4JY8A 3KBSA 5LNUA 3GDLA 1BQCA 5C2GA 3W37A 1E73M 2YXOA 2EPLX 3GQYA 3RRAA 3NQAA 1G5AA 3FHQA 5I3DA 2QIIA 2QCLA 3NG3A 1RCOB 1BVNP 2DJXA 4HZ8A 3HJEA 4IIHA 3GXIA 5IXEA 3FSTA 4L1WA 7TIMA 2ZUSA 4PUDA 1S3TC 4AH7A 4GMEA 3AAMA 2AMGA 1ADOA 3VPLA 4KBXA 4W88A 3ABRA 3HG5A 2VUYA 4CD5A 2AQWA 1JDDA 1EA9C 2XFRA 3QLLA 3FSUA 1TB3A 2C16A 2GVJA 1EX5A 4GI8A 3M0IA 3QMSA 4FLSA 3W2MA 2BMBA 3H22A 2PFHA 1XBVA 4Y90A 1XD0A 4NJHA 1C8QA 2FGBA 2DY3A 4ERAA 4UR7A 3TNOA 5HUOA 2E1DA 5A6BD 1UQYA 4B3LA 2C0AA 1B0IA 1MYRA 2P0IA 1AD1A 1IGWA 4IFOA 4KCVA 1VLIA 3A23A 3MO7A 3G1FA 2POTA 5KETA 3LBOA 3RFAA 3U48A 1MQQA 5A1AA 1PKYA 2DSKA 5XIMA 3INPA 1JZ7A 4FHAA 2WO5A 1IEIA 3LOTA 4QS6A 1E0VA 3ZSTA 3S9ZA 3UY7A 4DJFA 1XFBA 4GKLA 3G0UA 3L0NA 1C3FA 3E0WA 4DZAA 2C15A 4JTLA 3W2UA 5AC5A 1KGUA 5CAKA 4C6FA 4XD6A 2I9EA 5D9OA 4XSMA 2DUXA 1PWMA 1XDJA 4IJBA 1OZMA 3EGJA 1KGXA 1WDSA 3FIGA 4AZ5A 1TREA 1HVXA 1X1NA 1UC4A 1XH2A 3L4YA 2WNZA 4LXFA 2PE4A 1BEUA 1P6CA 4NNCA 1IEQA 4MVAA 2ALDA 3WEOA 3O0KA 3WQ4A 4LC6A 1LL4A 3BJSA 3MS8A 1XJBA 5AN7A 4XQ6A 2Y63A 2HXTA 3M5YA 4LBUA 1JZ2A 1JPDX 4TX9A 1OFDA 4E3VA 1ODUA 5MKGB 3TFCA 3L9CA 3W27A 2W63A 3LRMA 1GHRA 3WBEA 1M7XA 2WZTA 1R3WA 3P8JA 2W27A 3RYSA 5BOEA 5LNVA 4OKDA 2JBMA 3MJYA 4J40A 5CZKA 4CD4A 3Q65A 3W25A 1A47A 3TP4A 4F0SA 3LGEA 3QV8A 4MB1A 4H9YA 1MFVA 2WM1A 4R9XA 1JYVA 5DMMA 5K9CA 2VMFA 4AD2A 3DH7A 2DH3A 2POZA 2Z25A 3DHPA 1FHVA 3QN3A 4QIUA 3CH9A 4LAMA 5EMJA 1QASA 1KB3A 4JIIX 4TV5A 4HHPA 1E6RA 4GGHA 1L6WA 3TLLA 2H6RA 3EX4A 4Q3MA 1N2VA 3OGSA 3T8QA 1XD1A 3DECA 4JIEA 4S3GA 3WQVA 1KFWA 4GE8A 4NHVA 4ILSA 4U31A 4B3KA 4QGCA 2BWGA 4W8LA 2FH6A 1XLLA 5IHRA 4IJCA 5GVJA 1UD8A 4HA4A 1BKHA 2DIEA 1KM5A 4H9VA 4KERA 2Y8VA 1A5LC 3I7SA 4QEHA 1HF6A 4B9ZA 4AYGA 2PTDA 3TH6A 2BHYA 3O15A 1EEXA 1S39A 4RE2A 1Y5WA 4OVXA 4YCOA 2QEZA 2GGIA 1V3HA 1S2TA 2VL4A 4S38A 3CEPA 3GTXA 3O1NA 1E40A 4G6CA 1QHPA 4AWEA 1W3HA 3W7NA 4JBRA 3TOYA 3AJ7A 4DJEC 3Q94A 1V6WA 1M01A 1DJGA 3PM6A 2J47A 3B0XA 3BQ6A 3MBFA 4AWUA 3KUMA 5LA0A 1NELA 3ABZA 5KZMA 4GKTA 3UGVA 4ZGYA 4GQGA 4MJ2A 1W56A 4LYRA 3DESA 1SO5A 3LB0A 1DQWA 3ES8A 3KM8A 3FVMA 4Y9NA 3DUGA 2VD9A 1IEXA 4MMWA 4PR4A 3NQVA 2DVXA 1ITXA 4BWLC 2YCLA 5EA9A 3I7RA 1OYAA 3K13A 1J0IA 1Q6LA 1KCXA 1P5BA 3MI6A 3WJYA 1Z7AA 5J8LA 1QFEA 3BCDA 2H8XA 4PC8A 5JIPA 4DO5A 1QT1A 4JS3A 4ML4A 1SSDA 1FH7A 1JZ6A 2ZZ6A 4ADTA 4PMUA 1S1PA 2RDUA 3D47A 3WLKX 1H63A 1LL7A 4P7OA 3KL0A 3PZTA 2PRMA 3ME3A 1W6TA 5DY3A 4BKNA 1L9WA 1JDCA 2E6FA 3BGAA 2PRHA 4INFA 1V6YA 1I1XA 3KVLA 1S5MA 3LCGA 1XRFA 1GWJA 1M7JA 3C4UA 1D7KA 2WC3A 1UP0A 1V3KA 1GVFA 4JL2A 2B81A 1XLDA 3E49A 3MWCA 4YYFA 1LWJA 3AXXA 3QY7A 5E09A 2YL5A 1TPB1 4TUFA 2QDGA 1NWTA 1SZRA 3QHMA 3O0FA 5BWFA 3IVUA 3G6LA 3BSMA 1MNSA 3NFUA 5A6KA 3OGVA 4JZ5A 2QDHA 3B9AA 4H6RA 1AL7A 5E0CA 3VU2A 4MNLA 3O8AA 5LNSA 1OYBA 4L4MA 4JEJA 3CAQA 4GI4A 1MSSA 3I6RA 4LUSA 1OFRA 5FA5A 4YMZA 3DZ1A 3DFYA 4IT1A 5GJMA 1W3JA 5CSUA 8XIMA 4LF2A 2E6DA 4KFOA 3EWYA 4EWJA 8RUCA 3PPHA 1H51A 3GR4A 2B7NA 4PRRA 5XIAA 1ZHAA 2EPOA 1TA3B 3ID7A 1J0ZA 1E51A 1W3IA 2PDUA 1OT1A 1FCUA 4BQ2A 3D3FA 1XINA 4NILA 1HGYA 3KL3A 3UR7A 3CPUA 4HNVA 3L4ZA 2VFFA 3W85A 2E1WA 3S1XA 3W7QA 4EPBC 3VE7A 4NQ1A 1A53A 4YHGA 3OBEA 3PZQA 1A3HA 4LAUA 3L68A 4AHPA 4GH1A 3H2OA 3W1LA 3KHJA 4QHRA 3UJEA 2EG7A 3THUA 1QR7A 3CV7A 1EJWC 4RW5A 1AFSA 2Z00A 1VCVA 3C3NA 3LS9A 5AFDA 2Y70A 2P8BA 3WFZA 4NSBA 4FS9A 3LCFA 2VRKA 1HKJA 3VCCA 4JD4A 3LMZA 3W6MA 2GSJA 1Q3NA 3UP8A 1YMYA 3W82A 3MYOA 4A35A 3ZM8A 4H01A 1GOWA 1X1ZA 4AZCA 4AZ7A 2QR6A 3AMKA 3QQ1A 1MXDA 3LLXA 4Q8MA 3SUUA 4CNPA 5BCAA 4AIUA 2IPWA 4FK9A 4GIRA 3AIUA 1ECEA 3T44A 1EDGA 2XWDA 3RX4A 3BW4A 3MKVA 4UNIA 2VWTA 3WEZA 4WKAA 4CN1A 2FLIA 4HZ6A 2QZRA 4ACZA 5FEXA 1OF8A 4DF1A 4P8UA 2GK1B 1QOXA 5M1TA 2GPTA 1R2TA 2X1IA 3VD3A 1K3UA 3VABA 1WDWA 3EX6A 2FHBA 4EPDC 4HA3A 2R1KA 1YYAA 2F6UA 4WF7A 1SPQA 4A3QA 2VVSA 4NG3A 3TJ4A 3VKBA 4C6CA 3RNDA 4F66A 1E1CA 4O16A 2VC7A 4Y6GA 5CGQA 1P0BA 1JDEA 4GQBA 2E0PA 4JNZA 5C70A 4WIWA 2AKZA 3WFLA 3VIMA 1FDYA 1P0DA 4XAGA 3ZFHA 1K8ZA 3AWOA 3OEXA 3ZLHA 4CD7A 3WQFA 3GNPA 1TTQA 1AQ0A 4WHBA 1LZOA 2TAAA 3U57A 1Z8AA 4DJDC 4GFIA 1HGWA 3GNOA 2C1GA 1JCYA 4YTQA 4XAFA 1GKPA 2KZHA 1SFTA 1RA0A 1UIOA 5I78A 4MNJA 3JZEA 4WGHA 3STPA 2C1HA 4R7JA 4U28A 3V36A 3E0FA 1BLIA 1UZ1A 4R9OA 4DLMA 2GYIA 4UFMA 3UFYA 2DSVA 2AAMA 1XRTA 4YXGA 3GM8A 2ZTJA 2XSBA 4B5UA 3PANA 1TMLA 1QAPA 4JTQA 1DJZA 3GNDA 1AD4A 1I75A 4GQRA 2W3ZA 3IACA 3REQA 1QO2A 3FEQA 1MDLA 1FTXA 1TV5A 3SGGA 3WDJA 1RPKA 2DGAA 1OJXA 3FKRA 2OODA 1EEPA 1TMQA 3RCNA 1SZNA 3ORWA 4JTEA 2F6KA 4GISA 3RX3A 1X8CA 2OSXA 2RDXA 2BGQA 3R7MA 3G2GA 3MY9A 4Y9PA 2AOSA 3M07A 1ME7A 4FEZA 3NAVA 2OQLA 2UV8G 4RK8A 2VCBA 4AW7A 4PL2A 3QSTA 3ARPA 5I5RA 4S23A 2PTYA 3PZMA 4MUPA 2J6VA 1B9ZA 1PO9A 3RIKA 4GINA 4MY1A 4TX8A 4RZ6A 2X30A 4AIOA 2Z27A 3EOLA 2G8ZA 3NQFA 1XKYA 4HYRA 4Z2IA 1UR1A 3CB3A 3IRSA 1OC7A 2WLYA 2DSUA 4Q6XA 1EQCA 3BJTA 1R7OA 4GFSA 3O6CA 3WH8A 3H6OA 2GGGA 3FYYA 1UB3A 1RLCL 2WKLA 1GEHA 2ZE3A 3SBFA 3W6YA 3LZ3A 1C91A 1LQ2A 4F9JA 2Z4GA 3T05A 3VZXA 1RY8A 4CVUA 4UMBA 4IMCA 4UQDA 4OUEA 1K6AA 4HIBA 3ARXA 1EJUC 4AX6A 1VEMA 4A8NA 3IWPA 4A8IA 4YCPA 1QOQA 2GJLA 3NPWA 3HA1A 2Z1VA 3UERA 2H9AB 1EKOA 3CJPA 3SCWA 3RPTA 2EO7A 3FGCA 1P0EA 2ZX7A 1OF6A 4N4QA 3NZRA 3QOKA 3QVQA 3PVFA 4Z1YA 1KRMA 3T0CA 2BZNA 3HGSA 2D2OA 3QBUA 3FA3A 4QJ1A 3PWAA 2QV4A 5AECA 1JR1A 4MYAA 4DJFC 4XISA 4O1CA 4E2DA 3B8DA 3RO6A 2J62A 3LRLA 1IXQA 1WDDA 5KZ6A 1CX9A 3VD4A 5D32A 1DIOA 5FEWA 1KM2A 1AW5A 3M0KA 2JKPA 5DF0A 1TV8A 1WA3A 1I0DA 4QCEA 3CZGA 5K9DA 4K2SA 2CZVA 4AD5A 3KRUA 2WNQA 4DZ5A 4J3XA 3TQKA 1W9UA 2Y6ZA 4JDYA 4RW3A 3WQDA 2DSWA 5AZ0A 3VX0A 4AFYA 2XVGA 2FDMA 4FOJA 1VHNA 3GAYA 4LT9A 1JFXA 4MPQA 2ZFAA 4PUUA 1TUXA 1J79A 4GXMA 2R1MA 4IF2A 1JULA 3H54A 4N9EA 1G4TA 1A49A 4Z2JA 1KR0A 2HJPA 3VAVA 3SI9A 3TCSA 2VFEA 3WENA 3A3XA 3TXZA 4B5TA 4LCQA 1KQYA 3G1HA 3LEPA 1P4CA 5D8ZA</