1RYFA

Alternative splicing of rac1 generates rac1b, a self-activating gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
170
Chain Sequence
b'GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1b
publication title Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 170
sequence length 203
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ryfA00
4US2R 3ZVRA 1VYVA 1FP7A 1DBSA 2D06A 3B9QA 4HUQB 1LS1A 2IF2A 4US1R 4ZI3A 1E79A 1R5OA 3QVVA 3KQLA 1OJLA 3KJIA 5FL7D 1E9CA 4G5QA 1GKUB 4P33A 2WWFA 2JASA 4DXAA 4DDVA 4K81B 2NZ8A 1HUQA 2P5TB 3QKRB 2OFWA 5JLJA 3AVYA 2BMJA 2Q9CA 3CX7A 8OHMA 1KK2A 1TQDA 1DS6A 3VQTA 4B33A 5JJIA 1TEVA 1XTSA 2ZRGA 3IQXA 3U44B 4E22A 2IBMA 3T1TA 3MUFA 2PZEA 4R7ZA 3REGA 4TMXA 2PEYA 5JCZA 1W7AA 1EX6A 2GJ9A 2GZHA 2CVHA 3KUCA 3EX7C 4KSCA 3AEZA 1FOEB 2J59A 1BMFD 4LYJA 2ZJ8A 4TWZA 2F43B 2GKSA 2JLZA 2AL7A 1NIPA 1ZIOA 5J40A 621PA 2HUPA 2JIZA 1IM2A 3TSOA 4M9XA 5DN6D 1PLLA 3LFUA 2FSGA 2IS2A 5BN5A 3K09A 4DDTA 2FZ4A 1DAEA 5AUPB 1G9XA 3SQXA 3BC1A 5E7IA 4PPNA 3RS0A 4E03A 3GLHE 1T6NA 4Q5IA 1HV8A 4M1MA 4P4SA 1PJRA 1N0WA 3KDSE 5G40A 2XTNA 3TQCA 1SGWA 2GEVA 5KSOA 3SQWA 3I62A 1DO2A 3IDQA 4YXWD 5JFGA 4POAA 1D2MA 1E2EA 4NH0A 1XXHB 3ZD6A 3U3KA 3SYKA 2RGAA 2WHXA 2A9KA 1IN7A 4NBSA 1XD2A 2ERXA 3CF0A 3E70C 3EPKA 1MO3A 3PUWA 1K5DA 1TU4A 3VKHA 1G6HA 2ZI7A 4TYYA 5DLQC 3UK6A 3C15C 3L43A 4IXNA 3T5GA 5J4LA 2YV5A 2Z0MA 1HH4A 1KDPA 4WBSA 1W49A 1G5RA 2UKDA 2RGDA 2ZRJA 2EFDB 1GZSA 4Q00A 3ZZTA 3KX2A 4B48A 5EE5B 1KO4A 4ITRC 4CT4B 4PC7A 3WP1B 5F2EA 2B7BA 3NTUA 4PSKA 3PJRA 4M1TA 1WBDA 2AD5A 3WRYC 4HAXA 1S1MA 2RMKA 2F6RA 3EA0A 2JAQA 4CF7A 1VIYA 1E2JA 4QM6A 4ASUD 2ZSEA 3PCRB 5EQTA 3FYHA 1AS3A 2HCJB 4JYBA 2YYZA 2GXSA 4W5JA 2YOGA 2O8BA 2ZITA 4X8OA 2QSZA 5KTYA 2R6DA 5EE9A 3AUXA 3L8ZA 5JHGB 5EP1A 3MAAC 5H68A 4QHTA 3DKPA 2FGJA 4TT3D 4B47A 2GVDC 4HB2A 4XIGS 1XCGB 2YJTD 1GL7A 4EJSC 4JLJA 1JNYA 4XVRA 1YZQA 2ZE6A 1VHTA 2GCOB 4GFDA 2A78A 3GJ0A 2BBTA 1LFDB 2ATVA 1KAGA 1FFHA 4H1VA 5CYPA 1HQCA 2GF9A 3GLIE 3AF2A 4Q1CA 1U9IC 4BRWA 5JJKA 3U4QB 4NPHA 3KXIA 4K46A 2ZANA 4H1UA 4PAQA 2UZ3A 3GLGB 1JECA 4AYTA 1IY1A 1K8RA 2JATA 4EFLA 2XGJA 1JEEA 5CB6A 1VKJA 3RS2A 1OIWA 4G5OA 4TYWA 1KY2A 1FQKA 3LAWA 4Q4LA 3SJZA 4LZZA 1OH6A 3FOZA 2C78A 4WOPA 4RFSB 5E3HA 4CIDA 2VP5A 5IT5A 2XAUA 1RW4A 2NG1A 3QKSA 4XVQA 1MOZA 2VSOA 4R98A 4JYCA 5FOVA 2QQ0A 3KFVA 2G88A 2J7PA 1KI4A 3GMTA 3MG9A 4HAZA 4BGDA 1OIVA 4JVSB 4LOAA 4URZR 4G5RA 1XF9A 2Z5FA 2A2ZA 4LBVA 4OBEA 4DHEA 4NYIQ 1QHHA 2BCGY 3NVAA 4IDOA 1ZC4A 4RJLA 2OAQ1 3CWZA 3QY0A 2B7CA 1Z63A 1Z8FA 5CLLA 3S1AA 4MGZR 1FUUA 2J1LA 1JAHA 1VPLA 1R0ZA 2GJAA 5L3QA 3UMRA 4MKGA 4AWXA 2JGNA 3VU9A 2ZYWX 3THYB 4W5WA 1TMKA 2QM7A 1LNZA 2VQSA 4Q66C 1E6CA 5DHFA 4DT1B 1P9WA 4IW3B 4JSYA 3NG1A 2FFBA 1D9ZA 3Q7PA 1RJ9A 1XJCA 2QP3A 3T1VA 4P3YA 2VEDA 4IDNA 3CUEF 1E96A 4DKXA 2R8RA 1GRNA 3W6NA 1C9KA 2QGZA 3OEEA 3SZRA 5L3QB 4PR0A 4LUCA 1BOFA 1VECA 1J8MF 2ZR9A 1DAKA 3W3ZB 1AS2A 4PFSA 5FTKA 4KI0A 5K8UA 3GJ5A 1G41A 2QP4A 1ZM7A 1ZCBA 2WTUA 4XOIA 5AUOB 1RFLA 1FX0B 3W6OA 1QHIA 3B1YA 5L3RA 3KKMA 3BWDD 4URUR 3B13B 2BWJA 2IYSA 4DLVA 4AKGA 1U0LA 1L7VC 2BM0A 2I1VB 3DMNA 3IHLA 1XMVA 2ZRMA 2XNSA 3PENA 521PA 1Q20A 2HJGA 4I99A 2AR7A 2A5DA 4IXMA 4Q9LA 4A8JA 5B64A 3AV0B 2D62A 4OHVA 1ZIPA 2AXPA 2W6ID 1L8QA 1IJFA 2GEDA 3TLXA 3B1ZA 4B44A 1QHXA 3TGPA 2QT1A 1UM8A 1E2IA 3KTAB 2EVWX 4WA7A 1G8PA 4IEIA 2ZIAA 1LB1B 4A8JB 3NC0C 1QF9A 1C4OA 4LK2A 3A1VA 4N0EA 4IVRA 2HF8A 3SEAA 4DEYA 1KO5A 1HEIA 1GFIA 2GCPA 3C5CA 1KI7A 5G3ZA 1I4LD 1W5SA 2QRZA 4IDPA 5D3MB 2VF7A 4KO8A 1J2JA 5AJZA 3ZVLA 3U6KA 4JJZA 1S3SA 4IKEA 1OFHA 3AVOA 1OT3A 4BFYA 1IN6A 3ZQJA 5FFMA 1OHHD 2CK3A 1XJ0A 2FJUA 1W36C 3R7WB 2I3BA 5K8LA 3RC8A 1FTNA 4JVLA 2F3RA 5FUWA 4BE7B 5FI0B 1ZCAA 4LV8B 1SVMA 3MWJA 3TAUA 1NN3A 2YOHA 4HZIA 1E0JA 2NZJA 2XEXA 1NMZA 1FMJA 3CIOA 4QHYA 3UANA 4PZZA 2ZI6A 2F1RA 2ZRNA 1R4AA 2H8KA 5IHPA 1DEKA 4CW7A 1F2TB 4LJ4A 1C1YA 4Q02A 5C2JB 2XTZA 3IEVA 4S35A 2R62A 2WWXA 1Z08A 2ZYUX 4KFRA 3WYFA 4BPBA 4LHWA 4HZUB 2WVJA 2XZOA 1Z0DA 1YZUA 1XEXB 1YVDA 3D31A 3B1WA 5JWOA 4KFTA 4HB4A 1GVNB 1Z28A 1S9DA 3GLGE 4LPKA 3DL0A 3LV8A 4GPTA 5IK2A 3TH5A 1COWA 3D6TB 2ODEA 4Q1DA 1UBFA 3KFXA 3WYAA 4QXAA 1WMSA 1GRRA 5H8WA 3VAAA 4A0GA 1QHNA 4OI1A 4PTLA 4LY6A 1OF1A 3ETLA 2RB4A 1JQJC 2JJ2A 5KPDA 1P9NA 4X8LA 4PPGA 1JR3D 1J70A 5JSZA 3KJEA 2C8VA 1EFRA 3PUXA 3RAPR 2YINC 5FPKA 2EYQA 2PLRA 4MYHA 1ZM9A 2R65A 2YC2C 3A37A 3QEOA 3SS8A 3ZJYA 4AURA 4AKHA 4P4TA 2G0NA 4PSVA 5EXPA 1XWIA 4KHZA 2ODWA 4JLNA 4QM7A 3GCGA 4TMTA 4M1YA 4FN5A 1N6IA 2JLUA 1OYYA 4YMVA 4EIWA 4R2IA 4BFXA 1FUKA 3PV0A 2KJQA 4CEHA 1NP6A 3CONA 1L2TA 1XP8A 1FNMA 2CLSA 1UFQA 3K70B 2BEJA 1OFUX 1RYHA 1LV7A 2G77B 1YZGA 2QENA 4EKDA 2PX0A 1HTWA 1XD9A 4BFSA 2J9RA 1GL9B 4WW0A 2PH1A 4PPFA 2RHDA 4C4PA 3ADBA 3N2IA 2A30A 2E87A 3EXAA 3I4LA 1D9XA 4YMTA 4QC2A 3WMFA 1OPXA 3B7GA 2QBYB 2QAGB 4NKRA 3K0EA 4TMKA 1D2EA 4LV6A 2DFKB 5C46F 1KJWA 1M7HA 1RKBA 2XOKD 4HDOB 2AWNA 5JJLA 4KBFA 4L16A 2QT0A 1NSTA 3KQNA 2P65A 1XTKA 2N42A 3ZS9A 5FPTA 1E98A 2W58A 4JLPA 5M04A 1G1MA 1N6OA 3QPVA 4QL3A 5FBRB 4C0JA 4KU4A 4F38A 3NHBA 4DUGD 2FEMA 1IN5A 1M8PA 2JDIA 3F3YA 2DWQA 4NTZA 5TDHA 2FH5B 2OSBA 3ZZUA 2V1XA 3IO3A 3LLUA 4DLTA 2JLYA 1SXJC 3QXHA 1HQYE 1N25A 2CJWB 2B21A 2IYXA 5ANRB 2ZTSA 3LH5A 4NYMQ 1UKZA 4PAOA 5F9FA 3CRVA 1NY5A 3K70D 4CEIB 3K9HA 1OYWA 1CULC 2OXRA 3OAAA 1FQJA 4LGMA 2CCJA 3CNLA 3FKSA 3KJGA 1KMHB 2X19A 1NJGA 4G0NA 5EZ6B 5ELXA 4O2LA 1AGRA 2OLKA 3HYRA 2D2EA 3QXJA 4XSGA 2PX3A 1NVWQ 4DCNA 4V02A 2CNWA 2OILA 2VTKA 3LDAA 5CYOA 2IXEA 5HCNA 3TIFA 3VR1A 4C7OB 1PUJA 1CJKC 2BBWA 1E0KA 4ON9A 4NU0A 4YDHB 2CE2X 3SHFA 4ZDWA 3NBYC 5C4MA 1NIJA 2WKQA 2UZIR 2QE7D 5DIFA 1E3MA 2GILA 3AVQA 5GJCA 4YC7A 1PV4A 4JLDA 3MWKA 1NNEA 5EUQB 5EUMA 1ZU5A 3LWNA 2Q3MA 1GKYA 1JR3E 4I1SA 4QFMA 4RFVA 3I61A 1NN5A 3LW8A 1WQ1R 4S2EA 1XTRA 2W00A 4O0MA 3U7HB 3X2SA 2P6NA 3FDIA 3HP1A 3MWLA 2ZU0C 1QHSA 2GCNA 4LPSA 2BCJQ 5FOTA 1H8ED 4Z8YA 5DYIA 1EXMA 1LTQA 1YZTA 2ZS8A 3DOEA 3CX6A 1DE0A 1G3RA 4GI7A 5DI3A 3AP3A 4Q4JA 1W2HA 1P2VA 4Z54A 2YWFA 3GPLA 4G1UC 1JJVA 2IF0A 1NVVQ 1Q57A 1XZQA 1E9RA 1PLKA 1DOAA 1YZKA 3MLEA 4AK9A 3GD7A 5KDDA 1SKYB 4MKIA 3GLHA 4NP6A 4Q03A 1GTVA 3WNCA 2BM1A 1G3UA 2C77A 4DIEA 4Q01A 1TPZA 5EP4A 3OFNA 1F2UA 3UKDA 3OIVA 1EK0A 1W4AA 4BWYA 3EIQA 4IJMA 4NDZA 1CR2A 2AD1A 1Q44A 3LVQE 4D0NA 2DFNA 4PAMA 4LC0A 4Q9JA 2DYKA 1T3LA 1AK2A 3CNOA 1E1QA 1T0JB 1AGPA 1H8HD 1ZMXA 2QZ4A 2X77A 3O8DA 2XB4A 1KJYA 1J99A 1RZ3A 3KB2A 3LBNA 4LDJA 4LHZA 1GM5A 2FSHA 2IYUA 2CMKA 2J3EA 1N3BA 1DG3A 3FFBA 4QGGA 4DDUA 3GP8A 2J87A 2RGNC 2BEKA 1W5TA 2SHKA 4JLMA 1SVKA 3ZLJA 4B71A 1S3GA 2HYDA 3VX4A 1MO6A 1W0JA 1XNJA 1R0YA 4GT1A 2GZDA 2PL3A 2HJVA 3H4MA 2WWHA 4JKIA 3IHWA 2FA9A 1P7CA 1UADA 2VH5R 2WJVA 4NHOA 1P72A 1WXQA 2ANCA 4IOMA 1TQ4A 2YNMA 1M34E 2OFXA 1VG0B 5KYKA 2CLCX 3ZIAA 1XTIA 3U2QA 4RD0A 2A3RA 2CL0X 2ZRHA 4D0LB 2NO6A 3FE2A 4OQXA 5KDOA 2IS6A 2ZUDA 2OLJA 3OF5A 3K0AB 2HCBA 5D3QA 1II8A 1YR9A 4WAUA 5JRJA 2ZSFA 1CRQA 3LX8A 1W2GA 1PZNA 2ZE8A 1Z6TA 3B5JA 3NIBA 2OT3B 2NO9A 3M1IA 3THXA 2Q21A 5FL7A 3G5UA 1QHGA 2PBRA 4IDHA 2Q0HA 4A4DA 1IY0A 4OYHA 1U8AA 4GOXA 2GHIA 2GZAA 3NBXX 3PEUA 4PC3A 1VCOA 5BYJA 4IRUB 3HU1A 5A4JA 4UNNA 1XTJA 1Z2CA 2ZR0A 1EG7A 1CEEA 1KSGA 1G291 3I8XA 3L0PA 1G6OA 3RABA 4M2LA 4DSUA 1Z0KA 3QUSA 3C5HA 3CWQA 4C0LA 3EPHA 2XNDD 2V54A 3TUIC 4TLCA 4UNPA 3AVUA 1R0WA 4G3XA 3EZ6A 3CKLA 1EFUA 2IT1A 2PT7A 4LCBA 4MUAA 3ZH9B 4EAQA 3R9IA 1Z2AA 1BMFA 4F91B 1EWRA 1IXSB 4B73A 1CF4A 3DPUA 2WMNB 3U60B 1YR8A 2WPDD 4BRUA 1XJQA 5KO2A 4EJSA 3BBPA 3P26A 4HB0A 2OEPA 2BKEA 1KK1A 4P32A 4B74A 5LDDC 3EC2A 1CTQA 3QSYA 2GWHA 1E2NA 1Z22A 1GAJA 2XXAB 1R0XA 4TYNA 5J47A 2Y8EA 3F0TA 3GEIA 2FFHA 4IHQA 1KI8A 4D82A 1U9IA 3N2EA 5FUXA 2JLQA 5EP3A 1GP2A 3X1DA 1U98A 2O0JA 4MITA 4HAVA 1UAAA 2IUTA 1Z5ZA 4Q7KA 4YXWA 4XTRA 3HR8A 1SHZA 2IXGA 1CR1A 1KNQA 4EJSB 3W6PA 2CCGA 1E2MA 1Q3HA 4Y0AA 3UG6A 4A36A 1Q1ZA 1Q12A 1YRBA 5JS7A 3ICEA 1YR6A 1F6BA 4M53A 4QGHA 1NY6A 3WBJA 4PHFA 1ODFA 4L4UA 4BFZA 3NWJA 3B78A 4IFEA 5JI2E 3GLFE 3RYTC 2BDTA 3AVXA 4US0R 1R7RA 1E0AA 3MRSA 3SC3A 4TZ0A 1ZUNB 2ZQ5A 3B85A 3GFPA 1G20E 5TV2A 5FBQB 3PUZA 4Q1EA 4XH9B 3EIHA 2B8WA 2GAOA 4KAXA 2ZJOA 3BFXA 5KU1A 2YC4C 2ZR7A 5HKKA 2IWHA 1G18A 4M1WA 4MA4A 5AUNB 1NSFA 2CVFA 4RD1A 1YJ5A 4IVQA 2CHGA 2VIIA 2KB0A 3SN6A 1KI1A 4B6FA 1T9HA 2KI5A 1E9BA 2OZEA 1EGAA 3HJNA 3BFKA 1UKVY 4A2WA 4PQFA 4DLWA 2RGCA 1G19A 3I72A 1IJEA 1KAOA 1P2TA 1ZVQA 2XSZA 4JIMA 4PQYA 4WZBE 1UKEA 4Q19A 2V6IA 2XZPA 5KNCA 1GDDA 4RD3A 2HXSA 4BZPA 4DIDA 4FWIB 3KKNA 4KLNA 1U81A 3U7GA 1Y63A 1NKSA 1W48A 2OG2A 4D4JA 1R8QA 5J4HA 3NBFA 4V0OA 3C41J 5LB4A 3V4RA 1FPMA 3OE7D 4D4LA 4OK6A 3WY9A 1OB5A 421PA 5LD2C 1S8FA 4P4SB 3QENA 4FXPA 1TF7A 3QKUA 1AZTA 4LYAA 4TQUS 3X1YA 1RRFA 1FTSA 3I3SR 2G9NA 1R5BA 4G5GA 4PC1A 3QJYA 4U00A 4LHXA 1OXXK 1TU3A 1XPOA 4TSFD 5K8TA 1HURA 1X8KA 3QG5A 1XD2B 3EARA 1YZLA 2C99A 2YHSA 2PT5A 3AVVA 3E2IA 1DVRA 2KE5A 4R9UC 4PC2A 2BV3A 3EG5A 3RWMB 1U0HC 2J46A 5EE0A 2E1RA 2VP2A 2D74A 4JLOA 2F1HA 1A1VA 2ZE7A 1GIAA 1T8TA 1NBMD 1D6JA 2EFGA 3BB3A 1T0HB 3BH6A 3GJ6A 2ZUBA 4M8NE 5CITA 2NO7A 4CGZA 2QRNA 1OE0A 2QEQA 4BLSA 2ONJA 1MH1A 1D2NA 1MRSA 2QPTA 3EIEA 3ZDQA 2V55B 3VR6A 2G3YA 2IYYA 4EQ6A 5BN4A 2RGBA 1NRJB 2WWYA 3MJRA 4QKQA 3QG1A 4KVAA 1NJFA 1MRNA 1S9HA 1U90A 1M7BA 4DSTA 4XJXA 3BE4A 2IYVA 5B30A 1E4YA 1ZD9A 2QPAA 4ACAA 2ZI4A 1IN4A 3U3OA 1KJZA 1ZM4A 2ZETA 4TQAA 2O8BB 4XVUA 4ZIRA 3K0SA 4URYR 4V0KA 2ZYTX 3JZMA 2WSSD 1G7SA 2OFOA 3I1FA 3JVUA 3QQ5A 4JKYA 1JQLB 4LJAA 3P27A 4NYJR 1I2DA 3BXZA 5CIWA 2IUUA 4BLTA 2I1QA 4RVCA 5DH9A 4OK3A 4ERNA 4C2TA 3ND8A 5AUQA 4TL6A 3WHKA 4CDGA 2HXYA 2IUSA 1NN0A 1DARA 1U0JA 2HT6A 3HPRA 5HR5A 3EPLA 1VCIA 3REFA 3R9XA 3VMFA 4PZYA 2YWGA 3DM5A 2AKAB 4UXIA 3KZ1E 1PVOA 3AVWA 4RZ3A 4XSHA 3LVRE 3P4YA 3IO5A 2REOA 3IIMA 1GSIA 3CPHA 3T1OA 4I1UA 4C0AC 2CBZA 4NCNA 4NMMA 1XDBA 2VP6A 4UJ5A 2OAP1 5B2ZA 3NKVA 2NQ2C 4AIIA 1KSHA 2HLDA 4RZUA 4DLYA 3EZ9A 5HE8A 4FIDA 1S4QA 1SVIA 1Z06A 2XB2A 1I4TD 4TYPA 4FCWA 3AP1A 4Q9IA 3QKSB 3RVBA 4GP7A 3DMDA 3H2YA 1X8LA 4A15A 4YDSA 2W6IA 2FG5A 1RC8A 3CNNA 1J7KA 2REBA 5TB5A 1UPTA 1OLOA 2C04A 2WAXA 4ZCIA 1XZPA 2VBCA 4XWOA 5CDFE 2BC9A 5LBIA 2WWIA 1QHHB 3IUYA 1JBKA 5EJEA 5JHHB 1DADA 4JBWA 4LBZA 4L8GA 3A58B 1QVRA 2ZRFA 4IVPA 4OQFA 5L3SA 1TF2A 2WJGA 3GJXC 2JLXA 1P6XA 3AKYA 4MGYR 3S1AB 5FBWB 3KJHA 2QNRA 2FSFA 3ZVNA 3TR0A 1JAIA 1SKQA 3A1TA 4FMCF 3WMGA 3VU9B 1W4BA 1CJMA 1IONA 2WKPA 2R44A 1G5TA 1FMLA 3HWSA 4OHZA 4OQLA 2VYFA 5K8IA 1NVUQ 3H1TA 4MGIR 4TQ9A 4QBFA 2HT1A 4FMCB 3N70A 1RJ9B 1Z6YA 3ZS8A 4KFSA 1AIPA 1X6VA 2Q3HA 1MKYA 2BMFA 3CPJB 3OEHD 4GOKA 4IDQA 5E4FA 3TBKA 1CJTC 4IFBA 1E1RA 5KNBA 4PSAA 1NBME 4ACBA 4D4KA 1UJ2A 5FBVB 4HAYA 1EESA 1XEWY 2WKRA 4H9GA 2ANBA 1Z0AA 4BLOA 2NTYC 2ZVPX 1S0UA 4Z1MD 5JRZA 3A4LA 4E09A 1YR7A 2WJJA 2CXXA 4CYMA 4U7DA 1XXHE 3B60A 4ZCLA 2J7PD 4AYWA 3UMSA 1BKDR 1XEWX 4KBGA 4KJZA 3NH6A 2B8TA 3RRYA 4V0ME 4FINA 3Q5DA 3U61B 1ZAKA 4C2UA 1E9FA 3BB1A 1KSJA 1ZJ6A 2A5YB 3T61A 4F4CA 3PR1A 4Q9HA 4BFVA 1QHYA 3QPUA 1MR3F 1NLFA 2ZVQX 3DZDA 1OKKA 4XD7A 4M1OA 4TLDA 3TSZA 3O47A 4D0GA 2OO7A 1OB2A 2AWOA 2ZEJA 4QBGB 3CR8A 4IOKA 1F5NA 4QNRA 1KO8A 2FDCA 3UG7A 1UKYA 5KHOC 4B3XA 1D5CA 2CHVA 4L9WA 1E4VA 1EWQA 3ICQB 3A8TA 1D8TA 3X1WA 1PUIA 1VTKA 2ZRDA 3WNBA 1II0A 1G8GA 1SXJA 2ZJ2A 4OJKA 4LYFA 2NIPA 2IS4A 4N3NA 1JR3A 3EC1A 1UF9A 3MFYA 1KI3A 2F1JA 4TL8A 3LXRA 1CIPA 2C9YA 4AG6A 4DJTA 1G3MA 3K0FA 3E5HA 2GESA 4QNMA 1GNRA 3DHWC 4HDQB 4MYUA 3GJ3A 1VIAA 5SZHB 1JPNA 2D7DA 3EPJA 1KO1A 2O0KA 3K8YA 1AKEA 4AKEA 4TL9A 2R6AA 3L0SA 4HYYA 4KVGA 3BFVA 5AJWA 2LCFA 1SXJB 3C16C 3FMFA 4N0DA 5TVKA 4DEXA 1Z0IA 2O5VA 2P6UA 3LD9A 1FNNA 2VSXA 2HV8A 3H84A 1CKEA 3KQKA 3KXKA 3U3RA 2D4HA 1ANKA 1V5WA 2ZRKA 4OI4A 3U5ZB 2PCJA 2V7QA 2J5XA 3RLFA 2W6JA 5G53C 2OXCA 4AD8A 2ODBA 1TL7C 2EFCB 2IL1A 3DOFA 3NXSA 2FMXA 3THWA 3MD0A 4L5BA 2ZSBA 3CPEA 2QORA 2W0MA 4ZKEA 1B23P 2IW3A 2P3SA 3BB4A 5DYGA 1E0SA 1TUIA 2IEZA 4YONB 3ZD7A 4LHYA 2FX3A 1WB9A 3RRNA 1Z6XA 2WZQA 5G41A 1YRAA 5HPYB 1Z0FA 1R10A 4KLZA 2FF7A 4Q4AA 5DNYB 1OXTA 2DR3A 3THWB 2AHOA 1Z29A 2G6BA 1KTVA 5JBQA 3UIEA 1M1YE 1W44A 4W9MC 4QJ5A 3BORA 5J4YA 4C9BA 1X1RA 4AC9A 1Q0UA 3J81k 2GDJA 4X8HA 2OESA 4B2LA 2J0UA 3TE6A 2Q3FA 4AI6A 4BLRA 5JSZB 3RANA 3GJ4A 1E2DA 3RC3A 3SU8A 2WIBA 1KSFX 5AK0A 1TNDA 3U4QA 3QBTA 3FFAA 1T3SA 1XCMA 3VNVA 2X2EA 4DCUA 3IQWA 3EASA 3VHLB 4HLQB 4YMSA 5BXQC 3V00A 1KDTA 3B9PA 5DSZA 2RGNA 3IEUA 2FWRA 2CHQA 4M9SA 1HA3A 4CEHB 4ZDJA 2ZROA 1E2LA 3KKOA 2WIAA 1X3SA 2GA8A 3L0IB 4M1KA 1P61B 4BLQA 3HU2A 4O25A 3ASYA 3RDPA 2O8DA 2PJZA 4N1AA 4RD4A 1SULA 1TQ2A 1YU9A 2FZLA 5TY0A 4EPYA 2ORWA 2QE7A 3BAFA 3PQCA 3QVUA 2ZJYA 1NG9A 4F92B 5LB2A 3D7MA 1OIXA 1E2HA 3B1VA 1N6RA 4PHHA 3CR7A 5SZJA 2CCKA 3ONWA 1G8FA 3TJZA 1O3YA 4DCSA 3FMIA 1R5NA 2QP9X 1IXZA 2IYQA 4LJYA 4GZMA 1COWD 5E7JA 3QXXA 1X8JA 3SYLA 2FFAA 2ZREA 1TX4B 5EE3A 2C95A 4C30A 3I5XA 2PZGA 1A2KC 5GJWC 3BJIC 3VFDA 3R8FA 3ASZA 4NYIR 3QI2A 1ZNWA 2VRWA 5DO9A 2RGGA 1XBTA 2ZSDA 1EFRD 2ZRAA 1W47A 3SBDA 1DAFA 3W9YA 1KDOA 2AKYA 2ERYA 3DZ8A 3SOPA 2J0VA 5FH9A 4U5XA 4BASA 3WXMA 4LI0A 3UMFA 4M0LA 1MABA 2FGKA 1CXZA 4KXFB 2IYLD 2XITA 4X8MA 4E5UA 3K0CC 1DTSA 2WBLC 5FBLB 4RCYA 2HDNB 2C5LA 1W0KA 1EX7A 1EFHA 1S2MA 4JBYA 4WIAA 1TEXA 4E07A 1G16A 2FPKA 4Y0VA 2ZJZA 2OBLA 4PPQA 1A2BA 1H8HA 1P2UA 2ZAMA 1N6KA 1M6NA 1VHLA 1UBEA 4JJKA 3VKWA 4XTCS 5KPJA 1E9EA 3TSWA 3M0EA 1HT1E 3NEJA 3GLFA 3RSLA 4P4UA 1VDZA 2QU8A 2WOJA 1OV4A 2KBEA 2WWWA 3FHOA 3NC1C 3Q7QA 1DAHA 4RSGA 3AF0A 1AS0A 2ZJ5A 4LBYA 1GG2A 2IC5A 4EFNA 1AN0A 4JL6A 4MKFA 3VKGA 2BHRA 1EFCA 2ZRLA 1FL9A 4PQRA 3HR7A 4B3FX 4CZ2A 4FCTA 3OIWA 3SNHA 1KIMA 2C2HA 2WM9B 4V0LA 1G7RA 2IX3A 2A5FA 4TLEA 3JVVA 1Q1QA 2V9PA 3H86A 2OCPA 5B58C 4B3GA 2JEOA 1IOZA 1P2SA 2NO1A 5DI9A 3F8TA 4P31A 4TMVA 1NG1A 5GJVC 3B2EA 2VP4A 3GQBA 2QPOA 1RYFA 2JDID 5IDVA 1OFIA 3PIRA 2BIFA 3SJAA 2QGNA 1DAIA 5DI3B 4Q4JB 1QG4A 4F4JA 3CF6R 1RRCA 1CJUC 3E1SA 4LHVA 2VHUA 1P9RA 4M1SA 1P73A 1Q1EA 4OHWA 3AF3A 3EAQA 2DY1A 3QF4A 5L3VA 3K70C 1UBCA 2FE4A 2VP0A 3GLHB 3KL4A 4QBHA 4BFTA 4F4IA 5AJYA 3V9PA 3D3QA 4ZO4A 1FZQA 1F2UB 2JLWA 3FKSD 3L8YA 3BS4A 3RS4A 1NI3A 4D81A 3Q8XB 1GNPA 3R9WA 2W83A 2RHMA 1KI2A 5KSZA 1WRBA 2GNOA 4ZCMA 1E99A 2QAGC 1SVWA 5A5GA 5F98A 3K1JA 2WJYA 1CP2A 3KQUA 2ZXUA 3K9LA 1N6NA 1BS1A 3GFOA 4ARZA 1ZD1A 2B6HA 2PLFA 1R2QA 4LJ7A 2IK8A 2F7SA 4MYTA 1OXUA 3CBQA 1N6HA 3UWKA 4A0HA 2WICA 6Q21A 2WWGA 4B2IA 3RRMA 1P5ZB 1OXVA 2TMKA 4NL4H 1KZ7B 1KYIA 2EFHB 4D4MA 4JS0A 4Q18A 2F9LA 4DWJA 1YKSA 4LWZA 2JJ1D 5JMTA 5FTNA 4YQFA 2QMEA 3ZVMA 4JT4A 1Y3AA 3G0HA 1P62B 1T8UA 3LX5A 3K9GA 4C3ZA 3ADKA 4Q4HA 3WNDA 3QKTA 1U2RA 1JPJA 3L82B 5CM8B 2W2TA 1N5LA 1UDXA 2C96A 3GLIA 2ATXA 2IYTA 4DRZA 2EFEB 1AQYA 2R2AA 4NCJA 1ELOA 1GITA 4GP6A 5FTJA 1II8B 3OFND 4EUNA 2KWIA 3B82A 1G3IA 3AVTA 1VYUA 2RAPA 3CRW1 5FR2A 3RWOA 4HLUA 4B3CA 3THXB 3IIKA 2J41A 3QPWA 4OQMA 3JZAA 3OHMA 3CRRA 4NE2A 5JS8A 3A1UA 1KOFA 2FNAA 2X8AA 2NOAA 3W5IA 3M6AA 2GRJA 2O8FA 1R6BX 3GFTA 4V0NA 1KI6A 2RH5A 3K9NA 4DZZA 1R8SA 2BMDA 2O8CA 3MCAA 3WP0A 1DG1G 2ZRIA 5DN6A 1B0UA 2HYIC 4IEEA 5FOSA 2JA1A 2N1BA 5C4GB 2ZU6A 3AP2A 3WYGA 4NONA 1Q1BA 1W0JD 1TQ6A 2QY9A 4D80A 3ZZ0A 4HUQA 1UBGA 1U8YA 5BW8A 2O0HA 1MT0A 1U8ZA 1XMSA 4KCGA 3W8RA 1KK0A 3P32A 1WP9A 3BIFA 5H70A 4IOJA 3IBGA 2ZE5A 1T4GA 5AR1A 4DLUA 2D2FA 3ZIAD 1N0VC 1S96A 3QKRA 4YMUA 2P5SA 1MO5A 3OE7A 4Q1BA 5KSYA 1RPZA 4TMZA 3CB4A 1Z6GA 2QAJA 4UQOA 2GAAA 3U44A 4A9AA 2R9VA 5JCPA 2OCYC 3TR5A 1OFTA 4PANA 1AZSC 3F5FA 4WZAE 2AK2A 1ZP6A 2IYWA 4DLSA 4TSFA 1IAQA 2IXFA 2QMOA 5EXXA 2DFLA 2WV9A 2D7CA 3W34A 2OE2A 5H1YA 4PX9A 2F43A 1ZC3A 1BIFA 2WSMA 4DLXA 4MH0R 3I92A 4NZYA 1OH5A 3L2OB 4BECA 3X1XA 4ASUA 4NCHA 2ZS9A 3P20A 4JT2A 4O3MA 1T91A 1SKYE 1QRAA 2GTPA 1E94E 3PG5A 4HAUA 1NBMA 4B6EA 4LJ5A 2BOVA 4W7SA 1KY3A 3AGQA 4UJ3A 4C0SA 1CR0A 3SFZA 4NYMR 4TT3A 2WMOB 1XB2A 1S1CA 4OJQA 1ZBDA 2NPFA 2O8EA 2LKCA 4II7A 2PEZA 2Z6VA 4L15A 3UWOA 3A6PC 2OHFA 1XXHA 2AK3A 3NDBB 4HLCA 5FTMA 3U3JA 5TXGA 5AJXA 5E7MA 4RZXA 1FW6A 4WXPA 1LF0A 2BJVA 1N5KA 1UDWA 2K5UA 3NBZC 2XX3A 3I8SA 4V0MA 1IY2A 5CK4A 1ZYUA 4MRRA 4B3DA 2AX4A 1T5LA 1ZUHA 2WSSA 2YWHA 2BVNA 4ESVA 2QTVB 2ZS7A 5FTLA 3ZGXA 3MWYW 1G3QA 1GWNA 2REXB 1E79D 4MQBA 1VCNA 3SYNA 2MMCA 2O8EB 3A1WA 821PA 3P4XA 3A4NA 2CE7A 4LX0A 4YMWA 3VTKA 1F48A 2GBLC 4GSYA 4BLPA 1JXOA 4A6XA 2B92A 2IYRA 3GJ7A 4Q7JB 5FPYA 3WHLA 3FTQA 4JSTA 4FMDF 4HATA 4ESHA 1M2OB 3OIUA 3SBEA 3A4MA 2J0SA 2EYUA 2QA5A 1W4RA 3KKPA 2OCAA 2HF9A 4KITB 3KQHA 3ADCA 4M9ZA 1A4RA 2LKDA 4HLUC 2VP9A 2DPXA 4FMDB 3HDTA 4JBXA 3SHWA 3O8CA 2QQEA 3IILA 2Z43A 4DC9A 4Z8XA 5GJBA 5HKKD 1NVVR 4MKHA 2JLRA 4PO1A 3FGNA 2GF0A 5C18A 3LBHA 5HZKA 1LF5A 4A92A 4RKEA 4PO8A 4A82A 1GL6A 4BQSA 4HLDA 4OHXA 2IEYA 1KKMA 4UXJA 4FW9A 2JIZD 2FV8A 3PVSA 3UXMA 5HCIA 3Q3JB 4RD2A 3T35A 1ZNZA 2GCOA 2YVUA 2ZRPA 3H0KA 2MSDB 4HEJA 3TVDA 5A0FA 1A82A 2O52A 2VA8A 3TRFA 2ZI5A 3EWSA 3LNCA 4LC1A 2G83A 3BD9A 2QMHA 3EZ7A 5DHAA 3EZFA 4ZI2A 4EQ6B 2XSZD 1AM4D 4XWKA 1JI0A 2ZJAA 3GLGA 1NN1A 1GUAA 1SVLA 2A7QA 3BERA 2W2XA 4Q1AA 4RY2A 5CK5A 3SDZA 3SFVA 5F9HA 3AQ4A 1ONBA 2EWVA 3PXGA 1G21E 1H65A 5P21A 3AH8A 121PA 2C9OA 1GNQA 3PEVA 1F3OA 3SJBA 2GEUA 4C0QC 1LW7A 3CRQA 4ZIRB 4RFSA 4A6PA 2IHBA 3FWYA 4YLGA 5KNDA 3QEJA 3G82C 1OH7A 1BO6A 2P6RA 3MJHA 5AJVB 1BYIA 1SVOA 2DBYA 2ZRCA 3RNLA 2VLIA 1F60A 1W36B 4WVFA 2CLDX 3FKQA 4MDEA 3TVTA 3OEHA 1T5IA 2KBFA 1E2PA 1WBBA 2ZPTX 1TADA 4QJ3A 1U99A 4GBMA 3AF4A 2H17A 4KYIB 4B76A 2QTHA 2ZM5A 2P0EA 2E9SA 4GZLA 1G8HA 1Z0JA 1BH2A 3WMEA 3IPYA 4Z1MA 1G7CA 2CEAA 4BEJA 1M7GA 2AFIE 3Q5EA 2MSCB 5FR1A 2F55A 4HI0E 3BGWA 1OSNA 1G17A 3TKLA 2H92A 4FD2A 1MO4A 3HYTA 1DO0A 2BKUA 4OL0A 4PHGA 1UEJA 1ZW6A 3KKQA 3OZXA 3O8RA 3THYA 3PFIA 4QHSA 5J5CA 3N5CA 3T06B 1AJEA 1JXMA 3MMPA 4RD6A 1VCMA 4TLAA 1LY1A 4DT1A 4B43A 1P4SA 2WOOA 5DE3A 3W8NA 3P1JA 5C1BA 4NCIA 4LJ6A 2MMGA 5HTKA 5EE1A 2XJ4A 4F93B 2FPMA 4M22A 1Z83A 3K09C 3W90A 2G1KA 3ADDA 4U02A 3GJ8A 3FMOB 1QVAA 5FUVA 1SVSA 2G0TA 1XMJA 4BUJA 3DEFA 1ZM3A 2PCLA 4ABYA 2IS1A 2EU8A 2QG6A 3LO5A 1WDTA 1OHHA 3BRWD 1FX0A 2ZJBA 3PEYA 5L3SB 4W5HA 1U94A 1W36D 2EQBA 1W1WA 1GRQA 4LBWA 3CW2A 4AG5A 3WBKA 4O2RA 5J4VA 2L0XA 1KK3A 1KZGB 3QIAA 1L4UA 1VG8A 5FOUA 4EPWA 2PMKA 4GOJA 1KNXA 4MUBA 3RSOA 1JALA 4ILEA 2NPIA 3RS3A 3M4YA 5JI3E 4URXR 3B8HA 4GDFA 1RVDA 3FPAA 1AKYA 4QGFA 4DB4A 2GJ8A 5GADl 3EZ2A 1XD8A 3KUDA 1I4DD 3BOSA 2J0QA 1ZNXA 2WJIA 3KTAA 4URVR 1VMAA 5FPSA 2DCUA 2HLDD 4URWR 2BMEA 4DB2A 4GRAA 1LVGA 2V4ZA 4HSEA 1MV5A 3AM1A 3TNFA 1V43A 3QOFA 2JCSA 2C9CA 1YZNA 2QN6A 3AKCA 3W5JA 1X1SA 4TZ6A 1DAGA 2FN4A 5FOWA 4Q7LA 5KSPA 1UEIA 3RS5A 5D3MA 3FVQA 2J45A 4TLBA 3NEYA 2ECKA 2ZAOA 2VHCA 3KXLA 3CRMA 3B1XA 3GEHA 3T34A 4DSNA 5CJPA 4HDCA 3R7WA 3Q9LA 1SHKA 3OESA 1NLYA 3UATA 3IIJA 2ASEA 3OEED 4UNQA 4I81A 3EWAA 4AY2A 4FWTA 3RHFA 4Q47A 4LV5B 2PJRA 1XRJA 3SR0A 2UVQA 1K5GA 3K0CA 5J4KA 2NMVA 2YKGA 3T5DA 1QBKC 3C4JA 3QF7A 1QDEA 3TQFA 1XTQA 2DHRA 3Q85A 3CH5A 4B3BA 4JLAA 4M4SA 4A0FA 1WF3A 2W0SA 1Q3TA 2NO0A 3AKEA 1ZU4A 4OI2A 2VPPA 1XX6A 3K0FB 3ZYCA 5B57C 3PUVA 4MDFA 3CH4B 1F2TA 4M21A 1E1RD 1WA5A 5BWMA 4QJ4A 2I4IA 1P60A 5TMPA 2JJ8A 2GXUA 1E2QA 1O87A 3LXXA 4HZUA 4Q48A 5HE9A 3O8BA 1ZINA 4C0KA 2CL6X 1KDRA 1XEXA 2Z83A 3LQQA 3HPQA 5FL3A 4ZPXA 4B35A 3LA6A 2IYZA 3FB4A 1VG9B 2HEIA 3LLMA 5JEDA 3PUYA 4KSBA 4JMPA 2CDNA 5JECA 2H7VA 2FU5C 2XOKA 1E9DA 1TUEA 4PC6A 1IQPA 3IPXA 5UKDA 1N6LA 4JZKA 1G4UR 4C0HA 5FI1B 4WZ6A 2F1IA 1DPFA 3CO5A 4OK5A 4DUGA 3Q72A 1OKKD 2ZI3A 4XD7D 1RRPA 1HY3A 2QMUA 4MRNA 2ONKA 4R71A 2RGEA 1DELA 3NHAA 2NGRA 1KO7A 3A36A 2YWEA 2QL6A 2KSQA 1CBUA 4PXAA 1E69A 4D6PA 2F9MA 1XPRA 4WXRA 4HB3A 4CEJA 3FHTA 1SXJD 1Z6AA 4DDWA 4MRVA 3DM9B 1RIFA 3RS7A 2CK3D 2JLSA 2H57A 3ECCA 2VL7A 4Q4AB 4BZXA 5JZVA 4GMXA 2ZSAA 4GL2A 1A5TA 1CLUA 2YZ2A 4B32A 4IOLA 4QOSA 2PMDA 4FCVA 4DVGA 4DSOA 3AVPA 3C7KA 5EXTA 3AKDA 3EW9A 1Z47A 3VHXA 5KUTA 3SI7A 1N0UA 1E2KA 2DB3A 1E2FA 1QG2A 1VYTA 4TTQA 3QE0A 2J0UB 1US8A 4EPTA 4CEJB 2V3CC 2QBYA 2QAGA 4R2HA 1HE1C 1GOTA 2CL7X 5DGXA 2LWIA 3ND9A 4K8OA 3MGCA 2DWPA 4JLVA 4F7WA 2Q6TA 2FFQA 4JVNA 2ORVA 3VNUA 4LJ9A 3GEEA 4G01B 4LSGA 4Z51A 2YOFA 4G5SA 4AYXA 2FPLA 2XJ9A 3LY5A 4Q7MB 2H18A 2V7QD 4PO9A 3CZQA 3B6EA 2W6JD 4DLRA 1A7JA 2FSIA 4HAWA 2EWWA 2ZYVX 1G4AE 5SZIA 3FMPB 1QZXA 1YQTA 1IXRC 2XTMA 3RRZA 2VF8A 3THOA 3VR4A 3AUYA 1US8B 221PA 1ZUIA 4OKSA 2GJKA 4RKFA 4UXHA 4MRSA 5IK2D 1J90A 2F3TA 5CIQA 3U6BA 1IN8A 1H8EA 2G1JA 2Q9BA 2O8DB 1N6PA 1JEDA 3PITA 1ESMA 3TW4A 3W3AA 4UNSA 3WRXC 3U7FB 1N5JA 4D26A 1P75A 2IA5A 4TTRA 5CM9C 3T12A 2JJ2D 2CJWA 4AKIA 1RE0A 5CJ2A 2VHJA 1IBRA 3QBVA 4I1VA 1JJ7A 2IHYA 1G5PA 4QBIA 2N46A 4CEIA 5CLQA 4C0BA 4CRWB 1XMIA 3DDCA 2D3WA 4OHYA 4TYQA 4B2PA 1VG1A 3A1SA 4Q21A 1KMHA 5EP2A 2A5GA 2WAYA 2H1LA 4CVNA 1EFTA 3I73A 1KKLA 3C14C 4RZ2A 5JWHA 1G7TA 2OM2A 4UKDA 3KB1A 1G8YA 2RKOA 1SZPA 4C7OA 2BBOA 3NH9A 1ZRHA 2QSYA 2GETA 4RCZA 4JL5A 4OI0A 2GXQA 3D8BA 4ZKDA 4BZQA 1MABB 2V6JA 1E9SA 1FP6A 2BJWA 4ZDKA 4A0RA 1GKIA 3QXSA 3SJCA 5EXSA 4I1OA 1YE8A 3TUZC 2VO1A 3CZPA 2ORIA 3I5YA 4FMBB 4B75A 1LS6A 1NL3A 1DAMA 2PZFA 4B34A 2FEOA 5IRCD 1E2GA 4I4LA 4D2IA 1ETUA 1E32A 2OV2A 3OIYA 5E95A 3I32A 3QNUA 4QRHA 4TL7A 1W46A 4KODA 3X1ZA 5KOYA 2Q9AA 4XWAA 5BYKA 3GLFB 1CR4A 1XFAA 2QI9C 5JEEA 1SXJE 2ZI9A 1PLJA 3UPUA 2ZUCA 2VHQA 3QXCA 1HE8B 1JR6A 1P3JA 1AA9A 2GJSA 1TTTA 4TMWA 5CB8A 3V4FA 3CX8A 5GVRA 2JJ1A 3TW8B 1NVXQ 1HT2E 3EA5A 3IBYA 2P2LA 3TUJC 3U3MA 3CM0A 5BQ5A 3VX3A 2OUKA 3R8CA 1M74A 4BFUA 3BK7A 4CT5A 1NF3A 4JVMA 2ODNA 1JB1A 1NMYA 2C98A 2VHTA 2OBNA 4NCKA 4QGAA 3AB3A 2IWRA 4UNRA 4A2PA 2H5EA 4LRWA 3OAAD 2JLVA 2FOLA 4QG7A 1T3HA 1NKTA 2DFTA 4A8JC 1XPUA 2A5JA 2AN9A 2AXNA 2XNDA 1G64A 4KFUA 4Q1FA 1W0KD 2X2FA 2DWOA 3BH7A 2R6CA 4HUTA 1KGDA 2CNWD 1Z3IX 2VSFA 2GVZC 2C03A 3AGPA 2OCBA 1J8YF 2MSEB 3C8UA 4NYJQ 1Z07A 3QF4B 4ZV4A 2AFHE 2EW1A 1KI9A 2H16A 4BFWA 2WPDA 2QTFA 4V03A 3NDPA 4EFMA 2QROA 4GNKA 2RGXA 2RCNA 4PZLA 1OH8A 1TF5A 3DKVA 3LQRA 2GXAA 3FHCB 1AQUA 4BEBA 5AWFC 3CF2A 1CS4C 2GK6A 3L0OA 2QUZA 3LBIA 3TMKA 1N2CE 4KV9A 5GVSA 1RRGA 4JLBA 1N5IA 5IF9A 5LPNA 3TK1A 3K0AA 4ARZB 4TTPA 5BN3A 5JWRA 2ZRBA 1ZM2A 4MRPA 1WE2A 1HYQA 1NMXA 4EPRA 3PEWA 2QM8A 3SE0A 4MGKR 4EDHA 5SZKB 5HZHA 2GK7A 3MSXA 5L8VA 1CU1A 2GBLA 2WJHA 5DISB 5FUYA 1L4YA 2R6FA 4LYHA 4A2QA 5FOXA 3LW7A 3K53A 5LD2B 3DVLA 1OXSC 4EPVA 4FI3C 5TARA 5F3WB 3VR5A 1ZNYA 2BBSA 3T1QA 1XEFA 1YHNA 4D25A 1X86B 1ESNA 1I2MA 4Q4HB 4P0TA 2Z4SA 1BYUA 4TN1A 3CLVA 3U7EB 1E1QD 2J7KA 3T15A 2W2VA 5FPHA 1TAGA 2P67A 3GLIB 4JLKA 1II9A 4LJ8A 2X1VA 5KDLA 1ZD8A 4GMDA 1CJVC 1WCV1 3BH0A 1IHUA 1Q21A 3VR2A 1KHTA 4MYCA 4DLZA 4J0QA 4KYUA 1NLZA 4L9SA 2V1UA 1KMQA 3HU3A 3R20A 2XXAA 3DO6A 4EPXA 2R6GA 4JL8A 1XCPA 4DCTA 1CRPA 1XU4A 5G3YA 2Z4RA 5EZ5A 2XZLA 3TAHA 3IGFA 1SQ5A 4DCVA 2O8FB 1KI6B 1K6MA 2O8CB 3ZQ6A 1OW3B 4ZDIA 1E9AA 1Q22A 1GILA 2OBMA 4OQNA 4DBLC 3LRPA 3VR3A 4PHTA 4Q9KA 3AF1A 5CDFA 4A1FA 721PA 2V8OA 3IKJA 1W4CA 4M9QA
chains in the Genus database with same CATH superfamily
5D3KA 3MIZA 3OTGA 1DBSA 2D06A 4KWCA 2YJ6A 5BUSA 1V8PA 4US1R 4MLPA 1O4VA 4ZI3A 2E3JA 2NP7A 4YCDA 1C30A 1KC1A 2B4KA 4CW7A 3KQLA 2OGZA 3HJUA 3BSWA 2WWFA 3QKIA 3PNLA 1L5VA 3SZLA 3BT7A 1EGQA 1IM8A 1Y7LA 4AW9A 1ZD2P 4CTOA 5KKNB 3KQPA 2D3TA 1NWHA 2P5TB 2OFWA 3ACBA 4KDFA 4XAQA 3TKAA 5JLJA 1V4NA 5HIIA 1DC8A 2H4FA 4UDOA 3AF6A 2Q9CA 2OCDA 3CX7A 2WR8A 1NXXA 8OHMA 1KK2A 5DNCA 3KL2A 4JXJA 4EFDA 1PD0A 3H2KA 5JJIA 1KEWA 4P5EA 4DBLE 4CN9A 5BSWA 3U44B 3GY0A 4E22A 2ZQZA 1TGYA 3OU2A 4R7ZA 3RWBA 3BSFA 4ZANA 1GT6A 1Y5NA 1CUHA 3BDIA 5JCZA 1W7AA 5IAGA 4KQFA 3KUCA 4UEQA 5INTA 2OCGA 2J59A 4RF5A 2BFBB 2DOKA 1DHTA 4I5IA 1U31A 2F43B 1IWPB 2D1SA 2HRCA 3FFTA 3L1HA 4TWZA 4XCQA 3UBMA 3SF8A 621PA 5BWLA 3M6WA 1EUDA 3TQSA 5C1IA 2JIZA 2ODQA 2D2VA 4FZJA 5TMBA 3QV2A 1ZGZA 4IF6A 4OHMA 5BWBA 1BA3A 3TX2A 2A1TR 1NQXA 1X74A 3OETA 4DA0A 4F1WA 4DDTA 2ETVA 3E1GA 2XVMA 1T8WA 4C0XA 3SQXA 2BONA 1JYEA 3BC1A 1L4GA 3HE3A 1VBNA 2VK2A 3DD5A 4KGDA 1XWWA 4GBJA 4Q5IA 5KYWA 5LP6B 2HK7A 4M1ZA 4M1MA 4ETNA 2J3MA 2GZRA 4P4SA 1PJRA 4X1YA 3KDSE 3VYUB 1Z0UA 2EZ8A 1AF7A 1JU4A 2PPLA 5G40A 1SGWA 5KYUB 1N1DA 1T9DA 1MIHA 3CKYA 3G8AA 4K9PA 4YXWD 5JFGA 3NCTA 4TXLA 4MWSA 1P18A 1XXHB 3ZD6A 4U0KA 2GASA 3SYKA 1CP3A 1W6RA 3VZDA 1E0DA 4NBSA 3H2SA 4X1IB 2ERXA 1JDVA 5IASA 3EPKA 3PUWA 3WWOA 1ZJWA 2CWDA 5K3AA 1HG0A 4WUTA 3I4CA 3E9NA 1G6HA 2ZI7A 3UENA 1NQVA 4K9MA 3UK6A 3S8MA 5KVSA 5J4LA 3JQBC 5A6SB 1CUIA 3RU9A 3UEOA 1TE2A 2AW5A 4W1RA 3MRXA 4EJ0A 2V7UA 4NMWA 5JOQA 1TYDE 2UKDA 4FKBA 3G9XA 1WPQA 2ZRJA 5DBIA 3SZMA 3BTSA 1SC1A 1YF3A 1QYXA 2XE6A 1A88A 3A9TA 2J3JA 3WE7A 2OCIA 1NFRA 2XUKA 3NNNA 4MUGA 2P41A 5IUNC 1V16B 2XNHA 3HUDA 4RVOA 3AUAA 5LCXA 3PJRA 3RSQA 2Q6OA 1JHRA 2R7KA 1H0KA 3GYBA 1ZLXA 3O4FA 4HAXA 1NVEA 4UPEA 4M83A 1S1MA 1P7YA 3EA0A 1PFUA 1BWRA 3PGLA 4JT9A 1SIBE 1SKUA 3N0WA 1SBCA 2ZSEA 3PCRB 1AS3A 3W6UA 4JYBA 2PHZA 2YYZA 3QKWA 3ORSA 4ZMSA 3P2JA 4PIVA 2O8BA 1V96A 4Q6WA 5KTYA 3GFQA 3URMA 1DBPA 4GMGA 5EP1A 3MAAC 2W2KB 2CF5A 1RLMA 2GPJA 3PWKA 1BXKA 4N6GA 1JQ3A 3QVKA 3CV3A 3NLLA 2G1UA 1B3BA 4Y2SA 3ABRB 5CNJA 4HDRB 4JLJA 3BBLA 3DWEX 5TNXA 4ER7A 1RLJA 2XYGA 4ICIA 1QDUA 1VHTA 4GFDA 1FFAA 2OFPA 2R7LA 3GJ0A 3AJDA 1APBA 1LFDB 1SCUB 3QVLA 5CFOA 2C3YA 1KAGA 1C7RA 1QE3A 4CLRA 4Q34A 5TQ0A 4KREA 5I48A 4MUMA 3QE9Y 5TQ2A 4FE7A 1P33A 4BRWA 3VO1A 2A33A 2G67A 3GDWA 3KXIA 4P3PA 5IT9A 3I0ZA 3BRWA 4H1UA 5PGMA 1VLJA 5AVUA 4KR0A 4AYTA 1HFKA 1IY1A 5FLKA 3UT0A 4BBZA 2XGJA 3AI2A 1M1YA 3N2KB 1YUNA 3RS2A 5REQA 4YUWA 2XUAA 3WGGA 3D7NA 5JZSA 1KY2A 1FQKA 2Z1MA 4LZZA 4FDAA 3FOZA 3A2NA 4JNKA 5DZSA 4CM4A 2C78A 4Z0PA 3C6XA 4TTTS 1GSOA 4UUOA 5E3HA 5HRAA 5IT5A 4WY2A 5EJ8A 1UKAA 3OWHA 2O05A 3S2SA 1KAMA 1YFZA 3TPFA 2VSOA 1F8GA 2BD0A 1DNPA 4JYCA 2QQ0A 4UQLA 2VC2B 5ALMA 4YCBA 3TBHA 3OZIA 4LOAA 2L19A 3V4LA 4B85A 4BGUA 2XUOA 1OAOA 2A2ZA 1NOIA 3AY6A 5JQGA 3O8QB 4NYIQ 1QHHA 1RYNA 4GGMX 4PLTA 2C2KA 3O7WA 2UUCB 2OAQ1 2QRMA 1FRZA 3CWZA 4PYQA 4GUDA 3G5AA 4YBZA 3PIDA 3EIOA 3EIFA 1Z63A 1Z8FA 3MN1A 4FSHA 5JC1A 4ZCTA 5KX5F 2WJ4A 3WL6A 1RBMA 4AZSA 2J1LA 5L3QA 3LUDA 2NU9A 5M29A 3BWXA 5K6TA 4MKGA 4QXPA 2AB0A 5BV7A 1NM5A 4ENTA 1WMDA 1VKOA 2WZBA 4E0BA 2VQSA 2O19A 4NNPA 1SCBA 2ZSKA 4Q66C 5CHEA 1J0AA 4IW3B 3NG1A 4NWIA 3JARB 1BE0A 1IBLB 2QP3A 4IJ5A 2EJUA 2JZNA 4BLWA 3EXIB 3PVCA 3ETGA 1GRNA 1Y82A 4MW4A 4KQ2A 1KY5A 2WU3A 2FPGB 3PYXA 2WU0A 5BV2P 1HQDA 4HNAA 3HBFA 2BHTA 1AS2A 3GRZA 4PFSA 4KI0A 5FTKA 1FDIA 3GJ5A 4BZWA 4C87A 5BR8B 1ESZA 3NFRA 4NMHA 3PDHA 1U0TA 4OXXA 1AUPA 2Q5CA 3E6AA 5BSGA 1MZVA 2DWUA 1FXUA 3BE6A 1RFLA 3MD9A 4ZT3A 3FVTA 2VDMB 5AUOB 3LTNC 3HG7A 4IQGA 3Q98A 3G9UA 1QHIA 3B1YA 3R6WA 5B37A 1UWCA 4URUR 2Z6AA 2B8NA 3B7PA 1E1NA 4OX9Y 4ALNA 2I1VB 3IHLA 3KKKA 3BXGA 2PL5A 1PSZA 3U13A 2VF2A 2O2EA 2XNSA 4Y9UA 1N7IA 521PA 3GJSA 5KWVA 3OLCX 1H2WA 3F4BA 4OA5A 4X0EA 5B64A 2XCQA 3ZGZA 3L5KA 2AXPA 1RYMA 4KXXA 1T2FA 3RV4A 5JDCA 3TLXA 4OJYA 5LQMA 2C07A 4XIJA 4N7MA 1QHXA 1TK2A 1XIVA 2QIPA 3NYQA 4XFJA 2GAIA 1UM8A 3MCTA 2NNLD 2Y66A 4ZOQI 1N8NA 2CD7A 2PDAA 3K7EA 3PL5A 1QG6A 2IELA 4WLVA 5DX8A 4WA7A 4GD3Q 2QQ5A 4YRDA 5FLYA 1O2DA 4LY3A 1PGQA 2BZ0A 3GI1A 4ESEA 1Z15A 1H2ZA 3CG0A 3GVIA 1TJ5A 3E4CA 3AMVA 5KX5B 5BV1A 1K68A 1DWQA 1RHUA 3IPCA 4FFRA 4LK2A 3A1VA 4M7RA 2BSXA 3W04A 2W37A 4MVJI 2YCLA 4D8YA 4IVRA 4R31A 5FBHA 3EFBA 2E82A 1YQ9A 1I0LA 4PR3A 1KO5A 4BKRA 3PLRA 2WT4A 4IZHA 1WZCA 2FWMX 1B93A 2PX5A 3C5CA 1ZL0A 4E33A 1TCVA 3PC8A 4C7BA 3ELYA 4CI9A 1I4LD 4X65B 1EDEA 3ERCA 3N75A 4RADA 5DGHA 1M5TA 2A0XA 3ZU6A 4RTNA 1O0CA 3BCRA 3G7UA 3K0BA 4QQRA 1S3SA 2H1FA 3HXTA 4N5DA 2Y0PA 4H1HA 3GP5A 2HO4A 3IT2A 5AK6A 3IEMA 3U39A 5K8LA 1IZYA 1O95C 1ZO8A 1FDRA 2VTEA 5FNZA 3QFFA 4UZEA 4KG7A 2CYAA 3H9UA 3OPYB 3MWJA 1OQAA 2QW8A 2HSGA 3TAUA 1U6IA 5IHXA 5JH7B 3R0IA 1SIOA 2B37A 4LX8A 4L0MA 3UUFA 2XEXA 1B26A 2R00A 4G5HA 4QHYA 3W2TA 1YFKA 4PZZA 3B6MA 3L40A 1J97A 3BK2A 1SHTX 1PP4A 2UYQA 4WRRA 1FFBA 1M72A 4G1FA 2H8KA 1YAHA 1Y9JA 4MWEA 1ZXLA 1F2TB 4M8IA 1C1YA 4DARA 2XTZA 2GT1A 5E6UB 4S35A 2R62A 1LPPA 1ZA2A 2K7ZA 2RHLA 2W2OA 5G1OA 2PWPA 3RPEA 2XA9A 4HZUB 3DE0X 4O5AA 4CPDA 2A0FA 2Y0DA 1YZUA 1XEXB 3D31A 4LGYA 4KXWA 2HRQA 4ER0A 4KFTA 4IUCS 5AKXA 2IEAA 1AHIA 3FYUC 3RUCA 4HNUA 4H3SA 4CLHA 3GLGE 1CYDA 3I1YA 2E21A 1SUFA 1DQZA 3IPLA 5IK2A 2WP0A 4PG4A 1WM1A 4MQLA 5HP4A 3E48A 4O6VA 4KHPB 2QI9F 4KK4A 4U6NA 1E20A 5GZ3A 2PK3A 4QXAA 5ESDA 4EF5A 1KVSA 1STOA 1L5HB 2BRUC 3E0XA 2EZTA 3EGXB 1Z74A 4P86A 3B12A 4D9IA 1Z33A 1THMA 1WR8A 3E2MA 4EI8A 5FYDA 1N0IA 1DIRA 4PPGA 1J70A 3ZDRA 4E88A 4JGIA 2NXJA 4N65A 1TZCA 5DHPA 1SBIA 5FPKA 1JHQA 1BEEA 2HSDA 2R65A 1DWUA 1G5IA 2JHPA 3QEOA 4U2GA 5EKXA 3H11A 4HNQA 1JFFA 2FMTA 3A28A 5EXPA 1XWIA 1MG5A 1TJNA 3ORYA 4RMNA 3NXKA 3LFTA 2X4LA 1JKJB 4TMTA 4NARA 2CKDA 4EIWA 1BCSA 4BFXA 4MXDA 4UBJA 3AFIA 3PV0A 2GHQA 4CODB 3EQZA 4RNDB 4CQJA 5LQNA 1WHSA 4F8EA 5JSFA 1WXWA 1UODA 1OFUX 2H1WA 3EVFA 4RUKA 2QRHA 2V5UA 1OZGA 4S1OA 3SOZA 3VMMA 2Q1UA 4EKDA 2ODPA 1XD9A 1JAZA 2PX0A 2V74B 1XP5A 1YZ3A 4OQQA 2RHDA 3I4FA 4KLAA 5IBPA 4KQHA 2WIFA 1UXOA 2KW5A 2ZBFA 4ZZ2A 3RC7A 4LE0A 1O6GA 1WPXA 4RJ2A 4XW2A 2R751 5K0FA 3EXHA 1YE3A 3WRWA 3HJAA 2VAXA 3VNQA 1HOXA 5FA5A 5IDXA 3PJFA 4J4BA 3K0EA 4NV3A 4NF2A 4TMKA 1I1QB 1VHDA 4LV6A 4V38A 3CU5A 5CVUA 5EIHA 4YR7A 1M7HA 4L73A 2XOKD 1C2YA 3OQPA 3I04M 2BCEA 3LXUX 3OT1B 1KYZA 4OLFA 5C7IO 2QT0A 2N42A 1KP9A 1RWOA 5DDIP 5C4IA 3AM5A 3D4LA 4JJGA 1O4WA 1I36A 2FLKA 5M04A 1FFXB 2R87A 3QPVA 1FNBA 4C0JA 3JX9A 4F38A 1C41A 1D6MA 1QCYA 4U2EA 1ZH8A 1SKAA 2G6TA 4UUBA 3TTTA 1CD5A 4BNZA 4D4IA 2FEPA 5EY5B 1GVHA 1K6EA 2JAUA 3VM6A 1E2UA 4YT8A 4HYEA 4MR8A 2DLNA 3EHEA 4M88A 3S4YA 1U7UA 4NLLA 4NR0A 5TDHA 1EE1A 1Y8ZA 1XMPA 3UZUA 4OM8A 4BBAA 3UCFA 4I2NA 4YJ3F 3R7NA 4BX9A 4L02A 1ENPA 1YB6A 2FEWB 1HMPA 3O4RA 4EJ6A 5MN4A 4HEHA 3K6SB 3LLUA 4S3MA 5H5JA 4OLJA 4BVFA 4DLTA 3L6RA 2P75A 4BC0A 5IPFA 1OYVA 2IYXA 1SR8A 2AMYA 4NZOA 4KLCA 4R3WA 1VJTA 5C52B 4YJ3B 3G49A 2EGHA 3CRVA 4FI3F 5F9FA 3K70D 2AZ4A 4GPEA 4X93A 2CV1A 5AW1A 2NW6A 4BMXA 4KE8A 1ORVA 2JD0A 1TO1E 5TQVA 2X19A 1OLSB 1NJGA 4G0NA 4I14A 1VHJA 4XE5A 3R44A 5ELXA 1O6BA 4X66B 4ETMA 2OLKA 2D2EA 2XWPA 4PICA 4XSGA 3F96A 4D79A 1O0SA 4K03A 3HCAA 2CNWA 2Q3EA 2VTKA 3LDAA 4U7JA 3VR1A 5JY6A 5HK8A 1PUJA 4CL0A 1OC4A 1YACA 3K4PA 1H5NA 4KNWA 4ON9A 5K4AA 4YDHB 2CE2X 1Z5PA 1YWGO 2H63A 4IICA 3BIXA 4QASA 2WKQA 3LI2A 2YJ3A 3ROKA 2A9JA 3OPMA 2VJAA 5GJCA 4YC7A 1PV4A 4Q93A 1DIOB 1NONA 5EUMA 3R6DA 5CP8A 4IJQA 4XIFA 3ZU2A 4S2EA 3I61A 1WQ1R 2W00A 4UHKA 2BGGA 1NAIA 1XAJA 4O0MA 3U7HB 3IEPA 4TTJA 3HACA 2C3OA 3FYTA 3MAGA 5JG7A 2OMEA 3GARA 3TMYA 3OUTA 3DBLA 4Z8YA 5F35A 3PQ4A 2HMYB 2QS9A 2ZJ0A 3CX6A 3F6RA 3GLQA 1JSZA 1WW3A 1HETA 5GIPE 4O02B 2BFAA 3P5SA 3Q6NA 4HDMB 1BDIA 1W2HA 3RR2A 3DVSX 2YWFA 5DIZA 4EG4A 4Z54A 3W1WA 1JJIA 5FCDA 1K5HA 1FJHA 2JJMA 3JSAA 1A8UA 2F48A 1XNHA 1E9RA 1YZKA 4EECA 3ZK7A 4RESA 1P4RA 1HDIA 1U7TA 3GLHA 4NP6A 1DQSA 4FNOA 3IUJA 4QXOA 2J67A 2QDXA 2PGAA 1XTTA 1G9TA 2BM1A 1G3UA 4IHAA 4DIEA 4Q01A 2B35A 1LX7A 4RABA 5AQEA 5EP4A 4M87A 5CGQB 1W4AA 4FYPA 3F6BX 1S3FA 3O4HA 4NE7A 1AGXA 3NYWA 4J9UE 4BJ1A 2AD1A 2QW0X 3C5VA 4YJFA 1Q44A 3U7RA 1UT5A 3LVQE 3I6YA 3I1JA 1P29A 1PNVA 4MNTA 5HG0A 3SQLA 3D3WA 1SOAA 5KOHA 1AK2A 3CNOA 4FDTA 1A97A 3KB6A 1HG1A 1ID1A 1DJMA 4X24A 1AGPA 3AW9A 2QZ4A 3D8UA 4YASA 1XNRB 4C4XA 2QL5A 2VT2A 2XB4A 2YXPX 3CKMA 4CMIA 5D51S 2V5VA 1Q17A 4LHZA 4V2UA 1GM5A 1HPLA 5DYTA 3NWEA 3QWFA 2J3EA 4GEGA 4JQZA 1N3BA 3QVOA 3BDVA 3WLRA 1MN6A 2J87A 2MYNA 5EIBC 4IJVA 1X7XA 1GTSA 2SHKA 3M6VA 2X8LA 2F4NA 5E4TA 5H83A 5IW8A 4OHCA 3RGWS 1QFSA 4N49A 1CG6A 3VX4A 1W0JA 2D2IA 5K5EA 1R0YA 3FF4A 3JQGA 1FJGB 2HJVA 2L2QA 3IQIX 4DDMA 4JQSA 3AKZA 1W87A 2JGDA 4IMJB 4NHOA 2WVAA 3DL7A 1P72A 1G2QA 4V24A 3CVXA 1JH9A 4RM2A 2BFNA 1M34E 2WTEA 2OFXA 5LC1A 2GVNA 3L41A 3G9TA 2I67A 4JJEA 5P8WA 1NPYA 2WNHA 3STXA 2N75A 3W5HA 5FWYA 1JFSA 4MA5A 4ZHQA 4IIJA 1LLDA 3H5AA 3GH3A 4P1ZA 1F0KA 3I5AA 4R7GA 2YYAA 3ZIAA 4F6LA 4MQ5A 1MUUA 2NO6A 4E11A 3ZWOA 4QDUA 1L7OA 4MWBA 3VZQA 3PGKA 1PJSA 2ZUDA 2A9FA 4E15A 2OLJA 2I03A 3S44A 4Q24A 5D3QA 2A92A 4CJXA 4D3FA 1S7CA 4WAUA 5BN3B 1CRQA 4TWAA 1TCCA 2R8YA 4OO3A 3B5JA 1HSOA 1Z6TA 3NIBA 5JUWA 3ZK8A 4LXHA 1JEYB 2O6HA 4X95A 5DLYA 3WK4A 1WD7A 5A04A 3LVBA 1P4JA 2Q0HA 3IAHA 3GT3A 1BE8A 3Q0EA 1OX4B 4KTTE 1G21A 2BP7B 2GHIA 4N12A 3NBXX 4NU6A 2Q6VA 1Q2XA 1YI1A 2CHEA 3PEUA 4WEQA 3TQHA 4KJXA 4LNHA 3IR5A 3R5SA 4S0ZA 2OFFA 3B1JA 3ZWNA 2HSEA 4HCJA 4K05A 1UPAA 1PZGA 2YX1A 3HU1A 1U3UA 3DAGA 3RFUA 1QRDA 1XTJA 3TL6A 5A4JA 4FS3A 2HC9A 5KQMA 1EG7A 2RH9B 2GM9A 2VDUE 3EZXA 3UA3A 4I6JA 3L0PA 4P36A 3V55A 4RSRA 3GFVA 4IILA 4PLGA 1YC2A 4FEGA 4DSUA 4KH1A 5J3JA 3HRKA 4RTKA 2V54A 3RK4A 3SBXA 2WIKA 4ZVTA 2IX9A 1JVNA 3PPYA 4UNPA 3AVUA 3OX2A 1X9GA 3EZ6A 4KAAA 3CKLA 3PUJA 1RABA 3OE5A 1IMJA 4LCBA 2I2CA 2OP0A 2WFMA 3CNHA 2OVBA 5K2MA 3R9IA 3ZH9B 4B4OA 4EAQA 1GQRA 2I4OA 3R09A 4B73A 3ZZ1A 1CF4A 2WMNB 3IVCA 2VUIB 2IV7A 2AFIA 1YR8A 1BN7A 1USUA 4ZCPA 2XT9A 3ZTTA 4BRUA 2QTMA 4O2BA 4ZYLA 5BSVA 2OEPA 5LDDC 4P32A 4IIXA 2FQWA 4R1TA 1CTQA 2EWMA 1LSJA 2G7ZA 1E2NA 1QB7A 3CJQA 1R0XA 3P9QA 2CNBA 2FAXA 4IMPA 5J47A 2XXBA 5LWHA 3PK0A 3F0TA 4G9GA 2FFHA 4HUJA 1MENA 4TVBA 2XMPA 2Z9DA 1UIMA 4XQ9A 4D82A 3MCWA 5FUXA 4B0OA 4V0RA 3BA6A 3UFXA 2QB5A 4JX8A 4Q7KA 4YXWA 4CKXA 2BGJA 3CA8A 3LSTA 3FTEA 2JFPA 1WKBA 3A2KA 2BI8A 2CCGA 3A2LA 3VO9A 1GLGA 4HVLA 3KPVA 4Z7OB 2YXDA 3K32A 1Y5LA 1A04A 3SYRA 1RXYA 4W6ZA 5LYJF 4IZOA 1YR6A 5AHKA 1MVNA 3KZOA 2PZJA 2QT9A 3T9BA 3B3GA 3NWJA 3WGYA 3AY0A 3B78A 3TW0A 3PNQA 4DQ0A 2QD2A 5CDSA 4AM8A 4ZT5A 1TOAA 3EZGA 5AM1A 4HDRA 4XQEA 5LYJB 4BUZA 1UXGA 3MRSA 2Q99A 5D5HA 1HM5A 1ZUNB 1C30B 4Z3KA 4GI5A 3B85A 1BROA 1XI2A 3GFPA 3BK1A 1J7JA 5TV2A 4CKZA 5FBQB 3AW8A 3QELA 4Q1EA 4XH9B 2CLIB 2GAOA 4KAXA 3BFXA 4M38A 2YC4C 2CBXA 1GAXA 4LHSA 1UP7A 3LYUA 3NTRA 5YASA 5EWJA 4Q6BA 2XKJE 4D98A 1ECJA 3LUFA 1V8FA 3DJFA 1VE6A 2C4VA 3FCXA 1ECGA 1KZ1A 1NSFA 4DUPA 5B6JA 3CTPA 4IVQA 5H80A 3VUFA 3I12A 2VIIA 3D7SA 3CYFA 1TW2A 3H5LA 5ADUS 5B55A 3S81A 2HWYA 5AQ1A 1B8PA 1A8HA 1Z5WA 1EGAA 5I7OA 3HJNA 3IUEA 3A6GA 4L2IA 5C8DA 1Q7GA 1QH9A 3B3FA 2RGCA 2JARA 3HUEA 4JWTA 2GTIA 3I72A 3OPQA 3WWCA 3G1TA 3UMMA 1EE2A 1R16A 1L5LA 1H6DA 3IE2A 2BPOA 3D6VA 5E8JA 3TOCA 1EUDB 2UYGA 3QYJA 4TVOA 3WYBA 2J4FA 4EB6A 3JAWA 2EKQA 5T5QA 4ODIA 2BTOA 2F90A 2UZ0A 3I2FA 4FWIB 4H17A 5JVDA 4DIUA 5JW6A 1X8XA 3C8DA 3QX3A 1U81A 3ROZA 4Z9FA 2YIDA 1Y63A 3LCVB 1UCFA 1VPEA 3ICOA 3V2HA 5KYWB 1FPMA 4EMTA 4QU0A 2OBYA 1GZHB 1S8FA 1WXFA 1H23A 3KOZA 2RH8A 4P4SB 4QQ8A 4X1YB 1THGA 3UTDA 2AXQA 5ABPA 3PNVA 4LYAA 4V39A 3MERA 3ZW9A 1DT3A 1WLSA 1A7AA 1O1YA 2W6CX 4HEA1 4HXFB 3OQVA 3A6DA 4KUEA 3Q8LA 3EQ9A 1EZ1A 1O6FA 4U00A 1USGA 5K05A 1AUVA 1QIMA 3AR6A 5K8JB 1XPOA 4Z0TA 3QG5A 2D1FA 2P30A 3BSSA 4I1YA 1CHDA 4GOMD 2DHCA 4XASA 3C3XA 5DNEA 3ZGOA 4DTIA 5FX2A 2PT5A 4BCBA 4B7XA 5EHXA 1QIIA 3M6FA 3PQ2A 5JTUA 2FDXA 3ZH2A 4BMCA 3PZBA 4L76A 1C8BA 4PC2A 3LU1A 2WNIA 2J46A 3K2EA 5AOVA 2AV6A 4C4YA 1JPUA 5GGXA 3ZY5A 4UBLA 1J22A 2F1HA 2IZ7A 1YB2A 2FUNB 4PGMA 3ZX5A 5IKOA 1A1VA 1GIAA 4M8NE 1D6JA 5CITA 3BH6A 1OB2A 1X2BA 4RH3A 1C9NA 4BNFA 4EUKA 4MHSA 4XGRA 4A73A 2QPTA 3UICA 2XQGA 3WWDA 4B87A 3T1HB 1QH1B 1P5JA 2BGNA 4AMGA 1GPBA 2RGBA 2MHCA 4RLQA 1KEEA 1I8TA 2QN8A 1LLFA 1P9OA 2E6KA 2QQFA 2YMPA 4O4HA 3U7JA 4YP9A 1PGOA 1M7BA 3K94A 1HE2A 3OFSA 4DR3B 2QRVB 1PL7A 3BE4A 4Y1FA 4FYJA 3TOVA 1E4YA 2QN9A 1OTYA 3UJ7A 1WB5A 1EMDA 4WNIA 4OIMA 1UPUA 3S0JA 2O8BB 1IFXA 2VKTA 2YZGA 3K0SA 4AO7A 3GG9A 3JZMA 2WSSD 3I1FA 1AZLA 1HC7A 3PXDA 1N4AA 2YXNA 1QO9A 3BXZA 5KKCA 1H2HA 2YICA 1U8CB 1P4GA 4DR7B 1HFWA 1M33A 1A7KA 2WKSA 2UYOA 3ZE9A 3ND8A 5JIBA 3GZTB 3NAZA 4ITVA 4E2YA 4JP8A 3FW1A 2HBYA 2B1IA 2DM6A 2CFCA 3L49A 3N0XA 1VCIA 4CLRB 4E94A 4PZYA 5TQ0B 4POOA 1RPNA 2ZBQA 1XCBA 1CQIA 4TXJA 2AKAB 5TQ2B 3KZ1E 3BMQA 3MAJA 2QLNA 4UTOA 2REOA 3AL0C 1F4VA 3T1OA 5JAMA 1PR5A 2DR0A 2CBZA 3RU3A 4NMMA 2PANA 3ZXYA 3T4UA 1I80A 3KTDA 4OB6A 4ZJPA 2AEMA 1E3WA 3IHTA 1M1YB 4H4EA 5EWLA 5F3RA 5FBZA 5REQB 5TT0A 3VR0A 3JU3A 1PUXA 3MBKA 2IZ1A 4AIIA 1JKIA 1SD1A 3OD1A 1NT4A 2JFYA 1ICEA 2W2NA 3A1CA 4I4IA 4RZUA 5H0IA 4DLYA 4EB8A 1Z06A 4YCJA 2XB2A 2RIPA 4OOFA 1PO7A 2ZBUA 4CXMA 4FX2A 4R1OA 4GP7A 1EDOA 5JQGF 5I9LA 4BZZA 4YDSA 4C6SA 2FG5A 2ZJ1A 1RC8A 4CUKA 5FWDA 4WX2B 4RH1A 1JDZA 4JP5A 3HMKA 3OMWA 4CM6A 4CKYA 2VDKB 3O91A 5CDFE 5JQGB 5FBKA 1QHHB 5DBFA 1CUJA 3G7NA 3IUYA 1N1EA 3WGLA 1DADA 2IIPA 3RT7A 4D43A 5TPWA 4L8GA 3A58B 1EIWA 1QVRA 2YWBA 4IVPA 4GMHA 5BO5A 2JZCA 4AZVA 3OE1A 4CMJA 3I53A 3MCZA 1L0BA 1P6XA 3JW8A 2ESRA 3OOHA 4LVOA 2VJPA 4NEGA 3T7CA 3AIKA 3EIUA 3OPYI 4K6FA 2FSFA 2HO5A 2NU9B 4RMHA 4YRMA 5CAEA 3HR4A 3OH8A 3D4BA 1X9HA 1YS7A 1QIDA 1Z5OA 1W4BA 3HVHA 3LS2A 4MIOA 3A6HA 1IONA 4RO0A 1CYEA 3KU4A 3OOJA 3CT6A 1G5TA 3AEQB 3HWSA 4WI1A 4OHZA 3DJYA 1NVUQ 2NSHA 4MGIR 3S1LA 2HT1A 1NUAA 2OUIA 5F64A 5L9AA 3RFXA 4KEAA 1L5RA 1BXZA 3P9NA 3N70A 4X64B 3TGLA 3CUTA 1Z88A 1AIPA 2X1MA 1MBZA 1W94A 1SOMA 4RWZA 1E1RA 1JEJA 2CLKB 3VZSA 2XCLA 3CW9A 5KQSA 4AZWA 3BRQA 1XEWY 5ENVA 4DQDA 1PQWA 3KB8A 3L7LA 3MXOA 4HNAB 3PHHA 4YLYA 2WKRA 1CWUA 3NX4A 4J2HA 2RJ3A 3V7UA 3DVRX 2VZ0A 2ZIFA 3BD6A 4C1BA 4Z1MD 1S0UA 1YV9A 1I2AA 2C5SA 4HX9A 3Q2OA 3ORHA 4UOEA 4YV1A 1UBTS 5DCLA 4U7DA 1SG9A 2FUG1 2OCKA 3P97A 4NOJA 1E2BA 3EPJA 2I4LA 5COAA 4GDMA 3COSA 3R0JA 4KBGA 4O1MA 5JAPA 5B7NA 4IDEA 1ZPDA 3A4IA 1U8EA 4LDRA 1CUVA 1W5FA 3OT4A 3ID6C 1TYAE 4RA6A 4L8LA 4RX1A 3P9IA 3HCWA 2FP3A 1C9JA 1ZAKA 4RL4A 3NYRA 4XLTA 3UWOA 3X1JA 2E55A 1ISJA 1ZJ6A 3AB7A 4IY1A 4Q9HA 4BFVA 1QHYA 4AUNA 1MR3F 4KMMA 2ZVQX 4NV1A 2P9EA 3DZDA 4RF3A 3MUNA 4LRSB 3UB2A 2RSLA 4QO7A 3HP4A 1HDEA 2WI8A 3OFJA 5ALOA 3RTDA 1UZUA 1B00A 2YH2A 3TTVA 4D0GA 4WV3A 4BJHB 2AWOA 4QBGB 4DG9A 3CR8A 1KWKA 2QVXX 2XH8A 4EBBA 1X7WA 3L0DA 4GKKB 1XZIA 4I5GA 5C34B 5KHOC 1D0VA 2JBAA 3O3CA 4PGFA 2GH1A 4HDNA 2PMWB 1OTXA 4B3XA 1BU8A 1LBTA 1AZWA 4RV4A 4HYQA 3A8TA 1R0CA 1D8TA 4U63A 1PUIA 1R66A 1VTKA 2PUWA 1SXJA 1G8GA 3IMGA 4OJKA 1RSZA 4LYFA 4ZYVA 2NIPA 3VVMA 4FTWA 2WYWA 4YLEA 1FRNA 3EC1A 5AM2A 1KI3A 2C9YA 1CVIA 5CA0A 3BMCA 1IUKA 4EYQA 2CT8A 5EI5A 2OKCA 1CR6A 1AQJA 2I7TA 2XQVA 4QQFA 3ZKWB 4ZTBA 3CLUD 2CFSA 3K8YA 4EG6A 3AUFA 1TMOA 1QO0D 1AKEA 3AL2A 3GHHA 2LW7A 3OJ0A 3GK3A 4QNNA 3ZYZA 3BFVA 2DQKA 2PMEA 4GLFA 2JGEA 2PM8A 4LRYA 4DY4A 3KDPA 4N0DA 3L4SO 2OQIA 1DB3A 1DX4A 1T2NA 1FNNA 2VSXA 3AK4A 2CXOA 2OO3A 3M49A 5ALJA 2Q6IA 1L7EA 3KXKA 3RTEA 3FH0A 2Q5QA 4F3CA 1ANKA 3H2BA 3FZGA 3PF9A 2DQ4A 5KJEA 1Q19A 3JQ9C 2JFXA 3ZVKA 4M8KA 4IZ6A 1JLKA 1N9GA 3H04A 1WJGA 3PNSA 4R1NA 5U9CA 5JD4A 3WWYA 3T52A 5FQNA 2RKBA 1LXCA 4G4GA 2Z3ZA 3NXSA 5EIOA 3L7IA 6CHYA 3ZU5A 2AX3A 2O1WA 3A3YA 2NV2B 2AJ8A 1Z62A 3TI7A 5EWMA 4E5KA 2W0MA 3HJGA 4CM8B 1B23P 3VR4D 4BIIA 2A9VA 2AMJA 1E0SA 1KY4A 5DM0A 1N77A 2IV3A 3DOCA 3KPJA 3RRNA 1BHO1 3NBMA 1EH5A 2E5WA 5HPYB 2O7RA 2FF7A 1NZJA 1OLXA 1NC3A 4LMRA 2PBZA 1OXTA 1H85A 2H3HA 5LZ2A 4KZKA 3T95A 3RARA 1JMKC 1KTVA 5JBQA 3UIEA 3JAMA 1EP1B 5MGBA 1GZUA 2PD3A 1ISSA 2RAFA 2X8JA 4E4RA 2WTBA 4QT0A 4QJ5A 2Q7XA 4HNTA 3KSMA 4C9BA 4QXQA 4AC9A 3P5BA 1Y3CE 4OATA 4ZXFA 2W22A 5E6SB 4CKWB 2NP6A 4B2LA 3N7TA 1Z2EA 2Q3FA 3GO4A 1WUHS 3GUHA 2J0EA 3PQ7A 3HBAA 4HNSA 1IU9A 2D5CA 2V7XA 1I24A 3A4TA 5C5DA 4EM6A 4RY8A 1E2DA 3KE8A 2GNPA 1MT3A 2HQBA 3RC3A 3G9ZA 3O9VA 3N0RA 1CW2B 1T6BY 1OCEA 3L77A 4JI2B 3SDSA 3WA6A 1T3SA 1JFFB 2BSAA 5ALGA 1XCMA 3VNVA 3WMXA 2NQTA 1YI8A 5BW4A 1K2WA 2PRYA 5BXQC 3FBTA 2B20A 3LNTA 4CR8A 3V7FA 4TVKA 4KTVE 1FNSA 2L17A 4AAYA 1BCSB 4M9SA 4PZPA 4PWYA 4B5KA 5LMCA 3NGXA 3NANA 5ULLA 3CS3A 2GYUA 1X3SA 2I71A 2WIAA 5EJAA 1UOEA 1XJWA 1P61B 1M6HA 2P2DA 2QLMA 1WHSB 2MYUA 3HU2A 3N2GA 3CSUA 3HBMA 3MF4A 2PSFA 4LZJA 5JANA 1NT2A 1E5QA 5IYZF 4DMFA 3X1KA 3PQCA 2ZJYA 4PYJA 2AOTA 1ODIA 1ZD3A 3H6GA 5ETJA 1SOVA 3D7MA 3NOVA 2V96A 3AYZB 3ZHBA 3O0TA 3SS7X 1N6RA 2O2HA 4W8HA 3CR7A 4NHEA 3VSDA 1Y3IA 1G8FA 4YAJA 4Z4HA 5HEKA 1R1DA 1N2JA 2QLJA 3EXHB 1ISHA 3PKZA 4QOJA 3RVDA 3SXJA 4L07A 4AF6A 3P94A 4PG6A 3NT5A 1YJ8A 4GZMA 2X7JA 1NULA 1SCAA 2C4MA 2FOIA 2FSPA 1E5DA 2H5JA 3ELBA 5IDQA 2EJVA 4Q3DA 2ZREA 1TX4B 4ZAZA 4FT4A 2Q07A 4F4FA 4YQYA 5JYBA 2Q3BA 1R0LA 5HKAA 2JNWA 4PNEA 3R8FA 3ASZA 3P71T 3ZLJA 2DUMA 1EVQA 5DO9A 5I7RA 2RGGA 5DULA 3VKFA 3JWIA 2ZRAA 4X6UA 5GM1A 3W9YA 4CCSA 5ALVA 2L18A 1WZUA 3RF7A 4YHHB 2PGLA 4U5XA 4MR8B 4M0LA 3ZHVA 4BVHA 2GD6A 3Q1KA 4AWAA 1CXZA 4IIEA 4KXFB 4QPJC 4Z49A 3K0CC 4PZEA 3U4HA 2H4JA 3AF5A 3X2FA 1TM7E 2R8ZA 1W0KA 3VZRA 1BMTA 1H4VB 3JVEA 4F56A 4E07A 1G16A 1B16A 1GPLA 3ZBTA 3GRYA 3IOEA 3R2JA 4A5OA 3ZJ4A 3OIGA 1Z56C 3B6IA 3I0MA 5ALHA 1USVA 2ZAMA 4JJKA 1ZY2A 1HT1E 3BWYA 2ZYAA 4P4UA 3E9EA 2BEVA 2KBEA 3FMVA 1P44A 1T36A 2R7MA 3CVOA 1NJ5A 1Z17A 1DAHA 1FU7A 5FUMA 1Z4IA 2ZJ5A 1T9KA 2E4YA 4NPAA 1GG2A 3ZD8A 1PR3A 3HDGA 1LK7A 3O84A 2AE2A 4EFNA 2FZEA 4PQRA 5EIEA 2AOVA 3HR7A 4ML3A 4B3FX 1UL1X 4U2FA 3GA0A 3OC6A 2PD4A 2XYPA 4V0LA 1DKNA 1G7RA 2IH5A 2II6A 1KXZA 2A5FA 4TLEA 8AT1A 5FJIA 2NZ2A 1FDWA 1Q1QA 2HPAA 2V9PA 2YFQA 2YZKA 3WS7A 4AB1A 5B58C 1OD6A