1RY7A

Crystal structure of the 3 ig form of fgfr3c in complex with fgf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
151
structure length
151
Chain Sequence
EITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Growth factor/growth factor receptor
source organism Homo sapiens
total genus 26
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ry7A00
1ISZA 1MD6A 3H6RA 1JT4A 2NTDA 4JRAA 1W3GA 4ZFUB 3AJ5A 1XYFA 1M2TB 3BX1C 3IM7A 3OJVA 1RMLA 1E0OA 1EPWA 1Z0HA 3PMEA 1VCLA 1V6UA 2AXMA 1HCEA 3AZVA 3POKA 4HJJA 2KLLA 2NM1A 3FGMA 2VLCA 3P6IA 4J2KA 1W3FA 1YF8B 4GAIA 1G9CA 4HA2A 3MPPG 3FJBA 3BRDA 1TFMB 1HWNB 3RSJA 4Z9WB 4LO3A 4ZGRB 4IZXA 2D1ZA 8I1BA 1DZDA 3VEQA 1ILR1 4IHZA 3AJ6A 3CA3A 3VUOA 4I4XA 5BQUC 3FJAA 3SNVA 4JQ0A 3NBNA 3Q7YA 2F2FA 1AVUA 4D0TA 3WINC 3HALA 4QC4A 3JRRA 1QXMA 5BP5C 4Z8SB 5FZUA 3V0BA 3BTAA 3S8KA 4IONA 3UJ4A 4ZOTA 2I1BA 1WBAA 1I1BA 2DREA 4I3NA 4LO1C 2P39A 5EG6C 3D7WB 5EHAA 3AKIA 4A7ZA 1YYNA 2NYYA 3A07A 4XFSA 3CA1A 4ZLBB 3LTQA 3QYDA 3WA1A 1R8OA 1RG8A 1BFGA 1XG6A 3UD9A 1FN0A 3EF2A 4ISQA 3W9TA 3QR5A 2WRYA 3I2AA 3ZX7A 1JY0A 1W3AA 1BFBA 3BAOA 1AF9A 4EB2B 1T4QA 1KNMA 4J2SA 1IT0A 1JQZA 4X38A 3MALA 2AQZA 1WD4A 2YUGA 2BFHA 4G9MA 3CRIA 1GGPB 3R4UA 1QQLA 1BFCA 3WO3A 3AZWA 4IZEA 3PUBA 1G9BA 1PUUB 3UDAA 4EFQA 2IHOA 5DVHA 1RY7A 4J2YA 1AXMA 1IHKA 3O4OA 1N4KA 4H04A 1NUNA 4OW4A 4Q91A 3O49A 3R4SA 3O4BA 7I1BA 2QN4A 1UPSA 4ZFWB 3BADA 5BQUA 3BRGC 1TWMA 3UD8A 4JPZA 3O4AA 4QBVA 3A21A 1ABRB 3NJ5A 4CJMA 1XHBA 1V6XA 5BOWA 3WINA 4II0A 1Z2VA 3B9UA 4XFUA 5BP5A 4I4UA 21BIA 4GP0A 2MIBA 2BEBA 1QQKA 4GAFA 2AAIB 3LLPA 1TIEA 2X2TA 1JT3A 4A7KA 31BIA 4USPA 4LO1A 4ZKTB 2D24A 4I0YA 3V0AB 2Z48A 5JMCA 5GAQA 5BXTA 2IWTB 3BA4A 4TLPA 2GO2A 1II4A 4XFTA 2VSAA 3IM6A 2ZQOA 4QBCA 3VT0A 1S0EA 3N7MA 1G9DA 4OEFA 3BA5A 3KMVA 3CU1B 2HW9A 1K5VA 3A23A 4QD2B 4P0KA 4KC3A 1PZZA 1ISVA 3H6SE 3VWCA 1FV2A 3N7LA 4LO7B 1DFQA 1BASA 5F8WA 4F83A 1MC9A 4DENA 4GOVA 1T9FA 1ITBA 2FFUA 4KEKA 5EC5A 1HKNA 3OJ2A 1NZKA 2J3PA 1ONKB 1YXWA 1EV2A 1S0BA 1AVWB 1OQLB 2KI4A 4J23B 2HWAA 2Y9FA 1P63A 3CA4A 2RSTA 3HSMA 4I4VA 4JAWA 1DZCA 3RMXA 4OWLA 4I6IA 5B2HA 5G00A 1BARA 3V0AA 1IOBA 1K5UA 2D23A 1PUMB 1JLXA 3O4CA 2F8XC 3AH2A 4ZFYB 4JP0A 4EKXB 4F34A 2DRYA 3HBWA 4EFPA 1IILA 3VSZA 3RTIB 5FZZA 4G6JA 1AFCA 4XKIA 4I7IA 2Y9WC 4L4IA 4ZBVB 4D0ZA 3UD7A 4JKQA 3TC2A 3WO4A 2ET2A 4YOLA 3N7KA 4OEGA 3BAGA 2DRZA 4I96A 5D63A 4EFRA 3WMUA 2UUSA 2MLLB 3FJ9A 1YTOA 1ISXA 2HWMA 2Z49A 3F62B 3HMYA 2LIQA 1Q03A 4H9WA 1DLLA 1S0FA 3H6RB 3NBCA 1FMMS 3CRHA 1JT5A 1YBIA 2VXRA 2K43A 4G6MA 5HPZA 9ILBA 1D0HA 3FJIA 1TWEA 3FJFA 1DQOA 1R8NA 2R9KB 5FZYA 1TTUA 4EEEB 1HWMB 3Q7XA 3PHZA 1Q1UA 2ERMA 3F1RA 2D7IA 5DUYA 1A8DA 4USOA 3AH1A 5DSSB 3FJKA 1BFFA 3N0KA 1BLAA 4GOYA 3FJEA 4IY8A 1FWVA 3E8LC 2D20A 3T8SA 4FGFA 1J0SA 3ILAA 4QD2C 4L4HA 2Q3NB 3JUTA 4X37A 1DFCA 2FGFA 2KI6B 3O44A 3AH4A 3UJ0A 4LO7C 5BXRA 1ISWA 3NBEA 3FJJA 2RG9B 3BRFA 2D7RA 3V79C 3K1XA 1V6WA 3BAQA 2HZ9A 3IM5A 2K4AB 3Q7WA 4Q9GA 3H6QA 1S0GA 1DQGA 3FUQA 3O4DA 3CA0A 3OGFA 1JTCA 3ZC8A 3P53A 4J2XA 4IYBA 5D61A 4I8MA 1V6VA 2D43A 4IQPA 1RZOB 2GZBA 5F90A 2NZ9A 3BB2A 2FO1A 3AKFA 1FGAA 4AN7B 4I1EA 3I2XA 3CAHA 3ZXGA 1G9AA 4PC4A 5BXPA 3ZC9A 41BIA 2XOAA 4I1BA 2WBCA 1AVAC 2ZR1B 2NP0A 1FMZA 4OEEA 4ENDA 5I1BA 3BAHA 4GP3A 3RTJB 5FNXA 1IJTA 1WBCA 5FNWA 5JLVA 3O3QA 1HCDA 1XZZA 4ISRA 1Q04A 4QKSA 2D44A 2QYIB 2E4MC 3FUOA 2VU9A 1SR4C 4I4QA 1S0LA 1DJSB 4I4RA 5BXSA 2FFVA 4IY9A 4WBCA 1FQ9A 1HWOB 4ZA3B 4A7YA 1TOOA 1S0CA 4DEPA 1PC8B 4KEJA 4R6UB 2D22A 3FFZA 3VSFA 3WMVA 2VSEA 4D8HA 4X3AA 5BVPI 4LO2C 3P6JA 3CQAA 1DIWA 1EVTA 2VUAA 2DS0A 4LO0C 4LO8B 1ISYA 4JKXB 4Q9PA 1JLYA 1HIBA 3OBTA 3AKGA 2NVHA 4X39A 4QO3A 4OUJA 1IRAX 3BA7A 2ZQNA 5E24E 3FJHA 3FJCA 3VT1A 2MC2A 5F8SA 2LIEA 1M16A 4LO3C 4P6AA 1BA7A 1HWPB 2Y9GA 2M49A 6I1BA 2KKIA 3AKHA 1IRPA 3RMYA 3I29B 4QKRA 2Q9XA 2P23A 3NBDA 3OGGA 5F8YA 2AFGA 2BEAA 1JT7A 3BAVA 2F2FC 3HN1A 4OWJA 3IIRA 1CE7B 5DZUA 3HOMA 2X2SA 3CA6A 3CA5A 4DCKC 3OJMA 4HR6C 4FVVA 1G82A 4I4OA 4I37A 5D62A 1PWAA 4KBBA 1Z4SA 3C9ZA 1FWUA 1WD3A 3A22A 1EYLA 4QALA 2E4MA 1I1EA 4G1RA 2RQ9A 2KH2A 1F31A 2FDBM 1S0DA 1CVSA 4I4SA 1SR4A 3FJ8A 3FJDA 3VT2A 4I4YA 2ESUA 3OBRA 2L5XA 4P0LA 4KEIA 3N7JA 4P0JA 4I2SA 3O5WB 3CRGA 4OWKA 1L2HA 3PG0A 3ZXDA 1AVXB 1FV3A 3IAGC 3V0BB 4I4PA 2K8RA 2VXTI 2Y9XE 4LO2A 4G9NA 3BAUA 3S8JA 3WO2A 1BLDA 1SZ6B 4LO0A 1TP0A 4AN6A
chains in the Genus database with same CATH superfamily
1ISZA 1MD6A 3H6RA 1JT4A 2NTDA 4JRAA 1W3GA 4ZFUB 3AJ5A 1XYFA 1M2TB 3BX1C 3IM7A 3OJVA 1RMLA 1E0OA 1EPWA 1Z0HA 3PMEA 1VCLA 1V6UA 2AXMA 1HCEA 3AZVA 3POKA 4HJJA 2KLLA 2NM1A 3FGMA 2VLCA 3P6IA 4J2KA 1W3FA 1YF8B 4GAIA 1G9CA 4HA2A 3MPPG 3FJBA 3BRDA 1TFMB 1HWNB 3RSJA 4Z9WB 4LO3A 4ZGRB 4IZXA 2D1ZA 8I1BA 1DZDA 3VEQA 1ILR1 4IHZA 3AJ6A 3CA3A 3VUOA 4I4XA 5BQUC 3FJAA 3SNVA 4JQ0A 3NBNA 3Q7YA 2F2FA 1AVUA 4D0TA 3WINC 3HALA 4QC4A 3JRRA 1QXMA 5BP5C 4Z8SB 5FZUA 3V0BA 3BTAA 3S8KA 4IONA 3UJ4A 4ZOTA 2I1BA 1WBAA 1I1BA 2DREA 4I3NA 4LO1C 2P39A 5EG6C 3D7WB 5EHAA 3AKIA 4A7ZA 1YYNA 2NYYA 3A07A 4XFSA 3CA1A 4ZLBB 3LTQA 3QYDA 3WA1A 1R8OA 1RG8A 1BFGA 1XG6A 3UD9A 1FN0A 3EF2A 4ISQA 3W9TA 3QR5A 2WRYA 3I2AA 3ZX7A 1JY0A 1W3AA 1BFBA 3BAOA 1AF9A 4EB2B 1T4QA 1KNMA 4J2SA 1IT0A 1JQZA 4X38A 3MALA 2AQZA 1WD4A 2YUGA 2BFHA 4G9MA 3CRIA 1GGPB 3R4UA 1QQLA 1BFCA 3WO3A 3AZWA 4IZEA 3PUBA 1G9BA 1PUUB 3UDAA 4EFQA 2IHOA 5DVHA 1RY7A 4J2YA 1AXMA 1IHKA 3O4OA 1N4KA 4H04A 1NUNA 4OW4A 4Q91A 3O49A 3R4SA 3O4BA 7I1BA 2QN4A 1UPSA 4ZFWB 3BADA 5BQUA 3BRGC 1TWMA 3UD8A 4JPZA 3O4AA 4QBVA 3A21A 1ABRB 3NJ5A 4CJMA 1XHBA 1V6XA 5BOWA 3WINA 4II0A 1Z2VA 3B9UA 4XFUA 5BP5A 4I4UA 21BIA 4GP0A 2MIBA 2BEBA 1QQKA 4GAFA 2AAIB 3LLPA 1TIEA 2X2TA 1JT3A 4A7KA 31BIA 4USPA 4LO1A 4ZKTB 2D24A 4I0YA 3V0AB 2Z48A 5JMCA 5GAQA 5BXTA 2IWTB 3BA4A 4TLPA 2GO2A 1II4A 4XFTA 2VSAA 3IM6A 2ZQOA 4QBCA 3VT0A 1S0EA 3N7MA 1G9DA 4OEFA 3BA5A 3KMVA 3CU1B 2HW9A 1K5VA 3A23A 4QD2B 4P0KA 4KC3A 1PZZA 1ISVA 3H6SE 3VWCA 1FV2A 3N7LA 4LO7B 1DFQA 1BASA 5F8WA 4F83A 1MC9A 4DENA 4GOVA 1T9FA 1ITBA 2FFUA 4UY4A 4KEKA 5EC5A 1HKNA 3OJ2A 1NZKA 2J3PA 1ONKB 1YXWA 1EV2A 1S0BA 1AVWB 1OQLB 2KI4A 4J23B 2HWAA 2Y9FA 1P63A 3CA4A 2RSTA 3HSMA 4I4VA 4JAWA 1DZCA 3RMXA 4OWLA 4I6IA 5B2HA 5G00A 1BARA 3V0AA 1IOBA 1K5UA 2D23A 1PUMB 1JLXA 3O4CA 2F8XC 3AH2A 4ZFYB 4JP0A 4EKXB 4F34A 2DRYA 3HBWA 4EFPA 1IILA 3VSZA 3RTIB 5FZZA 4G6JA 4MZHA 1AFCA 4XKIA 4I7IA 2Y9WC 4L4IA 4ZBVB 4D0ZA 3UD7A 4JKQA 3TC2A 3WO4A 2ET2A 4YOLA 3N7KA 4OEGA 3BAGA 2DRZA 4I96A 5D63A 4EFRA 3WMUA 2UUSA 2MLLB 3FJ9A 1YTOA 1ISXA 2HWMA 2Z49A 2NS2A 3F62B 3HMYA 2LIQA 1Q03A 4H9WA 1DLLA 1S0FA 3H6RB 3NBCA 4MZFB 1FMMS 3CRHA 1JT5A 1YBIA 2VXRA 2K43A 4G6MA 5HPZA 9ILBA 4H75A 1D0HA 3FJIA 1TWEA 3FJFA 1DQOA 1R8NA 2R9KB 5FZYA 1TTUA 4EEEB 1HWMB 3Q7XA 3PHZA 1Q1UA 2ERMA 3F1RA 2D7IA 5DUYA 1A8DA 4USOA 3AH1A 5DSSB 3FJKA 1BFFA 3N0KA 1BLAA 4GOYA 3FJEA 4IY8A 1FWVA 3E8LC 2D20A 3T8SA 4FGFA 1J0SA 3ILAA 4QD2C 4L4HA 2Q3NB 3JUTA 4X37A 1DFCA 2FGFA 2KI6B 3O44A 3AH4A 3UJ0A 4LO7C 5BXRA 1ISWA 3NBEA 3FJJA 2RG9B 3BRFA 2D7RA 3V79C 3K1XA 1V6WA 3BAQA 2HZ9A 3IM5A 2K4AB 3Q7WA 4Q9GA 3H6QA 1S0GA 1DQGA 3FUQA 3O4DA 3CA0A 3OGFA 1JTCA 3ZC8A 3P53A 4J2XA 4IYBA 5D61A 4I8MA 1V6VA 2D43A 4IQPA 1RZOB 2GZBA 5F90A 2NZ9A 3BB2A 2FO1A 3AKFA 1FGAA 4AN7B 4I1EA 3I2XA 3CAHA 3ZXGA 1G9AA 4PC4A 5BXPA 3ZC9A 41BIA 2XOAA 4I1BA 2WBCA 1AVAC 2ZR1B 2NP0A 1FMZA 4OEEA 4ENDA 5I1BA 3BAHA 4GP3A 3RTJB 5FNXA 1IJTA 1WBCA 5FNWA 5JLVA 3O3QA 1HCDA 1XZZA 4ISRA 1Q04A 4QKSA 2D44A 2QYIB 2E4MC 4MZGB 3FUOA 2VU9A 1SR4C 4I4QA 1S0LA 1DJSB 4I4RA 5BXSA 2FFVA 4IY9A 4WBCA 1FQ9A 1HWOB 4ZA3B 4A7YA 1TOOA 1S0CA 4DEPA 1PC8B 4KEJA 4R6UB 2D22A 3FFZA 3VSFA 3WMVA 2VSEA 4D8HA 4X3AA 5BVPI 4LO2C 3P6JA 3CQAA 1DIWA 1EVTA 2VUAA 2DS0A 4LO0C 4LO8B 1ISYA 4JKXB 4Q9PA 1JLYA 1HIBA 3OBTA 3AKGA 2NVHA 4X39A 4QO3A 4OUJA 1IRAX 3BA7A 2ZQNA 5E24E 3FJHA 3FJCA 3VT1A 2MC2A 5F8SA 2LIEA 1M16A 4LO3C 4P6AA 1BA7A 1HWPB 2Y9GA 2M49A 6I1BA 2KKIA 3AKHA 1IRPA 3RMYA 3I29B 4QKRA 2Q9XA 2P23A 3NBDA 3OGGA 5F8YA 2AFGA 2BEAA 1JT7A 3BAVA 2F2FC 3HN1A 4OWJA 3IIRA 1CE7B 5DZUA 3HOMA 2X2SA 3CA6A 3CA5A 4DCKC 3OJMA 4HR6C 4FVVA 1G82A 4I4OA 4I37A 5D62A 1PWAA 4KBBA 1Z4SA 3C9ZA 1FWUA 1WD3A 3A22A 1EYLA 4QALA 2E4MA 1I1EA 4G1RA 2RQ9A 2KH2A 1F31A 2FDBM 1S0DA 1CVSA 4I4SA 1SR4A 3FJ8A 3FJDA 3VT2A 4I4YA 2ESUA 3OBRA 2L5XA 4P0LA 4KEIA 3N7JA 4P0JA 4I2SA 3O5WB 3CRGA 4OWKA 1L2HA 3PG0A 3ZXDA 1AVXB 1FV3A 3IAGC 3V0BB 4I4PA 2K8RA 2VXTI 2Y9XE 4LO2A 4G9NA 3BAUA 3S8JA 3WO2A 1BLDA 1SZ6B 4LO0A 1TP0A 4AN6A
chains in the Genus database with same CATH topology
1ISZA 1MD6A 3H6RA 1JT4A 2NTDA 4JRAA 1W3GA 4ZFUB 3AJ5A 1XYFA 1M2TB 3BX1C 3IM7A 3OJVA 1RMLA 1E0OA 1EPWA 1Z0HA 3PMEA 1VCLA 1V6UA 2AXMA 1HCEA 3AZVA 3POKA 4HJJA 2KLLA 2NM1A 3FGMA 2VLCA 3P6IA 4J2KA 1W3FA 1YF8B 4GAIA 1G9CA 4HA2A 3MPPG 3FJBA 3BRDA 1TFMB 1HWNB 3RSJA 4Z9WB 4LO3A 4ZGRB 4IZXA 2D1ZA 8I1BA 1DZDA 3VEQA 1ILR1 4IHZA 3AJ6A 3CA3A 3VUOA 4I4XA 5BQUC 3FJAA 3SNVA 4JQ0A 3NBNA 3Q7YA 2F2FA 1AVUA 4D0TA 3WINC 3HALA 4QC4A 3JRRA 1QXMA 5BP5C 4Z8SB 5FZUA 3V0BA 3BTAA 3S8KA 4IONA 3UJ4A 4ZOTA 2I1BA 1WBAA 1I1BA 2DREA 4I3NA 4LO1C 2P39A 5EG6C 3D7WB 5EHAA 3AKIA 4A7ZA 1YYNA 2NYYA 3A07A 4XFSA 3CA1A 4ZLBB 3LTQA 3QYDA 3WA1A 1R8OA 1RG8A 1BFGA 1XG6A 3UD9A 1FN0A 3EF2A 4ISQA 3W9TA 3QR5A 2WRYA 3I2AA 3ZX7A 1JY0A 1W3AA 1BFBA 3BAOA 1AF9A 4EB2B 1T4QA 1KNMA 4J2SA 1IT0A 1JQZA 4X38A 3MALA 2AQZA 1WD4A 2YUGA 2BFHA 4G9MA 3CRIA 1GGPB 3R4UA 1QQLA 1BFCA 3WO3A 3AZWA 4IZEA 3PUBA 1G9BA 1PUUB 3UDAA 4EFQA 2IHOA 5DVHA 1RY7A 4J2YA 1AXMA 1IHKA 3O4OA 1N4KA 4H04A 1NUNA 4OW4A 4Q91A 3O49A 3R4SA 3O4BA 7I1BA 2QN4A 1UPSA 4ZFWB 3BADA 5BQUA 3BRGC 1TWMA 3UD8A 4JPZA 3O4AA 4QBVA 3A21A 1ABRB 3NJ5A 4CJMA 1XHBA 1V6XA 5BOWA 3WINA 4II0A 1Z2VA 3B9UA 4XFUA 5BP5A 4I4UA 21BIA 4GP0A 2MIBA 2BEBA 1QQKA 4GAFA 2AAIB 3LLPA 1TIEA 2X2TA 1JT3A 4A7KA 31BIA 4USPA 4LO1A 4ZKTB 2D24A 4I0YA 3V0AB 2Z48A 5JMCA 5GAQA 5BXTA 2IWTB 3BA4A 4TLPA 2GO2A 1II4A 4XFTA 2VSAA 3IM6A 2ZQOA 4QBCA 3VT0A 1S0EA 3N7MA 1G9DA 4OEFA 3BA5A 3KMVA 3CU1B 2HW9A 1K5VA 3A23A 4QD2B 4P0KA 4KC3A 1PZZA 1ISVA 3H6SE 3VWCA 1FV2A 3N7LA 4LO7B 1DFQA 1BASA 5F8WA 4F83A 1MC9A 4DENA 4GOVA 1T9FA 1ITBA 2FFUA 4UY4A 4KEKA 5EC5A 1HKNA 3OJ2A 1NZKA 2J3PA 1ONKB 1YXWA 1EV2A 1S0BA 1AVWB 1OQLB 2KI4A 4J23B 2HWAA 2Y9FA 1P63A 3CA4A 2RSTA 3HSMA 4I4VA 4JAWA 1DZCA 3RMXA 4OWLA 4I6IA 5B2HA 5G00A 1BARA 3V0AA 1IOBA 1K5UA 2D23A 1PUMB 1JLXA 3O4CA 2F8XC 3AH2A 4ZFYB 4JP0A 4EKXB 4F34A 2DRYA 3HBWA 4EFPA 1IILA 3VSZA 3RTIB 5FZZA 4G6JA 4MZHA 1AFCA 4XKIA 4I7IA 2Y9WC 4L4IA 4ZBVB 4D0ZA 3UD7A 4JKQA 3TC2A 3WO4A 2ET2A 4YOLA 3N7KA 4OEGA 3BAGA 2DRZA 4I96A 5D63A 4EFRA 3WMUA 2UUSA 2MLLB 3FJ9A 1YTOA 1ISXA 2HWMA 2Z49A 2NS2A 3F62B 3HMYA 2LIQA 1Q03A 4H9WA 1DLLA 1S0FA 3H6RB 3NBCA 4MZFB 1FMMS 3CRHA 1JT5A 1YBIA 2VXRA 2K43A 4G6MA 5HPZA 9ILBA 4H75A 1D0HA 3FJIA 1TWEA 3FJFA 1DQOA 1R8NA 2R9KB 5FZYA 1TTUA 4EEEB 1HWMB 3Q7XA 3PHZA 1Q1UA 2ERMA 3F1RA 2D7IA 5DUYA 1A8DA 4USOA 3AH1A 5DSSB 3FJKA 1BFFA 3N0KA 1BLAA 4GOYA 3FJEA 4IY8A 1FWVA 3E8LC 2D20A 3T8SA 4FGFA 1J0SA 3ILAA 4QD2C 4L4HA 2Q3NB 3JUTA 4X37A 1DFCA 2FGFA 2KI6B 3O44A 3AH4A 3UJ0A 4LO7C 5BXRA 1ISWA 3NBEA 3FJJA 2RG9B 3BRFA 2D7RA 3V79C 3K1XA 1V6WA 3BAQA 2HZ9A 3IM5A 2K4AB 3Q7WA 4Q9GA 3H6QA 1S0GA 1DQGA 3FUQA 3O4DA 3CA0A 3OGFA 1JTCA 3ZC8A 3P53A 4J2XA 4IYBA 5D61A 4I8MA 1V6VA 2D43A 4IQPA 1RZOB 2GZBA 5F90A 2NZ9A 3BB2A 2FO1A 3AKFA 1FGAA 4AN7B 4I1EA 3I2XA 3CAHA 3ZXGA 1G9AA 4PC4A 5BXPA 3ZC9A 41BIA 2XOAA 4I1BA 2WBCA 1AVAC 2ZR1B 2NP0A 1FMZA 4OEEA 4ENDA 5I1BA 3BAHA 4GP3A 3RTJB 5FNXA 1IJTA 1WBCA 5FNWA 5JLVA 3O3QA 1HCDA 1XZZA 4ISRA 1Q04A 4QKSA 2D44A 2QYIB 2E4MC 4MZGB 3FUOA 2VU9A 1SR4C 4I4QA 1S0LA 1DJSB 4I4RA 5BXSA 2FFVA 4IY9A 4WBCA 1FQ9A 1HWOB 4ZA3B 4A7YA 1TOOA 1S0CA 4DEPA 1PC8B 4KEJA 4R6UB 2D22A 3FFZA 3VSFA 3WMVA 2VSEA 4D8HA 4X3AA 5BVPI 4LO2C 3P6JA 3CQAA 1DIWA 1EVTA 2VUAA 2DS0A 4LO0C 4LO8B 1ISYA 4JKXB 4Q9PA 1JLYA 1HIBA 3OBTA 3AKGA 2NVHA 4X39A 4QO3A 4OUJA 1IRAX 3BA7A 2ZQNA 5E24E 3FJHA 3FJCA 3VT1A 2MC2A 5F8SA 2LIEA 1M16A 4LO3C 4P6AA 1BA7A 1HWPB 2Y9GA 2M49A 6I1BA 2KKIA 3AKHA 1IRPA 3RMYA 3I29B 4QKRA 2Q9XA 2P23A 3NBDA 3OGGA 5F8YA 2AFGA 2BEAA 1JT7A 3BAVA 2F2FC 3HN1A 4OWJA 3IIRA 1CE7B 5DZUA 3HOMA 2X2SA 3CA6A 3CA5A 4DCKC 3OJMA 4HR6C 4FVVA 1G82A 4I4OA 4I37A 5D62A 1PWAA 4KBBA 1Z4SA 3C9ZA 1FWUA 1WD3A 3A22A 1EYLA 4QALA 2E4MA 1I1EA 4G1RA 2RQ9A 2KH2A 1F31A 2FDBM 1S0DA 1CVSA 4I4SA 1SR4A 3FJ8A 3FJDA 3VT2A 4I4YA 2ESUA 3OBRA 2L5XA 4P0LA 4KEIA 3N7JA 4P0JA 4I2SA 3O5WB 3CRGA 4OWKA 1L2HA 3PG0A 3ZXDA 1AVXB 1FV3A 3IAGC 3V0BB 4I4PA 2K8RA 2VXTI 2Y9XE 4LO2A 4G9NA 3BAUA 3S8JA 3WO2A 1BLDA 1SZ6B 4LO0A 1TP0A 4AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISZ A;  1MD6 A;  3H6R A;  1JT4 A;  2NTD A;  4JRA A;  1W3G A;  4ZFU B;  3AJ5 A;  1XYF A;  1M2T B;  3BX1 C;  3IM7 A;  3OJV A;  1RML A;  1E0O A;  1EPW A;  1Z0H A;  3PME A;  1VCL A;  1V6U A;  2AXM A;  1HCE A;  3AZV A;  3POK A;  4HJJ A;  2KLL A;  2NM1 A;  3FGM A;  2VLC A;  3P6I A;  4J2K A;  1W3F A;  1YF8 B;  4GAI A;  1G9C A;  4HA2 A;  3MPP G;  3FJB A;  3BRD A;  1TFM B;  1HWN B;  3RSJ A;  4Z9W B;  4LO3 A;  4ZGR B;  4IZX A;  2D1Z A;  8I1B A;  1DZD A;  3VEQ A;  1ILR 1;  4IHZ A;  3AJ6 A;  3CA3 A;  3VUO A;  4I4X A;  5BQU C;  3FJA A;  3SNV A;  4JQ0 A;  3NBN A;  3Q7Y A;  2F2F A;  1AVU A;  4D0T A;  3WIN C;  3HAL A;  4QC4 A;  3JRR A;  1QXM A;  5BP5 C;  4Z8S B;  5FZU A;  3V0B A;  3BTA A;  3S8K A;  4ION A;  3UJ4 A;  4ZOT A;  2I1B A;  1WBA A;  1I1B A;  2DRE A;  4I3N A;  4LO1 C;  2P39 A;  5EG6 C;  3D7W B;  5EHA A;  3AKI A;  4A7Z A;  1YYN A;  2NYY A;  3A07 A;  4XFS A;  3CA1 A;  4ZLB B;  3LTQ A;  3QYD A;  3WA1 A;  1R8O A;  1RG8 A;  1BFG A;  1XG6 A;  3UD9 A;  1FN0 A;  3EF2 A;  4ISQ A;  3W9T A;  3QR5 A;  2WRY A;  3I2A A;  3ZX7 A;  1JY0 A;  1W3A A;  1BFB A;  3BAO A;  1AF9 A;  4EB2 B;  1T4Q A;  1KNM A;  4J2S A;  1IT0 A;  1JQZ A;  4X38 A;  3MAL A;  2AQZ A;  1WD4 A;  2YUG A;  2BFH A;  4G9M A;  3CRI A;  1GGP B;  3R4U A;  1QQL A;  1BFC A;  3WO3 A;  3AZW A;  4IZE A;  3PUB A;  1G9B A;  1PUU B;  3UDA A;  4EFQ A;  2IHO A;  5DVH A;  1RY7 A;  4J2Y A;  1AXM A;  1IHK A;  3O4O A;  1N4K A;  4H04 A;  1NUN A;  4OW4 A;  4Q91 A;  3O49 A;  3R4S A;  3O4B A;  7I1B A;  2QN4 A;  1UPS A;  4ZFW B;  3BAD A;  5BQU A;  3BRG C;  1TWM A;  3UD8 A;  4JPZ A;  3O4A A;  4QBV A;  3A21 A;  1ABR B;  3NJ5 A;  4CJM A;  1XHB A;  1V6X A;  5BOW A;  3WIN A;  4II0 A;  1Z2V A;  3B9U A;  4XFU A;  5BP5 A;  4I4U A;  21BI A;  4GP0 A;  2MIB A;  2BEB A;  1QQK A;  4GAF A;  2AAI B;  3LLP A;  1TIE A;  2X2T A;  1JT3 A;  4A7K A;  31BI A;  4USP A;  4LO1 A;  4ZKT B;  2D24 A;  4I0Y A;  3V0A B;  2Z48 A;  5JMC A;  5GAQ A;  5BXT A;  2IWT B;  3BA4 A;  4TLP A;  2GO2 A;  1II4 A;  4XFT A;  2VSA A;  3IM6 A;  2ZQO A;  4QBC A;  3VT0 A;  1S0E A;  3N7M A;  1G9D A;  4OEF A;  3BA5 A;  3KMV A;  3CU1 B;  2HW9 A;  1K5V A;  3A23 A;  4QD2 B;  4P0K A;  4KC3 A;  1PZZ A;  1ISV A;  3H6S E;  3VWC A;  1FV2 A;  3N7L A;  4LO7 B;  1DFQ A;  1BAS A;  5F8W A;  4F83 A;  1MC9 A;  4DEN A;  4GOV A;  1T9F A;  1ITB A;  2FFU A;  4KEK A;  5EC5 A;  1HKN A;  3OJ2 A;  1NZK A;  2J3P A;  1ONK B;  1YXW A;  1EV2 A;  1S0B A;  1AVW B;  1OQL B;  2KI4 A;  4J23 B;  2HWA A;  2Y9F A;  1P63 A;  3CA4 A;  2RST A;  3HSM A;  4I4V A;  4JAW A;  1DZC A;  3RMX A;  4OWL A;  4I6I A;  5B2H A;  5G00 A;  1BAR A;  3V0A A;  1IOB A;  1K5U A;  2D23 A;  1PUM B;  1JLX A;  3O4C A;  2F8X C;  3AH2 A;  4ZFY B;  4JP0 A;  4EKX B;  4F34 A;  2DRY A;  3HBW A;  4EFP A;  1IIL A;  3VSZ A;  3RTI B;  5FZZ A;  4G6J A;  1AFC A;  4XKI A;  4I7I A;  2Y9W C;  4L4I A;  4ZBV B;  4D0Z A;  3UD7 A;  4JKQ A;  3TC2 A;  3WO4 A;  2ET2 A;  4YOL A;  3N7K A;  4OEG A;  3BAG A;  2DRZ A;  4I96 A;  5D63 A;  4EFR A;  3WMU A;  2UUS A;  2MLL B;  3FJ9 A;  1YTO A;  1ISX A;  2HWM A;  2Z49 A;  3F62 B;  3HMY A;  2LIQ A;  1Q03 A;  4H9W A;  1DLL A;  1S0F A;  3H6R B;  3NBC A;  1FMM S;  3CRH A;  1JT5 A;  1YBI A;  2VXR A;  2K43 A;  4G6M A;  5HPZ A;  9ILB A;  1D0H A;  3FJI A;  1TWE A;  3FJF A;  1DQO A;  1R8N A;  2R9K B;  5FZY A;  1TTU A;  4EEE B;  1HWM B;  3Q7X A;  3PHZ A;  1Q1U A;  2ERM A;  3F1R A;  2D7I A;  5DUY A;  1A8D A;  4USO A;  3AH1 A;  5DSS B;  3FJK A;  1BFF A;  3N0K A;  1BLA A;  4GOY A;  3FJE A;  4IY8 A;  1FWV A;  3E8L C;  2D20 A;  3T8S A;  4FGF A;  1J0S A;  3ILA A;  4QD2 C;  4L4H A;  2Q3N B;  3JUT A;  4X37 A;  1DFC A;  2FGF A;  2KI6 B;  3O44 A;  3AH4 A;  3UJ0 A;  4LO7 C;  5BXR A;  1ISW A;  3NBE A;  3FJJ A;  2RG9 B;  3BRF A;  2D7R A;  3V79 C;  3K1X A;  1V6W A;  3BAQ A;  2HZ9 A;  3IM5 A;  2K4A B;  3Q7W A;  4Q9G A;  3H6Q A;  1S0G A;  1DQG A;  3FUQ A;  3O4D A;  3CA0 A;  3OGF A;  1JTC A;  3ZC8 A;  3P53 A;  4J2X A;  4IYB A;  5D61 A;  4I8M A;  1V6V A;  2D43 A;  4IQP A;  1RZO B;  2GZB A;  5F90 A;  2NZ9 A;  3BB2 A;  2FO1 A;  3AKF A;  1FGA A;  4AN7 B;  4I1E A;  3I2X A;  3CAH A;  3ZXG A;  1G9A A;  4PC4 A;  5BXP A;  3ZC9 A;  41BI A;  2XOA A;  4I1B A;  2WBC A;  1AVA C;  2ZR1 B;  2NP0 A;  1FMZ A;  4OEE A;  4END A;  5I1B A;  3BAH A;  4GP3 A;  3RTJ B;  5FNX A;  1IJT A;  1WBC A;  5FNW A;  5JLV A;  3O3Q A;  1HCD A;  1XZZ A;  4ISR A;  1Q04 A;  4QKS A;  2D44 A;  2QYI B;  2E4M C;  3FUO A;  2VU9 A;  1SR4 C;  4I4Q A;  1S0L A;  1DJS B;  4I4R A;  5BXS A;  2FFV A;  4IY9 A;  4WBC A;  1FQ9 A;  1HWO B;  4ZA3 B;  4A7Y A;  1TOO A;  1S0C A;  4DEP A;  1PC8 B;  4KEJ A;  4R6U B;  2D22 A;  3FFZ A;  3VSF A;  3WMV A;  2VSE A;  4D8H A;  4X3A A;  5BVP I;  4LO2 C;  3P6J A;  3CQA A;  1DIW A;  1EVT A;  2VUA A;  2DS0 A;  4LO0 C;  4LO8 B;  1ISY A;  4JKX B;  4Q9P A;  1JLY A;  1HIB A;  3OBT A;  3AKG A;  2NVH A;  4X39 A;  4QO3 A;  4OUJ A;  1IRA X;  3BA7 A;  2ZQN A;  5E24 E;  3FJH A;  3FJC A;  3VT1 A;  2MC2 A;  5F8S A;  2LIE A;  1M16 A;  4LO3 C;  4P6A A;  1BA7 A;  1HWP B;  2Y9G A;  2M49 A;  6I1B A;  2KKI A;  3AKH A;  1IRP A;  3RMY A;  3I29 B;  4QKR A;  2Q9X A;  2P23 A;  3NBD A;  3OGG A;  5F8Y A;  2AFG A;  2BEA A;  1JT7 A;  3BAV A;  2F2F C;  3HN1 A;  4OWJ A;  3IIR A;  1CE7 B;  5DZU A;  3HOM A;  2X2S A;  3CA6 A;  3CA5 A;  4DCK C;  3OJM A;  4HR6 C;  4FVV A;  1G82 A;  4I4O A;  4I37 A;  5D62 A;  1PWA A;  4KBB A;  1Z4S A;  3C9Z A;  1FWU A;  1WD3 A;  3A22 A;  1EYL A;  4QAL A;  2E4M A;  1I1E A;  4G1R A;  2RQ9 A;  2KH2 A;  1F31 A;  2FDB M;  1S0D A;  1CVS A;  4I4S A;  1SR4 A;  3FJ8 A;  3FJD A;  3VT2 A;  4I4Y A;  2ESU A;  3OBR A;  2L5X A;  4P0L A;  4KEI A;  3N7J A;  4P0J A;  4I2S A;  3O5W B;  3CRG A;  4OWK A;  1L2H A;  3PG0 A;  3ZXD A;  1AVX B;  1FV3 A;  3IAG C;  3V0B B;  4I4P A;  2K8R A;  2VXT I;  2Y9X E;  4LO2 A;  4G9N A;  3BAU A;  3S8J A;  3WO2 A;  1BLD A;  1SZ6 B;  4LO0 A;  1TP0 A;  4AN6 A; 
#chains in the Genus database with same CATH topology
 1ISZ A;  1MD6 A;  3H6R A;  1JT4 A;  2NTD A;  4JRA A;  1W3G A;  4ZFU B;  3AJ5 A;  1XYF A;  1M2T B;  3BX1 C;  3IM7 A;  3OJV A;  1RML A;  1E0O A;  1EPW A;  1Z0H A;  3PME A;  1VCL A;  1V6U A;  2AXM A;  1HCE A;  3AZV A;  3POK A;  4HJJ A;  2KLL A;  2NM1 A;  3FGM A;  2VLC A;  3P6I A;  4J2K A;  1W3F A;  1YF8 B;  4GAI A;  1G9C A;  4HA2 A;  3MPP G;  3FJB A;  3BRD A;  1TFM B;  1HWN B;  3RSJ A;  4Z9W B;  4LO3 A;  4ZGR B;  4IZX A;  2D1Z A;  8I1B A;  1DZD A;  3VEQ A;  1ILR 1;  4IHZ A;  3AJ6 A;  3CA3 A;  3VUO A;  4I4X A;  5BQU C;  3FJA A;  3SNV A;  4JQ0 A;  3NBN A;  3Q7Y A;  2F2F A;  1AVU A;  4D0T A;  3WIN C;  3HAL A;  4QC4 A;  3JRR A;  1QXM A;  5BP5 C;  4Z8S B;  5FZU A;  3V0B A;  3BTA A;  3S8K A;  4ION A;  3UJ4 A;  4ZOT A;  2I1B A;  1WBA A;  1I1B A;  2DRE A;  4I3N A;  4LO1 C;  2P39 A;  5EG6 C;  3D7W B;  5EHA A;  3AKI A;  4A7Z A;  1YYN A;  2NYY A;  3A07 A;  4XFS A;  3CA1 A;  4ZLB B;  3LTQ A;  3QYD A;  3WA1 A;  1R8O A;  1RG8 A;  1BFG A;  1XG6 A;  3UD9 A;  1FN0 A;  3EF2 A;  4ISQ A;  3W9T A;  3QR5 A;  2WRY A;  3I2A A;  3ZX7 A;  1JY0 A;  1W3A A;  1BFB A;  3BAO A;  1AF9 A;  4EB2 B;  1T4Q A;  1KNM A;  4J2S A;  1IT0 A;  1JQZ A;  4X38 A;  3MAL A;  2AQZ A;  1WD4 A;  2YUG A;  2BFH A;  4G9M A;  3CRI A;  1GGP B;  3R4U A;  1QQL A;  1BFC A;  3WO3 A;  3AZW A;  4IZE A;  3PUB A;  1G9B A;  1PUU B;  3UDA A;  4EFQ A;  2IHO A;  5DVH A;  1RY7 A;  4J2Y A;  1AXM A;  1IHK A;  3O4O A;  1N4K A;  4H04 A;  1NUN A;  4OW4 A;  4Q91 A;  3O49 A;  3R4S A;  3O4B A;  7I1B A;  2QN4 A;  1UPS A;  4ZFW B;  3BAD A;  5BQU A;  3BRG C;  1TWM A;  3UD8 A;  4JPZ A;  3O4A A;  4QBV A;  3A21 A;  1ABR B;  3NJ5 A;  4CJM A;  1XHB A;  1V6X A;  5BOW A;  3WIN A;  4II0 A;  1Z2V A;  3B9U A;  4XFU A;  5BP5 A;  4I4U A;  21BI A;  4GP0 A;  2MIB A;  2BEB A;  1QQK A;  4GAF A;  2AAI B;  3LLP A;  1TIE A;  2X2T A;  1JT3 A;  4A7K A;  31BI A;  4USP A;  4LO1 A;  4ZKT B;  2D24 A;  4I0Y A;  3V0A B;  2Z48 A;  5JMC A;  5GAQ A;  5BXT A;  2IWT B;  3BA4 A;  4TLP A;  2GO2 A;  1II4 A;  4XFT A;  2VSA A;  3IM6 A;  2ZQO A;  4QBC A;  3VT0 A;  1S0E A;  3N7M A;  1G9D A;  4OEF A;  3BA5 A;  3KMV A;  3CU1 B;  2HW9 A;  1K5V A;  3A23 A;  4QD2 B;  4P0K A;  4KC3 A;  1PZZ A;  1ISV A;  3H6S E;  3VWC A;  1FV2 A;  3N7L A;  4LO7 B;  1DFQ A;  1BAS A;  5F8W A;  4F83 A;  1MC9 A;  4DEN A;  4GOV A;  1T9F A;  1ITB A;  2FFU A;  4UY4 A;  4KEK A;  5EC5 A;  1HKN A;  3OJ2 A;  1NZK A;  2J3P A;  1ONK B;  1YXW A;  1EV2 A;  1S0B A;  1AVW B;  1OQL B;  2KI4 A;  4J23 B;  2HWA A;  2Y9F A;  1P63 A;  3CA4 A;  2RST A;  3HSM A;  4I4V A;  4JAW A;  1DZC A;  3RMX A;  4OWL A;  4I6I A;  5B2H A;  5G00 A;  1BAR A;  3V0A A;  1IOB A;  1K5U A;  2D23 A;  1PUM B;  1JLX A;  3O4C A;  2F8X C;  3AH2 A;  4ZFY B;  4JP0 A;  4EKX B;  4F34 A;  2DRY A;  3HBW A;  4EFP A;  1IIL A;  3VSZ A;  3RTI B;  5FZZ A;  4G6J A;  4MZH A;  1AFC A;  4XKI A;  4I7I A;  2Y9W C;  4L4I A;  4ZBV B;  4D0Z A;  3UD7 A;  4JKQ A;  3TC2 A;  3WO4 A;  2ET2 A;  4YOL A;  3N7K A;  4OEG A;  3BAG A;  2DRZ A;  4I96 A;  5D63 A;  4EFR A;  3WMU A;  2UUS A;  2MLL B;  3FJ9 A;  1YTO A;  1ISX A;  2HWM A;  2Z49 A;  2NS2 A;  3F62 B;  3HMY A;  2LIQ A;  1Q03 A;  4H9W A;  1DLL A;  1S0F A;  3H6R B;  3NBC A;  4MZF B;  1FMM S;  3CRH A;  1JT5 A;  1YBI A;  2VXR A;  2K43 A;  4G6M A;  5HPZ A;  9ILB A;  4H75 A;  1D0H A;  3FJI A;  1TWE A;  3FJF A;  1DQO A;  1R8N A;  2R9K B;  5FZY A;  1TTU A;  4EEE B;  1HWM B;  3Q7X A;  3PHZ A;  1Q1U A;  2ERM A;  3F1R A;  2D7I A;  5DUY A;  1A8D A;  4USO A;  3AH1 A;  5DSS B;  3FJK A;  1BFF A;  3N0K A;  1BLA A;  4GOY A;  3FJE A;  4IY8 A;  1FWV A;  3E8L C;  2D20 A;  3T8S A;  4FGF A;  1J0S A;  3ILA A;  4QD2 C;  4L4H A;  2Q3N B;  3JUT A;  4X37 A;  1DFC A;  2FGF A;  2KI6 B;  3O44 A;  3AH4 A;  3UJ0 A;  4LO7 C;  5BXR A;  1ISW A;  3NBE A;  3FJJ A;  2RG9 B;  3BRF A;  2D7R A;  3V79 C;  3K1X A;  1V6W A;  3BAQ A;  2HZ9 A;  3IM5 A;  2K4A B;  3Q7W A;  4Q9G A;  3H6Q A;  1S0G A;  1DQG A;  3FUQ A;  3O4D A;  3CA0 A;  3OGF A;  1JTC A;  3ZC8 A;  3P53 A;  4J2X A;  4IYB A;  5D61 A;  4I8M A;  1V6V A;  2D43 A;  4IQP A;  1RZO B;  2GZB A;  5F90 A;  2NZ9 A;  3BB2 A;  2FO1 A;  3AKF A;  1FGA A;  4AN7 B;  4I1E A;  3I2X A;  3CAH A;  3ZXG A;  1G9A A;  4PC4 A;  5BXP A;  3ZC9 A;  41BI A;  2XOA A;  4I1B A;  2WBC A;  1AVA C;  2ZR1 B;  2NP0 A;  1FMZ A;  4OEE A;  4END A;  5I1B A;  3BAH A;  4GP3 A;  3RTJ B;  5FNX A;  1IJT A;  1WBC A;  5FNW A;  5JLV A;  3O3Q A;  1HCD A;  1XZZ A;  4ISR A;  1Q04 A;  4QKS A;  2D44 A;  2QYI B;  2E4M C;  4MZG B;  3FUO A;  2VU9 A;  1SR4 C;  4I4Q A;  1S0L A;  1DJS B;  4I4R A;  5BXS A;  2FFV A;  4IY9 A;  4WBC A;  1FQ9 A;  1HWO B;  4ZA3 B;  4A7Y A;  1TOO A;  1S0C A;  4DEP A;  1PC8 B;  4KEJ A;  4R6U B;  2D22 A;  3FFZ A;  3VSF A;  3WMV A;  2VSE A;  4D8H A;  4X3A A;  5BVP I;  4LO2 C;  3P6J A;  3CQA A;  1DIW A;  1EVT A;  2VUA A;  2DS0 A;  4LO0 C;  4LO8 B;  1ISY A;  4JKX B;  4Q9P A;  1JLY A;  1HIB A;  3OBT A;  3AKG A;  2NVH A;  4X39 A;  4QO3 A;  4OUJ A;  1IRA X;  3BA7 A;  2ZQN A;  5E24 E;  3FJH A;  3FJC A;  3VT1 A;  2MC2 A;  5F8S A;  2LIE A;  1M16 A;  4LO3 C;  4P6A A;  1BA7 A;  1HWP B;  2Y9G A;  2M49 A;  6I1B A;  2KKI A;  3AKH A;  1IRP A;  3RMY A;  3I29 B;  4QKR A;  2Q9X A;  2P23 A;  3NBD A;  3OGG A;  5F8Y A;  2AFG A;  2BEA A;  1JT7 A;  3BAV A;  2F2F C;  3HN1 A;  4OWJ A;  3IIR A;  1CE7 B;  5DZU A;  3HOM A;  2X2S A;  3CA6 A;  3CA5 A;  4DCK C;  3OJM A;  4HR6 C;  4FVV A;  1G82 A;  4I4O A;  4I37 A;  5D62 A;  1PWA A;  4KBB A;  1Z4S A;  3C9Z A;  1FWU A;  1WD3 A;  3A22 A;  1EYL A;  4QAL A;  2E4M A;  1I1E A;  4G1R A;  2RQ9 A;  2KH2 A;  1F31 A;  2FDB M;  1S0D A;  1CVS A;  4I4S A;  1SR4 A;  3FJ8 A;  3FJD A;  3VT2 A;  4I4Y A;  2ESU A;  3OBR A;  2L5X A;  4P0L A;  4KEI A;  3N7J A;  4P0J A;  4I2S A;  3O5W B;  3CRG A;  4OWK A;  1L2H A;  3PG0 A;  3ZXD A;  1AVX B;  1FV3 A;  3IAG C;  3V0B B;  4I4P A;  2K8R A;  2VXT I;  2Y9X E;  4LO2 A;  4G9N A;  3BAU A;  3S8J A;  3WO2 A;  1BLD A;  1SZ6 B;  4LO0 A;  1TP0 A;  4AN6 A; 
#chains in the Genus database with same CATH homology
 1ISZ A;  1MD6 A;  3H6R A;  1JT4 A;  2NTD A;  4JRA A;  1W3G A;  4ZFU B;  3AJ5 A;  1XYF A;  1M2T B;  3BX1 C;  3IM7 A;  3OJV A;  1RML A;  1E0O A;  1EPW A;  1Z0H A;  3PME A;  1VCL A;  1V6U A;  2AXM A;  1HCE A;  3AZV A;  3POK A;  4HJJ A;  2KLL A;  2NM1 A;  3FGM A;  2VLC A;  3P6I A;  4J2K A;  1W3F A;  1YF8 B;  4GAI A;  1G9C A;  4HA2 A;  3MPP G;  3FJB A;  3BRD A;  1TFM B;  1HWN B;  3RSJ A;  4Z9W B;  4LO3 A;  4ZGR B;  4IZX A;  2D1Z A;  8I1B A;  1DZD A;  3VEQ A;  1ILR 1;  4IHZ A;  3AJ6 A;  3CA3 A;  3VUO A;  4I4X A;  5BQU C;  3FJA A;  3SNV A;  4JQ0 A;  3NBN A;  3Q7Y A;  2F2F A;  1AVU A;  4D0T A;  3WIN C;  3HAL A;  4QC4 A;  3JRR A;  1QXM A;  5BP5 C;  4Z8S B;  5FZU A;  3V0B A;  3BTA A;  3S8K A;  4ION A;  3UJ4 A;  4ZOT A;  2I1B A;  1WBA A;  1I1B A;  2DRE A;  4I3N A;  4LO1 C;  2P39 A;  5EG6 C;  3D7W B;  5EHA A;  3AKI A;  4A7Z A;  1YYN A;  2NYY A;  3A07 A;  4XFS A;  3CA1 A;  4ZLB B;  3LTQ A;  3QYD A;  3WA1 A;  1R8O A;  1RG8 A;  1BFG A;  1XG6 A;  3UD9 A;  1FN0 A;  3EF2 A;  4ISQ A;  3W9T A;  3QR5 A;  2WRY A;  3I2A A;  3ZX7 A;  1JY0 A;  1W3A A;  1BFB A;  3BAO A;  1AF9 A;  4EB2 B;  1T4Q A;  1KNM A;  4J2S A;  1IT0 A;  1JQZ A;  4X38 A;  3MAL A;  2AQZ A;  1WD4 A;  2YUG A;  2BFH A;  4G9M A;  3CRI A;  1GGP B;  3R4U A;  1QQL A;  1BFC A;  3WO3 A;  3AZW A;  4IZE A;  3PUB A;  1G9B A;  1PUU B;  3UDA A;  4EFQ A;  2IHO A;  5DVH A;  1RY7 A;  4J2Y A;  1AXM A;  1IHK A;  3O4O A;  1N4K A;  4H04 A;  1NUN A;  4OW4 A;  4Q91 A;  3O49 A;  3R4S A;  3O4B A;  7I1B A;  2QN4 A;  1UPS A;  4ZFW B;  3BAD A;  5BQU A;  3BRG C;  1TWM A;  3UD8 A;  4JPZ A;  3O4A A;  4QBV A;  3A21 A;  1ABR B;  3NJ5 A;  4CJM A;  1XHB A;  1V6X A;  5BOW A;  3WIN A;  4II0 A;  1Z2V A;  3B9U A;  4XFU A;  5BP5 A;  4I4U A;  21BI A;  4GP0 A;  2MIB A;  2BEB A;  1QQK A;  4GAF A;  2AAI B;  3LLP A;  1TIE A;  2X2T A;  1JT3 A;  4A7K A;  31BI A;  4USP A;  4LO1 A;  4ZKT B;  2D24 A;  4I0Y A;  3V0A B;  2Z48 A;  5JMC A;  5GAQ A;  5BXT A;  2IWT B;  3BA4 A;  4TLP A;  2GO2 A;  1II4 A;  4XFT A;  2VSA A;  3IM6 A;  2ZQO A;  4QBC A;  3VT0 A;  1S0E A;  3N7M A;  1G9D A;  4OEF A;  3BA5 A;  3KMV A;  3CU1 B;  2HW9 A;  1K5V A;  3A23 A;  4QD2 B;  4P0K A;  4KC3 A;  1PZZ A;  1ISV A;  3H6S E;  3VWC A;  1FV2 A;  3N7L A;  4LO7 B;  1DFQ A;  1BAS A;  5F8W A;  4F83 A;  1MC9 A;  4DEN A;  4GOV A;  1T9F A;  1ITB A;  2FFU A;  4UY4 A;  4KEK A;  5EC5 A;  1HKN A;  3OJ2 A;  1NZK A;  2J3P A;  1ONK B;  1YXW A;  1EV2 A;  1S0B A;  1AVW B;  1OQL B;  2KI4 A;  4J23 B;  2HWA A;  2Y9F A;  1P63 A;  3CA4 A;  2RST A;  3HSM A;  4I4V A;  4JAW A;  1DZC A;  3RMX A;  4OWL A;  4I6I A;  5B2H A;  5G00 A;  1BAR A;  3V0A A;  1IOB A;  1K5U A;  2D23 A;  1PUM B;  1JLX A;  3O4C A;  2F8X C;  3AH2 A;  4ZFY B;  4JP0 A;  4EKX B;  4F34 A;  2DRY A;  3HBW A;  4EFP A;  1IIL A;  3VSZ A;  3RTI B;  5FZZ A;  4G6J A;  4MZH A;  1AFC A;  4XKI A;  4I7I A;  2Y9W C;  4L4I A;  4ZBV B;  4D0Z A;  3UD7 A;  4JKQ A;  3TC2 A;  3WO4 A;  2ET2 A;  4YOL A;  3N7K A;  4OEG A;  3BAG A;  2DRZ A;  4I96 A;  5D63 A;  4EFR A;  3WMU A;  2UUS A;  2MLL B;  3FJ9 A;  1YTO A;  1ISX A;  2HWM A;  2Z49 A;  2NS2 A;  3F62 B;  3HMY A;  2LIQ A;  1Q03 A;  4H9W A;  1DLL A;  1S0F A;  3H6R B;  3NBC A;  4MZF B;  1FMM S;  3CRH A;  1JT5 A;  1YBI A;  2VXR A;  2K43 A;  4G6M A;  5HPZ A;  9ILB A;  4H75 A;  1D0H A;  3FJI A;  1TWE A;  3FJF A;  1DQO A;  1R8N A;  2R9K B;  5FZY A;  1TTU A;  4EEE B;  1HWM B;  3Q7X A;  3PHZ A;  1Q1U A;  2ERM A;  3F1R A;  2D7I A;  5DUY A;  1A8D A;  4USO A;  3AH1 A;  5DSS B;  3FJK A;  1BFF A;  3N0K A;  1BLA A;  4GOY A;  3FJE A;  4IY8 A;  1FWV A;  3E8L C;  2D20 A;  3T8S A;  4FGF A;  1J0S A;  3ILA A;  4QD2 C;  4L4H A;  2Q3N B;  3JUT A;  4X37 A;  1DFC A;  2FGF A;  2KI6 B;  3O44 A;  3AH4 A;  3UJ0 A;  4LO7 C;  5BXR A;  1ISW A;  3NBE A;  3FJJ A;  2RG9 B;  3BRF A;  2D7R A;  3V79 C;  3K1X A;  1V6W A;  3BAQ A;  2HZ9 A;  3IM5 A;  2K4A B;  3Q7W A;  4Q9G A;  3H6Q A;  1S0G A;  1DQG A;  3FUQ A;  3O4D A;  3CA0 A;  3OGF A;  1JTC A;  3ZC8 A;  3P53 A;  4J2X A;  4IYB A;  5D61 A;  4I8M A;  1V6V A;  2D43 A;  4IQP A;  1RZO B;  2GZB A;  5F90 A;  2NZ9 A;  3BB2 A;  2FO1 A;  3AKF A;  1FGA A;  4AN7 B;  4I1E A;  3I2X A;  3CAH A;  3ZXG A;  1G9A A;  4PC4 A;  5BXP A;  3ZC9 A;  41BI A;  2XOA A;  4I1B A;  2WBC A;  1AVA C;  2ZR1 B;  2NP0 A;  1FMZ A;  4OEE A;  4END A;  5I1B A;  3BAH A;  4GP3 A;  3RTJ B;  5FNX A;  1IJT A;  1WBC A;  5FNW A;  5JLV A;  3O3Q A;  1HCD A;  1XZZ A;  4ISR A;  1Q04 A;  4QKS A;  2D44 A;  2QYI B;  2E4M C;  4MZG B;  3FUO A;  2VU9 A;  1SR4 C;  4I4Q A;  1S0L A;  1DJS B;  4I4R A;  5BXS A;  2FFV A;  4IY9 A;  4WBC A;  1FQ9 A;  1HWO B;  4ZA3 B;  4A7Y A;  1TOO A;  1S0C A;  4DEP A;  1PC8 B;  4KEJ A;  4R6U B;  2D22 A;  3FFZ A;  3VSF A;  3WMV A;  2VSE A;  4D8H A;  4X3A A;  5BVP I;  4LO2 C;  3P6J A;  3CQA A;  1DIW A;  1EVT A;  2VUA A;  2DS0 A;  4LO0 C;  4LO8 B;  1ISY A;  4JKX B;  4Q9P A;  1JLY A;  1HIB A;  3OBT A;  3AKG A;  2NVH A;  4X39 A;  4QO3 A;  4OUJ A;  1IRA X;  3BA7 A;  2ZQN A;  5E24 E;  3FJH A;  3FJC A;  3VT1 A;  2MC2 A;  5F8S A;  2LIE A;  1M16 A;  4LO3 C;  4P6A A;  1BA7 A;  1HWP B;  2Y9G A;  2M49 A;  6I1B A;  2KKI A;  3AKH A;  1IRP A;  3RMY A;  3I29 B;  4QKR A;  2Q9X A;  2P23 A;  3NBD A;  3OGG A;  5F8Y A;  2AFG A;  2BEA A;  1JT7 A;  3BAV A;  2F2F C;  3HN1 A;  4OWJ A;  3IIR A;  1CE7 B;  5DZU A;  3HOM A;  2X2S A;  3CA6 A;  3CA5 A;  4DCK C;  3OJM A;  4HR6 C;  4FVV A;  1G82 A;  4I4O A;  4I37 A;  5D62 A;  1PWA A;  4KBB A;  1Z4S A;  3C9Z A;  1FWU A;  1WD3 A;  3A22 A;  1EYL A;  4QAL A;  2E4M A;  1I1E A;  4G1R A;  2RQ9 A;  2KH2 A;  1F31 A;  2FDB M;  1S0D A;  1CVS A;  4I4S A;  1SR4 A;  3FJ8 A;  3FJD A;  3VT2 A;  4I4Y A;  2ESU A;  3OBR A;  2L5X A;  4P0L A;  4KEI A;  3N7J A;  4P0J A;  4I2S A;  3O5W B;  3CRG A;  4OWK A;  1L2H A;  3PG0 A;  3ZXD A;  1AVX B;  1FV3 A;  3IAG C;  3V0B B;  4I4P A;  2K8R A;  2VXT I;  2Y9X E;  4LO2 A;  4G9N A;  3BAU A;  3S8J A;  3WO2 A;  1BLD A;  1SZ6 B;  4LO0 A;  1TP0 A;  4AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...