1RY0A

Structure of prostaglandin f synthase with prostaglandin d2
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
319
structure length
319
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human prostaglandin F synthase (AKR1C3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 118
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ry0A00
3KRBA 1ZUAX 3ONCA 3C3UA 2PDFA 4GABA 4JIRA 2PDBA 3S3GA 3FJNA 2ACSA 3U2CA 2QXWA 2IPWA 4LAZA 1QWKA 2I17A 3CMFA 3DOPA 3V36A 2FZ8A 2HEJA 3BCJA 2NVDA 3R58A 1XJBA 4GQ0A 5KETA 1MZRA 3GHSA 4DBUA 1AZ1A 2HE5A 2R24A 1A80A 3RX2A 2DUXA 4PRTA 3RX3A 3N6QA 2INZA 4DBWA 1X96A 1JEZA 4HBKA 3UZYA 4JTRA 1ZSXA 3ONBA 2PF8A 3WCZA 4YVVA 4QR6A 4PUUA 3UP8A 4XZLX 1SM9A 2FZDA 4DZ5A 1Z89A 5JH2A 2INEA 2IKIA 3WG6A 4IJCA 1RALA 4JQ4A 4LB4A 1MI3A 4PMJA 1PZ0A 2IKGA 3BUVA 4YU1A 2PDNA 3LENA 1Q5MA 4LBSA 4QX4A 2BP1A 4Q3MA 1HW6A 4PRRA 1ZGDA 1EL3A 2FZ9A 4QBXA 3F7JA 4DBSA 2PFHA 3MB9A 2FZBA 4GIEA 1FRBA 2C91A 4XZIA 4JQ2A 4L1WA 3T42A 4GA8A 4AUBA 1S1PA 4QXIA 3LN3A 5AZ0A 2PDIA 2IS7A 3M0IA 3GUGA 5M2FX 4XK2A 1LQAA 3CAVA 1M9HA 1S2CA 4ZFCA 3R8HA 4H8NA 2IQDA 2ACUA 2HVNA 1HQTA 2PDYA 3M4HA 4WDUA 3QKZA 1XGDA 4JTAA 4I5XA 4GCAA 4JQ1A 1R38A 1RY8A 3H4GA 4Q7BA 4NKCA 4LBRA 2PZNA 3GHUA 3BURA 1PYFA 3V0TA 1S1RA 1LWIA 3UZXA 3R8GA 1T41A 3H7UA 1Z9AA 3M64A 1QRQA 3UZWA 3GHRA 3V0UA 1YNPA 3WBXA 1T40A 4IGSA 4WEVX 5HNUA 5LIWX 3R94A 1PWLA 3WBWA 3V0SA 4LB3A 2WZTA 2PDMA 2F2KA 4WGHA 4JTDA 3Q67A 2ACRA 3D3FA 2J8TA 2I16A 4YVPA 2IPGA 3LEPA 1GVEA 4WDTA 1J96A 4XZNX 4JQ3A 1PZ1A 1X97A 3DN5A 2HDJA 2HE8A 1K8CA 2DUZA 5LIXX 4JTCA 1XF0A 5LIUX 1RY0A 2IKJA 1AFSA 4R9OA 2A79A 3MC5A 4L1XA 1Z3NA 3O0KA 1AH4A 5HA7A 2ALRA 3R7MA 3V35A 2PDXA 3UYIA 4H7CA 1AZ2A 3EAUA 1US0A 1VP5A 3UWEA 3LZ5A 4YVXA 4WDWA 3Q65A 1X98A 2ISFA 1AH3A 4WDXA 2PDLA 3FX4A 4OTKA 2PD5A 3BV7A 4FALA 1IHIA 1S2AA 3CAQA 2DV0A 2IQ0A 4PR4A 1Z8AA 4PUWA 1C9WA 1EKOA 1YNQA 4XVEA 4LAUA 4HMNA 3B3DA 2FGBA 4IJRA 3WBYA 5LIYX 3R6IA 2PDKA 3O3RA 2PDJA 5DANA 2FVLA 3H7RA 4FA3A 3LQGA 4XO7A 3UZZA 1YE6A 4JQAA 1IEIA 1PWMA 2ACQA 2PDWA 2HV5A 4YS1A 4FZIA 2BGQA 3UG8A 4GACA 3CV6A 2P5NA 2AGTA 3EB4A 2IPJA 1ADSA 2PDGA 4RPQA 3CASA 3LD5A 4XZMX 3LQLA 5C7HA 1UR3M 3P2VA 5AZ1A 1EXBA 2PDPA 2PD9A 4XO6A 2CLPA 3LBOA 3LNMA 4F40A 5JH1A 4XVDA 2F38A 4FAMA 5LIKX 2VDGA 3GHTA 5HNTA 2PDHA 4JTQA 4MHBA 2NVCA 2PEVA 2PDQA 1OG6A 1ZQ5A 3EB3A 4JIIX 1EF3A 2IPFA 2R9RA 4G5DA 1YE4A 3COTA 3RX4A 2WZMA 2IKHA 3VXGA 3LZ3A 3UGRA 3N2TA 3NTYA 4WRHA 1VBJA 3G1RA 3G5EA 4ASTA 3UFYA 1MRQA 2PDUA 4GQGA 2BGSA 2PDCA 4XZHA 4EXAA 4XAPA 1Q13A 4ICCX 3R43A 3CV7A 4EXBA 3ERPA 3LUTA 1AH0A 2HVOA 4JIHA
chains in the Genus database with same CATH superfamily
4GH1A 4WR3A 2HWGA 1E4LA 1XYCA 4Z42C 3SECA 3E02A 1AL8A 4AWSA 3EWUA 2VQTA 1HKWA 2YYTA 1A5BA 3UJSA 4ZXLA 3B06A 2HXUA 3BAWA 4M6QA 3KTCA 4FF7A 4AIBA 1TE6A 1BYBA 1B5TA 3NSXA 2CLEA 4M6VA 1MVYA 1NEYA 1DE6A 3GYEA 1LUCB 1JD7A 3MI6A 1ESWA 1UR2A 3M16A 3V18A 4GFIA 1JNEA 2OX1A 1DJHA 1JDDA 1EFZA 4JHMA 4PRTA 1UUQA 2YBTA 2ZBTA 1BKSA 1CZ1A 1HKKA 1Y0EA 1LORA 4WX2A 4E8DA 2HZGA 3P8JA 1H61A 2OMAA 2UBPC 1SJCA 4GUGA 4DUOA 2O0TA 1SM9A 4K37A 4ZXOA 4GNJA 3UJRA 4H00A 1E5JA 1UR8A 1QVBA 3N14A 2WYSA 4B5VA 2PCEA 5HUOA 3P60A 1QTWA 2OLSA 3CM4A 4LUYA 4LCRA 3QR0A 1GOWA 4GWEA 1WYIA 1B2YA 4ZO8A 2XN2A 1HX0A 1IZJA 2FH6A 3W02A 4AAJA 4L9YA 2HSAA 1QNQA 4ROQA 1ZGDA 3TC3A 4MOZA 4DYKA 5BWFA 3IGXA 4PUDA 5TQLA 5DRIA 3PPGA 3QMSA 2ZCGA 4GA8A 1F4AA 1M68A 3MCMA 3GH5A 1TV8A 4ECLA 3TCSA 1KCLA 3Q37A 2SFPA 1B4EA 1P0BA 4RE2A 4G1NA 4C65A 4TUFA 2IS7A 4Z1CA 1NARA 4POCA 1S2CA 3RLUA 1P0KA 4UQEA 1GORA 1M04A 1YTEA 1ITQA 3LU2A 2PDYA 4R3UA 1XC6A 3M0KA 1RD6A 1CGTA 4GYPC 1LLWA 3QV8A 1XG4A 1OFDA 4JY9A 4E0CA 4PCSA 2I9EA 5T91A 3NDZA 4YTUA 3SCVA 4XZ9A 4AHOA 1VCGA 3POHA 2HNEA 3WDIA 1F76A 1LWIA 5HK4A 3TTEA 3JRKA 1XLEA 3WLQA 3H7UA 2Q3OA 3WLMA 1PPIA 2UY2A 3N25A 3P3BA 3GHRA 1CENA 1S5MA 2XU2A 3I3EA 3LG3A 3PZTA 2NLYA 1MNSA 1KRMA 3GTHA 2QR6A 4Q22A 3QY6A 4WJEA 3OIHA 4HPJA 4J3UA 1B3OA 2B7QA 2WZTA 2F2KA 1DORA 4H04A 1UD3A 3D3FA 4BI5A 1KLZA 1M01A 3FGCB 1YPXA 2XGIA 3GSMA 2WC4A 1OYCA 2X2YA 4UTUA 4HN8A 5KZMA 1HJWA 4PH6A 2REQA 1QFEA 1ZALA 4LAKA 4Z2HA 1F5ZA 3NGFA 1W5PA 2VZVA 2PSNA 4ENLA 4AXKA 2EPNA 3UWWA 3ITGA 2J7CA 3WH9A 1OIFA 4K38A 1B9ZA 1OD8A 5D2TA 4JY8A 1LL7A 2P0OA 4K1WA 5FOOA 3LSBA 2EGZA 2NLIA 2VX4A 2Y89A 1UC5A 3E2RA 1A5MC 3L5MA 3K46A 2CLOA 3G24A 3BOFA 1VS1A 4YTQA 2BB0A 3RRAA 3VX1A 4AIEA 4JN7A 3GE7A 3L4XA 4O17A 3QMRA 4IL2A 3PBWA 4PEKA 3KBVA 1SGJA 3UJFA 2FPYA 2FGLA 3CAQA 3GG7A 2X0YA 4O14A 1IR1A 4C6FA 1TB3A 5LIYX 5A8NA 2WSRA 1WX0A 3CTLA 2ZXDA 3PJTA 1SSDA 1XD1A 4O0KA 1WOAA 3SR7A 3MHGA 4WVXA 1EBHA 3KM8A 1YE6A 1H2JA 3WK0A 3B03A 4GI4A 2DSWA 1W8SA 2V2CA 3GFXA 3MWAA 1EWEA 4R53A 4AEEA 4PL1A 1PCKA 5K7JA 1PX8A 2RUSA 4QNEA 4XQ6A 3WY1A 2XINA 4NX0A 4PMYA 4DF0A 4IQEA 2NZLA 2FZMA 3BJSA 3DYPA 3L9CA 3CZLA 4JL1A 2P5NA 3DKLA 5EL1A 3NYZA 4BI7A 1P1XA 4H6EA 4XZMX 3A5VA 1ZP3A 4DM2A 4ROPA 1XRSA 2PDPA 4US5D 3LBOA 1W5MA 4J4KA 4LJ3A 5JH1A 1YTKA 1E71M 4XAYA 3SN0A 4TVCA 3AJXA 2VFGA 5HNTA 3CIVA 1DJZA 2J4GA 2VD9A 1BEUA 4KRZA 3FDGA 1OF8A 3AIRA 2DH3A 3WUBA 4DO4A 3M5VA 5BWAA 4NJIA 4XBJA 2WC3A 4UFKA 4AH7A 3VXGA 2BV9A 1AD4A 3QRHA 4Z0SA 3SCRA 3SGUA 2FHFA 2P8CA 2ZX5A 4HP5A 3HG5A 4FXRA 1I1XA 4H1ZA 1FFQA 2HMCA 1SW7A 3PZOA 1AH0A 3RLHA 4RE3A 4NJGA 2YL9A 5CSRA 4LV4A 2BDQA 4HMCA 3LCWA 5CPLA 3O6AA 5FEWA 3ECQA 3NIYA 4QE4A 3VFCA 1K70A 4JTKA 2QHAA 4CEXC 1ZRQA 3E2QA 3GQYA 5GNYA 4A3RA 2IUZA 2D1ZA 2F8QA 1XUUA 4MB1A 1IWAA 3GG8A 4US6A 4M19A 3VX0A 3HU7A 4R33A 3KAOA 4LCSA 1B3ZA 1CECA 2D22A 3ITOA 4UZSA 3DOPA 3V36A 1BAGA 4C1KA 4WCJA 1JZ3A 3WJYA 2HTMA 4UTJA 4LWWA 5AY7A 1LOLA 2CZDA 1UP0A 4RK8A 3DYOA 5D8WA 5AVHA 3QSTA 4GH3A 1J11A 1LBFA 5FL0A 2BOGX 5EB8A 1A80A 1RR2A 2E40A 2V5KA 2YDQA 3TAOA 4J3VA 4E8GA 3IAPA 3S2LA 3A4JA 3VOCA 2INZA 2VFHA 4GGBA 4M1BA 4FXFA 3RNDA 5EMJA 5A5WA 3SB0A 3SEPA 9RUBA 1KC7A 4Y7EA 1VGAA 3F2DA 1TSIA 1GZJA 3TWAA 3SFKA 3W7DA 1NDZA 5CXPA 2D2GA 3NSMA 4LEFA 2IKIA 2BODX 3B8TA 4PMJA 2CLMA 4NZ4A 1C9DA 1DL3A 1MSSA 1C8XA 2PDNA 4PUKA 2CWXA 3AUJA 3A3WA 3CQ0A 4XISA 4PRRA 3ARSA 1EL3A 3S5ZA 2VRJA 1A5NC 3OG3A 4KEVA 3MB9A 4ZO7A 2C91A 3VIJA 3W74A 1TQXA 1D3CA 2Y24A 1C3FA 3CMJA 3LI1A 1XG3A 3BSHA 3H53A 1WCGA 3U9IA 3A47A 1PHQA 3ARTA 3NL5A 3GDRA 2NW0A 1R9XA 1O4UA 5LSMA 5I3FA 2WHLA 3VNKA 3LRLA 1EUNA 3MZNA 4K7VA 4V1XA 1TR9A 1N8IA 1D2KA 4HPHA 1V6YA 3CQHA 4UTWC 4JXCA 1AQMA 4W93A 4NIRA 1F6YA 3PTKA 1NF7A 1XLCA 4G7EA 1XGDA 3G22A 5MF5A 4Y8FA 2X42A 5IFTA 3DXIA 2WMKA 1JZ7A 1TTIA 3EDEA 1PKNA 1ZENA 3CJPA 3HG3A 1PYFA 3W27A 3E2VA 5C0QA 5EBUA 2YA2A 3O7UA 3M64A 3ZLFA 2VCBA 4CQ9A 3EMCA 1AW2A 1TWIA 3WMBA 3C3NA 3H70A 1RVGA 3O6YX 1J4EA 1ZCCA 3BC9A 3E2SA 2G37A 4XSLA 5CPTA 1FOBA 3FLUA 4PSRA 5IFPA 4MLRA 2YDRA 3DYMA 2ZC8A 2HDJA 1PBGA 2OEKA 3DFOA 1J0KA 1SMDA 1RLCL 3WH8A 3NM1A 3TP4A 3NXFA 4M29A 3F03K 4UR8A 1PZ3A 2DORA 3O15A 1PUDA 2A3AA 5E0KA 1EA9C 1AQHA 1LLZA 2GVLA 3MT1A 4NILA 4P7RA 3PVFA 1WKFA 3R7MA 3VD5A 1WKYA 1QPNA 1V0MA 3GU1A 3RGTA 4H6QA 2OODA 1QNVA 4GVFA 4KWSA 4W88A 3UXDA 1O60A 4A22A 3E9AA 3T9PA 1KBBA 4YVXA 3Q65A 2HRWA 1E4NA 4DNHA 5D05A 2ASHA 1G67A 3MWCA 3RLGA 1ZJBA 1W9VA 5HULA 4B3KA 3GFYA 2ICSA 4UB9A 3AHTA 4QIUA 4PUWA 4A3HA 3MKCA 4UTKA 3QKEA 4GPNA 3W7LA 4JPGA 1K02A 1KM3A 4GYKA 3ZJKA 2JIWA 3F2CA 3WDQA 5JIPA 2HBXA 1YXYA 3FEMA 4LBUA 5DXYA 4OV4A 5DMYA 2PLCA 2VRKA 3GZ3A 4DJDD 2PGWA 3PSWA 1TPB1 3CT7A 3GK0A 3UZZA 1H60A 3FAWA 3TYBA 5C9WA 3H2CA 4P7QA 1OGGA 2J7HA 4AIUA 3WENA 2ZUSA 5CGTA 4QE1A 1UPPA 1DIDA 2O7SA 3VD9A 4JX5A 5FEPA 3HJEA 4JDBA 1MO0A 1ADSA 2VEIA 3SSJA 2PA6A 3CASA 4I9TA 5DCBA 3QTPA 2NWSA 3ITTA 4AD5A 3EKZA 5DN1A 1EXBA 2GJNA 5CC6A 3CWOX 4NUWA 2IQTA 4GY1A 4LH8A 2W66A 4C6BA 2QDGA 1IEQA 4FAMA 1P43A 5HAOA 1B0IA 3DI0A 4LC6A 1QAPA 3EB3A 2VC5A 1X6NA 1Y8BA 3BE7A 3ZVHA 5CGQA 2GL5A 2IPFA 1XD0A 5AVNA 3K8LA 4DUVA 4XIAA 3VDCA 4H9MA 3DFHA 4N9CA 3NTYA 1Q66A 4FMVA 1GOXA 1FH8A 1CYGA 3GW0A 1PTAA 2G3NA 2NQZA 4JEJA 1RSCA 1W1VA 2V5DA 3KBNA 2I14A 3VILA 5RUBA 3AZRA 1EHAA 1FWNA 1GNXA 2WV8A 3HFTA 3HJZA 3SO7A 3PG9A 4AZ5A 1FTXA 5I77A 2DIKA 3KXQA 3TQ0A 3RDKA 1FXPA 5TD4A 5G4HC 1KFCA 3W83A 4S3DA 3VNYA 4MTVA 3PF3A 2J88A 3U2CA 1QWGA 4GUFA 3WUFA 1LQ2A 5BXTA 3PM6A 2VWTA 3THCA 3T81A 2J7EA 4QJ3B 1GVQA 4R7WA 1C8QA 3NZQA 2J7GA 3ZSTA 4C6JA 5I3HA 1C91A 3LCIA 3FOKA 2HBVA 1BD0A 1MRAA 4BJHA 1G7VA 4RNIA 3S1GA 1XBVA 2F6KA 4HU3A 5XIAA 1Q65A 3N2BA 4V15A 2YIHA 1FX6A 1AZ1A 1FBAA 1LWHA 3PSVA 1A5KC 1GYLA 3INPA 2QIWA 2W79A 1Z32X 1BWKA 3G1XA 5D2YA 5LNVA 4A05A 2UV8G 1NWTA 4IXHA 4MDPA 5DEZA 3LCFA 2A2IA 3E0IA 5G2WA 3UP8A 2CBJA 4WGXA 2VFDA 3OLGA 1M7PA 5JU6A 1VFOA 3WLLA 2Y8VA 1MQPA 4HTYA 4L6HA 1XDLA 2GUYA 3XIMA 1GTHA 4IJCA 1MI3A 1M7OA 3MP3A 4PMOA 5FJTA 4E5TA 3SRHA 3DESA 4LVGA 5J5RA 4O15A 1JGMA 1IZCA 3N4FA 2FZ9A 2KAUC 1WAUA 3BLFA 4JYFA 3CLMA 4TQTA 4P7LA 1B4KA 2FH8A 3M5ZA 3CGTA 3AIUA 2WMIA 4IIHA 2ZXBA 3GDKA 1OHLA 4AWUA 3SM0A 1T5AA 2C6QA 3NM3A 3M0VA 3M5XA 1PKMA 2OSYA 1UQYA 3GDLA 1K9EA 4AD4A 3PBVA 2YZ5A 3OBAA 1YLVA 4H8UA 3DFYA 4ZQNA 4H6KA 3QKZA 4I6KA 3KWSA 4RUBA 3VUPA 4NT0A 4CCEA 4Z2JA 2XYLA 2C16A 3I7QA 5AC8A 3ZLGA 5DXXA 3VIFA 5AC6A 2ZE0A 3EPOA 3OLDA 3H2AA 3MMUA 1N55A 1QJWA 2PMQA 4RXGA 1EJXC 4ZO6A 2BWGA 1J0YA 3W7QA 1YBQA 3PP7A 3BG5A 3PZGA 3SN4A 2NV1A 5HMDA 2QDHA 1BF6A 3W2LA 3NDYA 4AVFA 4ZMGA 2Y6ZA 3CLWA 2OEMA 4DWDA 1WB0A 1PWLA 2OELA 1N2VA 4UTTA 5FEZA 1RCOB 4JTDA 2O56A 3Q67A 4D6FA 1TTJA 4L4OA 1HJXA 1CB7B 1J01A 2JK2A 5C2XA 2XIMA 2J7BA 1V08A 3RU8X 3ARWA 1XLGA 4FB7A 2ZZ5A 1XLHA 4H4IA 3A4WA 4MF4A 3VOJA 4EIVA 3E3HA 1HG3A 4R9OA 3G1YA 5LA2A 1TMLA 3KTSA 4DWSD 3FNDA 3L5AA 2O9OA 4MM1A 2ONEA 5EBAA 4D71A 1NU5A 1DWGM 3EWDA 1IZKA 3BSMA 2CLHA 1SO3A 1JPKA 1RQEA 1MUCA 4WF7A 3BANA 1GYNA 2PS2A 2G4JA 2VEGA 2OWCA 2QUUA 3T55A 5K3VA 4H8VA 3ARPA 3SCUA 2FVKA 3V5FA 4NI8A 4CQBA 4X0NA 3U6WA 2VR5A 1JL8A 3T07A 2BHZA 3C0JA 1DJWA 1DJXA 3WBEA 3WSUA 3LA4A 1H7NA 3SQMA 4UQBA 4MZ8A 3T05A 2F6XA 1DWIM 5HJYA 3BJFA 4XO7A 3NEVA 3MV11 2Z1XA 4JQAA 2NSXA 2ACQA 2AMXA 3MANA 4H6RA 2WKJA 3S2CA 3AUOA 1F2JA 1NSJA 1ONXA 1ECEA 1H5YA 1G94A 4CCCA 3A3XA 3UW6A 4RZ5A 3PJWA 4IMAA 4RPQA 2VJXA 1GTEA 3AXHA 1W1TA 3VCCA 4HVXA 1F8IA 2O55A 3VIOA 4QAWA 4ZSUA 2DQXA 2PTXA 3LS9A 1VBHA 5CBIA 4O1AA 4WXZA 1FHLA 1OIMA 3H4WA 3IVTA 1XI3A 1BSIA 1K7EA 4XWUA 3DU0A 3NL3A 3SCNA 2PDQA 4TO8A 2BY1A 1JCLA 2VD8A 2CNCA 2XH7A 4DF2A 1E40A 4I3GA 3W25A 1MDLA 1B3XA 3VIGA 1MYRA 1E1EA 1OFEA 2NT0A 1NFBA 1JYNA 2YCIX 4FR1A 1M41A 3K30A 3NWRA 4I7WA 4IX0A 1AW5A 4F8XA 3G5EA 4S23A 1E4IA 1JZ5A 4GNVA 1FXQA 3BICA 4XAPA 3FV9A 3PC0A 4DYJA 4WXYA 1OM0A 3RIKA 2ZOXA 1US2A 4WIWA 1KRBC 1KXTA 2WSYA 3PTDA 1KWKA 3EOEA 1Q7MA 2J62A 1X8CA 1C7TA 1XC4A 3UR8A 1O95A 3WJXA 4D6GA 4B5UA 2NVAA 3L2LA 3P80A 2I56A 4UIOA 3W7OA 3MS8A 5H2ZA 3CMFA 4EF8A 1KFEA 3RYSA 3KVJA 1ZJHA 5I24A 3IEBA 3VNMA 2VXNA 3QLDA 2OXNA 2GGIA 4BK9A 4IIDA 3LPOA 2C0AA 3ZJ8A 3UU0A 1YQ2A 1O6IA 1WNOA 4IM4A 2J9XA 3DG3A 1EJRC 4NJJA 1H7RA 5A8PA 3IARA 2CBIA 1NM9A 3LPPA 4PB5A 2Y61A 3ONBA 4AZBA 4WUIA 3LCGA 5C2GA 4N02A 1IXOA 2WNQA 3TW9A 4D6JA 4K6AA 2LLEA 1V4YA 1XIJA 2Z2BA 4PUEA 5FESA 4EAYA 2V3GA 4L56A 4DWSB 5LHEA 4HPNA 4REQB 3RM8A 2BGNE 2VYOA 2YL6A 4YU1A 3B4UA 3VCRA 4E2DA 4QX4A 1NOWA 4C90A 1V0KA 1U83A 2H8ZA 2OSWA 3UT0A 4HOWA 4BHYA 4HOZA 2VHLA 3WQFA 1KV5A 2BOFX 4XZIA 4A8IA 3G3MA 4LT9A 3LN3A 4E3VA 4Q8NA 2ZX6A 3AHVA 2CBUA 4H9XA 2WMFA 3URAA 5AHIA 5M2FX 5D04C 1KBKA 3AMDA 2C3ZA 2Y4SA 2OQYA 1OYAA 1J0JA 1TE1A 3HM7A 5FF4A 3LLFA 1QI5A 1HQTA 3FVDA 3YPIA 2C13A 4QLJA 1VFTA 4HK5A 1H11A 4OJYA 4WDUA 3G1AA 3FYYA 5CKSA 3IV8A 4HYWA 4KGJA 2TSYA 4JQ1A 3JS3A 5FIPA 5FF3A 4GNKB 2PWGA 2QCCA 3C2EA 2OLAA 2CC0A 5HQLA 1V7YA 3QFWA 3TN3A 1JI2A 2XZ7A 4Q8MA 3NNTA 1IT8A 2J9YA 4A29A 3GNRA 2XM1A 3QF0A 3APYA 1R46A 4NJHA 2GJXA 1D7KA 2RJGA 3W73A 2V82A 3KBMA 1YPFA 4IP5A 3N19B 3A22A 4TMBA 3FYPA 2XFFA 3N9KA 4C1NA 1XCWA 2CETA 3DFSA 4N7QA 4P5UA 2ZRWA 3FKRA 2OZ8A 1I75A 2V63A 3CQJA 4H7VA 4D1IA 2I16A 1QO5A 1KM4A 2BHYA 3DIPA 4XZNX 1DTUA 1PZ1A 4RKAA 2F61A 3BVJA 4IG2A 3CXOA 4CVUA 3P0XA 1FWDC 3RRXA 4ZL1A 2BFGA 1XF0A 2WSPA 1BG9A 4GYJA 1XLBA 4ACZA 3EWXA 1LWJA 5HOSA 2W27A 1JYXA 4B5NA 6XIAA 2ZZ7A 5BOFA 5D9MA 5A8GA 1SZFA 4H7CA 4GOAA 3OVGA 2FGZA 4EVZA 1MUWA 2Y7EA 3CBWA 2FDMA 3I65A 4I90A 2TODA 3UF9A 1T8XA 2W3ZA 4MJ2A 1J2WA 4BEQA 4QM1A 3M1ZA 1VZWA 3DENA 1I0DA 3WLPA 2GUUA 2O9TA 2V2DA 3B0PA 3VD4A 1HJSA 1GHSA 3PAOA 1KQZA 4C7FA 1A3XA 1VAHA 4YWIA 2EHHA 2OYLA 2GPTA 3GIYA 1YBQB 3W3OA 3WBYA 3BMVA 5CJNA 3G8RA 4C7DA 4AEFA 2PDJA 2A7NA 3UVIA 1W3TA 5K9XA 5DANA 3T4CA 4DZAA 5F7UA 3FJ4A 4AQLA 1BGAA 1O1ZA 3W26A 1EYWA 4F4RA 1HGYA 3HTWA 3EEZA 1HN1A 3CYJA 3P62A 3DKJA 4O4WA 1HP4A 4Q8WA 1UD8A 4IPNB 3S1UA 4IMFA 3JZEA 1FHDA 2DZPA 5KMYA 3G3DA 3CZJA 3VAVA 1CLXA 4S3KA 4EACA 4QG8A 3KE0A 3MO7A 5C9ZA 1K77A 2R1PA 4WKAA 2ISWA 1TJRA 4AW7A 4CQ8A 3LQLA 4O57A 1EP2A 4BFAA 2NQ9A 4NASA 5AZ1A 1FCQA 4QCFA 4HB7A 5JIWA 3SAZA 2P76A 1WZAA 4TX6A 4DBDA 1KR0A 2R82A 1XIHA 3PBMA 1KTNA 1KM2A 3IJ7A 1JULA 3GBDA 1JDFA 2NVCA 4U33A 1B57A 1NDYA 1EOKA 2EO7A 3LM3A 3COTA 4OV9A 3RM4A 4FO4A 3EX6A 3MI2A 3I3BA 3KFTA 3VGDA 1EA0A 5CZJA 2OOGA 3OZPA 4LFYA 5A6LA 1Q4WA 4JHOA 1CXIA 1MRQA 4XZHA 3R0DA 2Q6ZA 3BW2A 1MFUA 3STGA 1JPIA 2CCRA 2YOCA 1HGWA 4RDVA 3LHUA 1UD2A 4M80A 3W72A 3MBDA 3WMCA 2WQPA 4QCEA 2TMDA 3UJ2A 4NZFA 1PAMA 4HSOA 3TXZA 3T40A 2HJPA 4J3ZA 3FVMA 1K7FA 2ACSA 3KBWA 3NOEA 1BRLA 4AD1A 1T8QA 3C52A 1ZB5A 2Y70A 2YW4A 5IBXC 3B9AA 2HEJA 3OQEA 5KEZA 4F0LA 2VCCA 3SGGA 2GDQA 3DERA 1KLYA 3F4DA 5GVJA 2REQB 1J9YA 5D09A 3AQUA 4R27A 2DIEA 3GDMA 2QT3A 3OOQA 4GKTA 3KW3A 2WZHA 3VOHA 3T78A 1WDPA 2X09A 3TYEA 4MNLA 4CNOA 4DNMA 1I4NA 1Q4NX 4AZHA 1H7OA 1SVDA 4O28A 3VMNA 3KS6A 1IXNA 2XFYA 4DJDC 3W7EA 3D5HA 5ECUA 3WJWA 5BNKA 3MMWA 1I60A 4YVVA 3M41A 5DY2A 3B0XA 4NAEB 1Z42A 2ODOA 2FPVA 4M5PA 1GK8A 2ISDA 2DZXA 2FTWA 1WE5A 1F74A 1XW8A 2EBNA 4JQ4A 1XIMA 4JYDA 6ENLA 3LGGA 2V6AA 4JGDA 3A4AA 3QFEA 3I6TA 2VI0A 3RILA 3LENA 3V1PA 4LBSA 4PMDA 3T7VA 1UHVA 2VEFA 5CPQA 5AYXA 3F7JA 1BQGA 3W70A 3KRUA 1HNYA 3D3AA 4PULA 1HKVA 2OZ0A 3ARVA 3WNPA 3P61A 1JPDX 2VOMA 1BYDA 5A1AA 1NQ6A 3N34A 3HIJA 5AZ0A 4S1FA 1I2RA 3C2VA 1EYEA 2RFGA 2A4AA 3W1XA 4FNUA 1K9DA 2C8NA 1EHNA 3W7KA 1VYRA 3EOOA 2JKAA 4W8BA 1DWJM 7TAAA 4RNHA 4GXWA 5M03A 1DBTA 4H83A 2DDXA 4CCDA 2X41A 1I45A 1AMKA 1LT7A 1BGGA 2OPJA 2XISA 4FLOA 1Q3NA 1R3TA 3QHOA 2J25A 2PTDA 4JN8A 1KGWA 1VEPA 2V3DA 2DZUA 2DW6A 3KRZA 2WKGA 2WOQA 4DUWA 1Q2RA 2FMNA 4HZ7A 4QGCA 3A21A 3E1F1 1T41A 2ZIDA 2EF9A 3T0BA 3TAKA 2ZWYA 1UWRA 1AUSL 2P0IA 3H26A 1YNPA 4B2DA 1K9FA 2YR1A 3BMWA 2QUNA 3FFSA 1LTDA 3WJZA 1ZAIA 1TUFA 3HN3A 4PB4A 1FA2A 1ONEA 1TV2A 1R86A 3R4IA 2W5FA 4KEMA 1V6VA 4LX4A 3UG5A 2OQLA 1HXJA 2E6DA 2VNCA 1K3UA 2D3LA 5HQEA 2CKRA 4O1BA 4WK9A 3M07A 3AYSA 3SCSA 4B92A 3B0YA 3OGVA 3CPRA 4J9JA 1UMLA 4Q8PA 2BHUA 3QZ6A 2MUCA 3RR1A 3TJ4A 4EPDC 3CUFA 3MBFA 3TN5A 1QNOA 2Q3RA 4UNLA 4GQRA 3N6HA 3SN1A 1Q45A 4JX6A 1BG4A 3SCWA 3KEHA 2YCJA 3ZT5A 2R6OA 3WUGA 2YXGA 3CL6A 1US0A 3MHUA 1EB3A 2WQDA 4GHRA 2PRMA 2GK1B 2YYUA 3IRSA 1A4MA 2ZUVA 2GVYA 4IGNA 4QTGA 3WDHA 2PD5A 3A23A 3CZGA 5MKGA 4GCXA 4MZYA 5AC7A 1ISYA 3GDBA 1S2AA 3SZ8A 4W87A 2DZVA 4ICMA 1ODUA 4L4LA 3W2KA 3S9IA 4QG6A 3EA2A 4IJRA 2PWUA 5I6SA 4UFMA 5J8LA 5I02A 4N6FA 4Q8TA 1XX1A 3NQGA 4J27A 5GNXA 3UY7A 4UR9A 3BLKA 1G4TA 1QBAA 4LXFA 4RZ4A 3IJ8A 2YZRA 2VC6A 1RUSA 2VUNA 2D2JA 4HU8A 3HFYA 1XYBA 3KLKA 1FP9A 3PFRA 1REQB 1G4SA 2Z7KA 3S1XA 4GACA 4NX5A 2PURA 1UZ4A 2AGTA 1DHPA 3XISA 2YDSA 3ANVA 2WBGA 4GLEA 3UR7A 1NF0A 1W6TA 5AFDA 1J93A 1AJZA 2C18A 4XO6A 1GW1A 2CLPA 3B9DA 4WKFA 3LGDA 2YB1A 3VE7A 4BCEA 1Y5WA 4GI9A 1XCFA 2BY3A 3MP4A 3CAWA 4LQ1A 2ON3A 3I7RA 4WJXA 3ARQA 4JTQA 1IR2A 3LCXA 3SUWA 3OPSA 4MHBA 2PEVA 4LRTA 1MXGA 3GO2A 4J2MA 4S3AA 2BXYA 4K8GA 1DTNA 1UD6A 4ERGA 2ZVIA 3RX4A 4TU1A 3FA4A 3ZQ9A 3O6DA 3WH5A 4HA0A 3RO8A 2WC7A 1TQJA 4CQCA 1XLAA 4TTGA 5CJMA 4AD2A 4MNKA 3I7SA 1TV3A 3R43A 4AB4A 5CQ1A 1E9ZB 3WJSA 3GVRA 1QHOA 4JTUA 3UR2A 3LTYA 3TZFA 4B5TA 3CHFA 1F3EA 4CNNA 1L2UA 2E9LA 4GABA 4QE5A 4GKLA 4OZOA 1W5QA 2D73A 3MKVA 5F4WA 3VD3A 3TQKA 3HPXA 4F9DA 3JZUA 4IUGA 1RBLA 1YEYA 3AROA 3DI1A 3QHNA 1X39A 1LL4A 4B5SA 2DT1A 1HJQA 2Y0FA 2ZADA 4Y8EA 1U22A 2FKPA 1NDWA 2TPSA 5M5DA 5A8QA 3VI2A 2CU0A 4UOQA 2VGBA 1UP2A 3L65A 5EU9A 4FNQA 1XFCA 4NZ1A 3W23A 1LM1A 3PBYA 1CXEA 5KETA 3EYPA 1NJJA 3TR9A 1A3HA 1UPMB 2P88A 3WQDA 1S2VA 2G8ZA 3B8UA 3OZYA 1JFHA 4U31A 5I2UA 2DZTA 1XIIA 4F66A 3ES7A 2PC4A 2ZRXA 3NSNA 1FWAC 2XZ9A 1KM5A 1Q8AA 3AWNA 3DX5A 4FLSA 2XG9A 4UFJA 3IUIA 3PUEA 1RVKA 1DVJA 4Q8UA 5H1WA 1TCDA 2GSHA 1LOSA 2PTWA 1UP3A 3TCEA 4Q7NA 2FPTA 4YL2A 1QATA 1DV7A 3UVAA 2QCMA 1KXQA 5REQB 3GRIA 4X61A 4UCGA 1OZMA 4DELA 4BQ5A 5DRCA 2WLZA 4A8NA 2QULA 2A7PA 3HGRA 1JRCA 2AOSA 3C8FA 3W7HA 3CUJA 2E8YA 4GUJA 4DAFA 1TRDA 4FF5A 1YNYA 4Q4PA 1AA1B 2GOKA 4KPLA 3ITXA 2G5WA 1IEXA 2Y5SA 1X8FA 1L6WA 2ZUNA 5CZ0A 3DBPA 5M17A 5I3GA 1OX4A 1QCWA 3POCA 3M0IA 3KVLA 2C71A 3DCPA 2RH9A 4NAFA 5EMLA 1VBUA 4MB5A 3TQVA 4DPPA 1IWBA 4KFNA 2Z26A 2VO5A 1DQXA 3KZSA 2KX9A 1E6QM 1G1YA 2AL2A 3C2RA 3FYOA 5FEXA 3QVQA 1RBOB 1VLWA 3LNPA 1PKYA 5LA0A 2FHBA 1LP6A 4IG2B 4GO9A 4LBRA 4U5IA 4ZSTA 3VPLA 3TYDA 3GXNA 2DT2A 3KOFA 1F6PA 5FSEC 5HJXA 2NX9A 1YDNA 3WK1A 4FS9A 3R11A 1XH0A 4C5YA 4IGSA 4B16A 4JNYA 4DJFA 2VDHA 3V0SA 3U2EA 4RPPA 3TU9A 2GK1A 1KFBA 1VFSA 2AQOA 4RE4A 4CQAA 3ITYA 1HKIA 4BQ3A 1J96A 2V67A 1ZTVA 3U4FA 3SY1A 3AIEA 1K8CA 3TSBA 2INFA 6PTDA 4PBGA 3MU7A 1TPC1 3VKCA 1E73M 1XIFA 2YCKX 3OQ8A 4MVAA 2Z1SA 3T0AA 2R91A 3BSGA 3O0KA 3BLIA 3R2GA 5HA7A 4RNJA 5C5YA 2QQ6A 4AU0A 1HUVA 2CBVA 3G0XA 3RM9A 2XIQA 5M1TA 2PDXA 3I3DA 1TJ1A 2R14A 4LUJA 4KESA 4E6MA 4XKYB 2OEJA 1QNPA 1O12A 4LYPA 1X98A 4OE7A 5E93A 5FJJA 1HT6A 4WQ6A 2QCGA 1IHIA 3ZSSA 1WOBA 2Z1KA 4PB3A 3VKBA 1WO2A 4AWEA 1A0EA 5LNSA 3E49A 3P5YA 2VFEA 4HMNA 2OOFA 2YBUA 3PHAA 4HZ8A 4ZBCA 4GYFA 2FGBA 3WQEA 1XLFA 5L9FA 4OT7A 4MNMA 2QCEA 1HP5A 4RE0A 3K1DA 5F1VA 4FA3A 3PUGA 1DIOA 3VU2A 1W2VA 4XB3A 1UR1A 4C91A 4CGTA 3UWVA 5C55A 3VZYA 1CDGA 2HV5A 3DGBA 4ZB2A 5CZSA 1IXPA 4IPIA 1V5XA 2BGQA 1LYXA 1ZZMA 1TREA 1CXLA 2XVNA 3UPBA 2YJQA 3WK3A 5I07A 1FCUA 1GVRA 2J7FA 3RR4A 1JXJA 1W1PA 1U1JA 4H01A 1UR3M 3P84A 2PPGA 2Z25A 2GGEA 4ZEPA 5ABEA 3ZFHA 3GB6A 4I7VA 4ZOBA 4F40A 4IZGA 1XH2A 2QPSA 1GQKA 1SJAA 4P2VA 3H4XA 1E72M 4F0KA 1QW7A 2PP3A 5G1MA 1V8EA 4YYCA 4PUNA 3GTNA 3UXLA 2QMJA 5K4ZA 2FMOA 2X7VA 1B30A 2ZWZA 4HCLA 4G5DA 1YE4A 4AD3A 3DAQA 3S6TA 5AYZA 3TR2A 1IXQA 2YX0A 1GEHA 3GVWA 2PE4A 4KMQA 2WPBA 4PA8A 4LUIA 3UZ5A 3AXKA 1AJ2A 4REQA 1R3SA 4GYPA 2VWSA 1UR9A 4DJDA 3CV7A 2R1LA 4BQ2A 1UA3A 4AZGA 4GZJA 4IFKA 1XDMA 1ZUAX 2D2HA 4N9DA 3WD1A 3LHWA 4IFRA 2P50A 3GW3A 3S3GA 4I6VA 3H54A 4XKYA 1O66A 3U8GA 3EBVA 3N17A 3BZGA 3OGRA 3BWWA 4RDZA 4C1LA 1QWKA 3AYVA 2B7OA 4X63A 2OVLA 3W1RA 3E12A 3WQ6A 4MUZA 2FZ8A 3VM5A 3WQ5A 4GD0A 5FI8A 1D3HA 1I2PA 5I5RA 4KFOA 2NVDA 4IICA 4IPPA 7ODCA 4L6OA 3RAOA 3WDJA 5E9XA 4MJZA 2PB1A 3WQVA 1MZRA 1CWYA 1KB3A 1J12A 2HE5A 2C1GA 4JYEA 2ZZ6A 1O5XA 1RPKA 2ABAA 2DJXA 2XM2A 3W82A 2E67A 3U4AA 1DJQA 4OOZA 4V33A 1GW9A 5CPMA 1IQ8A 4L5ZA 4MB3A 2V38A 1VCVA 1GQJA 5SWUA 4D6DA 2FHCA 2GVEA 1M3UA 3AIQA 4X22A 2YPIA 3AIBA 3W22A 1HL8A 4K1GA 4DZ5A 3BGGA 3WF0A 2XFWA 3RPDA 2WHJA 1FCBA 3NQVA 5A94A 1R7AA 4MMWA 4UTHA 3U7BA 3F4WA 2OGYA 2I5IA 4JKLA 4XD5A 2DZAA 1W1A1 2DUAA 1EJTC 1TMHA 4WJ8A 3JVAA 3SCPA 3BAXA 5A6TC 3C5QA 3ME3A 5IDIA 3MI3A 5GJPA 1A5UA 4AWTA 3GXPA 1MDRA 5TAOA 3KL5A 3CUGA 1MNZA 2X1SA 4C6CA 3WD4A 2GUBA 2OKOA 1UKSA 4IJBA 1GJWA 3AICA 4Q32A 1UWSA 2D0FA 5HATA 2XH4A 4AMCA 1EOMA 3NL2A 3PWAA 3N4AA 1EP1A 3NZRA 1OFAA 2D0GA 1F7BA 1OCJA 4NHVA 1LF1A 3KBSA 1O5KA 2ACUA 2ZUUA 1REQA 4M82A 3LMYA 4JS3A 2VEKA 2VZSA 3AS3A 3R10A 3M4HA 3QC3A 4MNJA 2HCVA 1GEQA 2EQDA 1L8PA 3BDKA 3PAJA 5BRBA 4KIEA 1DWAM 1XGZA 4JNZA 4ZR8A 3GU9A 4PTMA 4YHGA 1VPYA 3BOXA 5JBFA 1VCFA 3QN3A 4HSHA 5IHRA 4J40A 4C6PA 1UOZA 3PZVA 2Y2WA 1B54A 3CC1A 1E5NA 2CLIA 4P8VA 4EWJA 4AY8A 1EJSC 1E6SM 1I0BA 5DO8A 3QM3A 4XZWA 4QITA 3P7YA 4ERAA 2ACRA 4OIFA 2GGJA 1ZBCA 1SFJA 5MKGB 5KSWA 3OIXA 4Q4SA 2YFOA 1HVXA 6TIMA 3TONA 3GH4A 2B7NA 3R25A 5LIUX 2F9RA 4L1XA 5E5CA 3T2PA 3WLKX 1VFFA 3DH7A 3K2GA 5FKYA 3UA4A 3V35A 4FIRA 1NP2A 4EK7A 4PODA 2O9PA 3BQ6A 1AZ2A 3LYEA 3UY8A 4A2SA 1XLJA 3IGSA 1G4EA 1RCXB 1IWPA 1VENA 2J74A 2XWEA 2BS9A 1F61A 4BS0A 1AH3A 1TPH1 2F2HA 2WWDA 2AGKA 1W8GA 1KCXA 2PDLA 1W5NA 1XRFA 5KZEA 3IK2A 1B90A 3HQPA 3VOIA 3GNPA 3SBFA 1W2PA 4ZE5A 4MADA 4MJ4A 4MWAA 4HU0A 4NNCA 3L2IA 3HURA 5CSUA 1CXFA 1W17A 1LQ0A 5DMNA 2DSZA 4PCNA 4S3JA 3GBEA 3W1UA 1QPKA 1P6BA 2ZA2A 1EQPA 4F79A 2Z27A 4OECA 5I79A 4Q7IA 3BW3A 3STCA 3CV1A 3PUDA 2WO5A 4JIPA 3QGVA 4DZHA 2C79A 2P10A 5BXPA 1HKJA 4M56A 3ZM8A 2PDWA 4MYXA 4UTTC 3OA5A 4V28A 4J35A 5IXEA 2Y5JA 4UTIA 4O13A 2YCLB 3ZXWA 4DUXA 1JAEA 1R7OA 4Q8VA 3T0DA 4BEUA 1JDAA 2AMGA 3C2FA 2DPEA 3B9NA 3WFZA 3GXIA 2CITA 1VFLA 1W9PA 1EGZA 3VDGA 3A24A 4QROA 1CIUA 4QQUA 4LNCA 4PFHA 3RU6A 4FOUA 3W9ZA 1Q8JA 1GG1A 3L5LA 1UWUA 4JR5A 5LIKX 3VM7A 2PLKA 4PMNA 3ZLHA 3GHTA 4Y9OA 4GISA 2CKSA 1OCBA 4DWSA 3EDFA 3PNUA 7ENLA 3RCYA 4LRSA 1Z69A 4IQLA 4ATDA 3C4UA 3E74A 4QSFA 1EIXA 5FSDC 3M6DA 1CPUA 4FK9A 3N2TA 3NQDA 3BXWA 1V3HA 3D47A 1W3JA 3T2OA 1QNRA 1TV4A 2GSJA 5CSSA 2BGSA 3NURA 4HTBA 4DJEA 1SR9A 4KERA 2Y1HA 4A6GA 2F6UA 4L1GA 1TPWA 3ERPA 1WXZA 1W9DM 2Y8UA 3RITA 3URQA 1BKHA 2WVVB 5AHMA 3W0KA 4AF0B 2BVDA 2WPGA 2Y63A 4CUCA 1UZHA 3DEQA 1E1CA 1MW3A 4HNNA 1OYBA 5LYRA 5BCAA 2OQHA 1FH9A 1P6CA 3VYLA 1BYCA 1K8YA 1KGUA 3VDBA 2A7RA 1UYQA 5CC5A 4TOQA 2QXWA 3R1ZA 3WF1A 4GGHA 1JF6A 2QJJA 1D7FA 1VJZA 2E68A 1UUOA 4PBFA 5EMKA 1YXCA 4CD7A 5HINA 4RNFA 2XIIA 4X9YA 3QQ0A 2CFFA 2WNWA 4CU6A 4I5RA 3ZJ6A 2F7FA 1GKPA 4XTDA 2V68A 4HU4A 4C6KA 1EUAA 3BLLA 1AQFA 3SGZA 3H21A 2HS8A 3BG9A 4B3LA 4HOXA 2R24A 1CEOA 3OO2A 3AAMA 5C70A 3RX2A 4AZCB 3RX3A 1X96A 2G4FA 4C6QA 5KITA 1SZGA 4K7YA 3GU2A 2V5JA 3UZYA 2HQAA 2CLKA 1JZ2A 5KINA 1Z7AA 4JTRA 5CAKA 5C9XA 2RKXA 3AHYA 1AMYA 4EPKA 1KTCA 2Q01A 4CD4A 3G6LA 5TIMA 3CUHA 3LHVA 1QR7A 2HPMA 3PN8A 1F3TA 3W2NA 1AJ0A 1R0MA 3PZ9A 1RALA 1RHCA 2UY3A 3BQ5A 2BG5A 2GJLA 4ZOCA 3NYDA 1R5YA 1NOFA 5HR7A 4L7ZA 3W7PA 3VK5A 3PB0A 2BP1A 4F2TA 3DZ1A 3KVKA 1BVZA 1W37A 5XIMA 1EJUC 1EJWC 2D2OA 3NR0A 5DT5A 1MXSA 3S2JA 2PGRA 4W8LA 3KRSA 4JD4A 4BI6A 1LG2A 2VX6A 1TPDA 4CN4A 1ZU8A 1OWQA 1S1PA 4QS6A 4PMRA 4OBRA 1M1BA 1XQKA 3PZIA 3VGEA 3WMSA 3TJXA 3DG6A 2G3MA 3MVTA 1FFRA 1XBZA 1LQAA 3KTXA 5BRPA 4L4PA 4CVWA 2E25A 4JN6A 3GVVA 1P6WA 5A6KA 3UG4A 1QI3A 1O5QA 1E15A 1GUVA 1NWRA 4F0HA 1UZDA 4Z1AA 1S5VA 2CZFA 3PJXA 3FJ6A 4ORIA 4JTAA 3FSTA 2E5BA 4UBPC 3SJNA 3EXSA 1GOKA 4L65A 4CNTA 3G2GA 4C60A 3GHUA 4FX7A 1PJ9A 3DC0A 3G1DA 1HO1A 4ACZB 5DCDA 1W3KA 3FSUA 2HS6A 1Z9AA 2DIJA 2Z6JA 4MSSA 3AMCA 3BO9A 1OC5A 2YB4A 2V2HA 1WZMA 1E9IA 4GFSA 4DO7A 3K4AA 4GG9A 1ITCA 1LLOA 3GXMA 3R94A 4G6CA 2OO0A 1H1NA 3S42A 4WGHA 4Y90A 2I1OA 1MEWA 4YVPA 2IPGA 2YGYA 4ZB0A 2WCAA 3BAJA 2VVSA 1GVEA 2R1KA 1TA3A 1U5HA 4NQ1A 1DEDA 5AYIA 2GGGA 4HMDA 3RJXA 5LA1A 1WQ5A 4N9EA 1Z44A 3QY7A 1WDQA 4HYVA 1KD0A 3W85A 3S5YA 2V8ZA 4QLKA 1WBJA 2BVYA 3KUMA 1CXHA 4OOUA 1F07A 3S9ZA 2ZC1A 3B4YA 3CQIA 3OLIA 3FAXA 3VNIA 2Q8LA 4C7GA 3WQCA 2ZZ4A 1FKXA 3QH2A 3VTRA 1XKJA 4PCFA 4D72A 3LZ5A 4R5EA 1CGUA 3C6CA 4DJED 3M47A 2A5HA 2Z7GA 1VD6A 3GIQA 5FJIA 5I3IA 1XDJA 2DJLA 3WQ8A 1R3WA 2O4MA 2I5GA 5HMSA 1P0NA 3TSMA 4U4MA 3GC5A 1VHCA 1XSJA 5TNVA 3TROA 1C8VA 1H7WA 2ZICA 1PVNA 3K1GA 4IOTA 2YCLA 1ONWA 4E4PA 1CLKA 2QCDA 3PFMA 3TX9A 3DECA 1VQTA 3KCJA 3EOLA 1TTPA 3EWWA 3ALFA 3CNYA 2Y7GA 4BA0A 5FD0A 1LUCA 1HZYA 1O7AA 1PEZA 4O11A 1JPMA 3AXXA 3SURA 2ISSA 4LV9A 2AKMA 1HF6A 2PBGA 3O8AA 3TYZA 2WZEA 4PMUA 4YS1A 4Q4QA 3UD6A 1UJQA 4OGZA 3ZVHB 3W7IA 1EZ2A 3NQ8A 5I23A 3UG8A 3MMTA 4PGLA 1XYAA 2IPJA 4DY1A 3E0FA 3WNMA 4UMAA 1PO9A 3MYPA 2PRLA 1QMLA 4ZQPA 2VL4A 4BZYA 5A69A 1R87A 5A6JA 3BLDA 2G97A 3M0LA 1W9XA 3CWNA 3HGOA 3PBGA 4W7WA 6XIMA 1JYWA 4MUPA 3LSCA 1QBBA 3FW6A 4XBSA 2NQHA 4CD5A 4FOKA 1ZBVA 1EF3A 4ML4A 3UXAA 2DW7A 3EDJA 3HB9A 5BOEA 2B0MA 3SQLA 6TAAA 3VGHA 5AKQA 5AN7A 1E0TA 4O12A 1V6TA 3MJYA 3OODA 5F2GA 4JTIA 1MQQA 2NQLA 5I3KA 4KWUA 3N9RA 1K6WA 3TTQA 2GLKA 4LGXA 1P7TB 3TKFA 5D8ZA 3S5OA 3N4EA 1OCQA 4DB7A 1HO4A 2VTFA 3MO4A 3QGAC 3IJ6A 1QI2A 3I6RA 5CPSA 4DXKA 1J0HA 3PZMA 4NL1A 3GG1A 3ABZA 4YHEA 3WQGA 3PWGA 4Y9MA 2G50A 2WHKA 1CGYA 1DQWA 4WZHA 3L23A 4UTWA 3P74A 3ZMRA 1ONRA 4Q4KA 5JQ9A 1X1OA 2QJIA 4MAVA 1CNVA 2DVTA 1WDWA 3P0WA 1H0IA 3EWBX 1H50A 1US3A 3DGRA 5DT7A 3ABSA 3HQNA 1IYXA 3MSGA 4F48A 4ZQOA 4B91A 2PU1A 1OX5A 2W63A 2RDWA 1KA9F 4OFCA 1R3YA 1DJGA 1KKOA 3N3TA 1SFLA 3NPUA 1U2YA 1UIPA 3AMGA 3QV7A 2J8FA 2J75A 4W84A 2HROA 2QV4A 4GBUA 3E96A 5DFAA 4AX6A 5AC4A 1PDYA 3GAKA 3THUA 2OYMA 2WAGA 5JXQA 3S5SA 2A6LA 2QVHA 3RMEA 1IEVA 3VGGA 1X1ZA 2WMIB 3O9NA 1RK5A 4DO5A 4HKPA 2BBFA 3WLOA 1HVQA 1Z6KA 3CHCA 3PZUA 3VIIA 3LOTA 3KOZA 1VR6A 2O92A 1NQKA 1MWOA 4B2DD 3OGSA 3WCZA 2VENA 3BH4A 1M7JA 3SCOA 4QR6A 1FWCC 4S3CA 3VKDA 3WYZA 4PUUA 1JCTA 1LRNA 1W56A 2WNNA 1RCQA 2OU4A 5D33A 3OW1A 3FCPA 5JBEA 4JTFA 5HPOA 5JH2A 3WK2A 2Z1WA 3IS4A 3M46A 4V1YA 2XSAA 4KKXA 3EWZA 3SRFA 4W5ZA 5EA9A 2YL5A 3WH6A 1GGOA 4LUTA 2WLYA 3ELFA 1JZ4A 3LXAA 3E38A 1SW3A 4DBSA 1PX3A 1N82A 2JALA 2PFHA 2CHOA 4NI3A 3AYRA 3MDUA 4JQ2A 4J5NA 2JKPA 4S3BA 3N04A 3G1SA 3QY8A 4X9SA 2BY2A 4GJ1A 3CL8A 3QQ1A 5AHLA 4NSBA 1JVNA 3UEQA 1TCMA 1N8FA 1UWAA 7CGTA 2B81A 3B8DA 4CQDA 1TZZA 4AZ7A 3WIJA 4X2PA 3PJUA 4KWVA 3UR5A 3TVAA 1ISVA 1TYGA 1H0GA 3CH0A 4G56A 3ARYA 4NG3A 1EX1A 4WLCA 3W2MA 1DP0A 2OWWA 2XH0A 5D4YA 2JEQA 4P8WA 4LS0A 3V5OA 4TIMA 2JF6A 2WHMA 3K13A 3KCOA 3OA3A 3OLEA 1E56A 3FN9A 1PKLA 2A3LA 1HL9A 1UH2A 3R8GA 5BW6A 1OABA 2YA1A 3SSZA 2H6RA 3P6LA 3MUAA 3NQ6A 1TFVA 4ZGYA 2PDMA 1TVPA 2GJXB 5CC7A 4M3PA 3RJYA 4NZ5A 3H2FA 1TUXA 5CLTA 3G1VA 4U5KA 4UUIA 2PWVA 2HE8A 2XGZA 2G3IA 3JU2A 1F6KA 4R9XA 1UW9A 4EX4A 3WLJA 1R47A 1UUMA 2WW5A 3AO0A 4TV6A 1BWLA 2GZXA 2Y62A 2QUMA 3LGEA 5G4WA 4HCDA 2AAMA 3KWXA 1VYSX 4NYYA 3W86A 2J78A 2RDTA 3L68A 4TVUA 4DJFC 1SJBA 3KL0A 2J7DA 2VRQA 1OFRA 4X3ZA 1KWGA 1RP8A 4MY9A 1UQZA 2R94A 4AC1X 1XCXA 1JQXA 3GC2A 1RQBA 3V5CA 4O16A 3AZSA 3FX4A 4Q4MA 4JTEA 2QF7A 3AMKA 4FALA 4KWWA 4PMZA 1EH9A 4LALA 1VYPX 7XIMA 1XPYA 4IUOA 1OFBA 1K8ZA 3BL3A 2PWFA 2CLLA 2YLLA 4LUTB 2D69A 3QBUA 2ZUWA 4W85A 1SZNA 4AZCA 4HK6A 2XUCA 7TIMA 4O4VA 2PAJA 2OLHA 1JCMP 1BVNP 5U7SA 1ECQA 3LQGA 1RV8A 3I4EA 1PL9A 3H2EA 2FB3A 3WLIA 4HK7A 1TTQA 3L0NA 4AX7A 2V3EA 2PLJA 1IEIA 5HXMA 2C14A 1XLMA 4EWND 3EDDA 4DI8A 4IISA 3FY1A 3IANA 1F05A 3IK4A 4RDWA 2FLIA 1ITUA 1T99A 3STEA 4E4UA 5CC3A 3N6JA 1CCWB 3NXLA 3QOKA 3B8IA 2RAGA 4KEUA 4AMAA 1R3RA 1OADA 1GOIA 1TVNA 5I3DA 1KRAC 1IT7A 1PHWA 3E0WA 4QFUA 1K4GA 1DJIA 4I9MA 5EMUA 4JTHA 5CCZA 4KH2A 3R89A 1C93A 3HGJA 4W7UA 5HANA 3SUTA 3LI0A 5ABFB 4G9PA 3QHMA 3M6YA 3NPWA 4PEEA 3W2UA 3WNNA 2E0PA 1NAL1 3MQTA 2R9RA 4DPQA 4XUGA 2CEQA 3T44A 1N7KA 2V3FA 5DQPA 4F0MA 3EXRA 5A8MA 4LS1A 2Z1BA 4FLRA 1FWTA 2A0NA 1DWHM 3T2QA 2DT3A 2E9MA 3G1RA 2CIPA 1ML1A 2PU0A 5IM51 3L2MA 4HHPA 3UFYA 2Z4GA 4ML9A 1E9YB 2Q8XA 3S47A 4B4FA 3EOSA 5HMFA 1M65A 3VDHA 3QR3A 4EXBA 1E51A 4DRSA 2PLMA 5K2ZA 4W8AA 1JG9A 3FIGA 2D20A 1GQLA 2FDSA 3TSDA 3MYOA 3I4KA 2XJ7A 3LK6A 4JIRA 2BX7A 3D46A 4U10A 1MFVA 4E2BA 3B04A 4MFDA 1POJA 1JJKA 4Z2GA 1GCYA 1LL6A 4H2HA 3HG2A 1D3GA 3A9IA 4FX6M 4CKQA 5T8GA 1P1MA 5CBJA 1POKA 4HHMA 1OFQA 3T09A 4J28A 3IPWA 1OSEA 2GDVA 2Z2UA 3PTMA 5HR6A 2DT0A 5BXSA 3WLNA 5C2CA 3TE9A 2Z28A 4RDYA 1ZLPA 2WJFA 4CNPA 3W28A 4NVTA 1CTNA 4JCMA 1RZMA 5EMMA 4LAMA 1ODZA 2DZWA 4GIRA 4MYAA 3MMDA 2NV9A 2QJGA 2ZA1A 4MJMA 3VZXA 1XLIA 4PTVA 3K5XA 2FZDA 3ABXA 4RV8A 3NDOA 1NFPA 3FDKA 2UY5A 3TFCA 5C8BB 1K9TA 4F2BA 2POTA 3AISA 1I2NA 3II1A 3LV5A 3GH7A 1E9LA 4E3TA 4LEQA 4W9TA 4HJFA 4UFHA 4D2JA 1OC6A 5A3HA 2ZXAA 2ZXQA 3L0KA 2D23A 4FR6A 1AW1A 3EX1A 4B15A 3O6CA 3TOYA 3D6NA 1FWWA 3H23A 3T42A 1SW0A 1UOKA 1OFPA 4G2DA 1W9UA 1PCWA 1E70M 2QEZA 1KO0A 2BVWA 3H8AA 3A13A 1GOMA 4L64A 3VNZA 4PFMA 3GYCA 4JTJA 2BNJA 4ILSA 3TV8A 3TWBA 1C29A 4H8NA 1W3LA 3UJEA 4XG1A 1H51A 2PWHA 3G8EA 1R3QA 2P8BA 3D0CA 1QK0A 1DYSA 4CU8A 1G5AA 1S3HA 2VR2A 4MWAE 3ISIX 1JUKA 2Y7DA 1ZPTA 1UC4A 1R38A 4P7OA 1WUFA 1GG0A 2VQUA 1Q63A 4Q7BA 1A5AA 1OFOA 1X6UA 3GZAA 2W6RA 1RAKA 2PI6A 1YKWA 1XQLA 2JGQA 2WCGA 2G0WA 4CN6A 3C0SA 3UCCA 3WBAA 5T26A 4FLQA 3SJ3A 3OZOA 4C5ZA 2B31A 4N0RA 6REQB 1V03A 4PN2A 4J3TA 2EPOA 1XL9A 1FWBC 4PTDA 1FP8A 1BFNA 1T40A 3DFQA 5LIWX 4B9ZA 2GQ9A 5C6MA 4I5UA 9XIAA 1TWDA 4L80A 1M03A 3B97A 2VR4A 3M0YA 4L4MA 4GZ7A 3H2MA 4YTSA 1U1UA 3GXFA 4E4FA 3GR4A 3CIXA 4R34A 5LGXA 1QHPA 3LBCA 3K4DA 3R13A 1VHNA 5FAGA 3MW7A 2GOUA 1UH3A 7PTDA 2POZA 1AFSA 4ICNA 2A79A 1R8LA 4G8TA 1TO3A 4IL0A 4O1DA 3GG0A 1Q7QA 2IXVA 1SJDA 3H2NA 4LOCA 2VDIA 2E8ZA 3TYUA 3NOYA 3U5UA 1EDTA 1OT2A 1XLKA 2QGYA 1SO4A 2XVGA 4I9AA 2X1IA 1R85A 4DZIA 1BPLB 3UWEA 3LPGA 3CMGA 1J5SA 1OBAA 4WDWA 1RK6A 1CI1A 3HPFA 3U2OA 4OTKA 3PS7A 1A5OC 5FJUA 1QOPA 4I7UA 1CBGA 1XICA 2DV0A 4NZ3A 1T0OA 3ZR5A 4XVEA 1GHRA 1LCOA 3LMZA 4BF5A 3H6OA 3WFLA 1TV7A 1DPMA 4MLJA 4IPJA 2WMHA 5I00A 3CO8A 3HOJA 4XAGA 2FTYA 3WUEA 4Y9NA 2BTMA 1S2WA 4FHAA 4UTMA 4YMZA 2QNEA 1Y5XA 4RLIA 1ZS2A 2HK1A 4KCUA 1JZ6A 1PYMA 1S2TA 3UESA 3G1HA 3CB8A 4RW5A 3MTWA 3WF4A 1H4PA 5BU9A 3WN6A 1S2UA 5HDRA 1VIWA 3BARA 1K7XA 3VIHA 5G1YA 3LX9A 2WJZA 3FHQA 1D8WA 4M1RA 5AOUA 4D1JA 4YN5A 3CB3A 1XP3A 3R0UA 1XIBA 3L21A 1WA3A 1QK2A 4OQVA 2V30A 1ZJAA 3MUCA 4YCPA 3OVRA 1TMQA 3LRMA 1WKEA 2E1WA 3NCOA 1X38A 4Z2LA 4KGLA 5LZLA 4GY0A 1CLVA 3FS2A 2IXUA 3NAVA 4FSAA 3BTNA 3AS0A 2QCFA 1FUYA 5HWMA 4W86A 5H8UA 4YJ5A 3ICJA 5A6MA 2XTKA 4NU7A 4YWSA 1H62A 1B1YA 1HIZA 1TPFA 4PBEA 4HHLA 3LZ3A 1K6AA 1ALDA 2KZHA 1UMYA 1J2BA 1WV2A 1B9BA 4PC8A 4GQGA 3G0UA 3RCNA 3RUBL 1Q13A 3REQA 5I78A 4S3FA 3OVQA 5BMXA 2A6NA 3S2NA 3C2OA 4RL3A 5G1TA 4WD0A 3A9BA 2NQ5A 1ZNNA 3APGA 4NAEA 5FCZA 4K68A 1OJXA 3AS1A 3OVPA 4W4QA 3ABRA 4PUJA 3QJAA 1V0LA 4Y6GA 3TDFA 4JTGA 2ZRVA 3WQOA 3THQA 3CZ8A 3QW4B 4KCWA 2J77A 1YDOA 5DBUA 5B7YA 1KXVA 4C6IA 4UQ9A 4HA4A 1DE5A 4UFLA 1GVIA 2WZIA 1DIEA 4ZOEA 5CBBA 4HD5A 1PE1A 1U33A 3AWOA 4FNPA 1XPGA 4GQ0A 5I7GA 1C7SA 1XUZA 4AYSA 1LOQA 4Q4RA 1T96A 1JCYA 1F3XA 3GHSA 3BV4A 3UZJA 4IP7A 1EGVA 1BQCA 1S5WA 2A3HA 4NF7A 2PWEA 1JEZA 4LAOA 5IDZA 4E2OA 2HK0A 1OGBA 3ZZ1A 3AHZA 2PBOA 4PCTA 1ENUA 3MDWA 4D9PA 3PTQA 5IOBA 3ITCA 1UD4A 3ZWTA 4Q8QA 6REQA 2B4GA 2FB2A 2WVVA 4GXMA 2E1DA 1DKWA 3OBKA 4O8AA 1VEMA 4XKMA 3UNDA 5T9CE 4XD3A 1J6PA 2YDAA 3B40A 3GS6A 2ADAA 3CPUA 4PZVA 1EC8A 4G7FA 4US5A 4XBKA 1XWYA 3G18A 4JDYA 3MP5A 3FKKA 2NXHA 4Q3MA 3KL3A 3PUOA 4YTRA 4MWAB 1TR1A 2W4XA 2UWFA 4HNOA 1XYMA 2ZUMA 5D9PA 2C1IA 1W1IE 3PZQA 3RHGA 4ZVJA 5A2BA 3O05A 1ME7A 2X2GA 2P53A 4AUBA 3DBNA 1Q6DA 1ICPA 4CU7A 3M5YA 1KTBA 1EC9A 3ATZA 1RJPA 4J3SA 3GR8A 3CO4A 4N42A 1FKWA 5BROA 4F2UA 5DX7A 3MHFA 4JFVA 3NPVA 2YFNA 4KRTA 4CN1A 2NT1A 2YBVA 2IMRA 3N2XA 3EDKA 1GKQA 1W3HA 3KX6A 3USZA 2TYSA 5PTDA 3TQPA 1PB0A 1PXGA 3BZJA 4FX8A 3WEMA 2XIBA 4B4HA 4O53A 1I9CB 3NJ3A 2OYKA 3L4ZA 2QCDB 1A5LC 4D8LA 2DVXA 3VZZA 4DEFA 4YTTA 4IGMA 1H63A 2BOEX 3VGFA 1GQIA 1F9CA 4H7ZA 1SPQA 3JUGA 1QRQA 3UZWA 1KRCC 4DIAA 4IIGA 3WO8A 1PTDA 3W81A 1VH7A 5KZ6A 1GJUA 1XRVA 2J47A 3USBA 5BXRA 3WBWA 4KCVA 2OGJA 1W91A 3W1MA 4IWWA 2V69A 4LVAA 4QQ3A 4IX2A 2ANUA 1J18A 1DXFA 1OQFA 4GI6A 4HNLA 3LEPA 2V0TA 3M0HA 5D9OA 2I7GA 2B7PA 3TLLA 3CS2A 1MEHA 4JCLA 5E0FA 4A2RA 3QV9A 3MUIA 2OKTA 4L61A 3NO3A 3ZOAA 3B8WA 4JTCA 4O0QA 3ANUA 3W7JA 3STPA 3F2BA 4X60A 1TZ9A 2QJNA 1WUEA 4D8ZA 3S2MA 1NTHA 1QW9A 3AU2A 3NVTA 4NY2A 3W53A 2I5QA 2NV2A 1EO7A 1BLIA 1TV5A 4X2RA 1GZ1A 1A49A 2HVMA 5E6ZA 2J27A 2ZYFA 2VX5A 1E6PA 3F5JA 3GVQA 4XIMA 4RZ6A 1RXOB 4AHPA 3UWZA 4XAZA 3UQNA 1VBRA 2HPIA 4HJWA 3EZ4A 2ISFA 3HQ1A 3G1FA 4R7JA 1JXKA 2ZE3A 3NQ7A 7REQB 1Y7VA 4U3CA 5DLCA 4JTSA 1VPQA 2E3ZA 1ZAJA 3FHAA 1A53A 2DGAA 4LAUA 4DWSC 3JW7A 1MZHA 3KBJA 1NFGA 2QKFA 4LUSA 2QLYA 5FJRA 1Q7ZA 3R6IA 2J6XA 3GWQA 3M44A 2PDKA 2V9DA 3ITLA 2W92A 3IUDA 1XLLA 1UH4A 2NUXA 2OT0A 3KHJA 5LXXA 3W00A 1AG1O 3CUXA 3M0JA 4IF2A 5GJMA 3AZTA 5ABFA 2E6FA 1HFBA 5K4XA 4ATWA 3LPFA 4LC8A 4M7SA 1KGXA 2GGHA 5CEWA 2VZTA 2PUZA 3VOFA 4Z1YA 3L4WA 4JHZA 1J6OA 2ZTKA 1GVYA 1VEOA 1MW1A 5DCEA 4DVOA 3NA8A 1EPXA 5D9NA 4GI8A 1A3WA 3ZS4A 1QPQA 1B3YA 1JNDA 5C7HA 3MUZ1 1V77A 3CUZA 3K8MA 1JR1A 5HPCA 1TJ0A 3SCQA 2JKEA 4OVXA 4QHRA 1CW2A 5DMMA 3O16A 4IMEA 4GIAA 2RJHA 3LBMA 8CGTA 3IJQA 4JIIX 1W54A 1GOQA 4PTXA 4A4AA 1YHTA 1P4CA 3WQPA 1ITXA 4K39A 4Q6JA 4PMXA 3LTSA 3H24A 4MG4A 1E0XA 3ANYA 4MKSA 5EMYA 2CPUA 2E5DA 1PZ2A 1MW0A 5D2WA 3PPHA 1ME8A 1OK4A 1EXPA 1VJIA 1KBIA 5D03A 2PDUA 3B05A 1DXIA 3NZGA 4ICCX 1FDJA 3F5KA 3LUTA 5D2VA 4ORMA 3WDPP 3TTSA 3WKZA 4QDPA 1K8XA 4IIFA 3OG2A 1K03A 2TRSA 5CG0A 3LXCA 4G1KA 3IJLA 1YXDA 2X0SA 3FJNA 3BCDA 5BZAA 1GYMA 4PCPA 3O07A 4E2VA 1E3ZA 2ZQ0A 3QYQA 1HJVA 1NH6A 1QHZA 4NYUA 3LDVA 4LAZA 3B0UX 2ZVRA 3CV2A 3P14A 2YW3A 2I17A 1YDYA 3TNOA 4Q8OA 4KWOA 1DIKA 2O9RA 3L4VA 2XFRA 4LU0A 4B90A 3URBA 3ZWSA 3CHEA 1FWGC 3L4TA 3IIPA 5GPRA 3BCJA 1V3IA 1UR0A 3BMXA 3S5NA 4ADTA 1TPVA 1WDSA 3TC6A 1Q2SA 1JCXA 8XIAA 4KCTA 5CJ5A 2C7FA 1K4HA 3W75A 4O18A 1EZWA 1WP6A 1QI0A 3WL1A 4DBUA 2VEPA 4OBSA 3TXVA 1KCZA 2DUXA 1TPUA 4EPBC 1H3GA 3FXYA 3QSRA 2Z00A 2QS8A 4U2ZA 1G0CA 1L8NA 1RJQA 3VE9A 1UBPC 3W7NA 3CYVA 1XR2A 3F5LA 4UTFA 1S38A 1AODA 7A3HA 1L9WA 3O0FA 2EPLX 1OB0A 1H41A 3UWUA 2DEPA 2GQAA 1J79A 3N29A 4HT3A 4FI4A 4YLWA 3VKKA 1IGWA 1AQ0A 4QEEA 2RDUA 5EFFA 4HSNA 1V6XA 3GR7A 5T9BG 4YNGA 4GQQA 5AHNA 2BY0A 1SMAA 1B31A 5G2IA 1IV8A 3VCNA 1Q5MA 1EBGA 1KFJA 1GONA 1T6MA 2YCEA 2GQ3A 2ZRZA 4AHQA 1W32A 1HW6A 3LLXA 1W9BM 2VC9A 3UXIA 3EX4A 2EG7A 4W5UA 3AFBA 3GNXA 3HBLA 4BY3A 3QZAA 1GVFA 4GO8A 4ZQMA 4L1WA 4QS5A 1G01A 4HHHA 4PTNA 5D38A 3A4XA 3KOYA 4QXIA 1JAKA 4RZBA 1EEPA 4LF2A 3REQB 4DX3A 5CSYA 2A1YA 1C92A 1ISXA 1FWFC 3IIXA 1GZGA 1S5NA 4ZFCA 4LSBA 3R8HA 1OEPA 3EXTA 4IMGA 1FWSA 1XBYA 2FFIA 3M7SA 4JFWA 4JTLA 3AXMA 3QOMA 3M0XA 4NP7A 4ATLA 4MKVA 4GRSA 4GIYA 2G96A 4I5XA 1BWVA 3EPNA 2XH2A 3MA8A 1EX5A 3VNJA 1OVDA 4NKCA 4ZFMA 3QXBA 2QGHA 2CZVA 1GKRA 3C8NA 1WPCA 2QYGA 2OZ3A 4UNIA 4J3XA 3S8HA 4FIQA 2CHNA 3L0GA 4ZE4A 1O5RA 2WKLA 2ZKMX 1GPWA 1H1ZA 5I03A 2NXGA 6ALDA 1JUBA 1RA0A 3HGSA 4BF9A 2XHYA 2JE8A 4WEVX 3K8KA 3TUUA 5A2AA 4YCOA 4JAWA 1IE7C 3QZEA 4O54A 2Z24A 4XTIA 2DSKA 1ZHAA 2RGLA 4IP4A 1EC7A 1VBGA 2O4QA 2BASA 3QLLA 2J8TA 3CWHA 3MZ2A 3SW6A 4IMDA 4UOZA 3LHZA 3HMCA 4MWAD 4J2PA 3HPZA 3GAYA 4DI9A 1MUMA 5LIXX 4EE9A 1PSCA 1RY0A 1VPXA 3SIZA 3VIMA 5F2MA 3MC5A 4LCQA 2AL2B 1NWSA 3N2MA 3V16A 3L7RA 5MHBA 3OHIA 1FDYA 1R2TA 1DWFM 3L4UA 5DY3A 3AIWA 1QOQA 3F4NA 1IF2A 3TTYA 2G3JA 3N11A 3EAUA 3SY8A 2YA0A 5FACA 4RJEA 1V3KA 3HV8A 2E28A 4WDXA 1SO5A 4H3DA 3IRDA 3LCLA 2EPMX 3P67A 4MWAC 3NVDA 1V79A 2Z29A 1H1YA 3WLTA 4KETA 5E0CA 3C56A 4XZBA 1EKOA 5A6BD 1UWTA 1OX6A 3B9OA 5G2HA 5DMLA 4JOMA 3E0VA 1EJVC 3SQSA 8RUCA 5I3JA 5C71A 3B8SA 5HNNA 3AOFA 4Y9PA 4QDWA 3W87A 4ACYA 1UROA 1KR1A 3RXZA 3NZ1A 4R7OA 2DQWA 2DSUA 3PZNA 3LRKA 5D37A 3PANA 3N3MA 1V6WA 3RK8A 1M53A 5H8MA 2GDUA 4UXDA 3ZIZA 2EG8A 4MPQA 1CGWA 2PDGA 3FXGA 2PZ0A 4LVFA 3WD0A 1OINA 2GSEA 1Q6QA 3CIWA 5HWJA 4QSHA 3AS2A 1V3MA 2R8WA 4NAFB 4K2SA 1F4HA 3LNMA 4BQ4A 5LHFA 2JEPA 2F38A 2QVNA 1JF5A 5EYWA 4RR4A 4UC5A 5CAHA 3NO5A 4TR9A 2W91A 3U48A 3M7WA 5A95A 2ZDRA 1E3XA 5I09A 4IH3A 1ZL1A 4M24A 9XIMA 2WZMA 4UWMA 2D3NA 3CZKA 4HZ6A 1AL7A 3R8RA 3V3WA 1G6CA 2OJPA 4ZA0A 2ZX8A 1TVLA 2CHRA 1VLIA 3PK7A 2GWGA 2CWNA 3W7MA 2XPKA 3GVGA 3OB8A 5H6HA 3U3HA 4GUIA 5AB3A 2HXTA 1FDZA 1QO2A 3V4BA 3WD2A 1QXLA 3TN6A 3WH7A 2ZRUA 2WMJA 5L6UA 1PDZA 2E9BA 1F73A 3H2OA 3R79A 5DBTA 3ONCA 2DZSA 4JIQA 4GVIA 2PDFA 5FF0A 2Q02A 3CHVA 3HQOA 2I57A 2ZA3A 2BLEA 3NQEA 3UPWA 3AMLA 4BWLC 2XVLA 4UMCA 1S39A 1ADDA 1TX2A 2E5CA 2X40A 1FH7A 1RPXA 4M51A 5FA5A 4S3EA 1UD5A 3QMTA 2OZTA 2VT0A 4OWGA 3R58A 1I2QA 1I6NA 4MKNA 5REQA 4S39A 1J5TA 6A3HA 1XISA 4GX9A 1YW1A 2OX4A 1AVAA 3QQWA 1DOSA 3RLVA 1TIWA 1TZ7A 1IEWA 1ZJIA 3B8VA 3GY1A 1ZSXA 4IMCA 2PF8A 3PNZA 3FA3A 3BK0A 2J66A 4PTWA 1QW8A 1ICSA 3B0VC 1E1CB 3VD7A 4RV3A 1IIGA 4FP1A 4KS0A 5ENLA 1E43A 4J1OA 2INEA 3WG6A 1T7LA 3NQMA 3THAA 1PZ0A 3TC7A 3BUVA 5U4NA 4BR1A 3V1HA 4DYEA 1BRLB 1SZEA 4TMCA 4HNTA 2DVUA 1W5OA 3ITVA 1M5WA 1LRQA 2UZ9A 4LVDA 3NEHA 1JRBA 4GIEA 3OHMB 3BGAA 4OUEA 1FRBA 1MQRA 4D6EA 4URIA 3AYTA 1QASA 4LY8A 8A3HA 1O68A 4ZQCA 2OO6A 1AD1A 3IJ9A 1J0ZA 2JIEA 3LHYA 1KM1A 3FJLA 3LM7A 4CCZA 2QAFA 5CZTA 5CG7A 1V93A 4C6DA 4ADUA 3URNA 1M9HA 1WBHA 4V2XA 4C6MA 4KRUA 4UMBA 3OJGA 3FA5A 1L6GA 3R5EA 4Y96A 4JIEA 2RGMA 3RN6A 1LBMA 5FL1A 4O0ZA 4ES4A 4P61A 1R2RA 1TELA 1JCNA 4N9BA 4ZODA 1XIEA 4A3UA 4A35A 4A3YA 2EAWA 3L4YA 1A0DA 2QJMA 5D02A 2EKGA 1LROA 3IAQA 2NX3A 4WOQA 3GXTA 1MXDA 2CESA 2WJDA 2VMFA 4LUSB 4YYFA 3UZXA 2XGBA 3KDOA 3AI0A 2FYMA 2CZ5A 1PIGA 1G69A 1TJ2A 4GJJA 1UZ1A 2QPXA 2JF7A 3G77A 3V0UA 3E5PA 3DG7A 3VABA 5H8PA 3U57A 3W1AA 1XRTA 4MY1A 1FHUA 4Z1DA 1CB2A 5JBDA 1GPFA 1FWHC 3K4WA 4L9XA 1RP9A 3WNOA 4WKHA 3UCDA 4O10A 1I8JA 5E09A 3ATYA 5C54A 3W37A 4UQAA 3C86A 3DDMA 3U7VA 1KFLA 4QDMA 3STFA 3TN4A 2W67A 3CTTA 3EKLA 3W29A 3EMZA 2D0HA 2PP0A 2WJEA 2XVKA 1HKMA 4Q6XA 3ARXA 1G9HA 2QJHA 2J79A 2ZX7A 3CQKA 4QJ1A 3CEUA 1NELA 3VIKA 1JIBA 4QNWA 5AHFA 1VP5A 1L6FA 3AC0A 4GMEA 4UTLA 1V0NA 5AYBA 1JGIA 1UKTA 2PC8A 1TPEA 1MW2A 4AYGA 4DXVA 4UR7A 1R3VA 4QEHA 4ERIA 1E0VA 5CH9A 2DSVA 4HYRA 3KDNA 4AIOA 2BXZA 4MIMA 2MNRA 2H9AB 3CUIA 4FNRA 3ORWA 2BZNA 3B3DA 3HA1A 3N73A 4C6EA 4XSMA 4QLLA 2GQ8A 3BLOA 2CW6A 3S6DA 3O3RA 1OT1A 2NX1A 2CLFA 2IW0A 4WY0F 3QEZA 1KNWA 3T6CA 5F4SA 1CXKA 2C0HA 3VOGA 4H9VA 5D32A 2EXOA 5HMEA 1IIHA 3WLRA 5LNWA 3AALA 1PWMA 1OY0A 2E77A 4JL2A 3T08A 3VDAA 4IHCA 2VGFA 3E0LA 1KQYA 4DN1A 2VZUA 3PB2A 3LERA 2VX7A 2GJPA 3Q58A 3DFNA 5A8OA 3U0HA 2VM8A 2Q09A 3SY5A 3MCOA 2ZFAA 1J0IA 3NPXA 3GTXA 3U2ZA 3IWPA 1ISWA 4A8RA 1BTMA 3OBEA 4S2BA 2VP8A 4CNSA 1TJPA 3W7CA 1XS2A 4XVDA 4PL2A 4RCXA 3M0ZA 4LPCA 1OCNA 2PDHA 3TJIA 4B5WA 4LYQA 3A3HA 2WM0A 4NXKA 3T4WA 4AVNA 1A5CA 3TJLA 5EY5A 2CXEA 3H7VA 5F2LA 2IKHA 1KW1A 2QAPA 2PWDA 3LHTA 4C6NA 4WSKA 1TKKA 2C19A 1QU4A 3SFWA 3LY0A 3W84A 3V7PA 1K1DA 3ABOA 2ISVA 2PDCA 3MSYA 1BXBA 3QYSA 4ALDA 3W6LA 4HNUA 1JPHA 4O1FA 4PSPA 1W1B1 2FJUB 4EAMA 3W1LA 4KIRA 4U2YA 4C6OA 5ABHA 1L6YA 1SFSA 2GFTA 4HN4A 4ZO9A 5CPNA 3VC5A 3NZPA 3RCMA 3DFTA 1UR4A 2XVPA 1U1HA 3N13A 1WDDA 1OGSA 4B3ZA 3UG3A 1P7TA 3W2JA 1C8YA 3CPGA 1QNSA 4IQDA 1WZLA 3CHDA 5BMWA 1LRTA 5JVLA 4O19A 3TLQA 1Q6FA 3UA3A 1V7AA 2NSOA 1W1ZA 4DJEC 3LTPA 2GVGA 3MPGA 3O1NA 3CK5A 4PRWA 3PG8A 3MKKA 2QDEA 3EX3A 2XIJA 3BJTA 3ENLA 2PRHA 3UBPC 1XYLA 2Y5EA 4FXSA 1BXNA 4R88A 1SO6A 1RD5A 2J9ZA 1E4MM 4PMQA 3S4TA 3N6QA 1YYAA 1L6SA 1Q85A 4KEZA 3W1QA 4JFUA 1OF6A 3GDTA 1EWDA 4AF0A 3T8LA 1CT5A 4QJ4B 3GIPA 3LB0A 3EWYA 3CAKA 4FEZA 5HBFA 4CLMA 3TYCA 1Z89A 1PTGA 2QUTA 4M7TA 1JCJA 4O50A 5HQMA 4LB4A 1H09A 2E6YA 4BWLA 3MUY1 3DC8A 1J10A 3MJMA 4LF1A 2IKGA 4PE8A 1THFD 4N2YA 1B3WA 3A6OA 3S1WA 4ZTYA 3SADA 1FVPA 2NUYA 2PODA 3VKJA 5CLWA 3N2CA 3FK4A 3KOWA 4GZEA 3Q4DA 1UA7A 3MVIA 4S3GA 1TG7A 1ZBKA 2EJAA 2VGGA 4DF1A 3LV6A 2PDIA 3WL0A 2XSXA 3GUGA 3EPMA 3AIVA 1F3WA 1EGMA 5HJLA 1XYFA 1QPOA 3ZT7A 5CPOA 1Y5VA 3TYAA 1ICQA 1W3NA 3GKFA 1O94A 2OT1A 2VELA 4GCAA 1BF2A 5A2CA 2CXGA 2CERA 5A6BA 2ZUTA 2X1TA 2VZOA 4QISA 2X1RA 5AHEA 1LZOA 4K8EA 3UYCA 2E6AA 1I1WA 3PPFA 1QUMA 3V0TA 3QR1A 3EX2A 2EG6A 2FFCA 4L6DA 2H3BA 3APTA 4N6EA 4K36A 1NOUA 1YDVA 1SZRA 4S38A 4HA1A 3T1GA 4YXGA 3L12A 2Z1VA 3WBXA 5CGMA 1RH9A 1JD9A 2BSLA 4MB4A 1ELSA 3P5ZA 3ARUA 3W1NA 4WSHA 3I6EA 3NGJA 3S1VA 2TAAA 1TWWA 3TW6A 5E9AA 4JTTA 4O8RA 1NDVA 3A64A 4WSJA 4ZOAA 4EKJA 2VEMA 3EB2A 3KVMA 4HNVA 1VJSA 4LVBA 4UZUA 1VFUA 4J7RA 3DHUA 4MY8A 4OBTA 1TWZA 3RFAA 4W7VA 3ZVIA 1SFTA 3SDOA 3WELA 3QPEA 1EDGA 2FZNA 2JGYA 4D6CA 2L5HA 2YSWA 1E6XM 1DJNA 5LXEA 4NNBA 5A6AA 1ZCOA 4DLMA 3WF2A 3S6OA 1GVSA 3H12A 1KCKA 3E5BA 1S5TA 3N2OA 2QW5A 1FCVA 3W1PA 1F8MA 3EGJA 1FWJC 3TW7A 4JBRA 2IQ0A 2Z2AA 3P8IA 4PR4A 4UQCA 4AEOA 4H9ZA 2HNHA 4EXQA 2AKZA 1VRXA 4QG9A 2OSXA 4P8UA 1ZAHA 4LW7A 1S3TC 1B3VA 1WDRA 3N1AA 3WEOA 3GLCA 4M6UA 1Z41A 3C0QA 4N4PA 3DFPA 3NQFA 3H7RA 3P93A 4AVOA 3IUHA 3WQ4A 4OHQA 2PGFA 3OEXA 2RDXA 2G41A 4NNAA 4KFPA 2DU2A 2Z6IA 4GX8A 3GNNA 4WY0B 4F0RA 5C9UA 2X1UA 5EPDA 1VF8A 2VOTA 4FZIA 1UASA 3KZPA 4AY7A 4K8HA 2D24A 2Q8ZA 1Q6RA 3SI9A 3T8QA 3VNLA 3IACA 4MDOA 4KBXA 4HGXA 4P8XA 1A5SA 4Z0JA 1GT8A 3VKAA 1UKOA 1KFWA 2V5LA 5BYWA 3P2VA 3WLHA 4H9UA 3F1QA 3B9EA 1PS9A 1DJYA 5LKYA 3O63A 3KOXA 3P82A 2ZRYA 4LTSA 3ID7A 2VDGA 3E6EA 3SCTA 3NO1A 3CT2A 4QP0A 3XINA 5C7VA 3GTIA 1ZQ5A 3HPSA 1KBJA 5EFDA 1R6WA 1OG0A 2E7FA 3OU8A 4H2CA 2E4TA 1UJPA 1R9YA 3W76A 3I68A 1FY6A 3C2YA 4ZCWA 3N9SA 3UGRA 1FWRA 4GBDA 1A50A 1PX4A 1ZFJA 3G6MA 5IBXA 4ASTA 1XSIA 3M0MA 1NP0A 2FTPA 3QPYA 3EWCA 3WX7A 3N12A 1VFHA 4TTUA 2I9UA 3VUSA 2HVOA 2NUWA 5F2IA 4MGGA 3GTFA 3QC0A 5K9DA 3ARZA 2WB5A 3C3UA 3DHDA 3KP1A 3Q2DA 4B5XA 1W0MA 3AU6A 1YX1A 1EEXA 1YPIA 3UPMA 4UNKA 2A3BA 3F4VA 2IPWA 1IT0A 5HWNA 4HNCA 4RX0A 3UWQA 1WAWA 2QDDA 3OTRA 4KW2A 3I10A 3BAKA 5JMUA 5BRQA 3UNTA 3IJIA 4H8HA 3IVUA 1XHGA 4AD0A 2A21A 2QCHA 1EJ7L 3SUUA 3RG6A 4IFOA 3TA6A 1JFXA