1RYFA

Alternative splicing of rac1 generates rac1b, a self-activating gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
170
Chain Sequence
GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1b
total genus 51
structure length 170
sequence length 203
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ryfA00
4AYWA 2OG2A 1C4OA 1SULA 3CR8A 4FMCB 4DDUA 3Q5DA 2C96A 4RFSA 4N0EA 3VTKA 4BWYA 2OV2A 1NKTA 3SQXA 2PEYA 3CX8A 3B2EA 1P2UA 1Z28A 1IY0A 2QROA 3QE0A 4GZLA 3PXGA 3VHLB 5CDFE 2QTFA 2OEPA 2R9VA 3RRNA 4CEJB 5IDVA 1UF9A 2GJSA 1DAHA 4FMCF 5FR1A 4KFSA 3P4XA 4XWKA 5CITA 1BMFD 4P4SB 4US1R 4XTCS 1U9IA 2WJGA 3OE7D 1W36C 2ZUDA 2JJ1D 3OEHA 2RGBA 2IWRA 1UEJA 4ZDWA 3CUEF 1E9SA 3QPWA 4D6PA 5B57C 3NC1C 4DHEA 2IS1A 3BORA 2J59A 4S2EA 3TRFA 3J81k 3B8HA 4LHXA 4DWJA 2QBYA 2EFCB 3K0CA 1IQPA 1X6VA 5J4HA 1W48A 4JKIA 2WKQA 1IXZA 2A5YB 5FPSA 4BRUA 4DCNA 3TQCA 2FSGA 4WZAE 3LXRA 1J8MF 5FI1B 4K81B 2ZQ5A 1VKJA 4HDOB 3BS4A 4GBMA 1E9AA 3W3AA 5EE5B 4QJ4A 3GLGB 3H1TA 3RSLA 1W46A 4C2UA 3GLHB 4LOAA 4Q4JA 4TLDA 3AF0A 4CVNA 5EE9A 4HZIA 3U7HB 3THYB 1FP6A 2O8CA 1YE8A 3TR0A 2BVNA 2HXYA 2X8AA 1JNYA 4IOJA 5CK5A 1FNNA 1G1MA 4DCTA 4TQAA 3KQLA 4CEHA 2JIZD 5KPDA 3VQTA 1FNMA 3A6PC 4OL0A 2Q9CA 2QQEA 3GJ4A 1D8TA 1XF9A 2ZRIA 5CK4A 1E4YA 3ZLJA 1SQ5A 1AS2A 2V6JA 1WF3A 2YWFA 3B1ZA 1JR3D 3MD0A 3HP1A 1JEDA 4RCZA 1KSHA 2EYQA 4URVR 2OFXA 1FFHA 3Q7PA 3GLIB 3KL4A 4A1FA 1AGPA 5BN4A 4QM6A 1S1CA 5KYKA 2BM0A 4GNKA 1M2OB 2OLJA 2WWIA 2QU8A 4M21A 4A92A 3E70C 3D8BA 1ZM9A 4BLOA 3ADDA 1XDBA 2RGXA 1NG9A 3PIRA 4LJYA 4URZR 1DG1G 2ZE7A 3EZFA 1KY3A 3GD7A 4NL4H 8OHMA 1F48A 4TTRA 4Z8XA 3AP3A 2R62A 3R7WB 2C2HA 2GVDC 2KBFA 4UXHA 4XWAA 1KK0A 4M9XA 4XSHA 4AURA 4X8MA 3ND8A 3EIQA 3UG6A 2CLCX 5C4GB 5A4JA 3TH5A 5IK2A 5HE8A 4BLPA 4B2LA 4OYHA 4WXPA 3G82C 2DPXA 4QRHA 4KFTA 2Q6TA 2ZI3A 4B73A 1QHGA 4Q4LA 3I92A 1N0WA 1I4LD 4P3YA 4KLZA 1G18A 2H17A 4V0MA 3THYA 3AM1A 1X8JA 2XTMA 3EW9A 1AZTA 1NBMA 1KTVA 2RMKA 4XOIA 3TAHA 4M1SA 2HLDA 5FTNA 4AC9A 3KX2A 2HF8A 1XD8A 3KB2A 3KB1A 4B3XA 1QG4A 3BH7A 1XD2A 4LBYA 4DUGD 5AJVB 1HQCA 3LO5A 3DPUA 4ARZA 4KCGA 4A6XA 1EG7A 1EWQA 2GF9A 3GJ5A 1JR6A 1KI6B 3Q3JB 4DB4A 1E79A 4N0DA 3SBDA 3CX7A 2XOKD 3R7WA 3VFDA 3TK1A 4DZZA 1BH2A 1VG9B 3C5CA 3PQCA 1T8UA 3QENA 2FX3A 4OI4A 5B64A 2XB2A 1R0WA 4XD7D 1BS1A 2IYYA 4G01B 3HPRA 1YRAA 3X1DA 3CRVA 2FU5C 4QJ5A 2R6CA 1I2MA 5KUTA 1K8RA 2GNOA 3BBPA 3V00A 1XCPA 4JJZA 1CR4A 3PVSA 4WBSA 1KDOA 1JB1A 4MYHA 4URUR 2RAPA 5HR5A 4BRWA 1V43A 3VR4A 1RRPA 4D4JA 2B7BA 2BIFA 3A36A 1OT3A 3BXZA 3IUYA 2XX3A 2ZUCA 4HLUA 1AS0A 1KO1A 3ASZA 3CH4B 2GK6A 3RS3A 3VR2A 4LY6A 4B33A 3GEIA 2D2FA 4S35A 5C2JB 1SKYE 1G7TA 2CNWA 2Z43A 4AK9A 3EZ2A 4Q18A 2C03A 2O8CB 4EFLA 1UBCA 1GZSA 1G4UR 1Z83A 3QF7A 4FN5A 4AG5A 4DT1B 2QE7A 3QBTA 4RJLA 4PFSA 2CHVA 2DHRA 4PC7A 2FZ4A 1Z3IX 3ADKA 4IFEA 4C0LA 2ZM5A 4M4SA 2ZRDA 3RVBA 4MYCA 4RD0A 1OYYA 2QTVB 1QDEA 3AF3A 4NTZA 3T1QA 4BFSA 1OIVA 5G3ZA 1Z0IA 3U6KA 1M7HA 4IEEA 1KIMA 3AB3A 4QBGB 2QSZA 1G19A 2D2EA 3KXKA 5JEDA 1CEEA 3IEVA 2IYRA 2RGCA 1DE0A 2A9KA 1ZUIA 1FP7A 2HYDA 4LV6A 4QBIA 1AM4D 2NO1A 3GLHE 1NBME 2WPDA 2PCJA 4FMBB 4TMXA 2WWGA 3WP0A 1Z6AA 1KDRA 2YJTD 4NDZA 4RKFA 2IYSA 2Q21A 1GL7A 2IL1A 5EUMA 3ZGXA 2IEYA 4B3BA 3NVAA 1II9A 4N1AA 5JJIA 3EIHA 4QBFA 3U3OA 3C4JA 3ADCA 1J70A 1NMYA 3VX4A 1DAGA 4BFXA 3K9HA 4GT1A 2WV9A 3ONWA 3H4MA 1G3QA 4P0TA 1W0JA 2YOFA 4F38A 1R2QA 2J7KA 2ZREA 2CLSA 2IA5A 1HTWA 2VPPA 1FX0A 2DWQA 3DKVA 4C0JA 1T8TA 4A8JB 4Z54A 2B7CA 3PEWA 1QRAA 4AWXA 2VA8A 3V4FA 1KI3A 4LZZA 1Z6TA 3PCRB 1LNZA 1HA3A 1P9NA 1IY1A 2UZ3A 3KUCA 3H84A 1KDPA 4GOXA 2F1HA 1SVKA 1P4SA 2FV8A 5JLJA 3QKRA 4TMVA 2IT1A 4Q4AB 4JLKA 4LDJA 4NPHA 1MRSA 3CF0A 1QVAA 4IHQA 4JVSB 4D2IA 4NU0A 3X1WA 1YQTA 1VIYA 1KAOA 2J0SA 5CIWA 2REOA 5LBIA 3SYKA 5HCNA 5GJWC 1LVGA 4EQ6A 2X1VA 3LX5A 2NZJA 4Q1CA 3VU9B 2GDJA 4NCKA 3KTAB 4EPTA 3AKCA 4W9MC 1U99A 4IJMA 1W4CA 1N25A 2WJVA 2VSFA 3H2YA 3ND9A 4JL5A 2J1LA 4Q4HA 5DYIA 2G1JA 5FBWB 4X8OA 5FI0B 1DO0A 4PTLA 3U3MA 2EYUA 3CH5A 5C1BA 3GCGA 3QG1A 2BDTA 2IYVA 3I72A 2C8VA 4W5HA 1QHSA 5KU1A 1Z2AA 4WVFA 4ZKEA 5KPJA 4M1MA 2DFLA 3GEEA 3I3SR 1Q1QA 4Y0AA 2CDNA 4PHTA 1N6RA 4LBVA 3UK6A 1R6BX 1ZC3A 3N2IA 3NBFA 1IXSB 6Q21A 4PC2A 1S0UA 5FTLA 2OBLA 2JATA 2UZIR 2GJAA 4RD1A 2V1XA 2GXQA 2HUPA 4D80A 1OFUX 5HKKD 1MOZA 2F1JA 1KGDA 2D06A 1G5TA 3ZH9B 4JYBA 4PZLA 3KKOA 4BZPA 2PZGA 1CJVC 4DC9A 4BGDA 5L3QB 3SC3A 3THWA 3C5HA 3E1SA 3T34A 2G6BA 3EIEA 4KITB 1E4VA 4QNRA 3RYTC 3HU3A 4GL2A 1JI0A 2E87A 1E2IA 2FSHA 3U4QB 4OK3A 1R0ZA 2IW3A 3BE4A 2ANCA 1G16A 2QP9X 2QP4A 4IOMA 3P1JA 4X8LA 1ZU4A 1MO4A 1XMJA 1JQJC 5HCIA 2ZRMA 2JASA 1CF4A 2QP3A 2Z4RA 2ZI9A 4MUAA 1RW4A 2I4IA 1ZUNB 4HUQA 4IRUB 4EQ6B 3IIMA 3K0FB 1T6NA 3AGQA 3PEUA 1T91A 2ZYVX 5DH9A 5GJVC 2W0MA 4PC1A 4NYJQ 2LKDA 3FOZA 3ZVLA 4GFDA 3QXCA 1XTSA 2F7SA 5F98A 4FMDF 1OH7A 4EIWA 4RZXA 5KOYA 3GLFE 4CEIA 4TSFA 4IDOA 1NVVR 2PBRA 2ZIAA 3RRYA 2Z4SA 4OQNA 2ZAMA 4DT1A 3NC0C 1JJVA 1UKEA 1NL3A 1TF2A 2FH5B 1DAMA 2NO6A 1FMJA 3QXXA 2N42A 1YR6A 2LWIA 2PLRA 1MV5A 2Q9BA 3CLVA 3IDQA 1S9DA 4LJ9A 3T5DA 4A0GA 4Q9KA 2R6AA 1N6HA 4UNNA 2G3YA 3CZQA 2WICA 2GZHA 1DS6A 4L16A 3GFPA 1KYIA 3UMRA 1YR9A 2IXGA 2RH5A 4UQOA 1DO2A 1S2MA 5AUQA 2DWPA 4KYUA 3ASYA 1XEWX 3F5FA 3RRZA 1TX4B 1EGAA 4GDFA 2H8KA 1SHKA 1IN8A 3HPQA 5L3VA 2ZJYA 2GZDA 2REBA 1E2PA 2C98A 4WZBE 3AVTA 4JYCA 1G21E 1KI4A 3OE7A 5DSZA 5FUWA 3LFUA 4P33A 1AQYA 4AG6A 1VDZA 4DLWA 1VPLA 1SKQA 4IOLA 1E3MA 1RYHA 1QF9A 5BN5A 2TMKA 3U7GA 4TMKA 2HT6A 4JSYA 1NG1A 2G83A 2CK3A 3VHXA 3EPHA 1P6XA 5F9HA 4P4UA 1W5SA 4FIDA 1QHXA 4A36A 1NVWQ 5AJZA 4AKHA 3QKSA 1E2EA 4AKGA 1B23P 1ZD1A 3EZ6A 4BFUA 3EZ9A 721PA 3D7MA 1OKKD 3K0CC 1G3IA 2WTUA 2FPLA 3RANA 2XZLA 4TMWA 5JS7A 2JLZA 1XMIA 4V02A 1Z2CA 2EFGA 2EQBA 5CB8A 4FWTA 3S1AA 5L8VA 2PL3A 1O3YA 3M6AA 1N6IA 4QGGA 4EFMA 1US8B 4NCJA 3R8CA 5BW8A 4ZDKA 5CDFA 1WB9A 3PEVA 1E0SA 1XZQA 2ECKA 3QXSA 1CIPA 1EX7A 2HT1A 3SDZA 4PPFA 5JRZA 3K8YA 2ZJAA 4DUGA 3FHTA 3IO3A 1P5ZB 2ODNA 3ZS8A 1WXQA 3R20A 3O8BA 5EZ6B 4B2IA 1E0KA 4DLYA 2OAP1 4ITRC 4GP6A 4ZV4A 3BH6A 1SGWA 5CIQA 1YU9A 2BC9A 2ZRLA 2CCKA 4WW0A 2ZJ8A 2WJHA 2DCUA 5KSOA 1U8AA 2FE4A 2VHTA 3DEFA 5DGXA 2AD1A 4JMPA 1GSIA 1XU4A 5EXXA 2QPAA 1IJFA 1E9EA 2VP6A 1EFHA 3K09A 3B9PA 4IDNA 4MA4A 2BEKA 3ZZTA 4DEYA 3AKEA 3MSXA 4NZYA 4YMTA 2I1QA 5KHOC 4B3CA 3KKNA 1G7SA 2WSSD 1P2VA 3CNLA 3X2SA 4HYYA 3WMEA 4MRRA 3BK7A 4U5XA 1ODFA 1P9WA 3TGPA 4FW9A 2BV3A 2ZI7A 4BFTA 1N6OA 2SHKA 2ZR7A 4Q7JB 2Y8EA 2G88A 4P4SA 3NBXX 4L8GA 3NBYC 1YR8A 2P67A 4KFRA 4LX0A 3JZAA 4II7A 4RVCA 4UXIA 3SJZA 1ESNA 4K46A 4F4CA 1MR3F 1DPFA 5CM8B 1E1RD 1JECA 1GRNA 2RB4A 3KQUA 2CHGA 2XITA 4RD4A 4WOPA 4DDTA 2ZRFA 1EFCA 1FQJA 5EP2A 1WMSA 2R6FA 4IDHA 2V7QD 2LKCA 2CCGA 3QOFA 3MCAA 2NO0A 1F2UA 1YVDA 5TVKA 3K53A 1TAGA 3O8RA 4PPNA 2QQ0A 3P4YA 5EP4A 4BFWA 4EAQA 5ANRB 3GPLA 1OXUA 3TSOA 1QHYA 2JLVA 1OF1A 4JBWA 1VYVA 4PO8A 1DTSA 3CRMA 1Z0AA 3GLIA 2FDCA 1W4BA 3C16C 3WMFA 3NXSA 1NNEA 1AA9A 1VCIA 3CPHA 2L0XA 2WBLC 4PSKA 2ZRJA 3SJCA 2CJWB 2NQ2C 2ZJOA 4OQMA 2BJVA 4C0QC 2WSMA 1KO8A 1LF5A 1O87A 1Q3HA 1TF7A 3UXMA 1G8PA 3SS8A 2BBTA 5LD2C 5EUQB 1U8ZA 1GRQA 4KSBA 5DHAA 3IPYA 3CKLA 2OILA 4LGMA 1W7AA 3U6BA 1X1RA 2ZANA 3CIOA 1RIFA 1E2QA 1MABB 2BM1A 1X1SA 3BAFA 3F8TA 5FL7A 4US2R 3WNDA 1TEVA 3IO5A 4BZQA 4JLMA 2FGJA 3AKYA 1NSFA 2ASEA 2KE5A 3QPVA 2O8BA 1I2DA 2ZRKA 2FSIA 1BOFA 3LQQA 4CGZA 3LWNA 5JJLA 4RD6A 1TU3A 1VG0B 3KQNA 4EDHA 2BMEA 2WPDD 1Z8FA 2JCSA 3VR3A 5H70A 4LCBA 4LJ4A 3LLMA 4BFYA 1XBTA 2XSZA 5B2ZA 3MJRA 4C30A 4D4LA 1ZINA 2VHUA 3TJZA 2YKGA 4DLTA 2ZYWX 3ETLA 3LVQE 1T9HA 1U8YA 3MGCA 3HR8A 4G5OA 1PUIA 1KNQA 2AHOA 1WP9A 4O2LA 1XTQA 3ZJYA 4HEJA 2CE2X 4R98A 2ZYUX 1HY3A 2DFKB 1E1RA 2FGKA 1R8SA 2ONKA 3H0KA 1CP2A 1DADA 1WRBA 3LNCA 3G5UA 5KSZA 3AF4A 2OHFA 3PR1A 1AZSC 2KBEA 2IF0A 3DOFA 2V8OA 4TYWA 2J87A 2IXFA 2XAUA 3RAPR 2GILA 3QY0A 1TQ6A 3UWOA 4A2PA 5JEEA 1RRGA 4KXFB 1EK0A 1NJGA 2OXCA 2ZSEA 2HCBA 4OK6A 4RSGA 1U2RA 2PT5A 2ZR9A 5TARA 2JDID 3ZZ0A 2DFNA 1W0KA 2RGNA 3IIJA 4JT4A 2ORIA 1OYWA 1W36B 2WIAA 3OESA 3LH5A 4US0R 1ZP6A 3KQKA 3R8FA 4JLNA 4EFNA 2HYIC 3CRRA 2CXXA 3FMOB 1ZMXA 3TAUA 2W00A 5KSPA 4IEIA 4B44A 2VIIA 1E32A 4LWZA 3B82A 2BBSA 5CYOA 4UKDA 2CHQA 2JJ1A 1PJRA 3OEHD 3TBKA 3EASA 3AF1A 3VKWA 1FX0B 4QOSA 4PHHA 1E9CA 1YZGA 2FJUA 3AH8A 2JLUA 2J5XA 5FTJA 1EFRD 1RFLA 1R10A 2AWNA 3B13B 4W5JA 2QY9A 2NPFA 1S3GA 3M0EA 1G4AE 3CRQA 4B71A 4E03A 5FOUA 1OXTA 4YXWD 2ANBA 1TL7C 1OXXK 1XX6A 1FMLA 3QEJA 2ONJA 2XJ4A 1TQ2A 2WKPA 3Q8XB 4UNPA 2AFHE 1HE1C 3D31A 2DR3A 2ZS8A 2H18A 3QNUA 1IHUA 3FWYA 3RS5A 4HSEA 1DAIA 2YZ2A 2H57A 2GESA 2GA8A 3W90A 2VHCA 2CNWD 2D4HA 5CLLA 3TW4A 3SJBA 2QI9C 4CW7A 2AFIE 2O0HA 3PEYA 4Z1MD 3GQBA 1Q22A 1US8A 2QAGC 2GEVA 4PPQA 5FPTA 3LX8A 2YINC 1TU4A 1UAAA 2JAQA 1A7JA 1N5JA 1G6HA 1KK2A 2QSYA 3B1YA 2JJ2A 4NYIR 3QI2A 2FN4A 4AYTA 4ZIRB 3QJYA 2JDIA 1BYUA 1NIPA 3ADBA 1UBGA 2D7CA 1F60A 4I1VA 2W6IA 1ZW6A 1YZLA 4AKEA 1P60A 1T3HA 5AUOB 4TL9A 4PXAA 5JI2E 1A5TA 4IDQA 1E2JA 5JWRA 5BYKA 3SYNA 4A8JA 4QHTA 5E7JA 2PEZA 1GWNA 2OT3B 1TEXA 3BFXA 1HV8A 3LLUA 5K8TA 2V3CC 1NRJB 3DDCA 2GETA 1GKIA 5TB5A 1Y63A 2IYUA 3QF4A 1Z0JA 4XVQA 2CE7A 5DI9A 1DARA 4OK5A 4LUCA 4DKXA 1JAIA 3A1UA 4GOKA 3W6OA 2PMKA 4TYPA 1OFHA 4KVGA 1GM5A 2VF7A 3ZQJA 3WRXC 3K0SA 4OHZA 2JA1A 3NIBA 4H1VA 1JJ7A 3A1TA 4NCHA 4ACBA 3QKSB 4Z51A 3SQWA 3A37A 4JLOA 5H68A 4MRSA 1II8A 1MO5A 1NY5A 3T12A 4B6FA 2V9PA 3IQWA 3TLXA 1WQ1R 4KYIB 4P32A 1HEIA 1TQ4A 2KB0A 3C41J 4KVAA 4OJKA 5BQ5A 3Q5EA 3CNNA 4LJ6A 1AS3A 4DJTA 3PITA 1LB1B 2ZVQX 3NWJA 5E4FA 4LC0A 1N5IA 1R5OA 3K70B 3QBVA 4U02A 1JQLB 3B5JA 4DLXA 1Z06A 3MMPA 4C0SA 4LJ5A 3OFNA 2G77B 1GKYA 5FBRB 5EP1A 4A2WA 5BWMA 3GLGE 4IDPA 2NMVA 1VCMA 5J4YA 4YMUA 1GDDA 1M1YE 2D3WA 2ZRCA 5JBQA 1H8ED 1E99A 1SXJE 2VBCA 3QXJA 2P2LA 1T5IA 1DG3A 3Q72A 3W3ZB 1TF5A 4PQFA 1U0LA 2QMHA 1MABA 1HYQA 3K9LA 3SEAA 3RS0A 4B74A 5CLQA 3AUXA 1UBFA 1FUUA 2GTPA 4ZCLA 2A5FA 2ZE8A 3A1VA 4LHYA 4NCNA 5FOXA 3UKDA 2AXNA 2FA9A 4KI0A 2F1IA 4A9AA 2ZSAA 1RRCA 2ZITA 2BMJA 4YDHB 1PVOA 2P5TB 4GZMA 4M1OA 4PAMA 5ELXA 4D0GA 1XTRA 3K0AB 1OSNA 4EJSB 4G5GA 2NGRA 2WWHA 2AD5A 1VMAA 3EC2A 2QL6A 4OHYA 1KOFA 4LHWA 1YZNA 1WA5A 2OFOA 5AUNB 1XXHB 3FB4A 421PA 1TNDA 4A82A 1ZNWA 221PA 1Q0UA 3S1AB 1NIJA 5L3SB 3AP1A 1RC8A 2J7PD 1Z0FA 4DEXA 1M6NA 3RSOA 4ERNA 4TWZA 4ASUA 4M53A 3W34A 4EPRA 4R2IA 2V7QA 4JS0A 2XTNA 1W2GA 4HLUC 4KHZA 5L3RA 4IVPA 5FTMA 4JVLA 5KTYA 2H16A 5L3QA 3O8CA 1EESA 2ZI5A 3WMGA 2MMGA 1KO4A 2G1KA 4OI1A 2HXSA 1GNPA 1HE8B 2BCGY 3N70A 2CMKA 2GF0A 4Q7KA 1YRBA 5FUVA 3RWOA 1UJ2A 4M22A 2V55B 4KFUA 2I1VB 3IEUA 2QT1A 5BXQC 4A15A 1Q44A 1MO3A 5EE3A 2XZOA 1S3SA 2GCNA 1G8YA 3EA0A 3HU2A 1G3UA 4YLGA 1CR1A 4B32A 2JLXA 2MSCB 5A0FA 1S96A 3QKUA 4EJSC 1G5RA 1W4RA 3NTUA 5D3QA 1DAFA 1KK1A 1GILA 2VYFA 5LB2A 3WYAA 2O0KA 5FR2A 3KXIA 2RGEA 1ZBDA 4EUNA 2GJKA 4DDWA 1RYFA 5JCZA 1SXJA 1XD9A 4TL7A 2QGZA 1QVRA 2GZAA 4MKHA 1N5KA 2GHIA 5IRCD 2QZ4A 2ZRBA 3E5HA 4TLCA 4TT3D 1VG8A 4BQSA 4B3GA 4P4TA 3W9YA 3SOPA 4QM7A 1L7VC 3WXMA 3AVYA 4R9UC 1FZQA 2R6GA 4G5QA 4JVMA 1T3SA 3QF4B 2JLRA 4V0OA 1E96A 4LYJA 4Q19A 1KNXA 3DM5A 3U3JA 1CJMA 1G41A 4C7OA 3LDAA 3W5JA 3FHCB 4PAOA 3K70C 1Q57A 4RD3A 1D2NA 2RGDA 1ZAKA 2O52A 1XFAA 2PLFA 3P27A 4YMWA 4BASA 1NLZA 4MQBA 3K9GA 3I4LA 2RGGA 2IBMA 3ICQB 1NF3A 2ODWA 2ZXUA 1D2MA 1SXJB 5TXGA 3CPJB 4I99A 1J90A 1XJQA 1WBBA 4QGFA 5AJXA 3EARA 4QHYA 5FTKA 3V9PA 3C8UA 1JXMA 4D4KA 1DAEA 5HKKA 1RKBA 4PHGA 1Q1BA 4MKFA 4GMXA 1BYIA 3RNLA 3UIEA 1H8EA 2QMOA 1KMQA 4PR0A 2WVJA 3GLIE 2QMEA 1E69A 2CVHA 3QPUA 4LSGA 3TSWA 3P26A 4ARZB 2ZJZA 2X2FA 3I61A 2AWOA 4FCTA 2GEUA 3N5CA 3E2IA 3CRW1 1AK2A 2XEXA 4TL8A 2ZE5A 1HURA 4HZUB 1NBMD 2X77A 4EPYA 4L4UA 4GP7A 1A82A 1NY6A 2ZS7A 2EU8A 4V0ME 3BERA 3L0SA 4F4JA 1GVNB 5H1YA 1Q3TA 2HEIA 1AIPA 3FKQA 3IKJA 4Z8YA 2CEAA 4E07A 2O8BB 1N5LA 1R7RA 4TYQA 4P31A 3EPLA 2WWXA 1GIAA 1SVSA 5CJPA 4J0QA 1AKEA 1VCOA 3W8NA 2B8TA 2P65A 4LV5B 4DDVA 4ZI2A 1QHHA 1VCNA 4M1YA 1TTTA 1XXHA 2QA5A 4QL3A 4HLCA 3U3RA 1MT0A 4CEJA 2VQSA 1NI3A 3NBZC 1KI9A 3K1JA 1KJZA 1R0YA 1VTKA 1XTKA 2QEQA 3A8TA 1BKDR 4I1OA 3C14C 2O8EA 1IOZA 4RFSB 1BIFA 4KV9A 1A2KC 3K0AA 4MRNA 1M7BA 4M2LA 4PANA 2NZ8A 1JALA 2VH5R 1UKYA 4MGIR 1OB5A 3CWZA 1VYUA 5AK0A 4K8OA 1OH8A 5UKDA 4Q7MB 2GXSA 4FINA 1W0JD 3RLFA 4O0MA 2AKYA 1CBUA 4AY2A 2F9MA 4OI2A 3KKPA 4ESHA 4LHVA 2IYTA 3WRYC 2ZSFA 4JLAA 2BEJA 1F3OA 1GG2A 4Q00A 1XMSA 2I3BA 2VO1A 4OQFA 1NN3A 4WIAA 1LW7A 1AJEA 3QQ5A 2YOHA 3AKDA 3HDTA 4L9SA 3VR1A 4QGAA 4MGYR 1XEXB 2XGJA 2JIZA 4OHXA 2IS4A 1IY2A 1VHLA 2CCJA 4NKRA 4DSUA 2H5EA 2EWWA 2V4ZA 3K0FA 3GJ7A 2ZJBA 2ZU0C 3B7GA 3GJ8A 4A6PA 4TZ6A 5FOWA 3CONA 3A4NA 3SFZA 2ZE6A 1E2KA 1GNRA 5FBVB 1KJWA 1KSJA 4Q66C 3SHWA 3TR5A 3B78A 2C9OA 1N6NA 4OJQA 3WY9A 1ONBA 2FFBA 4B35A 3L2OB 1NSTA 4BFVA 3K09C 3LW8A 4XH9B 1CJTC 1BO6A 5G53C 5JZVA 3MUFA 3OIUA 4MRPA 1E1QA 4I4LA 4V0LA 2ORVA 1A4RA 2QPTA 4OQLA 3PG5A 3Q9LA 4Q4HB 2IUSA 3HYRA 1IONA 5B58C 2A30A 3JVUA 5JHHB 1OIXA 1W5TA 4KODA 1UDXA 4Q03A 3ECCA 2HDNB 3T1VA 2Q9AA 2XB4A 4DVGA 2IXEA 2GJ8A 4RD2A 3QG5A 3BFKA 5FBLB 3UATA 3QIAA 4YQFA 4V0KA 1SVIA 3T06B 1E2GA 3MJHA 4NH0A 3MWKA 1XEXA 2J3EA 1J2JA 5M04A 821PA 4HDQB 1R5NA 2PX0A 3WNBA 4GMDA 5HZKA 5D3MB 2GCPA 1CKEA 2QENA 2QG6A 2ZSDA 3VKHA 4Q5IA 5KNDA 2Z5FA 4G5SA 2WAYA 4LPKA 2BMFA 3PUXA 4D0LB 2ZRAA 3I1FA 1GUAA 3OEED 4TSFD 1L4YA 3EAQA 2P6RA 1S8FA 1EFRA 1E2HA 1FTNA 3T5GA 3BJIC 3MG9A 1WBDA 1W47A 4KBGA 2QE7D 2VEDA 2BWJA 4HB2A 2BBOA 2FF7A 3PENA 4PO1A 2C9CA 3UMSA 2B6HA 5HTKA 5DLQC 2AN9A 1QHNA 3LVRE 4UJ3A 3SI7A 4AI6A 121PA 1ZM3A 1G3MA 5FOTA 1Q1EA 2OAQ1 2HLDD 1ETUA 1KKMA 4PSAA 4PZYA 1Z5ZA 1RJ9B 3P32A 1ZIOA 4JLBA 4R7ZA 5DI3B 3SU8A 2OUKA 1U94A 2X19A 1JPJA 1Z08A 5TMPA 1P2SA 5G40A 4OHWA 2AR7A 4PX9A 1NVVQ 1JPNA 3L0IB 1DELA 2H92A 5EQTA 1IN4A 3SYLA 3LQRA 2XXAB 2ZEJA 4MUBA 5CYPA 3KUDA 4M8NE 3THOA 4MYUA 3IPXA 4EPXA 2WIBA 2EFHB 2X2EA 3MWJA 3O8DA 1VG1A 2EFDB 4JLJA 4POAA 1AQUA 4H1UA 2QTHA 2REXB 4NYIQ 4EPVA 4LJAA 1E0AA 2MSEB 1J7KA 2W2TA 1XD2B 2AK2A 4F93B 1U0JA 3BFVA 1GTVA 3DHWC 2J46A 4JBYA 5J4VA 5L3SA 4BFZA 2CL0X 2EVWX 3TIFA 2XOKA 1ZU5A 2ZVPX 1E9BA 1VYTA 4I81A 2A7QA 1KI1A 2RHDA 1RJ9A 1ZIPA 1VECA 3ZIAD 4M9QA 2OESA 2HJGA 5FFMA 3AQ4A 5C4MA 3R9IA 4M1TA 4B75A 2A5DA 4E5UA 4NP6A 4GOJA 4PQRA 4Q4AA 4URYR 2O8FB 3VR5A 1V5WA 4DLVA 2AKAB 2IWHA 4TTQA 1G20E 3VNUA 1KZGB 5KSYA 2BBWA 4QKQA 3MWLA 5GJCA 2NTYC 4V03A 4DSTA 1U90A 2VP4A 4DBLC 1KI2A 3BH0A 3AGPA 1ZD8A 2DFTA 4ZI3A 1RVDA 3NH9A 3P20A 1NP6A 2GXAA 2UKDA 3CF2A 3CM0A 4DXAA 1E2FA 1GOTA 2C95A 2P5SA 4O25A 1IBRA 2IK8A 1XTIA 4NCIA 4JLPA 4CEIB 2YWEA 5FPHA 3ZYCA 4Q1FA 2O8FA 2ZRNA 2YOGA 2A5JA 3OHMA 3FKSD 3MAAC 4BZXA 4JZKA 2OXRA 4BECA 5HPYB 5FPYA 3FFAA 2AL7A 2BCJQ 1ZC4A 4G3XA 2R8RA 5G3YA 2ZI4A 2OFWA 2ZSBA 3CNOA 2YHSA 4KU4A 3M4YA 4TQ9A 3GFTA 4CYMA 4DLRA 3D6TB 3NEYA 1X8LA 2Q3MA 1U0HC 1XEWY 4HB3A 3U4QA 1KSGA 4YMSA 1IN5A 1KMHA 2O8DA 1UADA 3LAWA 3MRSA 2EWVA 1MKYA 3H86A 4TYYA 4R2HA 1SXJD 2IYWA 2QMUA 4OI0A 1FL9A 1MRNA 1H65A 2B8WA 3QXHA 3W6PA 3DZDA 4MGZR 4AIIA 2F9LA 4B47A 3KZ1E 1ZUHA 4IOKA 1OJLA 2VSOA 3FFBA 4IXNA 3SR0A 1UBEA 4IVQA 1KJYA 4YC7A 1FOEB 1AKYA 1E94E 1N3BA 2QGNA 3KJHA 1SVLA 2OZEA 3TNFA 3U44B 3UG7A 2IYLD 1KMHB 3R9XA 4MDFA 4Q9HA 4QXAA 4NONA 2ZTSA 2QAJA 2DY1A 3BIFA 3EPKA 3M1IA 3I5YA 2F43B 4FI3C 3Q7QA 5IK2D 2IHBA 1DOAA 4IVRA 1EFTA 2ORWA 4QJ3A 1QG2A 1EX6A 2HV8A 3CPEA 3KTAA 2IEZA 3VR6A 2V54A 2IS2A 1VIAA 3CZPA 1ZRHA 4JL6A 1M8PA 4OBEA 4Q7LA 3WP1B 1U81A 1A1VA 2F55A 3EA5A 1E0JA 1EXMA 3PUVA 2FG5A 3PUWA 1KSFX 1ZM2A 1G17A 1XCGB 3KJIA 4Y0VA 1F2TA 5SZHB 1P73A 1M74A 1SVMA 5JECA 2VHQA 3KKMA 1FUKA 3IHWA 5DE3A 4ACAA 1W2HA 3IHLA 3K9NA 2ZETA 5E7IA 3BRWD 5JWHA 5J4KA 3GLHA 4Q4JB 3OZXA 4XVRA 2J7PA 3OIYA 2VRWA 1OLOA 4JKYA 4Q9JA 2B21A 2W2VA 3ICEA 3LRPA 4MGKR 1LS6A 2PT7A 2W6ID 2ZU6A 4I1SA 3X1XA 3IBGA 2VLIA 2ZRPA 4XJXA 4JBXA 1G3RA 1NMXA 1YZKA 1QBKC 4W5WA 3T35A 4FXPA 3FPAA 2JJ2D 4JVNA 4HZUA 1MO6A 1XPUA 2NPIA 2NO7A 3TVTA 1GNQA 1YZUA 3FHOA 1SZPA 4GI7A 2BMDA 3SN6A 5A5GA 4CIDA 4MDEA 4BLTA 5F3WB 3AVQA 3AV0B 1G64A 1KDTA 4M1KA 4Z1MA 2P6UA 3UMFA 1YKSA 1CRQA 4I1UA 3ZVMA 1II0A 1N6LA 2GCOA 1C1YA 2XSZD 1TMKA 1CJKC 1OV4A 3REGA 3B1XA 2IF2A 2C9YA 4BE7B 3NG1A 2MMCA 3FTQA 4YDSA 2C78A 4HAZA 1SKYB 1YZTA 2QAGB 4D26A 2ODEA 2WM9B 5DN6D 4Q47A 1JEEA 2UVQA 5C18A 5JWOA 2IUTA 2BKEA 3KFVA 3LBNA 4RY2A 3TUIC 3L0PA 4F4IA 4ZCIA 3KQHA 4M1WA 4IKEA 3ZIAA 1AN0A 1NVXQ 4BLQA 1GL9B 4A4DA 4HDCA 621PA 2C77A 3BC1A 2RCNA 3I73A 1UKVY 4EPWA 3DVLA 1UPTA 2CVFA 4NMMA 5DYGA 3SZRA 2K5UA 2WHXA 4C2TA 1GL6A 5KO2A 4Q1AA 1UFQA 4RZUA 3X1ZA 1IN7A 1I4DD 1P62B 2PJZA 3ZVNA 3NDBB 1HT1E 2R2AA 2ATXA 3L43A 3K70D 4L5BA 3AVUA 1Z29A 4PC3A 4M0LA 4RFVA 1DVRA 1H8HA 4ZDIA 4HAVA 4RZ2A 4DCUA 2QRZA 1Z6YA 1Q21A 1R8QA 1QHHB 4KO8A 4LJ8A 5BYJA 2Z83A 3A4MA 1HT2E 1IXRC 2QNRA 2VL7A 3KXLA 3FYHA 1II8B 2JLSA 4U00A 4Q01A 1X8KA 1XWIA 3TVDA 4TQUS 1NVUQ 2OM2A 4A0FA 4CRWB 2ZAOA 1LS1A 5AJWA 2FFAA 5TV2A 2W2XA 4A2QA 3IILA 3R9WA 2ZR0A 4DCSA 1G6OA 1EWRA 1HUQA 3W5IA 5LPNA 1G8FA 3CB4A 3NHAA 3RHFA 4G5RA 4HB0A 2W83A 3RC3A 1S9HA 1Z6XA 3LV8A 4QFMA 4DRZA 1KY2A 1L8QA 1OFTA 1R5BA 2O5VA 1H8HD 1OKKA 1Z47A 2FZLA 3F3YA 2OCAA 4KJZA 4C3ZA 3I32A 1XNJA 5P21A 3I5XA 4C4PA 1SXJC 3A58B 1E2MA 3W8RA 3ZQ6A 2RHMA 5K8UA 4MH0R 4MITA 1E2NA 3AUYA 2OSBA 3U7EB 5FL3A 3RRMA 3RS7A 1TQDA 1D5CA 1KK3A 1J99A 2NOAA 5B30A 3WHLA 4KAXA 4LBWA 1GFIA 3I8SA 3RABA 3CR7A 5JSZB 5HE9A 3QSYA 3DL0A 3AEZA 5DO9A 2W6JD 3A4LA 2QN6A 1YHNA 1JAHA 2IC5A 4HLQB 4LYHA 3RS2A 4D81A 5JS8A 4PAQA 2WMOB 3NDPA 1QHIA 1Z0KA 5GADl 3JVVA 2KSQA 5HZHA 1OH6A 5EE1A 2OBMA 4TT3A 2VSXA 5K8IA 3VKGA 3N2EA 1LTQA 1OE0A 3RC8A 1ZNZA 3LD9A 5DNYB 1G7CA 1XEFA 1XPOA 1JXOA 3GLFA 4QBHA 3CO5A 1E1QD 4LPSA 4C0HA 2JLYA 2O8EB 2Q3HA 1AGRA 2C04A 3OAAD 3EPJA 1KI6A 1N6PA 3GMTA 1UM8A 5BN3A 1ESMA 4LV8B 4NYMQ 4ESVA 3C15C 2HF9A 5SZKB 3MLEA 1R0XA 1W4AA 4NYMR 4PSVA 3T1TA 1XJ0A 1W44A 3V4RA 1CTQA 4WA7A 4W7SA 2GEDA 4YMVA 4N3NA 3UPUA 1QZXA 4CEHB 3VNVA 521PA 1XB2A 2O8DB 5C46F 3EWSA 2GKSA 4ASUD 3GP8A 2A5GA 3AF2A 1C9KA 1XP8A 4RKEA 2VP5A 2WJJA 1F5NA 4Q48A 1GITA 1Q1ZA 3F0TA 2G9NA 4UNRA 1U98A 2FMXA 1ZNXA 3QEOA 1IM2A 1PLKA 2QRNA 4V0NA 2YC4C 2ZI6A 1E79D 2D7DA 1DEKA 2H1LA 2YVUA 2KJQA 1ZJ6A 3TKLA 1R4AA 5FOSA 1IN6A 2GBLA 1E9DA 1CJUC 3I8XA 3TUJC 4HAWA 4ZCMA 3W6NA 4HATA 4HLDA 2HJVA 1L4UA 3SBEA 4Q1DA 4URWR 1XCMA 2ZUBA 4DCVA 2WZQA 1E2LA 1E9FA 3GEHA 1D6JA 3BOSA 3JZMA 1W49A 4DSOA 2ODBA 5AUPB 3NH6A 1CLUA 2WKRA 5EXTA 2CL6X 4TZ0A 2FWRA 3FMIA 2PJRA 2JLQA 5J4LA 2BHRA 1X86B 4MKIA 1IAQA 2E9SA 3HWSA 1WCV1 3AP2A 1D9XA 1F6BA 5EP3A 2ZROA 4D4MA 2RGNC 4TLEA 3RDPA 4TYNA 4CT5A 3A1WA 1SVWA 1UKZA 2QUZA 3HR7A 3OIVA 4XIGS 5CM9C 1XPRA 2G0NA 3NEJA 3BB3A 5EJEA 2W6JA 2JGNA 3LBIA 4IFBA 4G1UC 5JSZA 1ZNYA 4QGHA 4OHVA 5E7MA 1TADA 4NBSA 4B43A 1F2TB 4AKIA 4PO9A 5AR1A 5JHGB 2FOLA 5IF9A 1CR0A 4KBFA 2QAGA 3A1SA 2RGAA 1E6CA 3IBYA 2V1UA 3TE6A 3BWDD 5GJBA 3HYTA 3ZD7A 1M7GA 3BD9A 1HQYE 1ZVQA 1N6KA 1XTJA 3L0OA 2A3RA 4Q21A 1E2DA 3GLGA 4Q9LA 4JT2A 1ZYUA 4XSGA 2GXUA 1ZCBA 4ZIRA 4JL8A 4TLAA 2WJIA 4HAXA 2F43A 5FUYA 1KZ7B 2B92A 2GBLC 2ZRHA 4MKGA 2PMDA 4QHSA 1NLYA 1Z63A 4M9SA 2QBYB 3VAAA 4PZZA 1G5PA 3SNHA 2VF8A 1YR7A 3THWB 1B0UA 2PH1A 2QT0A 3CBQA 2NO9A 2ZS9A 3KJEA 2GVZC 2G0TA 1ELOA 5EE0A 4LHZA 5AJYA 4ZPXA 4D82A 1JBKA 2J45A 5JFGA 4HB4A 1ANKA 2N1BA 2OCYC 3DMNA 1RRFA 1S1MA 5IHPA 3SFVA 2J0UB 2KWIA 2Z6VA 3WNCA 4B34A 4LYAA 4URXR 2QPOA 4F7WA 3G0HA 1KKLA 2Q3FA 1ZD9A 2IYZA 1SHZA 2CK3D 2IHYA 2DYKA 2WAXA 2OCPA 3GJ3A 4Q1BA 3BB4A 3EXAA 1PZNA 4EKDA 4E09A 2ERYA 3PJRA 5EXSA 2OBNA 4FWIB 2NIPA 2R44A 4OKSA 1P2TA 2AX4A 5G41A 4C0AC 5DISB 1LV7A 3ZD6A 2GK7A 4JIMA 1Z07A 1XXHE 5F2EA 3AVPA 2P3SA 4PQYA 4F92B 3L82B 1UDWA 2GRJA 3ZDQA 3WBJA 2ERXA 5E3HA 3L8ZA 3DO6A 4C0KA 1NMZA 1XRJA 3B1WA 3B60A 1XJCA 2VTKA 3EWAA 2GAOA 1FW6A 1M34E 2CLDX 4ZDJA 2J0VA 4EJSA 1P3JA 4PC6A 1NN0A 1T0JB 2W58A 3GLFB 1OW3B 2OE2A 3WBKA 4Q9IA 3QKRB 1F2UB 2A2ZA 5DN6A 4LYFA 1YJ5A 4G0NA 4NYJR 1W36D 3VMFA 4MYTA 3DZ8A 4L9WA 3PV0A 1D9ZA 1KAGA 5GVSA 1NKSA 5GVRA 1TPZA 1CXZA 3KDSE 5JI3E 2GJ9A 2GCOB 2F1RA 3IIKA 1XZPA 3QVVA 4DB2A 5DHFA 3U7FB 2D74A 3AVWA 1NN1A 1GAJA 1Z0DA 3WYGA 5FL7D 5FOVA 2JEOA 2N46A 1G291 2YWHA 3I62A 2IS6A 4DIEA 5KDLA 3REFA 2WOOA 5FUXA 3O47A 4B48A 4BUJA 4O3MA 5IT5A 1KHTA 1CULC 1KO7A 1S4QA 2AXPA 2MSDB 3OAAA 1WDTA 1PLLA 1CRPA 2E1RA 3LA6A 1VHTA 4ON9A 2YV5A 1LFDB 2VHJA 2FPMA 2J41A 3LBHA 2FNAA 1W0KD 3FGNA 1JR3E 2IX3A 5J5CA 3LXXA 5DI3A 1OB2A 1DBSA 1COWD 2D62A 4JLDA 4TL6A 2WWYA 3GJXC 2YYZA 1GKUB 2AK3A 4U7DA 2XNSA 4WXRA 3WYFA 1G8GA 1OIWA 2H7VA 4X8HA 4Q1EA 2IYXA 2R65A 3FDIA 2CJWA 2DWOA 1LF0A 1PLJA 3B1VA 3TQFA 5JJKA 2XZPA 4XD7A 4BEBA 3TUZC 4ZKDA 1K6MA 3KFXA 5EXPA 4FD2A 2DBYA 3LY5A 3K0EA 4BLSA 1P72A 1P75A 3AVOA 4AD8A 4QC2A 1NJFA 3SJAA 4DLSA 3U5ZB 5E95A 4CT4B 5DIFA 3OEEA 5KDOA 2NG1A 4TMZA 4YXWA 1RE0A 1PV4A 3UANA 1ZM7A 2VP2A 4L15A 3DM9B 1P7CA 4JSTA 4KLNA 1N0VC 2HCJB 3OFND 5H8WA 2V6IA 1Z6GA 4E22A 2CL7X 1SVOA 1OPXA 4UNSA 4DLUA 1OHHA 4HUQB 4ZO4A 3CF6R 1U9IC 3U61B 3PUYA 3THXA 2OLKA 4KSCA 4B3FX 1T4GA 3TW8B 3D3QA 2O0JA 5F9FA 1FPMA 1KI7A 2OCBA 2PCLA 2ZRGA 5LDDC 4XVUA 3TSZA 2XJ9A 4Q02A 1FTSA 2BJWA 2YNMA 2F3TA 4GPTA 2Z0MA 2ATVA 3U44A 3NKVA 1N2CE 4OQXA 3LW7A 4LC1A 4TLBA 5SZJA 1ZCAA 1N0UA 3T15A 3RS4A 1K5DA 2F6RA 4JJKA 1G9XA 2J0UA 3CW2A 1E9RA 3ZVRA 4D25A 4FCWA 2GWHA 4UNQA 3WHKA 3VX3A 4ILEA 2C99A 2CBZA 4QG7A 4IW3B 2W0SA 4PHFA 5FH9A 2XNDD 2ZPTX 5EZ5A 3KJGA 4NHOA 1K5GA 1LY1A 4B2PA 4TN1A 5FPKA 1JR3A 3DKPA 2KI5A 1RZ3A 3FMPB 3QVUA 2JLWA 4LK2A 4ABYA 2P0EA 4C9BA 3TMKA 2QM8A 4RZ3A 5KNCA 1PUJA 1TUIA 3GJ0A 3SHFA 3ZZUA 1OFIA 4XWOA 2DB3A 5AWFC 5LB4A 1OH5A 4A8JC 1DAKA 1T3LA 3QUSA 2ZYTX 3VU9A 1HH4A 4BLRA 3THXB 1RPZA 2LCFA 2WJYA 5CB6A 2GAAA 2YC2C 3OIWA 3IGFA 4R71A 1CR2A 3B85A 1W1WA 2IYQA 5J40A 4TMTA 3EX7C 3X1YA 5D3MA 1G7RA 2FFHA 4C7OB 1OHHD 2WMNB 4TTPA 1T0HB 4DIDA 4YONB 1GRRA 1NLFA 3FMFA 3C7KA 2F3RA 1TUEA 2EW1A 1Q20A 3OF5A 1J8YF 5SZIA 5JCPA 1Z22A 3CX6A 1FQKA 3GFOA 5KNBA 1BMFA 2Q0HA 2FEMA 3HJNA 4BPBA 1UEIA 4HAYA 3GJ6A 2J9RA 4QNMA 4XTRA 3T61A 1P61B 2FSFA 4A0RA 2C5LA 2YWGA 2R6DA 2WSSA 3B6EA 2PX3A 1G8HA 5CJ2A 4UJ5A 5K8LA 2BOVA 5JRJA 1X3SA 3QKTA 4LI0A 5FBQB 4D0NA 1GP2A 4RCYA 4C0BA 2A78A 2XNDA 1I4TD 2OO7A 4A0HA 4CDGA 2RKOA 3AVVA 4AYXA 3AVXA 2EFEB 3EC1A 1ZM4A 3UWKA 2JJ8A 1OXVA 3MFYA 5TDHA 3KKQA 4FMDB 4F91B 3NHBA 1OXSC 4B76A 2ZJ5A 4DSNA 4LJ7A 1L2TA 3MWYW 2IUUA 1NN5A 3HU1A 3U2QA 4FCVA 2J0QA 1Y3AA 1COWA 1D2EA 2FFQA 3L8YA 2XXAA 1EFUA 1XMVA 1CU1A 4B3DA 2WWFA 3EG5A 3RWMB 1Q12A 4NE2A 1YZQA 3PUZA 2QORA 1T5LA 3BB1A 4M9ZA 4LBZA 4DLZA 5LD2B 1E98A 2PZEA 3Q85A 1IJEA 4JLVA 4CZ2A 5JMTA 4UXJA 4IXMA 4WZ6A 4B6EA 4GRAA 3PFIA 1KO5A 1P9RA 1A2BA 4HI0E 3FKSA 3ZS9A 4PPGA 2FEOA 4HUTA 2VP9A 2P6NA 1KI8A 2BKUA 4HAUA 3FVQA 3SE0A 5J47A 5KDDA 1CS4C 3T1OA 3BGWA 2WWWA 3U60B 4H9GA 2PZFA 2XTZA 3IQXA 3FE2A 4LRWA 3B9QA 4BEJA 2VP0A 2FPKA 2WOJA 4MRVA 4WAUA 1MH1A 2QM7A 3DMDA 3U3KA 1WE2A 4O2RA 4CF7A 3CWQA 2ZJ2A 4GSYA 3EZ7A 3DOEA 5TY0A
chains in the Genus database with same CATH superfamily
3BE8A 2X58A 3TQOA 2IHZA 4KYTA 4RPGA 1BCSB 1E66A 5JALA 1N36B 4KR3A 4HYEA 4ILKA 1GPH1 1UFVA 4ER5A 2OHHA 2NSYA 3LYUA 2GPWA 3MTDA 4I6GA 5SYNA 3GLQA 4B3RB 4DUYB 4MV5A 1DFGA 1QHFA 3Q87B 3UXEA 1I0IA 1Z28A 4FOLA 3PXGA 5BOVA 2HWYA 2OAEA 3BD6A 4ND1A 1XDDA 1MVNA 1E9VA 2KMLA 3D8TA 4NRDA 5IH3A 1B73A 4K0RA 1DAHA 4FMCF 2ZIVB 3FZQA 5I4BA 1E5LA 3HS3A 1U9IA 2WJGA 5G0VA 1XA0A 4JWTA 4FHEA 5ADVA 5K0FA 2P2SA 1R66A 1N2GA 2O54A 1MV8A 4HWSA 1Z17A 3QSGA 3QTTA 2W71A 4K9RA 4MTLA 3UH0A 3ULKA 3NHLA 3ZQUA 1TW3A 3HGTA 1LBTA 3LF1A 4YCMA 1Y7LA 3CUEF 1FB5A 3NC1C 1B0AA 1GPLA 4LHEA 3W2HA 4C4XA 5AM2A 2BGKA 4Q3CA 4KLRA 2NW6A 3SHQA 1K6JA 2MSNA 2QBYA 1NM5A 2NUBA 5DKFA 2HHHB 1ECPA 2XNCA 2NZ2A 4IR7A 5HUHA 4RQAA 4K81B 3U1TA 1FDIA 1VKJA 4HDOB 3TOZA 1C9DB 3O4HA 1WKBA 4WESA 5EE5B 2ERCA 3GLGB 1KQPA 3LO8A 4C2UA 3VR4H 4X5OA 1BHJA 1EVYA 3FYTA 3HY4A 4DAEA 3IA2A 5A62A 5EE9A 5JQGB 1TM5E 4BJ6A 3U7HB 4QE3A 1M83A 3VJLA 1YE8A 4YIHA 4DIUA 5IHXA 2HXYA 1A9TA 2JCXA 3R4CA 2B1IA 4FSHA 4XX0B 4TQAA 2GYYA 2G0AA 1JILA 1FNMA 1MJ5A 3H2IA 4CM1A 3PNOA 1G59A 2ZULA 2P69A 4OL0A 3GJ4A 5DHPA 1EE2A 2PD6A 3AWDA 1O6ZA 4GKJB 3PYXA 1Y37A 5E2AA 1M34B 2V6JA 3MD0A 3USCS 1JR3D 5AW1A 3HP1A 4RCZA 5F77A 1W87A 3GUUA 1KSHA 2CFCA 4URVR 3OA2A 2OFXA 3ABRB 2M1XA 1FFHA 5H81A 1S02A 4A1FA 1NXWA 2G67A 3E3MA 4Y7CA 4C6RA 4E6EA 2A92A 4U2BA 2R3SA 2BM0A 4GNKA 5LQNA 2G04A 1HZZA 1M2OB 1E2BA 1QYVA 5DHUA 2VDWB 5THXA 1W96A 4A92A 1JJFA 4BLOA 1ZM9A 8LDHA 5AVJA 3GELA 3RAFC 3JWHA 1DXQA 4LJYA 3ZBTA 5BRJA 4URZR 3WMRA 4EYGA 1R64A 1KY3A 8OHMA 4I50F 2D13A 4EVSA 3DEYX 4JYMA 2XKJE 2BEVB 4LC9A 2C2HA 5FBHA 3V80A 3QYPA 5ALGA 1I24A 5CURA 1TMOA 1M54A 2Q6OA 1L8AA 2YZMA 4M9XA 5EYPA 2C00A 3JQBA 2OQIA 3O75A 4FGLA 2CLCX 4LTMA 3MINA 4OYLA 4HG2A 2WJ6A 4WFQA 4CCWA 5A4JA 5IK2A 3O26A 4L0QA 4PLVA 4BLPA 4ESOA 4WXPA 2C4UA 3G82C 3OU6A 4QRHA 3EFHA 4ND5A 2P40A 3DJFA 2ZJ4A 1QHGA 2BFDB 4Y2QA 3I92A 3MN1A 5CU7A 5CT9A 1HNNA 3H1FA 2Q49A 4FYYA 2XODA 4GI2A 5EUBA 5JE8A 2BAGA 1HI9A 2H17A 4V0MA 3THYA 3DGEC 1HYGA 2JS7A 2QVZX 4X24A 5DPMA 3RJ5A 1SBIA 3CFYA 5B1DA 5BWLA 3AIKA 2HLDA 1M1XB 4H7IA 2KLHA 2XGOA 1GTG1 2HF8A 4KGXA 5FTNA 4GOND 4AC9A 3GGSA 4PYJA 4YUAA 3C5WP 1FFWA 4B3XA 1O4WA 3EVDA 3HVRA 4RTPA 2AFHB 2O2SA 3MEQA 5ALSA 1USUA 5HF6A 3SICE 3ZW7A 4DUGD 3GXOA 1A7AA 3DPUA 1EJ6A 1EG7A 1I4EB 1JWBB 2ILTA 3NANA 1KJJA 2PUJA 2AZ4A 2W37A 3Q3JB 3THSA 2B1GA 4ZTZB 2F62A 3ZY4A 3ZWYA 2XOKD 3VFDA 2QJFA 2R84A 3QVWA 1SZJG 3C5CA 4KIGA 4DZZA 3DTVA 3VO8A 3BWVA 1J7JA 4OI4A 2AN3A 2XB2A 3ZWXA 3UGKA 4OX9Y 4B09A 1WCIA 2NLOA 1BFUA 3RFVA 4KR6A 1IEVA 3GLIA 5DK4A 2FWIA 3O2NA 1YRAA 3X1DA 3ZJTA 2EZTA 2FU5C 4QJ5A 1U1CA 6PFKA 2EL9A 1CDZA 1BDBA 5KUTA 1K8RA 2GNOA 1E5QA 4OLHA 2DFPA 1Q77A 1SCBA 3ZDRA 1HOXA 1K3FA 2JB9A 4GBED 3QMMA 4WBSA 3W3AD 5HR5A 3U13A 2G5GX 3VR4A 2C92A 1JF8A 2H1SA 3E23A 2B7BA 4RYDA 2ZUCA 4HLUA 2J5KA 1GJRA 1KO1A 3AI2A 3ASZA 1JEQB 2A1IA 2CVZA 4UVIA 4ZOAA 1TM1E 3B9BA 3REQB 3P0FA 1DEHA 4S35A 4YLYA 4Y1FA 1R12A 2CNWA 2HPZA 2VNKA 4AK9A 1Z62A 4IIEA 4BL5A 3AHFA 2I7DA 3B6JA 1OXKB 4OG2A 3DR5A 4RGQA 1OZ0A 3A9CA 4B6PA 4BGIA 3ZTWA 2JVKA 1E6MA 4AG5A 4H27A 3OQIA 2QE7A 3RWBA 2FSUA 1QLWA 3QBTA 1GQYA 3RFFA 5BN1A 4IY1A 4DIBA 5IU6A 3N3BC 4WSOA 2FZ4A 2VAPA 3ADKA 3ROFA 1F4VA 2OV1A 3N75A 2PHZA 3RVBA 1WBJB 2MU1A 4MYCA 1OYYA 4NTZA 1MEEA 3T1QA 3KOUA 4J2OA 5G3ZA 1Z0IA 5EHZA 2OOKA 2YQZA 3AB3A 3KBBA 2QSZA 5ES4B 1QZZA 1CEEA 1A50B 1V7PC 2PGOA 1BWSA 4E51A 1Y7PA 3NO4A 7GPBA 2IYRA 1YS4A 1EWTA 1CZUA 1DE0A 2RGCA 4Q7QA 1U8UA 2Q8QA 3OZCA 1FP7A 4LV6A 4IH9A 1J0CA 5ECWA 4OL9A 2XUFA 1Q0TA 3WP0A 3BGDA 2PCJA 3LZ6A 1A2OA 2O8VA 2OHXA 5FTWA 1UP7A 1QJCA 2PA3A 3TRKA 3DYBA 5IKPA 1NUPA 2PWPA 1VL5A 1KWKA 1HOTA 2IL1A 1KP3A 1WB9A 4N40A 4KO3S 5JJIA 3GFFA 1SIBE 4X97A 4GX2A 4QO7A 2Z04A 1II9A 1K5HA 3BXXA 3EIHA 3FBGA 3R74A 1THMA 3C4JA 3STTA 3U3OA 3ADCA 3ZY2A 2JK1A 5D3ZA 4BFXA 2J8ZA 3K9HA 1LK0A 5IARA 3HXOA 4MPTA 4D9GA 1SCQA 3K4QA 5JUWA 4XJTA 5A3QA 1G3QA 5F12A 1RQXA 2CFIA 3G8BA 3IUEA 4IYRA 1Y8AA 3JQAD 3O90A 1R2QA 1J06A 1PEAA 2ZREA 4YJDA 1CUSA 5EJIA 2VPPA 3CGGA 3DKVA 3N05A 2C4NA 4C3VA 1T8TA 3GRCA 3MGGA 4J03A 4GE3A 3BBLA 5K01A 4I6EA 3HDHA 1NI4A 4HH0A 4DEVA 1KI3A 4LZZA 5CA1A 4P0QB 1KEZA 4TXMA 3ZZ1A 4CU5A 1LNZA 4RY8A 1HA3A 1P9NA 2FOXA 4HN4B 4NC9A 3TFOA 4ZEOA 3B6IA 3PF9A 5KOJA 3O7WA 4ZQBA 3VZRA 1GG5A 3DAOA 2VWQA 4B3TB 3B1FA 2R8XA 2XXJA 3H97A 1VHWA 4JLKA 3H2SA 4KWTA 3CF0A 2WP8J 1QVAA 3UTDA 4D2IA 4YXFA 1MA3A 4F9GA 2EEPA 1YQTA 1KAOA 1YT5A 1A97A 3Q7EA 5LBIA 1JEJA 1NQUA 5ALIA 5HCNA 4EVIA 9GPBA 4KE6A 4TTVA 1LVGA 3ED1A 4Q24A 4EQ6A 1YS9A 5KYWA 3BX1A 2KX7A 2NZJA 4Q1CA 4UTNA 2GDJA 2WTEA 1BE6A 2BEUB 5CT4A 1LNQA 4JQOA 1XLTC 4KJXA 4IS2A 1WXWA 3L0BA 5CH8A 1T2VA 2GLTA 4D0SA 1W4CA 3UYLA 3H2YA 4PLGA 2TMGA 3ND9A 1WD7A 4JL5A 1E18A 1GPBA 4NZPA 4EA6A 4AWAA 3GBPA 2V58A 2OP0A 3CUTA 3Q3IA 5FI0B 3U3MA 5I45A 5C1BA 1N2XA 2YYAA 3QG1A 1P81A 1G0NA 2BDTA 1MC4A 2JKZA 3I72A 1G2OA 1N5DA 5J1TB 3WK8A 1QHSA 1JX6A 1U3FA 1O89A 1ECFA 1UFOA 4LDRA 4NEHB 4D0RA 3CF4A 4M1MA 2J67A 1CVLA 2YXLA 3EJ6A 3H1EA 4Y0AA 5J43A 3OLCX 2CDNA 2CV2A 2O2IA 1JDNA 3K92A 1ZC3A 1JLHA 1S0UA 3OLXA 4M3NA 2UZIR 2GJAA 4FBGA 2V1XA 4RD1A 5E9WA 6YASA 1OFUX 5KWJA 3JD3A 5CW2A 1N2IA 5IAAA 2F1JA 5K3OA 4KMRA 3S55A 1BE0A 4MVCA 3E7PA 4MWTA 5AI6A 2IZ1A 2Q6VA 1XZNA 3TGWA 1ODJA 3KKOA 5GZ3A 4OGWA 2IDJA 3SC3A 5KNCD 4R8SA 5KYTA 4KITB 3HXTA 4AULA 4GL2A 2H31A 3DMFA 2E87A 3C7TA 1YBMA 5LOVB 2HIHA 2C2MA 1B93A 5COBA 5EJMA 4UCWA 1JSLA 1NVDA 2YJ3A 3B5IA 3MWGA 2IW3A 3IPRA 3I6ZA 1ABBA 1G16A 4A10A 1V5GA 4WACA 1YR2A 1XHFA 1MO4A 1W52X 1XWFA 2XT0A 2HHJA 3IFSA 5HCIA 1N7GA 1YI0A 2VDQB 1MPTA 4DV7B 1KVRA 1KYWA 1EM8B 4FONA 4HPJB 1XYVA 2HMVA 2I4IA 3DVQX 3H5IA 4IRUB 4KKVA 5JZMA 3IIMA 2WU3A 3BMNA 3MAJA 1TO2E 2W4QA 1FP4A 5D3KA 1MRZA 1F0YA 1BW9B 1G5HA 2P0AA 4F1JA 1T91A 1WSBA 2I80A 4DLNA 2Q1XA 1HSZA 4B3JA 2LKDA 3G0OA 2C5FA 4JUCA 4GFDA 4ZGGA 3LPNA 4QUJA 3WGIA 3VGJA 3O91A 4QNNA 2Y0PA 2ZUEA 1BN6A 1TIPA 4EB3A 2X8WA 1NVVR 4IDOA 4Z3OA 2Z4SA 3OT1A 2JH3A 1TLFA 2ZAMA 3CT4A 3KD3A 4O33A 3FVTA 3BT7A 5ADWA 5ICMA 2FH5B 5TPWB 1DAMA 1P39A 2C0QA 3ZLTA 1FMJA 3QXXA 1YR6A 2ORED 1S2DA 4ZRMA 3CZRA 1PHRA 1S9DA 1MAVA 3QUCA 4LJ9A 4A0GA 2FMUA 2R8PA 4Q9KA 4XYLA 3ICWA 3OZGA 1YB2A 2R6AA 3H2BA 3FPCA 4P8RA 3TDNA 2PUEA 2G3YA 4MWDA 4V38A 2C5AA 3UT5A 2GZHA 2X9QA 4XFDA 3GFPA 2BMVA 1EKXA 1E4EB 3AXTA 3CUVA 3M4XA 3PQ5A 3UMRA 5CEEA 1JGTA 2JCVA 3CSSA 1JFFB 1NOKA 3DKRA 3MJDA 4LY9A 4B6JA 5HIKA 4KYUA 4PZ9A 1XEWX 5ILOA 1JEOA 4JC4A 1GAQA 3RUFA 1TX4B 1Q95A 1SCJA 1QAMA 2IUEA 3BMCA 1SHKA 1Y1PA 4IX9A 1OWNA 2LTAA 4YI3A 2G25A 2GZDA 4EMUA 1I4OA 5IT0A 1RI2A 2REBA 5DNWA 1MEOA 1N2BA 3H75A 5AOCA 2DWUA 3ZXXA 4C7VA 2XLBA 3RW9A 1HT3A 3UENA 4QFCA 4P33A 3V8MA 2O1EA 5JY6A 3HVUA 4RSMA 4S1VA 1VDZA 3SZOA 2OV6A 4DLWA 5L6MB 4GYKA 1E3MA 1RYHA 3U7GA 2I2AA 4INOA 3CVWA 2G83A 1JRLA 2Q3CA 1L7AA 4NH4A 3INGA 2GFQA 1YB7A 3L1HA 4X93A 2H5LA 1CUWA 3N2KB 3OKPA 1C8BA 1E3TA 3A06A 4FIDA 5DLPA 3D8RA 3VUFA 1NVWQ 1RLTA 2A4KA 3DXZA 1Q6YA 3IA7A 5JDIC 1NVTA 2V6BA 2Z5GA 3EGEA 3MPOA 4HC4A 4G5XA 3EZ9A 4K9DA 4D3DA 4DCGA 721PA 1QQTA 1PSZA 3OPYB 3HGQA 3IQZA 3WWZA 3AJEA 2XQGA 3K0CC 4DGQA 3REQA 5L4NA 2WTUA 2MINB 3TFWA 4B6OA 4TMWA 4I55F 4YRDA 5AM5A 3UK7A 1T5DX 2PL3A 5L8VA 3M6AA 1EM6A 1A9RA 5HOQA 1HG1A 3R8CA 4YJFB 4IXTA 3O0TA 4OXQA 5CDFA 1LU9A 5BW8A 1E0SA 1A72A 1CIPA 2IHKA 1U3GA 4OAQA 4OHUA 2C2OA 1EEXB 1JZQA 3IMFA 4YRFA 4P34A 4E31A 3EE6A 1B41A 1ECJA 1LLDA 3EEBA 4XLTA 3GMDA 4IIDA 1T8YA 1Y3DE 2J9GA 3CLRC 5BR7A 2XE7A 3DYIA 4HAIA 5CFOA 1JG1A 2ZKIA 2PBLA 3EZXA 5I9MA 4A2CA 1BU8A 2QV7A 1NNI1 4KQFA 5AHKA 2XDQB 3K30A 1S2GA 1D6SA 4FWBA 2AMJA 2YW9A 5TGDA 2Q8PA 3RTAA 3T5CA 5LQKA 2J31A 4WW0A 1JH9A 3M9XA 1JZTA 2DCUA 3A05A 2FN3A 3KT8A 1FDUA 2FE4A 2IU3A 2VHTA 2WHEA 5DGXA 4MS3A 5AMXA 3W9SA 3CRNA 2XR1A 3F5QA 3T99A 2HMTA 3UUEA 2YL2A 3G89A 4RKYA 5EXXA 1UZAA 3LP5A 1SHJA 1CFJA 5FWXA 3E35A 4O2BA 4MA4A 2QRPA 4MULA 1Y48E 3GI1A 3QE2A 5JLAA 3F7OA 4EI9A 4R0VA 1KZ1A 4QQ8A 5JZSA 4PY2A 1HE3A 4NIMA 1KPHA 4U6QA 4IJ5A 3KKNA 3UQZA 9ABPA 1P2VA 3C74A 4CMKA 2I4LA 3OPNA 1U9JA 3X2SA 4HYYA 5EKTA 4EYQA 4MRRA 2JGAA 3ZHXA 3S40A 3DAYA 4R8VA 2ZBVA 3RSQA 3TGPA 2J3DA 1JFRA 2BV3A 4CFZA 4RNDB 4LSZA 5ESDA 1NW9B 3SG0A 1OU0A 4BFTA 1WOYA 2ZR7A 4ZANA 4E3ZA 2Y8EA 4JI6B 3WIBA 3NHKA 5KQLA 5DGCA 3ER6A 3NBXX 4L8GA 5E7QA 2GCIA 3JWJA 1YR8A 3TTVA 5T8KA 4KFRA 2ZCJA 1D1SA 2CC2A 2M2IA 3SJZA 1T35A 4N6OA 2WIJA 1E1RD 4IJWA 4EK9A 1CY1A 1L1RA 1YDMA 4A5OA 4MW6A 2HO5A 4ZO8A 4WOPA 1YHYA 2ZRFA 2CLEB 2JGDB 5EP2A 4UM8B 1SQ0A 3B52X 2R6FA 5A4AA 2V7QD 4E1BA 1U7TA 5K0TA 1BCSA 3AG6A 5KHAA 3HWWA 3QOFA 1HRDA 1VI5A 3MCAA 4GWGA 1YVDA 1JS1X 1N2SA 4MPDA 1O94A 2HB6A 4RDHA 5DN9A 4BB5A 4F56A 2RGWA 1T6BY 3BQNB 3P4YA 5EP4A 4LKOA 5B36A 2QRVA 3QOXA 2E6UX 4OM7A 4M1ZA 1VMKA 4Y3UA 5REQA 4JBWA 1I3OA 4ERXA 2R1ZA 3HH8A 3RU2A 4TX1A 3LNTA 1M0SA 1Z0AA 3BRQA 3DOHA 3LOUA 5C5CA 4KC0A 1EFAA 3HKDA 5ABPA 3ACBA 4QDXA 5IDQA 1PF7E 3DL2A 5EXDA 3DMTC 1RHJA 2CJWB 2CV0A 3MTAA 2PH3A 2WSMA 1LQUA 4DPKA 4QTTB 3RM3A 1O87A 2MWMA 3DE1X 2XRFA 3SLKA 1HDCA 1PR4A 2A1UB 1G8PA 1W5AA 1WKCA 3I2KA 3N2ZB 4I46A 2BBTA 3VNBA 4AO6A 1U8ZA 1Z18A 2DRIA 2V03A 3I6BA 1GRQA 4KSBA 1V4BA 3IPYA 1NUAA 1U8TA 1BXZA 3VISA 4Y7DA 3SS7X 4DW8A 5GIPE 3G7NA 2I78A 4MDYA 1CF9A 5KNCH 2P4SA 2QGFA 4U7PB 5K5EA 1IQUA 4QYWA 1MABB 2BM1A 1X1SA 4O2BB 3F8TA 1KKUA 1MHPA 3DFZA 3F4KA 4ZTUB 4BZQA 5JCXA 2XMCA 4PICA 4W9NC 3AKYA 1IQRA 1QM5A 3QPVA 4B82A 1RAIA 1I2DA 1EINA 3ZCQA 3AFHA 3IV7A 4HVCA 1YVUA 3LQQA 4F3KA 4TXJA 5JSFA 1TU3A 5EG5A 2LDXA 3COSA 1SCAA 4EDHA 1ZLXA 1Z8FA 2JCSA 3O2SB 3PC3A 3AG5A 1ISSA 3OJOA 4LCBA 4JQSA 3ZV6A 2RAVA 1XRRA 3PSAA 3LLMA 4JJIA 1WW3A 3VI4B 2BSAA 5KAMA 2XSZA 4MR7B 5BORA 5EIEA 1Z12A 2ALJA 3BHNA 4D4LA 4L8YA 4BIIA 5IH7A 2O2HA 1OT5A 2PMCA 4BX8A 4KXNA 3PGKA 1UXHA 3ETLA 4FGZA 1K88A 3FLMA 3D6UA 4DUPA 2FWNA 1T4CB 1FDWA 3GRVA 3PHGA 2GBFA 3HR8A 3MGCA 3PNLA 4FNMA 1NTRA 4TWRA 2GEKA 1TKRA 1PG0A 4MW9A 4HEJA 1G63A 3G68A 3K8ZA 4RFLA 5GV7A 4KR0A 4R98A 4RVUA 4ALIA 4D74A 4YAUA 2CXRA 5DW3A 3CLSD 1R8SA 2ONKA 3F46A 2OWDA 4H4CA 5JO9A 3LNCA 3KTFA 1Q92A 3DT9A 4BS9A 5IJZA 5K0BA 4QPNA 3G2JA 2JD2A 1ZK0A 5JYDA 3T38A 5CXUA 2IF0A 5D5QA 3GPDG 1WD5A 3ZNPA 4AZ0B 2XAUA 4K3UA 2GILA 5AVUA 4A2PA 3TZ6A 4YS6A 2VJMA 1R37A 2B5OA 5EMJA 3LSTA 5GV8A 4DBZA 1RRGA 4KXFB 4NQZA 3NS7A 3D2AA 1DCFA 2W4MA 1VE6A 2ZR9A 2O59A 4BU1A 4BOYA 2JDID 1WR8A 3TDMA 1W30A 3HY6A 3IIJA 5TQJA 1MDBA 3QEKA 3IQIX 1M6YA 3KYCB 2HQOA 3JAWB 2C8JA 3TLMA 3L1UA 2XVYA 5K3DA 4D99A 3AUKA 1GSAA 1ZP6A 3LH5A 2BY4A 3M6FA 5EQJB 5BYBA 3RU9A 1CY7A 2XYHA 4BJ1A 2WG2A 2HYIC 1SZDA 1YJQA 3CRRA 4N54A 4FNAA 1Q91A 4EJMA 5LU9A 1U80A 4FE4A 4Q37A 5B4TA 4TROA 3WJ1A 4DMGA 1NULA 2W00A 4BMZA 3UQYS 4CL0A 3PL5A 1ULSA 2VIIA 2AC7A 1J09A 4ZU3A 5BSEA 1ZK4A 2BBSA 5CYOA 3R4VA 4UKDA 2Q0QA 3G7SA 1UDAA 4JOCA 3TNLA 5MFPA 3GL9A 1DT3A 1FNCA 2WILA 2QT9A 4EW2A 3DBIA 4LNAA 3W5HA 4PHHA 3UMMA 1DWOA 1E9CA 1ISMA 1P3DA 1YZGA 3NOXA 1TM7E 3ACCA 2H1FA 3PJEA 1VM6A 1H69A 3WHIA 5AI4A 1ZN9A 1EFRD 1SOMA 2H48A 1EA5A 1SEVA 3K1TA 3PGVA 3Q6MA 4H7DA 3B13B 4R6XA 2DUUA 4W5JA 4ZYTA 3EMVA 2NPFA 5EHQA 4DIKA 4YR9A 1M0EA 3DDNA 1QIGA 3R9XA 2CYBA 5B7GA 5KMGB 4RTQA 3RAGA 1RYNA 2FVYA 2EJUA 1Y5NA 2AZMA 4Y1GA 2GTIA 4GSKA 4K9MA 3GEPA 5ALYA 3VZQA 3Q8XB 1HNXB 1ENPA 2NAPA 2VPQA 3PDUA 2IIQA 4KACA 4M8KA 2H18A 2AG8A 1G2PA 4BFLA 4UBOA 3FWYA 1R5JA 1GQOA 3OUZA 3IRUA 5LL6P 2YZ2A 3KLOA 4KDCA 3J7AC 2CNWD 3VSEA 3SJBA 3QPAA 5BP7A 4ID9A 4MP6A 4IQ8A 4ICIA 4A91A 4BE4A 1B8OA 1VB5A 1R0KA 3TMYA 4NENA 1XF1A 1MW8X 1TFRA 4W1QA 1N5JA 1G6HA 3FBWA 1TDJA 3B1YA 4FDUA 3DDWA 4K2AA 2J30A 2JJ2A 5K4GA 3AUTA 3KAKA 3PRJA 3CZMA 3Q88A 1BYUA 1KYTA 1WCYA 3DDHA 5KKNB 3RFTA 2D7CA 4I1VA 2RHWA 2I55A 5CLGA 4BYMA 1Q17A 2PH7A 4X6YA 5HIIA 1KU0A 5AUOB 3R0ZA 1A5TA 5DLYA 3OT1B 4PGHA 5BYKA 4D92A 4COOA 2R7KA 2VYNA 4M87A 5DM70 5ADHA 1C3OA 4L78A 1PYGA 2P6MA 2YZKA 4Q4DA 4BVHA 1HV8A 5KKAA 1AGXA 4XLZA 3R9KA 1NRJB 3DDCA 3RKUA 2V3CC 1GKIA 1CE8B 1VCHA 4BKOA 3HKBA 2BTQB 1Z0JA 3DMTA 3SC6A 2EEZA 1GZHB 4I14A 4PO3X 2M6LA 1JAIA 1M6WA 2IJGX 3A1UA 3UBMA 3WJ7A 4CMIA 1JQAA 4DKXA 2YH2A 1OFHA 2HV9A 1U4SA 4CG3A 5IAOA 3WRXC 2XB9A 1FYFA 1N9KA 3TLGB 3LLSA 1HKUA 1MVOA 4GC5A 4PYOA 1JJ7A 4NCHA 5CVDA 3BL6A 3QKSB 4ACBA 2VAVA 3VYWA 1P1KA 4G1EB 1QP8A 1HE2A 3IQWA 3UVEA 1WQ1R 1HEIA 1TQ4A 1X7GA 4OJKA 4MVJI 3RFUA 5FWXB 2FFJA 4UREA 5HEKA 1IBLB 5DBOA 3PITA 1C9MA 2BHSA 2H3HA 3FRJA 2DJ5A 1K7XB 3HRKA 4MS3B 1R5OA 3ZE9A 3QBVA 1HQKA 2ILVA 2WSLA 1VSTA 3AM3A 5H3LA 3WKEA 1B74A 2G77B 3M89A 1DWUA 4WY8A 2H54A 1Q2XA 3N59A 2X3FA 1OLSB 2B34A 2OBBA 2XUQA 3Q5GA 3W5VA 3K9FC 1TVCA 4GWLA 2NMVA 2JK0A 2Y0CA 1M1YE 3JSXA 2WYHA 1TA0A 4EX7A 4UMVA 2O1WA 3FOCA 1TF5A 1SURA 4W5QA 4UAVA 1Z39A 5ALUA 4O4IF 5CLQA 1UBFA 4OQZA 2J3MA 2GTPA 3A1VA 3CHYA 4LHYA 5FOXA 1CUBA 4M55A 2FA9A 5K0LA 1E3DA 4UVGA 2F1IA 2AR0A 3SBXA 4L5CA 4A9AA 4CETA 4XM2A 3IMGA 3LFTA 5CG1A 1RRCA 4GO1A 1DIGA 2ZUTA 4GZMA 2PBZA 1O2DA 2WQ7A 3PEFA 3P97A 1XTRA 4PZEA 4PG7A 4UBJA 3U9SA 4X85A 3R5HA 1ZVVA 4WLNA 2GPBA 1PVDA 2KYRA 4EKIA 2PKWA 2NGRA 4CIYA 1NU8A 2WWHA 1FU8A 5DTRA 2CBXA 3EQZA 4OHYA 4YBZA 3HFGA 2OFOA 4IGIA 4HDMB 1MORA 4PLZA 4UQLA 4QREA 3FB4A 4QUDA 1MC1A 1V8FA 3BWEA 421PA 221PA 3TRHA 1IHXA 1Q0UA 3S1AB 4QT4A 4EO7A 3EIXA 3K6RA 3FLAA 2J7PD 1UJMA 4DEXA 3HFSA 4R41A 2JGLA 3PHHA 4JBIA 4TV9F 2GLXA 3ETJA 4R2IA 4YJ3A 3VPSA 3WO0A 4EPRA 5FLXA 1PRYA 2ZDGA 3L05A 3MYYA 1TYBE 3IHKA 3PQ4A 2VHZA 3R2JA 4IVPA 4KVZA 4JVLA 5FADA 1EESA 8AT1A 1F6WA 1GT91 1ORDA 2CDRA 2P3QA 3CUUA 2R85A 4DQUA 4O2AA 1HE8B 3E3AA 1GEEA 1N7JA 2BCGY 3W7VA 5LUAA 1ZVMA 2B2NA 4PFQA 5IJWA 2GF0A 2NYRA 3DCYA 1GQFA 3KKZA 4Q7KA 1RC0A 1Y4SA 3PFGA 2W6NA 3WFZA 5JC8A 3N8HA 4M7OA 4DV6B 2OL4A 1MO3A 1NA5A 5DV9A 4CM9D 4DMFA 1GYRA 1WPRA 3WLJA 2B61A 2PS1A 1G8YA 4YLGA 4GF5A 2IP1A 2XA2A 3OCWA 1S96A 4M0FA 2HK7A 1D7OA 4IUDS 4W4TA 1G5RA 3I2JA 4EJSC 1DQYA 4JB2A 3TR6A 2CL5A 2LPMA 1T9BA 2VYFA 2VWHA 2NYAA 2V9ZA 4BNUA 5FR2A 3FG9A 3KXIA 2RHLA 3TXXA 1ZBDA 2J3HA 1DDOA 2Q4RA 2PMEA 3RRXA 5D51S 4JYPA 2E37A 4KX5A 5D87A 3LP6A 1RJDA 4QXPA 3DVRX 4MKHA 2GZAA 4ARIA 4GOMD 1KZYC 3TVYA 2G1PA 4KIWA 1NHGA 5D1NA 2H3EA 4MR9A 1FS6A 2HSJA 4LIPD 1UXJA 3MWDA 1D1QA 3WXMA 4PHCA 3FWKA 1Y8CA 3GGJA 4X1KB 2QRVB 1WSAA 1T3SA 4G5QA 3UK0A 4V0OA 4PLYA 4KO4S 3AJAA 4ETNA 4GXTA 3UAZA 1V9LA 4NXNB 3DM5A 3DFIA 4LWOA 1R9JA 2CZQA 4FOTA 4J1QA 4PAGA 5KNBD 5KOJB 3U26A 1WCWA 3LDAA 3WBBA 2GRUA 3SQNA 2HSEA 4EHIA 2GCGA 4D9MA 1GSOA 1Q57A 1YZVA 4RD3A 5KYWB 4ENTA 1GAEO 2ABWA 2EJVA 2OBFA 4GLBA 4RHTA 3C24A 4GBGA 4MQBA 4YMWA 4JI1B 1CYDA 5KNLA 1U2TA 2ST1A 2ZXUA 1SXJB 1K92A 2FPOA 2LZ0A 5TXGA 3WC4A 1ZJWA 5EPUA 3FMGA 4QGFA 2QJRA 2HWWA 1ZGCA 3HFJA 3O4IA 4DS3A 3BRCA 1FDOA 3EARA 3WS7A 3DE2X 2R7LA 3NNNA 1C0LA 4L6CA 5IM5A 1AV7A 1YR3A 3J80A 3MCZA 5KTTA 1BYIA 2B0JA 3SF8A 3UIEA 1QF6A 3EVZA 4PR0A 2WVJA 3W06A 3HGMA 3TOCA 1QYRA 3DV0A 1CRLA 3BJZA 1QE3A 4YB8A 4LSGA 3WI7A 4BX0A 4G6ZA 3OH8A 3G9TA 4E14A 2BMAA 3RF6A 3H11B 3P9SA 2Q2NA 4B87A 2AWOA 4FCTA 3ZY6A 3PZBA 1Q0RA 4U3JB 3M8KA 1AK2A 1IMOA 3A32A 2QMYA 2HFJA 4HZUB 1NBMD 5F73A 4EPYA 1H1TA 1ZJJA 1E7RA 4MVJD 3C39A 5J2TF 1Y5RA 5IKXA 2CEKA 4RPLA 3I9LA 2RAUA 3CY6A 1EDBA 1CUUA 1YUNA 2Y1GA 3O4RA 4G9EA 5EIAA 3OP4A 3AYZB 3IKJA 1POWA 3QPDA 2O8BB 4MVJE 5KTMA 4TYQA 1JPVA 4P31A 1MUUA 1GIAA 5CJPA 3W8NA 1AKEA 1GXSB 2QM0A 2B8TA 4RHEA 4WKGA 3RQSA 1V2HE 4ZI2A 1QHHA 3AB7A 3KEGA 1TTTA 5J2UB 4NMXB 4QL3A 4DA8A 1MT0A 3PCTA 1EJ0A 4GYYA 4WLFA 3RBXA 3HACA 1CUZA 4EQZA 2P1ZA 1TECE 3R5JA 4FXOA 4KXYA 1XTKA 3A8TA 3TSCA 3C14C 1IOZA 2VJBA 4RFSB 2I9PA 3TZEA 3UC9A 1HORA 2B82A 3H17A 4KV9A 2Z8XA 1YFJA 1A2KC 5T3YA 2JIOA 2JHPA 1ILWA 1FJ2A 5JROA 4NXMB 2I5PO 4ZOEA 1WPGA 2GZRA 3NATA 1QC5A 1UKYA 1CQWA 4K8OA 5KYNA 4PSDA 2P9ZA 3PC8C 4TM7A 1O58A 4FINA 5UKDA 3DZCA 3O1LA 1Y7IA 2AKYA 4ALLA 1CDDA 4AY2A 1JEYB 1XE3A 2XNHA 1OAAA 1MMFB 3EQ8A 4IRMA 2HNAA 4PU0A 2ZSFA 3LHFA 2CFRA 2BEVA 2ZSKA 2BEJA 1RMTA 3FSEA 5T3UA 4AJ1A 4CM9A 3RVQA 1DEAA 3NWPA 1H0HA 5HS4A 1ITZA 1YUMA 1UZUA 1NN3A 5DTJA 2YIMA 1ZIDA 3LDUA 1G2IA 4MA5A 3H9GA 1UC8A 2FKAA 2GYUA 1PK7A 2GKOA 1XEXB 3PT5A 4GX5A 4BX3A 3IDOA 4QWMA 4OUDB 3LRXA 3HBJA 4QPJC 3FYUB 3L0CA 4DSUA 2H5EA 3CZ4A 2QYHA 2NXNA 3A1CA 3K0FA 3AV3A 4RLFA 2ZB2A 4TVKA 4BNJA 1JVBA 2WFZA 5EY5B 3VC1A 5JS1A 3T7AA 3E18A 3K72B 1E2KA 1KBZA 2B37A 3NEPX 5TRTA 3FSGA 4E15A 2JGEA 4CTJA 1KJWA 3EG9A 3I01M 4EF5A 2YCBA 2ZLBA 4DQVA 3PXAA 3WY9A 3WGUA 1XT6A 4LXYA 4OHRA 5E9AA 4CUZA 1Z4KA 1WCIB 4ZYUA 1H22A 4ETIA 3F2VA 2VZ8A 3LX6A 1WXFA 2OV3A 3LW8A 2QLJA 4I0WB 3G5MA 1X7ZB 2IZ5A 3NHJA 2FG7C 3VAZA 1Z5GA 5FAKA 4MRPA 4I4LA 3R6WA 1HM5A 1ENYA 4F3YA 4BNWA 1TZ2A 4PE5B 2QPTA 2MSKA 3PG5A 4J49A 2JZOA 4MJXA 2DT5A 3U81A 2CDBA 2IUSA 4Q4HB 3WADA 2BGGA 2FWJA 2ZBUA 1W5TA 3CR3C 1BROA 4R31A 4P83A 2WHRA 1D2HA 3T1VA 4S04A 1XROA 4G41A 1M5UA 2IXEA 4RD2A 4UE6A 4X64B 2CY0A 3BFKA 1UXGA 3I0MA 2G9RA 3UATA 3ISTA 5B58T 3QIAA 4YQFA 4HNUA 2BPOA 2HK9A 2VR1A 4V0KA 4ZVPA 5JCOA 3OOYA 1C4WA 3I34X 1UDCA 3PGA1 1VE5A 1XTVA 3QMPA 1DG9A 4UAJA 2Y0BA 3V7NA 3EQ6A 1RKUA 1X0XA 4PIMA 5DK6A 4QYXA 1QQAA 4JMLA 4CQMA 1Z38A 3N8NA 3ZK8A 5A06A 1RJWA 4U39A 1SXPA 2ZSDA 3VC3A 4JOSA 2BFFB 4R8RA 1H9AA 1YE3A 2OV8A 4LPKA 3PBKA 1LC3A 3C4QA 3PUXA 4L85A 4QULA 1GUAA 3O8OB 4CQNA 3IDSA 1NUHA 3CEMA 4NF2A 4HVLA 1L4YA 1GGHA 4L6IA 4LZNA 1HNWB 1FLNA 4NU6A 3BJIC 2OMKA 2XCOA 1RWWA 3FUCA 4LMAA 2HTFA 3FPFA 1W47A 1CQIA 2HPVA 3MG9A 4FE3A 3ZW9A 1BX0A 2VEDA 2VJOA 3EFBA 3HYSA 2O3RA 4ZEXA 1XRSB 2BWJA 1A77A 2QF7A 2Y1LA 3GARA 4PYRA 3WOVA 2OUIA 5ITVA 3LVRE 4G4SO 4RQTA 121PA 2AR9A 1ZM3A 1G3MA 3N53A 5H0IA 5K2OA 4MEJA 4MQ5A 3PYMA 2GBIA 2X8JA 2I2BA 3A2MA 1H23A 2HLDD 2FQXA 1KKMA 4W8HA 4MV4A 3MW8A 4WADA 2O7SA 3P32A 4JLBA 4B83A 5DI3B 5CA1F 1DOHA 1ZH8A 4ZYWA 4KPFC 1U94A 2AQIA 1P8JA 4PVCA 2WYUA 3HVHA 3VO1A 2QZ9A 3MBOA 5G40A 2IIVA 1NVVQ 4QEKA 3W2EA 3L0IB 4JEHA 5AK3A 5B6JA 5HRUA 5HS6A 4RVHA 2H92A 2YICA 2IHJA 5EQTA 1IN4A 1UAGA 4GZ3A 2JG3A 3SYLA 4JJFA 2VTBA 4QO8A 4J0IA 4MUBA 4L4ZA 2PSHA 1A8IA 1YS6A 1V96A 2B98A 1L3CA 1ZOSA 3IPXA 4HQ0A 5HVNA 3MWJA 4BMNA 2EFDB 4IBOA 5