1RYFA

Alternative splicing of rac1 generates rac1b, a self-activating gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
170
Chain Sequence
GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1b
publication title Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 170
sequence length 203
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ryfA00
1S4QA 2R9VA 3A1SA 5IRCD 1DEKA 3R9XA 2FZLA 4B32A 3CW2A 2PMKA 4HAZA 1QF9A 3SFZA 1ZMXA 4WW0A 5B57C 4ZDIA 1KAGA 1U0JA 1II9A 2WJHA 3GLFE 4DCVA 1II8A 4MGIR 2J5XA 3MJHA 1LW7A 1VCMA 5KSYA 3IHWA 2IXEA 1NSTA 4RD6A 2ONKA 1E99A 4M4SA 4B6FA 1Q20A 3SYKA 2KI5A 4AKEA 1G7TA 1TNDA 3BRWD 1M1YE 4XJXA 2ORIA 3UIEA 3AGQA 5C46F 1DTSA 3QG5A 5EUMA 5J4YA 2J3EA 2VLIA 5KDLA 3MWKA 3T15A 1JNYA 1B0UA 1UADA 1G291 1NKTA 4B3FX 3B9QA 4A1FA 1HT2E 1QZXA 2PLRA 2XTZA 4KVGA 4N0EA 5LD2B 2HT1A 1T0JB 3RWMB 4JL8A 1KIMA 4L8GA 1P62B 4NCKA 1P4SA 1X6VA 3C14C 3KKQA 2ZYWX 3RRZA 1JPNA 2CHVA 2CHQA 2AL7A 1HE1C 3NC0C 4LPKA 4D0LB 1Q12A 1Z8FA 2HCJB 2E1RA 3HYRA 3QIAA 4G5OA 1N3BA 2IA5A 3AQ4A 2Q9BA 4PR0A 3SR0A 1DBSA 2FF7A 4WZAE 2W0MA 3Q7PA 1P3JA 2ZJAA 4CIDA 4XWAA 4BLTA 1NVVQ 1KO4A 3FKQA 4EKDA 2CMKA 5KU1A 4HYYA 1J70A 1F2TB 4NYMQ 1QG4A 1MABA 1JAIA 4C2UA 4PSAA 2XB2A 1CR0A 3CLVA 1NIPA 4KO8A 1R8SA 4TSFA 1SXJE 2Z43A 1EXMA 1BS1A 1G18A 2PZFA 5DO9A 3THXB 4Q7LA 3DZ8A 1HY3A 5E7IA 3EZ2A 2J0UB 4DLYA 1XZPA 3VU9B 1YQTA 2QRZA 2R44A 3BXZA 3ADCA 2ZTSA 1DAEA 4AWXA 2PJZA 2JATA 2B7CA 2KE5A 3SYLA 5FUVA 4MYUA 5BN5A 4DSNA 2VO1A 2ZRFA 1ZUNB 2G0NA 3KXIA 4H1VA 4QGAA 5DLQC 4B3DA 1N0WA 1RVDA 1ANKA 1VHTA 2BDTA 4NE2A 2IUTA 3GEHA 3MRSA 3AF2A 1SKYB 3AUYA 3QPUA 4BEBA 4DZZA 4ESHA 1K5GA 2IEYA 3ZVMA 4M22A 2ZR0A 1XDBA 1XXHB 2MMGA 1A82A 4JLVA 3FHCB 1G7RA 3CM0A 2A3RA 4PO1A 1TUEA 5FTNA 4P4SA 4JLAA 5LB2A 4QHSA 2ZITA 2OESA 3CB4A 1R10A 2PEYA 3BH6A 3K0FA 1XJ0A 2UZ3A 2EU8A 1IXZA 2JLQA 1H65A 1Q22A 4OK6A 2EFGA 2R65A 2XJ4A 5JWRA 5KSZA 1JR6A 3ZH9B 2C98A 4DEYA 3S1AA 4IEIA 1A2BA 2JLZA 4Q4HB 1PV4A 4OHZA 5JI3E 3RS7A 3CX8A 5JRZA 5C4MA 3OE7A 2GF0A 1UDXA 4DDTA 1CLUA 1F48A 1QVRA 3WRXC 3AVVA 4TMWA 3ZZUA 1QHYA 3Q5EA 4U00A 1E0AA 1Z0IA 2PEZA 5EXTA 1TQDA 1G3MA 1Q57A 4FW9A 3THWB 3B6EA 3TUIC 1E2KA 2A5GA 2V3CC 4XSGA 2YVUA 3TVTA 3BOSA 2ATVA 1AZSC 5EXPA 4Z8XA 1UEJA 3HDTA 4Q00A 4ZV4A 1T5IA 1OH6A 3G0HA 1Z6AA 3QI2A 2R6FA 4KXFB 4RKEA 4HLDA 4RJLA 2FEMA 3MAAC 1GVNB 4FMCB 1SKQA 2WJJA 2IS6A 1KK3A 1RYHA 2VP5A 1MR3F 2X2EA 3WNCA 5F98A 4DVGA 1O3YA 3PCRB 4NMMA 1U0HC 1PUJA 4JIMA 4GZMA 3QKSA 2QAGB 2ZJOA 1GG2A 3BB1A 4XIGS 1E2EA 1WBBA 4B73A 2F55A 4QGFA 1B23P 3W5JA 1X1RA 3SE0A 3UXMA 4URXR 1XZQA 4PPQA 1OHHA 2PMDA 4AURA 1YHNA 1E94E 5C18A 3UMRA 1E2PA 3GD7A 3QNUA 2GEDA 1WDTA 2CJWA 1NVVR 2IEZA 4CT5A 4RD2A 1QRAA 4GBMA 4TL6A 2GZAA 4NYMR 5IT5A 4LX0A 3MWLA 1IXRC 3T35A 4TT3A 1NSFA 1SVKA 3FMFA 4GI7A 5JZVA 1MRNA 3IBYA 1UAAA 2CE2X 1QBKC 2L0XA 4Q9HA 1KI2A 2H16A 2WKPA 2IHYA 2IF0A 1R6BX 4IOJA 5TMPA 2W58A 3B9PA 2VP2A 4A8JA 1NF3A 4KFRA 1K6MA 1HQCA 2NOAA 2ZRHA 3GLGE 3P26A 5JWOA 2FNAA 1E9SA 1U8YA 2H7VA 2NG1A 4DCSA 2JLRA 1FQJA 3L2OB 4LJ9A 2E9SA 4I99A 1G3IA 4KLNA 2B6HA 1CIPA 1OFHA 3BFKA 3U44B 4DC9A 1DAKA 3ZJYA 5JWHA 5EJEA 2VA8A 1QHNA 3TQCA 1D5CA 1ZINA 3RHFA 4EPWA 2WSSA 3LLMA 4P31A 2P2LA 2W6IA 4Z54A 2HUPA 1MO4A 1XEWX 4V0MA 2J1LA 4NKRA 1ZRHA 1OIXA 2GDJA 1YZTA 4OI4A 2ASEA 2XJ9A 1ZD8A 1Q1ZA 3KFXA 4JKIA 1QHGA 1IY0A 2WJGA 5FL3A 3TK1A 4A0RA 2NO0A 1LF0A 2OCBA 3PXGA 4M2LA 4B74A 2BJWA 1NY6A 4PHGA 3GFPA 4TYQA 3LA6A 3THXA 2ZJZA 5DHFA 4FWTA 4C9BA 5E95A 2GAAA 1PZNA 2D3WA 4UXHA 5B64A 1RIFA 2D2FA 3TBKA 3BH7A 3TW4A 1AJEA 4LC0A 3RRMA 4G01B 3V4FA 1AKYA 5GVRA 2IYSA 3EPHA 5CIQA 2IHBA 1IY1A 1AQUA 1GIAA 2GTPA 1VECA 4Z51A 5KNCA 4F4JA 2BWJA 1SVWA 1TAGA 3LVQE 2HDNB 4JLKA 3SC3A 3KFVA 1JEDA 2PZEA 3DKPA 1VDZA 3VR5A 1Z0FA 5TVKA 1E2JA 1G17A 1MOZA 4HLUA 2WWGA 1ETUA 1XXHA 4RD0A 2WAYA 1G64A 2ZSAA 4FCWA 2OHFA 1TF7A 1ZC4A 4XH9B 2KSQA 3PITA 1ZM3A 3TIFA 3F5FA 5H70A 1OPXA 2GJKA 3B1YA 2P6UA 3WNDA 4QKQA 4TSFD 3QKUA 4IVRA 3DVLA 1W36C 2FX3A 2GKSA 2O8CB 3SDZA 4PZLA 2XB4A 1YKSA 1AN0A 1KI6A 1X8KA 1T5LA 4P33A 4EPVA 1J8YF 2BM1A 1Z2CA 1U94A 3ND9A 3EW9A 4G3XA 4EPYA 4LBYA 1XP8A 3L0OA 3NWJA 2P5TB 1D6JA 3EARA 3QPVA 3QVVA 2OSBA 4D4KA 4LJAA 1Z0JA 4V03A 1NBMA 4LWZA 3WHKA 3EPLA 4AY2A 3U3RA 4Y0AA 1NJGA 2QNRA 2ZJYA 4TLBA 4Z1MA 4C0BA 1J2JA 2XITA 1VG8A 2CK3A 5CIWA 4HAUA 3THWA 4UNSA 4B75A 2AD5A 2BBTA 3DMDA 5GADl 4BZQA 2DWPA 1P9RA 1UBEA 4Q21A 3SNHA 4PO9A 2XEXA 2EFDB 4GT1A 4GL2A 2ZUBA 2GWHA 3TSWA 4DXAA 4RKFA 2WTUA 4G1UC 2WKRA 4Q1AA 1RC8A 4DJTA 4HI0E 2C77A 3U3OA 2IYZA 1CJTC 1RRPA 4NZYA 1CJKC 2FA9A 2BJVA 4TLEA 1Z6YA 4M1MA 4M1SA 3IHLA 2ZREA 4OI0A 4JBXA 4DT1B 4EIWA 1GOTA 3FFAA 3QQ5A 2IC5A 2FEOA 3M0EA 1Z0KA 2ZYVX 2QAGA 2WJIA 4FMBB 3QENA 5FFMA 5BQ5A 1G5PA 3Q3JB 3DM5A 1YR8A 2GRJA 4MYHA 1S1MA 4ASUA 3CWQA 1Q3HA 3QVUA 4ZO4A 4A92A 2O0HA 4YMUA 1P2TA 3OE7D 5AR1A 5D3MB 4WBSA 1Q44A 1OH7A 1HE8B 5P21A 2HXSA 4QRHA 2WWYA 4FCVA 4PHTA 4C2TA 1G5TA 4F4CA 5L3SA 2ERYA 4AG6A 2C9YA 1AS2A 2FPKA 2WJVA 4P3YA 4RVCA 5ELXA 1ZVQA 3GJ5A 1NIJA 1UKEA 2YC2C 4CDGA 3QJYA 3VX4A 3EIHA 3GEIA 5DYGA 3ZS8A 3U60B 2CEAA 4C0LA 1GNQA 1FMJA 3R8FA 1SVLA 4CEHB 3I32A 3K1JA 2QP4A 3WNBA 5SZJA 2IYQA 2J0QA 2J7KA 2WJYA 2QN6A 2V1XA 2ZYTX 5G53C 1TEVA 4POAA 1XTQA 4KCGA 2YWFA 4C7OA 4IVQA 4AYTA 2ORVA 1F5NA 1FP6A 1OHHD 2JLXA 4GZLA 2I1QA 821PA 3TAUA 4YMTA 3U44A 3GLHB 4NYJQ 5JJIA 4LJ5A 4TQAA 1SGWA 2D62A 2JJ2A 1FZQA 1TF2A 4GFDA 1ESMA 4F93B 2NPIA 1NN1A 1NLFA 4NDZA 3K0CC 1P2UA 1D2EA 2HJGA 4QNMA 2ZQ5A 4Q4JA 4ZKEA 1IAQA 1E4YA 1KI7A 3FMPB 4TT3D 2PJRA 4MITA 1HQYE 4BASA 3EAQA 4N1AA 3PENA 2TMKA 1BIFA 4LYAA 2X1VA 3RLFA 1G3UA 1Z0DA 1OB2A 1UKVY 2IBMA 2DWQA 2J46A 2F1HA 2F1JA 2ZI4A 3CR8A 2EFHB 1KDTA 2B7BA 3AP3A 4ON9A 4JLJA 1ZNZA 3T1VA 1KKMA 2H17A 1CXZA 3DEFA 3AEZA 1ZYUA 3OIUA 2DFTA 4JSTA 3MLEA 4N3NA 2ZRIA 2Q3MA 2X77A 3B8HA 3Q9LA 4OQFA 1EFRA 1E2IA 4B35A 2CL0X 3F8TA 5DIFA 2J41A 1KO8A 2Q6TA 4A2PA 5EE1A 3RSLA 4Q7KA 3SJZA 2ZSFA 4EUNA 4R7ZA 5LDDC 1U81A 1XTRA 3Q72A 3CPHA 4EQ6A 1KHTA 3GP8A 2WSSD 3PV0A 1W0KA 2W6ID 1MV5A 4D25A 1OV4A 5KYKA 3RSOA 3RRYA 4URZR 2C8VA 3LW8A 4MYCA 4DDVA 3PQCA 1ZM4A 5IK2A 1OXTA 5KNBA 4CF7A 5FPYA 1Q21A 3SHWA 4BUJA 2XTNA 1A2KC 2YC4C 3NHAA 4FD2A 3U6KA 2DPXA 2NPFA 3AVUA 3HWSA 4PQFA 3IDQA 4LYFA 5AK0A 4O2RA 1T3HA 1V5WA 1XCMA 1GSIA 2WHXA 4PAOA 3DHWC 3PFIA 2AXNA 4BRUA 2IYVA 2PLFA 2W2XA 3PUZA 4KYUA 3TUZC 3W5IA 4V02A 2QPOA 2GCNA 3G5UA 2RHDA 3FMOB 2BMEA 4QBGB 4B43A 2WIAA 1ZBDA 3W90A 1AM4D 1VG9B 1XMIA 4EJSC 1KDRA 3FHTA 4WOPA 5DE3A 2IS1A 3QBTA 2C95A 1GWNA 2D7DA 1GNRA 2ZRJA 1EX7A 3IEUA 1R0ZA 4QBIA 1E4VA 4QM7A 1VG1A 1DG1G 3M6AA 4X8LA 4CEJA 1G19A 4PC2A 1KJWA 4UXIA 4LJ4A 5KDOA 1JJVA 1LS1A 2EYQA 4BZPA 5FPHA 1I4LD 1E9AA 5J4HA 3KXKA 5C2JB 3U7GA 1E9DA 1FUUA 2JCSA 3GEEA 1NN0A 3LBIA 4P0TA 4TMXA 1O87A 3A58B 2FZ4A 5FBRB 4UNNA 2HJVA 1U0LA 1RRCA 2HXYA 1NRJB 1R5NA 1VHLA 2OUKA 4MRPA 5KO2A 1W47A 4I1OA 5CB6A 2EVWX 2FV8A 4DT1A 2FGKA 1TQ6A 2FPLA 3CX6A 4WAUA 1MO6A 1VTKA 3NBFA 5FOUA 2GF9A 2VHTA 4AG5A 4JLMA 1NN5A 4V0ME 2WMNB 2LWIA 3ADKA 2V54A 3NXSA 1C4OA 1NBMD 4ERNA 4NYJR 1XD2A 2C9CA 3QXJA 4Z1MD 5JRJA 4QJ5A 5D3MA 2G3YA 3EPKA 5F9FA 1G8FA 2CK3D 1SHZA 1E9EA 4OJKA 5JS8A 2R62A 3KB2A 4RCZA 4BFYA 3VTKA 4A6XA 4HSEA 3A4MA 2VPPA 2IWHA 2OEPA 3ZLJA 1KO1A 3IPYA 4BQSA 4W7SA 2ZUCA 4CGZA 4P4TA 4Q4AB 1BMFA 3LY5A 3QOFA 4HAXA 1TQ4A 3VR2A 3O8CA 1ODFA 1HUQA 5FI1B 4O3MA 3AKDA 1W36B 4IFEA 1G8HA 1FUKA 5JFGA 4GMXA 3NDBB 3GLIB 2EYUA 1G9XA 2CCJA 2FWRA 1RRFA 1MRSA 3KL4A 3K70D 1T91A 1U90A 1Z07A 2JEOA 1QHHB 4KSBA 4M8NE 2KBFA 1R0XA 2WWWA 1XXHE 1OYYA 4ASUD 1XTJA 1HTWA 2EFEB 1P75A 4HUQB 2OT3B 2UZIR 3LXXA 3K09C 3GLHA 3AF3A 3SQXA 3QBVA 4TN1A 1F2UB 2OCYC 3QF4B 4EFNA 3BFVA 6Q21A 1W48A 3PUYA 1KTVA 1KI9A 2C99A 5DGXA 4RZUA 2ZRLA 3DKVA 2HLDA 1N6HA 3AVYA 2G88A 2MSEB 2RMKA 4JJKA 4ACBA 3AGPA 1NBME 1S9HA 4GSYA 5BXQC 3FYHA 4S2EA 2FFBA 4LBWA 2YOGA 5HZHA 4ESVA 3NBXX 4ZDWA 3AUXA 2OG2A 3T1OA 3QPWA 2PCLA 2F6RA 2O8FB 5HTKA 1JXOA 2IL1A 2PT7A 4KFSA 4YDSA 4ARZA 2REOA 1FOEB 2NTYC 5EQTA 1XMSA 1Z28A 4HZUB 2HCBA 2V4ZA 5BYKA 1CU1A 3OIVA 5A4JA 2QBYB 4PX9A 3CF0A 2ZEJA 3HR8A 3CRVA 3K0AB 2FFQA 3D8BA 2ZJ8A 1QDEA 4G5RA 3WY9A 2BCGY 3OIYA 3LXRA 1GNPA 4Q1EA 4LZZA 3RVBA 4AKGA 4ZDJA 2JJ2D 1CKEA 2RAPA 2BBOA 3W34A 2R6CA 3NDPA 4FXPA 3A1VA 2ODBA 4PQYA 3SYNA 1XEXB 4GMDA 3L8YA 4OJQA 3IIKA 4B3GA 4PHFA 2QP3A 4GP6A 1EK0A 4RZ2A 3EX7C 2OXRA 4OQMA 4LHZA 3ZIAA 1Z83A 1KSHA 3GJ3A 1ZU5A 2I1VB 5LB4A 3NEYA 4PHHA 4HB4A 2ODWA 2ONJA 4ZCIA 2A9KA 3ZQJA 2FSIA 5JSZB 1DAFA 2A5YB 2ORWA 4WIAA 1RYFA 3LBNA 4Q9KA 4I4LA 4BRWA 4CZ2A 4V0OA 3PJRA 4LHXA 4DIDA 1EFRD 2R6DA 3C5CA 5EP1A 4AD8A 4QM6A 4NCIA 1TU4A 3KKPA 4W5HA 3WYGA 4LRWA 4HAVA 4M1WA 1U9IC 3RS0A 3TKLA 4D4LA 2KB0A 2YYZA 5EP2A 1AA9A 3SS8A 4IOKA 3QXHA 1W0KD 4UXJA 5GVSA 3KDSE 1CRPA 2N42A 1OT3A 3BH0A 3MWJA 1LFDB 3UG6A 4FI3C 3UATA 4GPTA 3V00A 2HF8A 2JLUA 4ABYA 2ZROA 4AK9A 1T0HB 3LWNA 4L16A 2ZS7A 1KMHB 2WKQA 1E9RA 2ZRMA 2WWFA 2PL3A 4II7A 5TB5A 5IK2D 3WMGA 2WOJA 3EZ6A 1PLLA 4QXAA 2OV2A 4PTLA 3V9PA 3I3SR 3RS3A 2BMJA 2GBLA 3I92A 2GZHA 1DOAA 1P7CA 1KZ7B 5IF9A 2NO1A 3B13B 1EX6A 2N46A 2W6JA 2BBWA 3AKCA 2CVHA 4BE7B 4NHOA 1ZNWA 4RD1A 2BC9A 4UQOA 4BFSA 2GVZC 3SEAA 1P73A 5LPNA 1JB1A 3IO5A 1Z63A 3LDAA 1T3LA 5H8WA 3I5YA 2QMEA 5CJPA 4LHYA 5DI3B 1Z2AA 2DCUA 4FN5A 3IIJA 1UJ2A 2VP4A 3UPUA 3MWYW 4CYMA 1E98A 3BWDD 2ECKA 5CLQA 2QQEA 1S8FA 1XTKA 2ZU6A 2O0JA 2ZE7A 3KUCA 3N70A 5FPTA 4IW3B 5KHOC 2VIIA 2VSOA 2OLKA 4IJMA 1TMKA 2EWWA 3GLIA 1E79A 1L7VC 2WWIA 2V1UA 2YKGA 3K0EA 5EP4A 2QMHA 2X2FA 1IXSB 1M7GA 2AD1A 2YOFA 2PT5A 4BFUA 5TXGA 3LRPA 4U02A 1S9DA 1QHHA 2F3TA 4LV6A 2NMVA 1HH4A 4E5UA 3E5HA 2IYTA 4B48A 3X1DA 4OHXA 5BW8A 4EJSB 4B2LA 2J45A 3T1TA 2H92A 2HF9A 1KI3A 4HUQA 4DB4A 2J0SA 2G0TA 2EQBA 1S1CA 4IDHA 1Z6XA 4BLPA 5C1BA 2ATXA 4CEIB 3A4NA 4JSYA 4NU0A 1L8QA 4KJZA 4JLOA 2GJ8A 1OJLA 3GJ0A 4TQ9A 2XZPA 2Y8EA 1UKZA 5GJWC 4AIIA 3IILA 3B1WA 3D7MA 1JEEA 3ZDQA 2NO7A 1BMFD 1UEIA 3BBPA 1Y63A 3LX8A 4IDQA 4Q1BA 4C3ZA 4F4IA 4EDHA 1Z0AA 2F9MA 3LX5A 4HB2A 4I81A 4RCYA 4Q7MB 5L3QA 3DMNA 1IN8A 1DAGA 1E0KA 1VCNA 3FB4A 5UKDA 4A36A 1P2SA 3IIMA 3D6TB 4R2IA 5DN6A 3WYAA 3OAAA 4XVUA 4KLZA 3VAAA 4F92B 4HZUA 1HT1E 4KYIB 1W2GA 1WCV1 3EA0A 2GAOA 3AB3A 4EAQA 2QBYA 1AS3A 4QJ3A 3ASZA 3CKLA 1GITA 4LV8B 2BM0A 1CF4A 3BERA 5G40A 1NVWQ 5EP3A 4A6PA 1US8B 4GOXA 5EXSA 5DYIA 4NBSA 5FOSA 5KTYA 1PVOA 1LY1A 1ZU4A 3A37A 3FOZA 3QSYA 4LBVA 3IBGA 3GLFB 2QU8A 1IN7A 2OO7A 1XEXA 4WXPA 4NPHA 1MH1A 4W5WA 1E2QA 4LYHA 2D4HA 5AUPB 1LTQA 2HLDD 2DFLA 2N1BA 3CNLA 3MJRA 4JZKA 1XEWY 1QHSA 2F7SA 1X8JA 3H0KA 3GJ6A 3UMSA 2Q3HA 5GJCA 2RGNA 2ZJBA 3U3JA 3TW8B 1XTIA 4X8MA 3DDCA 1E32A 1P6XA 5FI0B 5JSZA 4B47A 1G5RA 5JS7A 2QORA 3PEUA 1G6HA 4UNRA 2XZOA 2JJ1A 4R2HA 2ZE8A 4B2PA 1E96A 2QEQA 4QNRA 2WZQA 4OHWA 1GAJA 1KOFA 2RGGA 4Q18A 1JI0A 4PQRA 2JGNA 3LFUA 2FGJA 3U3KA 2EFCB 4KSCA 4F38A 4C30A 1G3RA 2C5LA 1TL7C 2CNWA 2V9PA 3I62A 2CBZA 2BKUA 3MFYA 4TL9A 1XNJA 4JS0A 1R5BA 2ZSEA 5FOTA 4LK2A 1I4DD 2BOVA 1WE2A 3Q85A 1F2TA 2QM8A 3EZ7A 2IUUA 4PSKA 1KI1A 3B5JA 1KMHA 2OFWA 2WICA 1XCGB 4LPSA 1L2TA 5BYJA 1OFTA 2IYUA 3ZIAD 3NTUA 3OFNA 3FHOA 4ZPXA 2Z83A 3RC3A 3GLHE 3GJ7A 3A6PC 1GTVA 2A5DA 2J0UA 2QGNA 3VU9A 1NVUQ 2C04A 1D2NA 1DELA 3D31A 4Q1FA 4D0GA 3I8SA 1BOFA 5KDDA 2GCOB 4O2LA 2CXXA 2A5FA 2XSZA 1NMXA 5DSZA 1RFLA 1W0JA 1E2HA 4KHZA 4V0LA 2OBMA 1BYIA 3AF4A 2Z4SA 4X8HA 2QSYA 1Z08A 5CK4A 1Z6TA 1E1RA 2FJUA 4Q03A 2R8RA 3JZAA 2D74A 4TTQA 1Q3TA 2CE7A 3PG5A 4J0QA 2P67A 3PUVA 5JHGB 1OB5A 1JPJA 1W4BA 1KYIA 5B2ZA 1EG7A 5FL7A 2ANCA 1G8PA 4JLBA 3QXSA 1GUAA 3M4YA 3VR4A 1N6NA 2PBRA 4Q4HA 2ODEA 3RABA 1G7SA 2W6JD 1CULC 2ZUDA 3FMIA 2J59A 2OLJA 4Q5IA 1RZ3A 3SI7A 1YZGA 1EFHA 4D2IA 4D0NA 3GMTA 1GDDA 5J47A 3MD0A 1U8ZA 4CEIA 1OIWA 2J7PA 1LF5A 1DARA 2H57A 3NKVA 4JYCA 2O8BB 1OW3B 1OXSC 4JT4A 5CDFA 4DDUA 2ZR9A 2Q9CA 2RGEA 3UK6A 3AM1A 2HEIA 4B34A 1PLJA 1DO0A 1P72A 3CO5A 2A78A 3H1TA 2GESA 3HPRA 4TMKA 4YQFA 2EW1A 3EPJA 2RGAA 5TV2A 5A0FA 1XJQA 1HV8A 3NVAA 3EASA 3L82B 2MSCB 2VP9A 4X8OA 3TMKA 1E79D 1E2DA 2QROA 3I61A 4JVMA 5HPYB 2ZI7A 2CCKA 4B2IA 2QTVB 3GQBA 3DL0A 4PPGA 3RS2A 3DZDA 1TPZA 4FINA 2E87A 3NHBA 4Z8YA 3HJNA 5JMTA 3R9WA 3FE2A 4L9WA 3ZYCA 4RFSB 3EIEA 3RC8A 3JZMA 5L8VA 1XRJA 3RANA 3AVQA 1AGPA 1CJUC 2CLCX 2OXCA 3CRRA 4OHVA 3CF2A 2QE7A 1US8A 3O47A 4OK5A 4Q19A 2G9NA 3WMFA 4OHYA 3UWOA 3QKRB 1Z06A 4ZIRB 1LNZA 4OQLA 1Q0UA 5JLJA 1G1MA 2ZM5A 2VHQA 2RGBA 3WXMA 4G5GA 5G3YA 2WBLC 2BEKA 1AQYA 3AKEA 3TAHA 2RB4A 1V43A 2IYLD 4DSUA 1QHXA 1S0UA 4HUTA 3KJIA 1NMZA 3QUSA 3ZS9A 4E09A 1CEEA 2JLVA 5FBQB 3RYTC 3IQXA 1Z3IX 1XFAA 2Z5FA 4LGMA 1QG2A 1KSJA 5SZKB 3A1WA 3CUEF 5AJVB 5FUWA 3A1UA 3T1QA 5DN6D 1JJ7A 1VPLA 3OAAD 5FR2A 1FX0B 2WAXA 1ZP6A 621PA 1R0WA 2FSGA 3ZVNA 4FMCF 1WA5A 2AKYA 2BBSA 2C96A 2IK8A 2GETA 3CNOA 3K09A 3W8RA 4P32A 5AUNB 3A8TA 3QKTA 5JEDA 3U61B 4LY6A 4NYIQ 4XWOA 3NBZC 4F91B 3GLIE 2JJ8A 3VR3A 1XPUA 2JIZA 1WF3A 3X1YA 4NCJA 4B3CA 4TTRA 3EWAA 4PC3A 4HDCA 1NJFA 4A8JC 2QT1A 3NEJA 2OZEA 2H18A 3T34A 4C0SA 2R2AA 3T61A 1XMVA 2AKAB 1OKKA 3QE0A 3N5CA 2QTHA 4Q1DA 4PFSA 1ZD9A 5K8TA 1G7CA 2W2TA 4IDPA 1K8RA 4M1TA 2AFHE 2OILA 1OIVA 4YMWA 4OK3A 1YRAA 4ZI2A 4DB2A 4LJ8A 1ZJ6A 2ZRAA 3BK7A 1IN6A 3PUWA 4JL6A 3C16C 4DLZA 1WP9A 4Q66C 3H86A 3JVVA 3U7EB 1W4RA 1N2CE 2JJ1D 5BN4A 1XB2A 2QI9C 2QZ4A 3TGPA 1D9ZA 4QC2A 1WBDA 4YMSA 4L15A 4MRRA 1FL9A 2ANBA 5AJZA 1JECA 2CNWD 1M8PA 1G21E 2CLDX 3I73A 1OH5A 1JALA 4G5QA 1VYUA 2FFAA 2KJQA 2RHMA 4PAQA 5HKKA 4HDOB 1JR3A 5FPSA 3RWOA 1R7RA 1Z22A 4LDJA 3KB1A 5IHPA 3FWYA 2ZI3A 4L5BA 4US2R 2QPTA 1OH8A 3W8NA 1YU9A 3KXLA 4NH0A 4DEXA 4YLGA 2O8CA 3C41J 2O8EB 2QL6A 3OFND 3AP1A 3VKHA 2GEUA 4JKYA 4MKGA 3B60A 3CRMA 2IS2A 2BHRA 3MG9A 3B78A 5BWMA 1EGAA 1TADA 3PEVA 4DBLC 2NZ8A 1GILA 2VP0A 5L3RA 3I5XA 2V6JA 4Y0VA 1II8B 4HEJA 4LHWA 2XSZD 2B21A 1IJFA 2ZRBA 1GRNA 2V55B 1U9IA 1P5ZB 1W0JD 3MCAA 1XF9A 4AKIA 3MUFA 3HR7A 1UBFA 4B3BA 2WV9A 2O8BA 1LB1B 1UF9A 2LKDA 3GFOA 4Q47A 1E1RD 1GL6A 3O8DA 2FFHA 2ZR7A 4K46A 4BFZA 1L4YA 4KFTA 2VSXA 3A1TA 4O0MA 3VHXA 4WVFA 2OFXA 1VG0B 1FMLA 4UKDA 2FDCA 2QUZA 4Q9IA 3OIWA 5FOXA 1EWRA 4OI2A 3X1WA 1N6PA 1W5SA 3HU2A 3CH4B 4MGZR 2IYRA 1DE0A 5FL7D 4IEEA 3DM9B 4KITB 3SJCA 2ZETA 3X2SA 1JQJC 1DS6A 3B1ZA 3K9GA 1KGDA 3EXAA 5EZ6B 3KJHA 5E7JA 2NO6A 2F1RA 4NYIR 4TMTA 1OLOA 4XTRA 1G4UR 2K5UA 1N6LA 4PPNA 3LQRA 3B1XA 1NG1A 3LD9A 4URVR 1YR6A 4TWZA 3QKRA 1RJ9B 2J7PD 1GKYA 2FU5C 5J4LA 3UMFA 5FBVB 3K70C 4RD3A 4N0DA 421PA 4NCHA 3EZ9A 2ZE5A 5KUTA 2ZU0C 1FTSA 4D6PA 3L0IB 4LJ6A 3D3QA 1GKUB 4QGGA 1FQKA 1XBTA 2WPDA 2ZAMA 3BGWA 4IOMA 1KNQA 2ZANA 1G4AE 4KI0A 3WP1B 5GJVC 3P32A 4S35A 5EUQB 2WM9B 4CEHA 3AVXA 1CBUA 4G0NA 2NIPA 2ERXA 2QP9X 3FKSA 2OE2A 3N2EA 3BS4A 1SKYE 3FGNA 4JBYA 3K9HA 4PC7A 1AIPA 4MYTA 2V7QA 1FX0A 1VYVA 4R9UC 3W6PA 4D80A 3W3AA 2Z6VA 3EWSA 4NCNA 1Q1EA 1NL3A 4MGYR 2DBYA 4IOLA 5SZHB 3TR0A 4GNKA 1NVXQ 2G1KA 1RPZA 5K8LA 3GJ4A 3K0FB 2QE7D 1N6IA 1A7JA 4MRSA 4TYWA 1KI8A 1JAHA 1P61B 1SVIA 4LC1A 1KO5A 5JI2E 1M2OB 3AF0A 4ILEA 2QRNA 4MKHA 4Q02A 3S1AB 3SOPA 4M9ZA 1CR2A 3L43A 3NG1A 3T5DA 2WWHA 3W3ZB 1FNMA 2BEJA 2AK3A 4BFWA 1TTTA 3I1FA 3QF7A 1GRRA 2C03A 2GILA 3CPEA 4OQNA 4PXAA 4PZYA 5AJWA 1NG9A 4UJ5A 4KV9A 3GJ8A 1SXJC 4DLRA 3X1XA 3B7GA 4OI1A 3TQFA 2QPAA 3CX7A 4PANA 3K0SA 5AJYA 2ZE6A 3ASYA 1FP7A 2LKCA 1X8LA 3CIOA 3HYTA 4IKEA 5AUQA 4A4DA 5KSOA 1W49A 5CDFE 1JBKA 3UANA 2REXB 1KI4A 1H8HA 4D26A 4OQXA 2YHSA 3WYFA 4MGKR 3IEVA 4DRZA 4JBWA 4DIEA 4XWKA 3KQNA 3C8UA 3GCGA 3TSOA 2DWOA 1W46A 1OXVA 5B58C 3WRYC 3I8XA 1MO3A 4TLDA 1NP6A 2JIZD 5CYOA 2VEDA 4QBHA 1CRQA 1T8TA 5H68A 1U98A 2X8AA 2GZDA 3QEOA 3AKYA 2YV5A 1DO2A 5D3QA 1E3MA 1IN5A 2XNDA 1COWA 2XXAB 4E07A 3KKMA 4BWYA 4I1SA 5FTLA 1UPTA 1OKKD 1QVAA 2BMFA 2I4IA 2YOHA 2O8EA 2NQ2C 4LJ7A 4LYJA 2W83A 2CL6X 4M9QA 4B33A 2IYYA 1EWQA 3ICQB 4LSGA 5G3ZA 2CJWB 4QJ4A 3FPAA 4XSHA 3KQKA 4JLDA 1CTQA 1YR9A 4Q9LA 2REBA 4MRVA 4HLQB 2VRWA 5J4KA 1II0A 2AK2A 2D7CA 2Q21A 3P4XA 3W9YA 1MT0A 2UKDA 4DCNA 5F2EA 1FPMA 3R9IA 3TVDA 2QG6A 3OEEA 5FTMA 4W9MC 3U4QB 3LVRE 1FNNA 3B85A 4HDQB 1N25A 4A8JB 4TTPA 1BYUA 1HYQA 3CF6R 5TDHA 4BLOA 5J4VA 4YONB 4BFTA 5HKKD 4BLRA 1JR3D 3EZFA 4KODA 3Q5DA 4FIDA 5FTKA 1AZTA 3SN6A 3ZZTA 4B71A 3IKJA 4F7WA 3OF5A 1WQ1R 4QFMA 1JQLB 2O8DB 1BH2A 721PA 1ZW6A 1E9CA 4A2WA 3DOFA 4PZZA 3BE4A 2IYWA 3M1IA 4XTCS 3E70C 3THOA 4JYBA 2H1LA 4JJZA 1ZNYA 3MMPA 3F3YA 4W5JA 3U2QA 3KQHA 2VSFA 4B44A 4DHEA 4A9AA 2ZXUA 5JJKA 2BV3A 1IY2A 4DLVA 3ECCA 5CITA 1KAOA 4O25A 4XD7A 4D4MA 3H4MA 1XEFA 1R8QA 2GK6A 5HCNA 2PX0A 5SZIA 3E2IA 1RJ9A 2R6AA 4YC7A 3AVWA 3L0PA 1GRQA 5F3WB 4MA4A 2QY9A 4Q4AA 3PIRA 4TL7A 4BPBA 2SHKA 4Q01A 1TU3A 4JLNA 4OYHA 1D8TA 1IQPA 2DR3A 4RD4A 5G41A 1U2RA 1S3SA 3HPQA 2CLSA 4M1YA 3VMFA 4DDWA 2GEVA 1E2LA 3SHFA 1ZM9A 2AWOA 4GP7A 3ND8A 2DB3A 1EFCA 2ZRNA 4UNQA 1KY3A 1E2GA 2IWRA 3RRNA 1JR3E 3CWZA 4M21A 4KVAA 1YZNA 1NLZA 1TQ2A 4ZDKA 3AVOA 5J40A 3U7FB 2B8WA 3L0SA 2GXSA 1H8EA 1TF5A 1UBCA 1E69A 1F2UA 2VHJA 1KI6B 1LVGA 3C15C 3QF4A 3K53A 1KSGA 1U8AA 3ONWA 3O8BA 1M6NA 1HA3A 2NO9A 3VKWA 1E2MA 1XTSA 1KKLA 3CR7A 4NL4H 1AGRA 1IN4A 1ZAKA 4BLSA 3IQWA 3FTQA 1Q1QA 2WPDD 1DAIA 1KDPA 1DG3A 1W2HA 3REFA 3PEWA 1VKJA 1N5LA 4GOKA 4NP6A 2BIFA 4WZBE 4ZCLA 8OHMA 3ADBA 1EFUA 4TYYA 4RY2A 4IRUB 2OFOA 2O8FA 3FKSD 1KY2A 3HP1A 5KPJA 3UG7A 1NMYA 4A0HA 1XPRA 3CONA 1Z5ZA 2IYXA 2ZRCA 1YE8A 3PUXA 1VIAA 2V7QD 1XU4A 1ESNA 4JT2A 1E1QA 4L4UA 1RKBA 4PC6A 3K0AA 4TYNA 1T4GA 4C0JA 2MMCA 1GL7A 5DISB 1CJVC 2C9OA 2JDIA 4BZXA 1VCOA 1ZUHA 2JA1A 3K70B 2CDNA 4RSGA 4KU4A 4LV5B 1GL9B 3F0TA 1P9NA 3K9NA 1I2DA 1P2VA 2ZPTX 1N5JA 1N6OA 4LUCA 3TLXA 4E03A 2XXAA 2JAQA 2XZLA 2VHUA 3QXXA 1KDOA 1CR4A 2AFIE 3KZ1E 2CL7X 3FVQA 2VF8A 2GJ9A 4HATA 1DAHA 4LI0A 3BD9A 1EESA 5L3SB 5K8UA 1IHUA 1T8UA 5JCPA 4MDFA 3RS5A 5EE5B 2B92A 4C0QC 1H8HD 5FTJA 2Q9AA 3ADDA 5DHAA 2F9LA 3U4QA 4I1VA 3ZVRA 4D82A 4XOIA 4A15A 4IDNA 3AV0B 2XX3A 1T3SA 3K0CA 1IONA 2WVJA 3SZRA 1Z47A 2IT1A 3K8YA 4M0LA 4GOJA 3KKNA 4TLCA 1C9KA 3RAPR 2GJSA 3P1JA 3VQTA 4ZKDA 2XNDD 4IXNA 1COWD 3LV8A 5DNYB 1DVRA 2VTKA 1J90A 5H1YA 1SXJB 4BEJA 4C7OB 2O8DA 4MQBA 3VHLB 1N0UA 3QG1A 5A5GA 2B8TA 2OCPA 3LBHA 4GRAA 4CT4B 3TJZA 3EC2A 4QHYA 2PCJA 1FTNA 1PJRA 3BJIC 4AKHA 5C4GB 2VQSA 5EE0A 4EPRA 2XOKA 3HU3A 4Q4JB 1N6KA 3NC1C 1K5DA 2WWXA 2PH1A 3KTAB 3LH5A 2ZVQX 4AI6A 4US0R 5IDVA 2J0VA 4MH0R 4WZ6A 2P65A 3VR1A 1OE0A 3OEED 2WIBA 4HB0A 4CW7A 1G6OA 1KJZA 4AC9A 1ZCAA 3LW7A 1AKEA 4LHVA 2AXPA 1VIYA 3EIQA 5DI3A 1G16A 3VX3A 1R2QA 3ZD7A 3DO6A 4URYR 2W2VA 4K81B 4RFVA 2CCGA 2GBLC 1FFHA 3GPLA 1SVMA 2ZJ5A 3C4JA 3FDIA 4TMZA 5GJBA 2QQ0A 4EFLA 1CJMA 2C78A 3R20A 1N5KA 1PUIA 4I1UA 3ZVLA 3RDPA 3P27A 4KBGA 1P9WA 4BFXA 4E22A 4EFMA 1W7AA 2QMOA 3PVSA 3WBKA 5HCIA 2ZI9A 2HV8A 5FOWA 1G8GA 2RGXA 3BORA 3KX2A 3SU8A 1L4UA 3ZQ6A 4EQ6B 1U99A 3W6OA 3VFDA 4D4JA 2XTMA 1LS6A 3WP0A 1P60A 3LNCA 1S96A 1KMQA 5KPDA 4KFUA 5L3VA 3IUYA 3PR1A 4Q48A 1S3GA 4FCTA 4R98A 4EJSA 2GXAA 4H1UA 3IPXA 1UBGA 2HYDA 2ZRKA 1ZUIA 1XWIA 4XD7D 5FPKA 2A2ZA 2OAQ1 3TNFA 3I4LA 3AH8A 1X1SA 3DOEA 2A5JA 5E3HA 4DUGA 1GFIA 4LJYA 3UKDA 1EFTA 3KJGA 3B82A 5FOVA 4Q7JB 1YZLA 1GM5A 1N0VC 4CVNA 1HURA 3AVPA 1YR7A 2G1JA 3NIBA 2F3RA 1E2NA 2GXUA 2AX4A 2BKEA 2QGZA 1MO5A 2QTFA 4LOAA 5AJXA 4BFVA 3KJEA 3AF1A 4YDHB 5M04A 2GXQA 1W36D 3SJAA 4UNPA 2CVFA 2FN4A 2XNSA 2P6RA 3BC1A 3TUJC 3I72A 3CPJB 5CYPA 1NKSA 2GA8A 2AR7A 5AUOB 1T6NA 2VBCA 4FMDB 4CEJB 3JVUA 2ZI5A 1WXQA 3R8CA 1OFIA 1IBRA 2IXFA 1KJYA 3THYB 3CH5A 4Q4LA 5JJLA 1RE0A 3K9LA 4D81A 4DLTA 4URWR 4YXWA 4AYWA 1H8ED 2NGRA 2GVDC 5CM9C 4QOSA 1DPFA 4FWIB 1YRBA 2GNOA 2JLSA 2KBEA 3MSXA 3GLFA 2BCJQ 1OF1A 3KQUA 5HE9A 3O8RA 2OM2A 4DWJA 1VYTA 2VH5R 1ZNXA 2I3BA 1XJCA 1XMJA 3OEHA 1RRGA 2ZI6A 4HB3A 1XD2B 3U3MA 1GZSA 3P20A 2WMOB 1N6RA 4HAYA 3VR6A 2OAP1 3SJBA 1YZKA 4RZ3A 2G83A 2FSFA 3L8ZA 3C7KA 3B2EA 3QY0A 1VCIA 3TE6A 3GLGB 2BVNA 3SBDA 2H8KA 3Q7QA 1CR1A 4MUAA 3W6NA 2AWNA 3BB3A 5K8IA 1R0YA 2LCFA 4HAWA 1XX6A 3PEYA 4ZI3A 2Z0MA 2P6NA 4TMVA 1E9FA 4DLUA 2O0KA 2FH5B 4M9SA 2Q3FA 1E1QD 1KK1A 2ODNA 5ANRB 5KNDA 3FFBA 5E4FA 2R6GA 1G20E 2Z4RA 4NTZA 1YZUA 5CJ2A 3MGCA 2VL7A 3TR5A 1AS0A 1NLYA 2J9RA 1KO7A 2RH5A 2JDID 4CRWB 4RZXA 3REGA 2RGNC 1OXUA 4DLSA 3TH5A 2QMUA 3BAFA 5DH9A 4M9XA 1CP2A 1F3OA 3A36A 4DSTA 3LO5A 2DY1A 2JASA 2W00A 4OL0A 1SXJA 4A0GA 1VMAA 5LD2C 4JVNA 1NY5A 2F43B 1C1YA 4HLCA 4JMPA 3T12A 2WSMA 3LQQA 1I4TD 2RGCA 3GJXC 4ACAA 1KK2A 2KWIA 3T5GA 5EE9A 3RS4A 3G82C 4B6EA 1X3SA 4PAMA 2ZVPX 1BKDR 3WHLA 5TY0A 1G41A 4B3XA 2GCOA 1ONBA 4IVPA 2F1IA 3KTAA 4QHTA 3Q8XB 4PPFA 1SQ5A 3LLUA 4KAXA 4QG7A 5HZKA 2DFNA 3R7WB 1NI3A 2ZS8A 2DHRA 3HU1A 4H9GA 5FUYA 4B76A 5EZ5A 5JEEA 5HR5A 5EXXA 4P4UA 4JVLA 2PX3A 4G5SA 4R71A 4C4PA 1WMSA 4ITRC 4TLAA 4ARZB 3LAWA 1E6CA 2NZJA 1KSFX 4MDEA 2YWGA 3KKOA 4WXRA 4QGHA 5CM8B 4MRNA 1M7HA 3SFVA 1DAMA 4Q9JA 1M7BA 1F6BA 2O52A 2ZSBA 2AHOA 3EC1A 2RCNA 4PC1A 4URUR 1A1VA 2ZRGA 1ZM7A 3IGFA 4A82A 2IF2A 4QL3A 1N5IA 5CK5A 1SZPA 4EPTA 1XCPA 4MKIA 3VNVA 1BO6A 1JXMA 4WA7A 2QSZA 4DLXA 1UKYA 1W44A 1ZIPA 2XOKD 1TEXA 4AYXA 4HLUC 4C0KA 1YVDA 4OKSA 2D06A 2RGDA 4ZCMA 4M53A 3ZD6A 1W4CA 4A2QA 5CB8A 2O5VA 2GCPA 1M34E 2Q0HA 2GK7A 4PSVA 3VKGA 3H84A 2QENA 3CRQA 1FW6A 3ZZ0A 3EG5A 3V4RA 1NN3A 1S2MA 1LV7A 1SVSA 4TZ6A 3A4LA 4LBZA 4IHQA 3EA5A 4TZ0A 2CHGA 4JL5A 1D9XA 2P0EA 2OBNA 2YZ2A 4TYPA 1UFQA 4C0AC 4PO8A 2QT0A 1X86B 1PLKA 3E1SA 2FOLA 3N2IA 2HYIC 2DYKA 2FE4A 1CS4C 4L9SA 1I2MA 4UJ3A 2HT6A 5FH9A 4LCBA 3J81k 3OESA 4DCUA 2G6BA 3ZGXA 3U6BA 2VP6A 3WBJA 1D2MA 2JLYA 3SBEA 3TRFA 2AN9A 1KNXA 1DADA 1G8YA 4JVSB 1ZCBA 2YWHA 1G3QA 1OFUX 2ZJ2A 1MABB 3X1ZA 4RFSA 3THYA 2DFKB 2H5EA 1Z6GA 1GP2A 1IJEA 1TX4B 2XAUA 2YNMA 3OHMA 2ZRPA 1F60A 2QM7A 3ETLA 1RW4A 4IFBA 4DUGD 5FBLB 1A4RA 4ZIRA 2YINC 2FPMA 3RNLA 3KUDA 4IXMA 2QA5A 3C5HA 5FR1A 1KZGB 2PZGA 5JHHB 1ELOA 3KQLA 5DI9A 3CZPA 1W4AA 1HEIA 1R4AA 1ZIOA 2QAGC 3GFTA 4MUBA 2UVQA 3BB4A 1ZM2A 4V0NA 2MSDB 4DSOA 3P4YA 2IXGA 4JLPA 3DPUA 3TSZA 1A5TA 2C2HA 2FSHA 521PA 121PA 2ZS9A 4HZIA 4BLQA 3GLGA 2VF7A 1WRBA 1SULA 3CNNA 3H2YA 5FBWB 1AK2A 5F9HA 2GJAA 2V6IA 2FG5A 2W0SA 1E9BA 1YJ5A 5J5CA 4K8OA 2FMXA 1E2FA 2YWEA 4DCTA 5JBQA 2ZRDA 3AP2A 1T9HA 4P4SB 2ZAOA 2EWVA 5AWFC 1Z29A 4QBFA 5CLLA 2V8OA 1Q1BA 1J8MF 2BMDA 2ZYUX 2IS4A 4Q1CA 4YXWD 2QAJA 1IM2A 3VNUA 2JLWA 4NONA 4FMDF 1OSNA 3T06B 2A7QA 4DLWA 3SQWA 3OZXA 5HE8A 1UM8A 5JECA 2IW3A 4XVQA 1W1WA 3UWKA 1E0JA 2P5SA 3BFXA 2GHIA 4US1R 3NH6A 1J99A 4BGDA 1TUIA 3OEHD 3ICEA 2J87A 3U5ZB 1XD9A 2F43A 3QXCA 2ZIAA 1SVOA 4U5XA 2RKOA 1GKIA 1M74A 1MKYA 1SHKA 5KSPA 4IDOA 4V0KA 2WOOA 3NBYC 4KBFA 1Y3AA 3WMEA 5TARA 2D2EA 5BN3A 3AVTA 4TQUS 5B30A 4U7DA 2OCAA 4DKXA 3B1VA 1YZQA 3BIFA 1J7KA 2P3SA 1E0SA 1OYWA 3R7WA 1IOZA 1NNEA 1QHIA 4XVRA 3U7HB 4MKFA 1XPOA 5LBIA 4EPXA 4C0HA 2G77B 5EE3A 2YJTD 4BECA 2OBLA 4M1KA 4TL8A 5L3QB 4GDFA 2VHCA 1UDWA 1KK0A 1OXXK 1XD8A 3CBQA 4A0FA 1ZD1A 2X19A 5FUXA 2XGJA 2VYFA 3QKSB 4YMVA 5E7MA 5JCZA 3IO3A 1WB9A 3CRW1 3CZQA 4M1OA 2IX3A 1W5TA 2ZSDA 1SXJD 2A30A 221PA 2IUSA 1R5OA 3NH9A 1ZC3A 5KOYA 3QEJA 4OBEA
chains in the Genus database with same CATH superfamily
1X9HA 4CUKA 1FRVA 5IRCD 1P18A 4RTNA 3A70A 4EI9A 3EIXA 1EK2A 3OOYA 3CW2A 3TOSA 4ZJYA 1KAGA 3R5KA 2NP7A 1OAOA 4CR7A 4ZHQB 1II9A 2WJHA 3QK7A 3QVWA 1ZMTA 3GAMA 4D92A 1ST3A 4ZEWA 4P3PA 3FZQA 3PD7A 3MJHA 4AXXA 1VCMA 4KEAA 4BP9A 3IRUA 1GG9A 2IXEA 3VPBA 5B1EA 3LP6A 5KSYA 2ONKA 1E99A 3VZSA 2Q6IA 3UK0A 4CM6A 4U0KA 3L0CA 2YN0A 5K0FA 4AKEA 2Y1CA 3OQHA 3AB8A 4X7PA 4F2WA 1N2JA 4XJXA 1FYWA 2Q5LA 3OX3A 4E21A 1P3DA 3ANMA 3KD3A 1C30A 1SWWA 5C46F 3QUCA 3WR5A 3T7DA 3IPRA 5J4YA 2VLIA 5KDLA 1MGOA 4RS4A 1CHNA 1VSBA 5HP4A 1BJRE 1JNYA 1UT6A 4KQFA 5AVJA 4EY4A 2NSLA 2PE5A 3ROZA 3AEXA 3WIVA 3K6KA 2PKYX 3D81A 3INNA 4M7WA 2F62A 2B3TA 3RWMB 5J58A 4L8GA 3EUWA 1P4SA 2Q2NA 4G8JA 1XCOA 3HCBA 3CN9A 3OFKA 2ZYWX 3DV0B 3RRZA 4D3XA 1VMKA 3NC0C 3ZC3A 2AL7A 4DBVO 5CFPA 3VH2A 1YXMA 1M2GA 1C1DB 3ZDBA 1Q12A 3PYLA 3HYRA 1YFZA 2E1RA 4NMXB 5J1TB 4I9NA 3QM1A 3W4KA 3ICVA 3DB1A 5DJ5A 3WAJA 1DBSA 3K35A 4WZAE 2W0MA 2ZJAA 1KVTA 3TRKA 4MVWA 4EHFA 3VSEA 1D2CA 1M8JA 1VLMA 1Z16A 4ENVA 2QIOA 2CMKA 1JWLA 4H1HA 3I6YA 3NCTA 2B5OA 4KO2S 5JBIA 4KX5A 3EVNA 3CLVA 4TSFA 3ZNOA 4MEJA 2Z43A 5FQNA 8AT1A 4PGFA 4AN0A 2ZJ6A 2JS7A 4I5GA 4Q7LA 1A2OA 5L4SA 4MR7A 2RJ3A 1HDOA 1KVRA 5E7IA 4MUHA 3UAVA 5JXGA 3NYQA 1VE7A 1ZQ1A 4PIVA 5T5QA 4C7JA 3VU9B 4KE9A 4DLYA 4XFJA 1GZVA 2R44A 4LNUA 1GQSA 1ZR4A 4FDMA 3VC7A 1DAEA 3EQ7A 3OLQA 5CYFA 2PJZA 3GI1A 1EZ4A 3PIIA 3SC2A 1E1DA 3T5CA 3WO1A 3AR7A 3T0GA 2H29A 1YBFA 1A9ZA 4MYUA 4QREA 2P4SA 5TQJA 2VO1A 4DSNA 5KYUB 5AXAA 2Q1TA 2WIDA 5JIBA 1N0WA 1K7FB 3T3EA 5TNXA 4ESOA 3V7WA 3GDFA 4JQZA 4NE2A 4PNPA 2MSWA 2PPLA 2EJUA 3MRSA 4FNAA 2I2DA 2YWJA 5IBRA 1OV6A 1RKVA 4HEA1 2NUAA 3QU4A 1K5GA 2IEYA 4GR5A 4DMUB 2W98A 3G2KA 1IFXA 3IAM1 1XDBA 3D6HA 3LLSA 4M22A 3ZCRA 5I9NA 4WNCA 2BF7A 3IUEA 1N8KA 4G97A 4AM8A 3GPBA 4XYMA 4MS1B 3K5IA 4IJ6A 4LSZA 4PFQA 4M1EA 5ERGB 3LKDA 3VZDA 4EY5A 4YWHA 2PEYA 1NBIA 1WVMA 2VDWA 2YNMD 1PX2A 1O58A 4IZIA 4AKTA 4D43A 4ZEMA 5J23A 3CG0A 1R88A 1U6KA 4W5OA 2ZB4A 4OK6A 2EFGA 2O9JA 5KSZA 5H9WA 3TFWA 2C98A 3UGQA 4G0UA 1WCXA 3TDNA 4RUKA 4Q4HB 5F7JA 1PV4A 4OHZA 3RC1A 3P2IA 5JRZA 4RULA 5C4MA 5IABA 3DZIA 3VR4H 1ZKDA 2GF0A 3BDIA 4ALNA 2HDOA 3MEQA 3UAOA 5HX7A 4QJIA 3AVVA 3ZZUA 1QHYA 3LK7A 1KC1A 2RGRA 1VQ1A 2PEZA 1E0AA 3HUFA 3PZRA 2JHCA 1HMPA 3TGLA 3TUIC 4XSGA 5EWJB 3TVTA 5ABPA 4ZJUA 3BOSA 2ATVA 1UBRS 3DVQX 4JCOA 5D5QA 4Z8XA 1B74A 2R1VA 3PC8A 2YFQA 3HDTA 2QD2A 4I66A 4MVYA 4KGVA 3T7RA 1GFWA 5LNK1 3AEKA 5B7PA 2IIBA 3G0HA 5DOVA 1BMTA 1ULAA 1VPTA 3ZJ4A 1TTQB 1CJSA 2C0QA 3MAAC 3O8QB 3N1UA 4JOSA 3T5MA 2GNPA 2DJIA 3H6KA 3C6QA 1RYHA 4GICA 4Y6PA 3HXMA 3BHMA 1DP4A 3WNCA 5F98A 1O3YA 4F6RA 4FJ2A 4NMMA 2XNCA 3OLVA 2YXPX 3QKSA 5GMOA 2XGSA 4XIGS 1W19A 1PSZA 3QLVC 5FWDA 3WB2A 4B73A 2XOEA 4URXR 2QRVB 1XZQA 2PT9A 3EFEA 1C0PA 4PPQA 3U80A 3S1LA 1K8ZB 2XQIA 1E94E 1JV2B 3RK0A 4L51A 1RI1A 4UVHA 3UMRA 2HLHA 3LZ6A 1PWEA 1SRRA 3QNUA 4MW6A 3ZWQA 5H82A 1JPUA 1NYRA 2CJWA 1IEQA 1NVVR 3HB0A 3L6OO 2IYOA 3FOBA 4QPZA 2WWVD 1NOKA 4RD2A 4GBMA 4U8HA 2UZ1A 2GZAA 5TC4A 2BKAA 6REQA 3SF8B 1G5HA 4KQXA 1B1CA 5TSDA 3C3YA 1TMGE 4TT3A 2WSYB 1H0RA 1UAYA 1V48A 1ZDMA 2VBIA 2VEOA 4GI7A 4K6MA 3ZCSA 4BU1A 2HUNA 5JZVA 3L01A 1WQ4A 4UTZA 4NBWA 1IUNA 4WFKA 1PVDA 4YT4A 2WKPA 4OXXA 1R6BX 3K2IA 1XNRB 1MQ8B 1NQWA 3AHCA 3AR8A 2NNLD 4DMGA 1NV8A 2VP2A 5BV8A 3CLSC 4B80A 1HQCA 2GOYA 3BIWA 3I9OA 1JILA 4D96A 3GLGE 3P26A 4TKZA 1P39A 1NPTO 5JWOA 4R1SA 1UR5A 4J76A 2H7VA 3KELA 4N5MA 2RJNA 3L3BA 3OCUA 3DDSA 1H23A 1BVYF 1MTOA 3A1NA 5E6UA 2H9YA 3WNVA 5GGXA 5DWVA 1KZ9A 2B6HA 1GPLA 2D7JA 2E6UX 2HH9A 1RAHA 2I2CA 4QQ8A 3RVMA 3PE3A 4H77A 2JAXA 1F2VA 1T5BA 5AVSA 1KDVA 2VA8A 4X90A 5EJEA 3TQCA 1D5CA 1ZINA 1RWXA 2DBZA 3QUQA 4QTTB 2RJOA 1EDOA 5ILQA 3P8ZA 1CVIA 3BWCA 5F2NA 4P31A 4FFBB 5F77A 2NNWB 2BT4A 1VL2A 2HUPA 4K3UA 5GOTA 4V0MA 4RA6A 2J1LA 2CZCA 4YJ2B 4NKRA 4LXHA 2GXAA 1JRLA 2ASEA 4FOLA 4MCHA 2A84A 2XJ9A 1ZD8A 2DKNA 2PDAA 3N8NA 4GYWA 1FDTA 3KKZA 3ED5A 1IY0A 4PPYA 5CFNA 1LF0A 3KRTA 4CLOA 3GBSA 2WF7A 1WS6A 1NY6A 4Y2GA 1IL0A 2QN7A 3THXA 5KWJA 3NTVA 4MA5A 2GN4A 2QSUA 5DHFA 1YUBA 2QTGA 5FO1A 4EHAA 2GAAA 3F46A 1GPDG 2JD0A 3VNAA 1PZNA 3DZJA 4UU7A 2HMUA 3B48A 1IVNA 3WZ2A 4E4YA 3P7MA 1EP9A 2Q62A 1TM4E 1AKYA 1V1JA 4CMBA 1W5AA 2P5UA 4GEGA 1VA5A 4WINA 1IY1A 5CIQA 5IM4A 2RHJA 2W93A 3PGJA 1GIAA 2LRHA 1Q16A 4BKQA 1VECA 3DOCA 2D13A 5BV1A 5JNSA 5KNCA 1DQZA 1RYDA 1YOVA 3LVQE 4G5YA 3EBOA 1NURA 4I4TA 3DNMA 4MICA 2JVKA 4P22A 1NUQA 5H3CA 3GA5A 2HZ7A 4ETNA 5HOEA 4MVJP 3AU9A 1EWVA 1KXZA 5K51A 1E2JA 2G36A 3UZUA 1MOZA 4HLUA 3SLRA 3R0QA 1IXKA 1DC4A 2ZSAA 4ALJA 5HS4A 3LCUA 2IOYA 2PS0A 1ZC4A 5K0NA 2Z1NA 3DDUA 2KSQA 3M4JA 3JWPA 4HNAA 4BJ6A 4H17A 1YJAA 1F4VA 1K4KA 4R2MA 5LL6P 1QP4A 3GDWA 2AOVA 2UYQA 3W5BA 4L7QA 2RONA 4IVRA 1A97A 4QIHA 2AT1A 2O8CB 3G9UA 1BROA 2AJBA 3JTEA 3L40A 2XUPA 3HVIA 3FOEC 1E4EA 1D2AA 1U94A 1B1AA 2BM1A 1EH5A 3EW9A 3ND9A 4S3MA 1XP8A 3RREA 3H9JA 5LQKA 3L0OA 3EWNA 3NWJA 1D6JA 2G8LA 2R00A 5BV0A 2Y76A 1ETHA 1KHHA 1H2EA 1HYEA 1Q83A 2GD6A 3HUUA 4RIHA 4XW2A 1CRWG 1P0FA 4CMEA 2NO4A 4Y0AA 1PNVA 3FNEA 1KIAA 1J2JA 2FR8C 3KSMA 4IIJF 3V8EA 4G0QA 4DQ0A 4OQPA 3KSDO 1SZCA 1A9TA 1FTWA 4H7JA 5BVGB 5EHGA 2WK1A 4B75A 2AD5A 2BBTA 4LISA 3DBHB 4IWYA 1PV1A 1V96A 2CYBA 4IHAA 2BONA 4CMIA 1C1XB 1MTZA 1P9RA 3CUWA 2FE1A 3OIFA 3JQ6A 3KT3A 3PVZA 3T0FA 4OHRA 3IUBA 4GL2A 3A26A 2ZUBA 3O82A 3RSCA 3EZNA 3TSWA 4DXAA 2X4IA 1Z5PA 3KPVA 1NVGA 2HPZA 1F7UA 3D8NA 4DJTA 4AZWA 1C5KA 1CJTC 5ICCA 2NSDA 4NBUA 4M1SA 3LOQA 5C34B 4ENQA 2EARA 1MJGA 3PFBA 4EIWA 3ITNA 2BUAA 4RVUA 5CA1B 3HEBA 2AMVA 2Y1KA 4B6OA 4YCMA 2QW1A 4FMBB 4E4RA 2FPGB 5F1OA 5HQJA 1GO2A 3Q3JB 1MJGM 4ASUA 4MYHA 3CWQA 1NHGA 1PQUA 4YCSA 4A92A 2NU7A 4CMGA 3QJGA 4YMUA 2O20A 1VL6A 3ET5A 4JI6B 1QP7A 3BMQA 4C89A 3L6DA 5D3MB 4QU9A 1Q44A 1XHFA 1HE8B 1QS0A 1XRQA 3HDGA 4UDYX 1JKMA 4FCVA 3CV3A 1ID1A 2FCRA 3MNFA 4PHTA 4CV0A 3IV7A 7ADHA 1UXJA 2CNKA 2P9ZA 4G0YA 1AS2A 2PUBA 2E0IA 2B99A 2N75A 4P3YA 1C0EA 1KFKB 2FUNB 5CG2A 2K7ZA 2AOUA 3CR3C 2IUEA 3HJGA 3GJ5A 4GR4A 5CVCA 4Z3OA 4IIFA 5EC8A 2Y66A 1U7HA 4AS3A 2YYSA 1BHSA 3U0BA 3EIHA 3HCFA 5KYYA 2WJAA 1U9YA 4OFBA 3OFVA 5GV7A 1XYGA 3A1CA 3T7TA 1SVNA 2CEAA 3D7LA 5JJ5A 1GA1A 4XVHA 4KV7A 3GNSA 4BBPA 1FMJA 3L8FA 2GFIA 2VDRB 3GFBA 4XM0A 1TUBA 3AYZB 4MUYA 5SZJA 1H2HA 3V8QA 3G9ZA 5EJGA 1EUCB 3OOSA 3ROTA 3D2CA 4NDNE 4YHBA 3OF2A 4OFZA 5G53C 1KEEB 1XTQA 4NNOA 4WMLA 3KALA 4HTFB 5JAIA 1J6UA 2GBPA 4AYTA 2PJUA 2D1FA 2RHOA 1FDWA 2NZYA 1I0LA 1N92A 3ANYB 4MQMA 4MR9A 4ZQBA 3TAUA 5JW6A 3U44A 4UHCA 1KFBB 1CETA 4ZTBA 1O7JA 3E8XA 2PV0A 4Y30A 1NF8A 4CM8A 1RWBA 1TF2A 4B3JA 1ESMA 1W6UA 1NN1A 3D4IA 4S1NA 1K7XB 1CUYA 1NLFA 4NDZA 3TOZA 3K0CC 1P2UA 1IZ7A 1I6LA 3QWFA 2GLTA 3T7IA 1D2EA 4Q4JA 3L92A 4I08A 3GJRA 2VQ3A 1IAQA 3KPUA 4ZU6X 4YUWA 3FMPB 2ZB3A 4FGWA 5DNVA 1BXGA 1JKJB 3F78A 3SHTA 2QQFA 4IJWA 3PENA 2DUMA 2H08A 2IPXA 4LY0A 4FZJA 2GN1A 3B3GA 3S8YA 2FX2A 3C1UA 3M81A 2X1VA 1OB2A 1FBNA 1Z0DA 4DJEC 4WA8A 2DWQA 2J46A 4ZYZA 3GBPA 2C57A 3ZK8A 1TCBA 3DMTA 4GWGA 1KDTA 4ON9A 1NBWB 4JLJA 3RTDA 1O6ZA 5CLHA 1Q7BA 1DBVO 5G0WA 5FORA 3AEZA 3ZXSA 1Q91A 2DFTA 3MLEA 3JWEA 2FVXA 1C3EA 2B36A 2ZRIA 4I5IA 4OQFA 1ISGA 3WVNA 3EAFA 1E5TA 4RZIA 4AY4A 4B35A 5JZBA 3CVWA 1KO8A 4BNHA 4A2PA 4KPUA 3MTIA 5EE1A 3ZNNA 2QRPA 4R7ZA 5EKDA 1FNDA 3CLHA 4CV1A 5LDDC 1BKYA 1V6AA 2G72A 1MIOA 3LT1A 2W6ID 3DUFB 3HLTA 4HDSA 1LDBA 2I78A 5DKFA 3E61A 1MV5A 2IPMA 4H0CA 1OV4A 3RSOA 3EF0A 4G36A 4D9MA 4HNVA 1FYVA 4ZOQI 1X9GA 1GG8A 1XTTA 3R0VA 4PAWA 5CDUA 3HR4A 3SF0A 8ABPA 1OXTA 4INJA 5GTDA 2GN6A 4UMEA 1QYXA 1SCUB 1LDMA 1A2KC 2VJMA 2YC4C 3CFYA 4KUHA 4YP0A 4C0XA 1CEYA 2NX2A 2R7KA 3HWSA 4PQFA 1ND6A 2EHDA 2OK8A 3NHWA 4MS3A 1T3HA 4A10A 4EFDA 4Z4CA 1GSIA 1X42A 3H83A 2ALJA 3SC6A 3E9CA 4EUHA 3IDSA 2GK4A 4MCIA 4OSEA 2AXNA 5F73A 4ZYTA 1GG5A 1Z2OX 1PFVA 2PLFA 4KE8A 4UHHA 3WYNA 4BV2A 5JRDS 3NO4A 4EA6A 2OR3A 1KMNA 1R6UA 3TUZC 1XRSB 1EXNA 1Y3DE 2QPOA 4B4DA 5A06A 2D54A 4EJ2A 3V2GA 5JZOA 3G5LA 2C8KA 2FUCA 2WUDA 2ZKIA 1LPPA 3W90A 1VG9B 3TEFA 3MC1A 1TW3A 1JXAA 1PT6A 1PYGA 3IJRA 4E32A 5BNIA 2GARA 1HX7A 3IVMA 2D7DA 3TKYA 1Q3KA 4Z4IA 5DCYA 3VR5D 3M6AA 1DG1G 4Q3NA 4X8LA 1ZK4A 2CV2A 5ER6A 1G19A 2QGFA 1LS1A 1LUAA 5JUWA 5FPHA 3CF4G 1E9AA 3MJCA 3GFRA 3H42B 5LQRA 1XV5A 2JCSA 1A7UA 1R37A 2Z8XA 1YDGA 3BL6A 3N6RA 3JCZA 4K28A 4M1QA 2ZYHA 4P0TA 5C51B 3EMKA 2FZ4A 4F4DA 1SOMA 2WHQA 3LDUA 1VKZA 3CY6A 1RRCA 2YN4A 2HXYA 4UE3S 2A1UB 1NRJB 3C3AA 4P2GA 5ENVA 2YJ3A 1HNNA 4IFTA 3LCRA 5IKEA 5KO2A 3Q8MA 5AOVA 3JAKB 1IBLB 4RY8A 2IDZA 4KRGA 5AK5A 4CR6A 3FKJA 2WE8A 4JLMA 3IMCA 4MIOA 1DFGA 3RV4A 5IARA 4R2LA 4V0ME 3ADKA 4C3VA 4ZRMA 2GPJA 5MHTA 2WTAA 1NBMD 4RKWA 4Q6WA 1Y0BA 5AHXA 2AG1A 1WXFA 3PP8A 1QJCA 1KFJB 4IS2A 4QPPA 4QQFA 4YRDA 1VJDA 5LQDA 1G8FA 4N7BA 3IA2A 1M1UA 5JS8A 2R62A 5K45A 1M9NA 4WBNF 3VTKA 4J0KA 1USKA 3A4MA 3LRTA 4HSEA 1I7LA 4LXYA 2BTEA 5L45A 1HTTA 3OD1A 4PN3A 1A9YA 3T4UA 4FT4A 3V7UA 3I76A 4EYGA 3LY5A 1TQ4A 4KTVE 3O91A 4J7XA 5HQTA 1N3YA 4E2FA 4J4HA 1ODFA 1HUQA 1UPBA 1RJFA 5CB4F 2OQVA 3ZE8A 1XVVA 2OC4A 4GMXA 5A3SA 3GLIB 2Z8ZA 3OE4A 1BQEA 4HK4A 2CCJA 2FWRA 3ACCA 3W2TA 3I4FA 3KL4A 2ZPUA 5KZMB 2A1TS 3K70D 5GPBA 4HPJB 4ALLA 5IANA 3HDYA 3SX4A 3F5QA 2OK7A 5IKPA 1SD5A 1T8WA 2C0CA 1N3IA 1J56A 4KSBA 4O2AB 2BFPA 5KVQA 2WWWA 3O3OB 3DE1X 2WY2D 2W4IA 1LC3A 4D8XA 4KQJA 3F5DA 5JARA 3UT0A 3QMMA 1KZHA 2G7MC 5GONF 2P91A 2PYZA 3UJHA 3GLHA 1JWBB 3P5BA 4J1NA 2ZXFA 3BMOB 2C2WA 3I9KA 4EVSA 2C2OA 1XQ9A 5JTUA 2P79A 2C59A 5DYWA 4FONA 2Z5LA 5C8ZA 1XMQB 5CVTA 5AJTA 1N2CB 4OD0A 3H0EA 4UM5A 5FULA 3WFZA 5K6RA 3MERA 1HRDA 3FROA 1MG0A 2ZRLA 3PRHA 2WHPB 1Z4MA 1JMKC 1V8ZA 2HLDA 4KPEC 4R16A 1X1BA 2MSEB 2RMKA 3D4NA 3AGPA 2WZDA 1H2ZA 3CCFA 5BXQC 4MUIA 4AZ0B 4S2EA 4B9EA 1N1GA 1W93A 5HZHA 2YOGA 3FYDA 3AHGA 3S2UA 4R84A 1UMDA 3NBXX 3O1IC 3P9NA 4ZDWA 1ZMOA 2NQTA 3UCXA 3QPWA 4A6EA 4BWFB 1UANA 5JH7A 2XIQA 3WIDA 1JXOA 5SYNA 1P80A 3WI7A 1HSOA 4O4HB 4B7UA 4ZT4A 1NQTA 5DM4A 1XMSA 4GF5A 4BNLA 1SNYA 5K8JB 1OGJA 2HW8A 1SUCA 2QBYB 4MZDA 5I5GA 4BUCA 4L74A 3CF0A 1NDQA 1FSZA 2G82A 3F4KA 3O9VA 4LTMA 3WLMA 1MVOA 1GTZA 5FUMA 2DEUA 3D8BA 2ZJ8A 4G5RA 3WY9A 2Z6UA 3E53A 3OIYA 1KY4A 1GNPA 1WXWA 1Y6JA 2BFBA 5GAJA 2H5LA 4ZDJA 4JP3A 1OREA 3CKYA 3KTFA 3FSGA 3W34A 4PLVA 2OD9A 2VZ0A 2R6CA 1U28A 3E23A 4FEEA 4GPBA 5JY1A 4PQYA 1V11B 4ZVNA 1WZIA 1M0TA 3HZOA 3MAGA 1CY4A 2PSJA 5D6NA 5CGZA 2J5BA 2QP3A 1J2UA 4Y6RA 2NU8B 3KYCA 5E0OA 2XUKA 5KTRA 3EX7C 1JAYA 4XUDA 1F38A 1T0IA 1XP5A 1TKBA 1KSHA 1DUVG 3DS8A 4ETIA 2NT3A 1UM9A 4OP3A 4TUYA 1JA1A 2HNBA 5TPWA 2XCOA 4HB4A 3ODPA 2AYZA 2G71A 3ZQJA 1OWLA 2JZOA 3JZFA 1I6KA 4G86A 2A5YB 3M1YA 1RYFA 1RYNA 4I4LA 3LXUX 4EW1A 4Y8VA 1ULHA 3EGDA 4V0OA 3GDHA 2QMQA 3H11A 1LLUA 3LO8A 3SQMA 3WQQA 4DIDA 1EFRD 2FW1A 3GRUA 4QDTA 5JDIC 3E15A 4C43A 1J2EA 1SCBA 4RIFA 1JKXA 2I7XA 3QRWA 2D2IA 3GJTA 2ZTUA 4E7PA 4W5HA 5ERYA 4M1WA 1MB9A 4YEDA 4ZT7A 1WZCA 2OFPA 2VHYA 2COEA 2I4OA 3AWDA 2A0UA 1GPMA 4H7KA 4TPKA 4FFOA 1H2WA 4WLVA 3OQPA 4UXJA 2ZUVA 1CRPA 2N42A 1OT3A 1LFDB 2IITA 4FI3C 4GPTA 4HXFB 5B1HA 2JLUA 3FVVA 5T8KA 1XAGA 5CDGA 4IV8A 1DQSA 3LWNA 4N3CA 5K3BA 2ZRMA 1E9RA 2AOXA 5TB5A 2PL3A 1GTRA 2WUWE 5TGTA 3WMGA 1Z75A 1JAZA 3DJFA 3HKEA 2OQIA 3GVPA 4NIMA 2V7TA 3V9PA 3V42A 2EG9A 3RS3A 2BMJA 1U11A 5LOVA 3CX3A 2GFQA 1S7GA 4G1CA 1KZ7B 1OXMA 1P29A 2QS9A 2NO1A 1FLNA 1A76A 1LQUA 4AJJA 4HC4A 4WY2A 4ZT2A 2N46A 4MGHA 1BDJA 4F2GA 2GEKA 3AKCA 2FW0A 1H4TA 2CXNA 3EXHC 2M6LA 5JY6A 1F9EA 3IEPA 2NACA 4NHOA 4RD1A 4HGZA 3GLVA 4WUTA 5DXJA 3U7QA 3BIXA 4YJFB 3F7MA 1O96A 5DM60 1H3EA 2Z5VA 2GVZC 4HGRA 2C5GA 4ZK2A 3CE9A 1JB1A 3KZXA 3MXTA 1YVRA 2JI8A 2OPHA 1RCTE 2AUNA 1Z63A 3HJFA 1T3LA 4RPHA 2YNMC 5H8WA 3I5YA 4BFLA 3ROXA 2KPOA 2QTWB 3EZLA 3LC7O 1LBHA 4FWBA 3H6GA 4REQB 4F8JA 5K5EA 4BMPB 2NQ8A 1AY0A 1QRUA 4KN6A 4XUEA 3D5QA 4E3ZA 5LQAA 1XN1A 2ECKA 5CLQA 4CLRB 1TMOA 3GFFA 5ITZB 3JD0A 1QRTA 1XTKA 3V1LA 3SXJA 4RF2A 4CMHA 3KUCA 1BU5A 3UV6A 2VYCA 5DGTA 4OXIA 5KVSA 1XJWA 3OA2A 4IW3B 5DBOA 4QPCA 4OYLA 2OB1A 4MO2A 4XJSA 1TMKA 2EWWA 3K8OE 5H16A 2AOWA 5CUQA 1AO0A 1NJ6A 3K0EA 1C7JA 4AJKA 4R6XA 5A2GA 4BCDA 2QMHA 3QWBA 4EG3A 3Q8KA 4QFBA 2C20A 2X2FA 2ZSJA 5EIBD 2AD1A 4D42A 1BXRA 4BFUA 1NVBA 4ENUA 1MAAA 2AQIA 1D03A 1HH4A 2JHAA 3INGA 1J07A 3ETHA 3IEXA 5FEMA 1W52X 2IYTA 2W6NA 5JE8A 4JI0B 3X1DA 3TNLA 2JIBA 3I2IA 4IDGA 1FTYA 1L5SA 5A9TA 1LPMA 4B2LA 4EJSB 5C37A 2HF9A 2BGUA 3VPAA 3R23A 3K32A 2FPPA 4JUIA 2EQBA 5FCDA 4J07A 3RTEA 3U4DA 2XHEA 4AQYB 2GO1A 1LZKA 4NU0A 1VBNA 3O31A 5U9CA 4KJZA 1SBIA 3GJ0A 1L5LA 2HU8A 1BDMA 1F9AA 4UREA 5EJAA 5BVHB 1UKZA 1DCFA 5GJWC 4MDYA 2YXLA 3WB9A 1ZO8A 1JEEA 1P9OA 3ZDQA 1KJQA 2NO7A 3LX8A 3PXUA 4ME6A 1Y63A 1Y4DE 4DE5A 4C3ZA 1BWRA 1VRCA 4GI1A 4EDHA 1E3SA 4B09A 2JCXA 2C2GA 5NLLA 3EGWA 1AZLA 3TZ6A 1E0KA 3UYLA 5UKDA 2PKEA 5IDQA 4HMOA 3NDRA 4KZKA 4YAEA 4C5BA 4G07A 1LTKA 1VSUA 1FFAA 3JQGA 4L1KA 4D6XA 1L5QA 1RLUA 3IQHX 3KG2A 2G17A 3OUUA 3Q0TA 4ENPA 6GPBA 4YAUA 4KLZA 1YK1A 3KOZA 5FA8A 1ONPA 4HZUA 2REQB 1A8SA 2WTXA 1W2GA 4KYIB 4UQLA 3EA0A 3F8SA 5LP6C 3TINA 2L82A 4F6CA 3SYTA 3QFCA 1GITA 1CF4A 3MFQA 3BERA 2PXXA 5G40A 5DMHA 1LEHA 1ZCZA 2CD9A 1PFKA 3GB9A 5EXSA 4ZCQA 3PLRA 1FSPA 1KQPA 1QFSA 4TZKA 3QFSA 4NBSA 2IEIA 2O3QA 1PVOA 1ZU4A 2HJSA 4BJ1A 4HNRA 2L17A 3P2MA 1ORHA 5F3DA 3QSYA 2UUOA 2OO7A 5CCXA 1U3VA 3D0OA 1R6DA 1E60A 4W5WA 1E2QA 1LRKA 5F76A 3QTTA 5FWXB 2JIDA 2PO5A 3H4IA 1LTQA 2WJZB 2DFLA 3CNLA 4JZKA 1C9MA 1Q0ZA 2F7SA 2GN9A 3C6XA 3EGOA 3H0KA 3GJ6A 3EFBA 3FNGA 2Q3HA 4DMFA 4G0VA 4ZTZB 3U49A 1QVVA 4BWGA 1Y4AE 4NEQA 1GXSB 3R0JA 3ELYA 3TW8B 4LJSA 4EHJA 2AQHA 4CJXA 4ZI5A 3PXXA 3TR6A 1P6XA 4IHKA 3UHAA 1YE3A 3RT1A 5REQA 4GPAA 4JEIA 2OGZA 2D0OB 3SM3A 1HC7A 4XCVA 5IUKC 1LC0A 2WZQA 1C7EA 3NDJA 4W8GA 3SY8A 4CR8A 4Q18A 1XA0A 1JI0A 2DPYA 4X1YB 1E58A 2JGNA 3LFUA 5DBEX 3T3HA 2EFCB 3QWHA 1KZYC 4F38A 1G3RA 2CC2A 4JELA 1C4XA 2MU1A 4NFLA 4AB1A 2AJTA 2XMQA 2YXEA 3PICA 5DNAA 5D5PA 4TL9A 2IIPA 4NZZA 1LX6A 2XHZA 2PANA 4BBAA 1GADO 4RDXA 1BE8A 1I4DD 1Z62A 3PT9A 1WE2A 2CB0A 5T67A 3P9SA 3V33A 5IT9A 2MSKA 4MWDA 5IYZF 2IUUA 2ZOSA 1YL7A 1V6CA 2JF0A 2P2SA 4YUAA 4YT8A 1BVUA 2WICA 3MJSA 1S02A 1L2TA 3ESCA 1ZIYA 1I7SB 3NTRA 1OUMA 4N9QA 4Y7DA 2ATEA 3TI9A 1JPVA 3CW9A 1L5NA 1HE4A 4X94A 4ZPXA 1HR0B 4H3VA 1XCLA 3GLHE 2XMSA 2OQRA 4Y9DA 1PL0A 4YH1A 3T8YA 3VJMA 2XMZA 1OYOA 3ZDZB 2C04A 4N8DA 1DELA 2CLEB 2PR7A 3LSTA 4KDCA 1W85B 3E4DA 4Q1FA 5CW2A 2P7IA 4L3VA 3FLMA 5BN4B 2FEAA 4O2LA 5KDDA 4WTOA 3NPAA 3JAWA 4MEAA 1NXVA 4RSMA 1PIWA 2AMJA 1FVXA 2FUEA 3GXOA 3BRQA 3HWRA 1MO2A 1OI2A 2F3SA 2XCQA 1I5EA 3LZDA 4X8HA 1Z08A 3O2NA 1Z6TA 3OCZA 4NJMB 2ZGVA 2BEWA 4JX9A 1E1RA 5K0EA 3IKVA 5T3UA 4Q03A 2PS3A 4IZ6A 1M76A 1AQNA 1NUPA 2D74A 1SCJA 3E7PA 3EVTA 1Z39A 4G63A 4YJ3F 1Q3TA 3GUZA 5C7LO 1T24A 3ABOB 4YV1A 1XR3A 5CFOA 4JP2A 4B4WA 1CYEA 2OGSA 5JHGB 5BR8B 3ETCA 4JNKA 3O83A 5IWAB 3GZTB 5IN5A 1V3UA 3AM4A 4OU4A 3U3ZA 1G2OA 1D2RA 4QEDA 1CUJA 4Y2PA 3DD1A 1LPNA 5EQJB 3F7TA 3LT0A 4JBHA 3II6X 3JZDA 4RVSA 1GUAA 3ETEA 3M4YA 1JAXA 2PSDA 3VR4A 3N2GA 2H7XA 1N6NA 2PBRA 2YRWA 5HRCA 2LDXA 2GKOA 3C6BA 2JGEA 4HBZA 4QT0A 4JA2A 3PQ8A 4IF4A 4IXWA 2INGX 3SI7A 1GUZA 5I3CA 4CKZA 4WESB 1V3VA 2V7BA 1E92A 4W99A 1G63A 3ITKA 4CEIA 3ZTTA 2J7PA 1LF5A 1DARA 1NKVA 3NANA 2O8BB 4GOOD 3ZWAA 5LKAA 4JT4A 5CDFA 4CIVA 2J08A 3UUFA 3H1PA 4HQLA 3M7IA 1F12A 2B34A 4L02A 4JYAB 2RGEA 3RPEA 3ELWA 1ULTA 3UK6A 4KNVA 3TW6A 1U1EA 2A78A 4RKYA 2E2WA 2ZTVA 3AFNA 4JJ7A 4NOJA 3CT6A 3EPJA 1U2PA 3LZCA 3N2KA 4L27A 4MV0A 3H9BA 3VSAA 3D9QX 1JR4A 3PI6A 4IMIB 1DXQA 3S2YA 1QV6A 1I80A 4JKOA 2WF8A 4ZC1A 1R0KA 5IZCC 1NBAA 2Z4TA 3RIXA 4JVMA 4XPIA 1IHOA 4M83A 4B2IA 2QTVB 5LQUA 3SVLA 3QOYA 4XYLA 1PT9A 2AOTB 3ZBPA 3HJNA 4KAAA 3A1EA 1IOVA 3LCCA 5KX5A 2VPWA 1N4DA 3LUJA 5F23A 4CF4A 4J0HA 1LBEA 1JHUA 3AVQA 1MVLA 2CLCX 2DY0A 2HSGA 2AZ4A 3IE1A 2QVYX 4FYVA 3CF2A 4Q19A 1UDRA 1RT9A 3D3WA 3GLSA 3NBAA 3NBUA 3RAGA 3ZHBA 2PSEA 1BS9A 3N0TA 1JX6A 5AVOA 3KQYA 1O6BA 3LY7A 4UAUA 1SWVA 3E05A 2ZM5A 1SA0A 2RGBA 5GM1A 1DXYA 5ALVA 1ABEA 2ONYA 2HQOA 5HJ5A 3HVUA 5KTMA 3FH0A 3W8EA 4DW8A 4AY3A 4Y2UA 2C5SA 2CN1A 1U9JA 2IYLD 3VI3B 1SEVA 2I6QA 4HO1X 3IKTA 3D8UA 4D8YA 3LT4A 4C08A 3LVFO 2JLVA 2R66A 3RYTC 5BWOA 4W5QA 4G09A 3UHJA 3D3EA 4U2EA 3DLBA 4LGMA 2Z5FA 5SZKB 3LCMA 3GOHA 2ZW9A 5FUWA 1FNBA 4I50A 4EATA 5DN6D 2GCGA 4ZPJA 2QX8A 5BY2A 3VBEA 2Q5EA 1LLCA 3OAAD 2JVJA 3DAGA 3LC0A 4X3CA 1PAUA 1VI5A 3ZDFA 3KZOA 1J22A 4EG0A 621PA 3ZVNA 2XDQB 1GEEA 3UFXB 2VG8A 2BBSA 2IK8A 1HFJA 3MGGA 4JFAA 3H8WA 1KQGA 2VQEB 5SYMA 3ZWWA 5KOHA 3FOCA 1VHDA 3QVTA 5F5LA 3A0RB 1N8SA 4IIUA 4NYIQ 3SHOA 4EY3A 3RIGA 4XWOA 5KQGA 1EDEA 1Y80A 2G7ZA 2YZMA 5J5AA 4PE5B 4O4LB 1UK7A 2JIZA 3COVA 3ESAA 3B1FA 4OFWA 1KJ8A 3B3AA 3EWAA 1T0UA 4TTRA 3W7BA 1ZD3A 4FZRA 1K9VF 3F6BX 4CNQA 1ZGAA 1PJSA 2NLOA 3CTPA 5HF6A 4K6KA 1U8XX 1DMRA 3WHIA 4EHDA 1MN6A 4AQDA 1HDEA 5E4TA 2AKAB 3ZE9A 4BTLA 4CWAA 2OV1A 4QTZA 3N5CA 5TF0A 3E81A 5A02A 3PJFA 5HXAA 2Q0QA 2YYYA 4OB6A 1G7CA 2W2TA 3LJKA 1QCDA 1CJBA 1BGVA 4KL8S 4OJTA 4AS1A 1ISSA 4DB2A 1QCCA 2FKAA 1YRAA 2MYUA 4YMWA 5DNWA 3SYRA 2ZRAA 2J3IA 1IN6A 3PUWA 4JL6A 4U7JA 2D5AA 2GZ2A 2ECOA 1WP9A 2QX6A 1JQ3A 1KZ4A 1RCUA 1Y7PA 2PRJA 3H86A 2QLMA 2XDYA 3JVVA 3NORA 3PUKA 3QX8A 1QOPB 3SKYA 3DBVO 3L5OA 4NEGA 5KTNA 1RE1A 2QI9C 2B30A 3TGPA 3EQ8A 4U7FA 1FL9A 1ZN8A 2VYVD 1FW8A 1TKCA 3QHAA 3F1KA 5AW1A 5KYWB 2JFBA 2GCEA 4ZMSA 4XPZA 5AHWA 2X9GA 3ESQA 3GNTA 4KXXA 2AN1A 4LJKA 4WCFC 1XNQB 3OJFA 1B6GA 1QOQB 4A8TA 1G8JA 2FFAA 1RAAA 3L46A 3VTFA 4HDOB 2BKXA 2QHXA 3AY0A 2AFVA 1V41E 3EYAA 3VVMA 4MJ3A 4DNFA 4GSLA 4L5BA 2PD4A 5ALQA 2ZT8A 2ZYRA 2GT1A 2AC2A 4AJOA 3TRJA 1OH8A 2E4VA 1YU9A 3KXLA 4DEXA 4WK2B 4YLGA 3C41J 5LYJA 2QL6A 4HZGA 2CNLA 2EDCA 4R1OA 5JROA 3GZNB 3IX7A 3TLKA 3V8MA 4H3HB 3JU3A 4U7WA 4OJMX 4B40A 2PZLA 2PQMA 2BHRA 1YNSA 4DV7B 1IEXA 2JFXA 3BA6A 1YE5A 4R9RA 4DBLC 3IVGA 5SY6A 4NZPA 5JQGB 2ISQA 2LZ0A 4FFDA 2V6JA 1TJPB 4EVQA 4KQCA 4GLJA 1QYCA 4AS2A 3NGXA 5JXIA 4P35A 4CKYA 1UZMA 2B21A 2ZRBA 2R68A 4WZBA 1RYEA 1JT9A 1IZ9A 4Y2SA 4Z7JA 1W0JD