1RYHA

Alternative splicing of rac1 generates rac1b, a self-activating gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
203
structure length
171
Chain Sequence
GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ras-related C3 botulinum toxin substrate 1 isoform Rac1b
total genus 52
structure length 171
sequence length 203
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ryhA00
1LF0A 4PO9A 1XXHB 4ESVA 4W5JA 4LJ9A 2ZANA 3ZVNA 2Q3MA 3T12A 2E87A 3U3RA 3TLXA 2OCPA 2G0NA 3CNNA 2Q6TA 3SFVA 2BMJA 1OYYA 1QVAA 4WZBE 3AKCA 3QKSA 1ZNWA 2ZIAA 3KQLA 3FHCB 4F38A 1Z0KA 1W36D 1G7RA 1NVXQ 2P6UA 1S8FA 2B6HA 2VF8A 4BGDA 5KNBA 3R9WA 4MDFA 3LLUA 4CGZA 5JJLA 2QP4A 1KMHB 2EFGA 5E7IA 2A3RA 5FPSA 3PEVA 1R8QA 3REFA 4M1OA 2IWHA 3LH5A 1RFLA 4C2UA 3ZVMA 4RCZA 4Q9JA 2REOA 1P2SA 3CBQA 3LNCA 3R20A 3AP2A 2V54A 4IJMA 4A2PA 2OT3B 2YHSA 1HT1E 2G88A 1TNDA 2F1JA 1Z6GA 2FMXA 4Q7JB 3CUEF 4PXAA 3H1TA 5AJVB 2HLDA 1Q1QA 2BC9A 1DG1G 1KSHA 1MABB 2D62A 2NO6A 1TADA 3ZDQA 4F7WA 4U5XA 2AFIE 4LGMA 2ZUDA 3NBZC 5JI2E 2QSYA 2QBYA 3OFND 4AIIA 1XCGB 2RMKA 4LV5B 2KSQA 1S3GA 3T34A 5EJEA 1GSIA 2A2ZA 1R2QA 1UF9A 3BC1A 4Q47A 1JEEA 5HKKD 5CM9C 4BE7B 1CS4C 1DADA 4LYJA 4U7DA 1Q1BA 3QKUA 1FUKA 2ORIA 2B92A 4A2WA 1KKLA 3W34A 3UWOA 1E2HA 1G7TA 4Q7KA 4PC1A 3L8YA 4NCHA 1CJKC 1DPFA 2IYVA 3ZIAD 4C0KA 3I3SR 5BW8A 1UDWA 4RFSB 2FPKA 2BEJA 1NIJA 5LPNA 1NVVR 2XJ4A 4E5UA 2QENA 4DB4A 1A4RA 4EIWA 4DIDA 5HKKA 1Y3AA 4BLPA 4ARZA 4TL8A 1QBKC 2YWHA 4XVQA 4A8JB 1H8EA 4FCWA 4TQUS 1E2JA 1KO7A 2JGNA 4JSYA 4YMSA 3NEJA 3ICQB 2GNOA 4RFSA 4M8NE 3OEED 1EWRA 1ZCAA 5KHOC 4JLAA 2KB0A 2IHYA 1F5NA 3O8RA 5HR5A 3GLIA 1JXMA 5KSYA 3ZZ0A 1JB1A 5DIFA 4Q7LA 1IJEA 2FU5C 2KBEA 3I1FA 2NO7A 2RGDA 4L5BA 3KKMA 3KJHA 1FMJA 2FFBA 3RS4A 2GF9A 3BRWD 1K8RA 4BLSA 4S35A 4V0MA 3WYGA 2F1RA 2PT7A 4E07A 2WWYA 2ZPTX 1U2RA 2O0HA 3IEUA 4BRUA 5J47A 1ZVQA 1OKKA 1W4AA 4KFRA 4NBSA 1CJVC 4D81A 2XB4A 3GLIB 2VRWA 4E03A 2J0UA 1N3BA 1U9IC 1YRAA 2PCJA 3PG5A 4F91B 4PANA 2FDCA 1JPNA 3QBVA 4C0QC 4K8OA 5E7MA 3K0EA 2ZE6A 4P4UA 3EPJA 2RGXA 4PSKA 4QGAA 4DKXA 2LKDA 3WMEA 1AS3A 1ZD9A 4A0GA 1TQDA 4AURA 2JLWA 4Q18A 1Z6TA 4JS0A 3IGFA 3SOPA 2ODWA 4OHXA 3B5JA 2VP9A 4R2HA 3KKOA 1G8YA 2A5FA 3NDPA 2HCJB 4EPTA 3W5IA 3QXSA 2WBLC 1BO6A 2JLSA 4FI3C 5IT5A 3PITA 1GWNA 3AF0A 1QHHA 2C77A 2RHMA 3AGPA 1X86B 2GHIA 4EPXA 2V6IA 5KSPA 3DZDA 1L8QA 1E4VA 3QKSB 2HEIA 1UPTA 2J9RA 5G41A 3GCGA 4NP6A 4XWOA 2AWNA 3LLMA 4B33A 2PL3A 3BFXA 1HQCA 3OAAA 1QHHB 1E9CA 1W0JD 2Q9AA 3U60B 1HYQA 3GJ6A 3KQNA 4HAXA 2XNSA 1EG7A 4QHSA 4QOSA 2NOAA 1N0VC 2ZYWX 3AF3A 3ZH9B 1ZNZA 3T5GA 2XSZD 3EPKA 2RCNA 3CZPA 2C5LA 2WJIA 2RAPA 3IBGA 1MRSA 4QM7A 1RKBA 1W5SA 1ZD1A 3KXIA 2A9KA 1SXJE 3X1XA 3ZZTA 4W9MC 1MO3A 4QM6A 4U00A 3RS7A 1CRPA 2XTZA 4QG7A 2MMGA 3R7WB 1QG4A 2JJ2D 5DE3A 2VHCA 2OILA 4ZI2A 3I92A 3KJIA 1EFCA 2CK3D 1M34E 1D9XA 2RGAA 3JZMA 1QF9A 4NTZA 3RC3A 4JKYA 3IBYA 2P6NA 4C0HA 4GOKA 1L4YA 5DLQC 1GRRA 3AUYA 2QT0A 3QVUA 5B57C 4LHZA 5F9FA 2WWIA 4BWYA 5FOVA 4HEJA 4CRWB 1ZC4A 3SC3A 4CEIB 1ZRHA 4IFBA 2CE7A 3ZZUA 3R9XA 3W8NA 4DWJA 4ZV4A 1W7AA 1ESMA 1N0UA 4G5RA 1E6CA 3KQHA 1GAJA 3ECCA 2P6RA 2ZI3A 1G19A 3DMNA 3AQ4A 3ASYA 1E9BA 2FFQA 3FPAA 3K0AB 4IXMA 2GCNA 3DKPA 3B1YA 3GJ5A 5CDFE 4IOJA 4GT1A 5HCIA 4Q1DA 2XOKD 3KUCA 5LB2A 4UKDA 1CJTC 1A7JA 1XEXB 2OSBA 1N6OA 1KYIA 3SYNA 4GOXA 2BKUA 1GL7A 4A6XA 4A0RA 4B2PA 1BYIA 1P60A 2BV3A 1DAEA 1AS0A 2RGNC 2ZJYA 4KLNA 3UG6A 3FTQA 1MKYA 2WJGA 3QKTA 3WNBA 1P2UA 2QL6A 1WBBA 5H8WA 2ATVA 3AF4A 4M9SA 3V4RA 1W46A 2YZ2A 3QXXA 4U02A 1FW6A 3PUZA 2NG1A 1XTQA 3QF4A 1U98A 4NU0A 1OHHA 4C0JA 3QNUA 5AUNB 2ZSFA 3A8TA 3C7KA 2IS4A 1DEKA 1CF4A 1A1VA 1OIXA 2YV5A 4DLRA 2GBLC 2CLSA 3MWLA 4NHOA 4Z8YA 4YDSA 2WICA 4HB4A 2WOJA 1J90A 3B82A 1W44A 4JLOA 3GFTA 3V9PA 2GJ8A 2XZLA 4ZCMA 2ZRNA 4MKHA 5EXPA 1W5TA 4DLXA 1N2CE 4EQ6A 2OM2A 2JA1A 3OIWA 4IRUB 5D3MB 3ZQJA 2JEOA 1TTTA 3GQBA 1KSGA 3OZXA 3ZVRA 3PR1A 2P5SA 2H16A 1X1RA 2JDIA 3EZFA 4HUQA 1VCNA 1G64A 2YOHA 1KZ7B 5BN5A 2EFCB 1MH1A 4PHFA 4DUGD 3KTAB 4BEBA 1DE0A 4R98A 4TT3A 2FN4A 5KTYA 5ELXA 2WWFA 4YQFA 4V0ME 1TU4A 4RCYA 1I2DA 1VG0B 1PZNA 3SR0A 1BMFD 4WVFA 3R8CA 3DMDA 1NJGA 2WTUA 2W6JD 1XPOA 3REGA 1R6BX 3H4MA 5KDDA 1NVVQ 6Q21A 2CCGA 4P33A 2GXSA 2OXCA 4RKFA 2QP3A 1OPXA 5CYOA 3TSZA 1G3MA 5L3QA 2JLYA 3K09C 2ANBA 3E5HA 4LHVA 4QL3A 3LQRA 2AXNA 2A5GA 2J0UB 3DL0A 2JLXA 3GLHA 1Q12A 2C9OA 3CF2A 1RRFA 5C4GB 4AK9A 1G4AE 2AK2A 1KDOA 2BBOA 2I1QA 3U61B 4EJSA 3LVQE 2WWGA 4M0LA 3U44B 4NKRA 1LTQA 2RKOA 1KTVA 1W2HA 4UXIA 4PHHA 3LX5A 5HCNA 3TQCA 2P2LA 5JEDA 3CNLA 2IUTA 1W0JA 2GK7A 1QZXA 2NZ8A 2SHKA 2AN9A 1IN8A 4OK6A 4BZQA 5JWOA 1S0UA 4ZDJA 1P9RA 2OAP1 2R2AA 1G20E 5C1BA 3C8UA 2C2HA 1KY2A 3CIOA 4FW9A 4LBWA 4EAQA 1QHSA 3K9LA 1AZTA 1Z0AA 2G1KA 2IUSA 2OG2A 1ZAKA 4G5OA 3TSWA 4WZ6A 1RZ3A 2VPPA 4TQ9A 5CB6A 4D2IA 3A1UA 2ZJAA 4OQLA 1OJLA 5FI0B 2IEYA 2O0KA 4HZIA 2W0MA 4TSFD 3CPEA 2DYKA 3L0SA 1AKYA 2NMVA 2CHVA 1TX4B 1ZUHA 4TLCA 3T06B 3I61A 2DCUA 1YRBA 5L3VA 3W3ZB 3PJRA 2VSOA 3WRXC 1DAIA 1HTWA 4J0QA 4PZYA 3W6OA 4DLSA 3PQCA 5TVKA 4DC9A 4TYYA 3QKRA 2ZU6A 4DSNA 1GKUB 3LA6A 2P3SA 4QJ4A 2RGEA 3MGCA 4LJ7A 1OV4A 1P3JA 3AEZA 1UAAA 2NQ2C 1KDPA 1UBEA 1V5WA 3QENA 1I4TD 2QAJA 3CO5A 3EC2A 1OXUA 1GUAA 2W0SA 5GVRA 1KI1A 5L8VA 1XU4A 1P2VA 2GJAA 3DVLA 4LBZA 3B1XA 1OH5A 4JL6A 3FFBA 2WWWA 4RD4A 3BXZA 4TLAA 1E2EA 4B76A 3TAUA 1VCIA 2BCGY 3L8ZA 4A4DA 1N5JA 1IM2A 1YR8A 2ATXA 1YZGA 3ADBA 4PQYA 5K8UA 4DDUA 4KITB 3TUIC 1T91A 1AM4D 1SVSA 3OIVA 4O3MA 4URUR 5FOXA 3MD0A 4NCNA 1PUIA 3RABA 1UKEA 3QE0A 2QBYB 4IOKA 1NLZA 4NZYA 3W90A 1G291 2VO1A 2BVNA 2J87A 2FF7A 1DO2A 3I4LA 4BEJA 5DN6A 1NN0A 1VG1A 2FSHA 2XNDD 1MO4A 1E0JA 3CRVA 2YOFA 3MUFA 5H68A 2ZRBA 4R71A 1EFTA 1M7GA 2I3BA 5FTJA 1OIWA 3BD9A 5LD2C 4D80A 3EA0A 3NBYC 2O8DA 1ZM9A 1XBTA 2AR7A 4OHWA 3AVVA 1M2OB 4N0EA 2YC2C 3K1JA 4ZCLA 2PZGA 4DXAA 1I2MA 2DWOA 2ZSDA 3KJEA 3OEHA 2GWHA 3K8YA 4YDHB 3CH4B 3AB3A 5EP3A 1IN5A 5FUYA 4PQFA 1RRCA 2V8OA 721PA 1KNXA 4QFMA 2QTVB 2LWIA 3WMGA 2JCSA 5EE1A 1EFHA 3U7HB 1VIAA 1Q21A 1NN3A 2OEPA 4LHWA 1XX6A 2W2XA 2ECKA 1FNMA 2D74A 3FVQA 1JECA 2Z43A 2HUPA 3GEEA 4HLDA 1ZINA 4PO1A 4B6FA 1DO0A 2O8EB 4JVNA 4JVMA 5EZ6B 2IHBA 4DLUA 1OXTA 2OLKA 3EAQA 2AFHE 1UKYA 4RZUA 3RRYA 2XTMA 2XZOA 1TU3A 1UM8A 3U7FB 2ORWA 4TLEA 1RPZA 1COWA 2D06A 3LQQA 1F3OA 1OSNA 5EXSA 4TYPA 1NBMD 4PPGA 3SE0A 3HP1A 2PEZA 3GLHE 5KSZA 1FP7A 2IS1A 1PLJA 3QPWA 4OQFA 2BM0A 5CM8B 4NH0A 4UNSA 5KU1A 4D26A 3KL4A 3P4XA 1X8JA 1ZW6A 3TKLA 3ADCA 4ARZB 2G3YA 1R0ZA 4NCJA 4B75A 4MGKR 3A4LA 4L4UA 1Z2CA 4N0DA 5IK2A 4H1VA 5J4YA 4TWZA 4QHYA 3UATA 4US0R 1KO8A 2V1XA 4GSYA 3SJBA 2ZS7A 5J4KA 3F3YA 4M9QA 1ZU5A 2J59A 4P4SB 3SJAA 2IX3A 4FCTA 2QROA 4M9XA 3DO6A 2WJHA 1GRNA 2N42A 4AG6A 4AKGA 2PT5A 3DZ8A 3IEVA 1HE1C 2ZJZA 1XD2B 2CL6X 5DH9A 2TMKA 2QTHA 1II8A 3IUYA 4UNPA 1OHHD 1TQ4A 2BIFA 2IYRA 3U44A 3X1DA 4I4LA 4PFSA 3Q9LA 2XB2A 421PA 1E9RA 3W3AA 4P4SA 3SU8A 1Q3TA 1CTQA 1E0AA 2D3WA 3QY0A 4G3XA 3TQFA 1P72A 1XMIA 1E2MA 1R5BA 2W6IA 1YKSA 1T3HA 4D4LA 4OQNA 4DEYA 1KMQA 4Q4JA 1GKIA 2OFOA 1SQ5A 1YQTA 3WMFA 5HZKA 2AK3A 1VYTA 2EFHB 5D3QA 3DEFA 4A0HA 3SBDA 1CR0A 4ZCIA 1OIVA 4XD7A 1J8MF 2R65A 1LVGA 5KDLA 3THYA 1YU9A 3OESA 5EQTA 1BOFA 1S2MA 3B1ZA 3O47A 1X6VA 3L43A 4G5GA 4HB0A 4LZZA 1OXVA 5HE9A 2FSGA 3B6EA 4Q4JB 2BKEA 2JJ1D 4Q9IA 2ZE5A 1DELA 521PA 1LB1B 2HV8A 1HA3A 3MWYW 4XVUA 4IDHA 3FWYA 4B2IA 2QM8A 3Q85A 1YE8A 2J0SA 4OK3A 2Z4RA 2J7PA 4MYTA 1NVWQ 1VG9B 4LJ5A 3U3OA 3AKYA 3VHLB 2YNMA 2F1HA 4M4SA 4BQSA 5KYKA 1TF5A 1OH7A 5J40A 1E2DA 5BXQC 3VNVA 3VR1A 1HUQA 1T4GA 1HV8A 2BHRA 1G6OA 1AKEA 4TSFA 2OESA 4QNMA 1N6KA 5IDVA 2H8KA 3T1VA 1J7KA 4LC1A 4OHZA 1XEWY 3ZGXA 4Z54A 4JLVA 4TL7A 3AVWA 5BN4A 4B32A 1RJ9A 1ZIPA 1L2TA 4RY2A 1U94A 3M4YA 4C0SA 1UBFA 4HAUA 3LXXA 3QSYA 3AM1A 2ZI5A 2OO7A 1II0A 4I81A 1D9ZA 5G3YA 3ZQ6A 1TL7C 2VTKA 2O5VA 4RD2A 1G8PA 1VCMA 4OKSA 2XX3A 2WJJA 1R5OA 4OHVA 3O8CA 1WP9A 4IXNA 4UNNA 3RSOA 4P3YA 4AC9A 1XMVA 2ZI4A 4YMVA 4JBXA 1Z08A 5B2ZA 4HDOB 5JCPA 5GJCA 4A2QA 2R44A 4W5HA 1MABA 2BMFA 5B30A 3CWQA 1ZYUA 4OI1A 3VQTA 5JS7A 2ODEA 3N5CA 4I1UA 2CVHA 2WHXA 3VR6A 3A4MA 2QUZA 1XPUA 3GJXC 1PV4A 4Q5IA 3EZ2A 2DFTA 1U0HC 3KB2A 4RFVA 3AVQA 3Q7PA 4GNKA 5FUVA 4DDVA 4C3ZA 1KK2A 5DNYB 1XEFA 3U7GA 2PJRA 1UKVY 1IN7A 3B2EA 3KFXA 2QP9X 4PSVA 3KB1A 2A5JA 4PC7A 3Q5DA 2NZJA 1Z5ZA 2ODNA 4TYWA 3QOFA 4KYIB 3TRFA 3EPHA 2R6FA 1OF1A 3KTAA 2DY1A 2ZJBA 2GVZC 1D2EA 3AVUA 2FX3A 2IYUA 3CRW1 3JVUA 1FNNA 2ZEJA 3IDQA 3RSLA 4NCKA 4MH0R 3A1TA 3CX7A 1NI3A 5FBLB 1KK3A 1E9EA 2ASEA 1Z0IA 1WXQA 1E2QA 1Q57A 5A0FA 3QF4B 1NF3A 3HPQA 3U4QB 2QE7D 221PA 3GLFA 4X8OA 1VPLA 4L15A 3RWOA 4Q1BA 2AD1A 2QQEA 5AJWA 2PCLA 1Q1ZA 2YOGA 3IQXA 4AWXA 1I4LD 2REXB 4L9SA 4FINA 4B74A 5L3SB 2GVDC 1N6HA 3I62A 3CNOA 4JBYA 3H0KA 1LY1A 2G77B 3VR5A 5L3QB 3LBNA 4A82A 4C0AC 3MFYA 1E1QA 1KSJA 1B0UA 1F6BA 1IQPA 3NH6A 4ITRC 3KFVA 4HZUB 1VTKA 1GOTA 3T61A 3U3JA 2EFDB 3Q3JB 5UKDA 1X3SA 1KI8A 1CBUA 3WP1B 3THXA 4QBFA 1K5DA 1Z07A 1W0KD 1U90A 1XJ0A 4XSHA 4PSAA 2C96A 4WOPA 1D6JA 2W6ID 4Y0AA 3E2IA 1E1QD 1ZM4A 3AVOA 2YKGA 2NGRA 2PMDA 4QNRA 2YWFA 4HLQB 3UANA 3SQWA 1JXOA 2CCJA 1A5TA 1E69A 1VHLA 3ASZA 1X1SA 1Z6XA 1QHXA 1G8FA 2EFEB 5SZJA 2P5TB 1KO5A 1U8AA 3L0OA 3GD7A 4LI0A 5FUXA 4YXWA 3SQXA 2UZIR 1JPJA 5IF9A 1A2BA 2CBZA 2H92A 2BMDA 2ZS9A 3GP8A 1D2NA 5DI3A 3A6PC 3LVRE 4D25A 4R9UC 2RH5A 1MO5A 1VIYA 4PR0A 4OI2A 5FR1A 4C9BA 3LBIA 4BLQA 3T1OA 3B9QA 3LX8A 1P62B 2MSEB 1H65A 1OFTA 1VYVA 2QAGB 1E99A 1BH2A 4DDWA 2IK8A 4DBLC 2GEUA 5KPDA 2FEOA 1SZPA 5TDHA 2VHQA 1JQLB 2PBRA 2W2TA 4GP7A 4H1UA 1T6NA 1GP2A 4PQRA 1XJCA 2VQSA 1G3RA 1Q1EA 3AVTA 2G6BA 2BEKA 3KZ1E 1EFRD 3NC1C 3Q7QA 1S3SA 1UKZA 3SBEA 2CK3A 1IJFA 2J5XA 3ZS8A 1GM5A 3B7GA 3EZ9A 4QGGA 3U6KA 3FMOB 2GXUA 4IOMA 4FIDA 2GCOA 1A82A 1Q44A 3D8BA 5SZIA 4EDHA 5GJVC 1D8TA 1WA5A 3D3QA 1W49A 3FMPB 4N3NA 2G83A 1SKYE 4KSBA 3KKNA 2GILA 2Q9CA 1UFQA 8OHMA 1ZP6A 4CW7A 1WB9A 3GJ8A 1Z0JA 5JSZA 1IXSB 1XTIA 2GEDA 3EIHA 2Q3HA 3QJYA 4BPBA 1G8GA 3TE6A 2Q0HA 2X2FA 2Z4SA 1IY1A 3VKWA 5BYKA 4AI6A 2WPDA 1JEDA 2NTYC 1G7SA 4NL4H 1JR3A 1NJFA 2A5YB 3B85A 4AD8A 1RYHA 3NC0C 3VMFA 2G1JA 2ZYTX 2X19A 4WXPA 1Z3IX 2O8FB 2B8WA 3BH7A 4UXJA 5JSZB 3UMRA 4G1UC 1NVUQ 4OJQA 2F3RA 1KZGB 4CEIA 1C9KA 1F2UA 2DHRA 2KE5A 3BIFA 4M1WA 5KUTA 5G40A 1W4RA 4TZ0A 5FOTA 4DVGA 4PPFA 3GLGE 1BYUA 1KDTA 1YR6A 2W83A 1W4BA 4A36A 4Q9KA 2GAOA 4A6PA 5TB5A 1US8A 2ZM5A 2O8BB 3RANA 2WJYA 4CF7A 3VR2A 5KDOA 4CVNA 3TW8B 2IL1A 2R62A 4NYJR 1K6MA 3GJ7A 1LNZA 4KVGA 1CIPA 5J4VA 5EE9A 5E95A 1JAHA 4CDGA 2XXAA 1UADA 1RVDA 5DHAA 5EP2A 1U9IA 1KSFX 4Q21A 1G5PA 1E9FA 2XEXA 2QQ0A 4WIAA 2V55B 3LDAA 3U6BA 4QHTA 4LY6A 5FBWB 2O8BA 1NG1A 2FH5B 3RS5A 1G3IA 2VSFA 3UG7A 4XWAA 4QBIA 1OT3A 3PXGA 1TF2A 2A30A 3MRSA 3K0SA 4BLOA 1UJ2A 3MJHA 1RW4A 5FOUA 2GETA 3I32A 4WAUA 2ZS8A 3BORA 4JIMA 2WAXA 4Q1EA 5IHPA 1JR3E 2NO0A 3DOFA 1OFIA 2GCPA 2BBSA 4A8JC 1LS6A 1CJMA 1DAMA 1Z22A 3D7MA 4UQOA 3NVAA 4C30A 3QPVA 4KI0A 3AKDA 1IN4A 3EXAA 4LBVA 4ESHA 4LK2A 2WV9A 5JRZA 3EWAA 5BWMA 3TIFA 2BJWA 3TGPA 1D2MA 5G53C 1W0KA 1N5LA 5E7JA 4DCTA 2WSSA 1S4QA 2GK6A 3UPUA 4JMPA 2XAUA 4HUQB 4KCGA 1OYWA 5L3SA 1N0WA 3UIEA 4GMDA 5DI9A 1QVRA 3I72A 3QG1A 4Q01A 3B78A 2ZVPX 4UJ3A 4GDFA 2X1VA 4TN1A 2O8EA 5K8IA 5KOYA 2ZAOA 3WRYC 5AWFC 2RB4A 2I1VB 3HDTA 3HR8A 4HZUA 1E1RA 4GI7A 3LD9A 5DO9A 3CR7A 2WAYA 4FN5A 4P4TA 3RRNA 1DAKA 4TMTA 3SS8A 3THXB 1CXZA 1JAIA 2JLRA 3K9NA 4M1KA 3TNFA 2ZRPA 1U8ZA 5IRCD 4D82A 1M7HA 1G4UR 2UZ3A 1OB5A 2ZRKA 3EIQA 3RS3A 4AYXA 1DAFA 4OK5A 1NN1A 2ORVA 5H70A 4DDTA 4ACAA 2GF0A 1SKQA 2HCBA 4LJ8A 1E1RD 3ZD6A 2C9CA 3QPUA 4CT5A 4IW3B 3ZLJA 4YMUA 2EWVA 2QI9C 4ASUD 3ICEA 4EUNA 1FP6A 4HATA 4XWKA 1ZC3A 4LYHA 2VHTA 4EJSB 2AHOA 5SZKB 3C14C 2FOLA 5GADl 1NP6A 1G21E 2GZDA 2YC4C 2OBNA 2O52A 3QF7A 1XPRA 3J81k 4NCIA 4B2LA 1KI4A 4DT1A 5JHHB 4CEJB 1XNJA 1GZSA 4FCVA 4G5QA 4PTLA 2DFNA 1YZQA 2RGGA 4QGHA 2AXPA 4HYYA 5JWRA 2CL7X 2FFAA 4CIDA 1JR6A 4F4CA 3A4NA 4QBHA 2IT1A 1E32A 3RC8A 3L0IB 1P4SA 3K70C 1NN5A 2IYYA 3BGWA 3TR0A 3HPRA 2MMCA 1B23P 3PENA 3QIAA 5J4HA 2XITA 1CR4A 1JNYA 1RC8A 2JAQA 4YXWD 4C0LA 4FWTA 5CK4A 3LFUA 1XMSA 2CJWB 1XD9A 4XVRA 3F8TA 1XCMA 4M22A 1X8LA 2BJVA 4GMXA 3TH5A 1P2TA 4KODA 5FI1B 3LW7A 2OBMA 4G0NA 4LRWA 1L4UA 3TSOA 5EUMA 1NKSA 1RJ9B 1S96A 4MUAA 4RD0A 5DYGA 3THWA 3THYB 3BAFA 1IBRA 3WP0A 3IPYA 4C2TA 5DN6D 5AR1A 2OFXA 3DPUA 3KJGA 3LAWA 2XZPA 4B6EA 2GJ9A 1DARA 2C98A 3A1SA 4KO8A 4F92B 1VMAA 2AL7A 2BCJQ 1WRBA 4IDOA 3CM0A 4X8LA 3RWMB 4DUGA 4WXRA 5AUOB 5P21A 4WBSA 2O8FA 1GIAA 2ZRAA 4KSCA 3WY9A 4IEEA 1ZM2A 2IYZA 1KDRA 4HLUA 4LYAA 1VHTA 1JALA 5FTLA 3EPLA 3AVPA 1QHIA 3BOSA 2A78A 3NBXX 5CLQA 1FUUA 2MSCB 4HDQB 1BIFA 3EIEA 4XSGA 4YONB 1A2KC 1CR2A 5FL3A 4DLYA 4UNQA 1P5ZB 4YLGA 4ILEA 1E9SA 5FTMA 3IIKA 4I1SA 3K9GA 4JLDA 1VCOA 5EXTA 3KXKA 1EFRA 1N6LA 3B9PA 3U3KA 1GTVA 3PCRB 3TUJC 1SXJB 5C2JB 1HE8B 2J3EA 2ZJOA 4M1TA 4EPRA 5CK5A 2ZAMA 3BS4A 4MRSA 1OB2A 5EP4A 4O2LA 4XOIA 5JBQA 4ACBA 2H18A 3L82B 3L0PA 5D3MA 2VIIA 1C4OA 3DHWC 3IILA 3LW8A 4LJYA 2OE2A 2PX3A 4C4PA 4W5WA 5FPHA 4TMXA 4KFSA 4LHXA 3AF2A 5DSZA 3CB4A 1NNEA 2IS6A 1YR7A 4KYUA 2NIPA 4N1AA 2GA8A 1ZBDA 1SVIA 3CLVA 1I4DD 4GRAA 2PX0A 4LDJA 4II7A 2VYFA 4LYFA 5LDDC 1OFUX 2QSZA 1ZUNB 2BWJA 2EVWX 2C8VA 1N6RA 2C95A 2F43B 1IY0A 4W7SA 1D5CA 3VKHA 4JKIA 1U0LA 1YZTA 2VLIA 4L9WA 4BFZA 1OFHA 4TLBA 2CMKA 4Z8XA 4Q4HA 1ZJ6A 1M8PA 3JZAA 4KHZA 1AIPA 2V7QD 2AWOA 3RAPR 3I5YA 2V9PA 3NTUA 2R6GA 4BUJA 1U81A 4JZKA 1SHZA 3TW4A 4DT1B 4CEJA 2IA5A 1GITA 4HAYA 3QXHA 4ZDWA 4IVRA 3H2YA 2C9YA 3UKDA 3OIYA 3GLHB 4LJ6A 4DLZA 4S2EA 2H17A 2QNRA 1W1WA 2QU8A 3AUXA 4HB3A 4NMMA 4MRRA 3PEYA 3LRPA 3VFDA 1CULC 2I4IA 5FPYA 4X8HA 3M0EA 2VP0A 3AKEA 2IYSA 4R7ZA 2ZRIA 2V7QA 1LFDB 4Q9HA 1VG8A 2WKRA 1OW3B 3MWJA 2QMHA 4CZ2A 3WXMA 4WW0A 1DAHA 2DWQA 2D7CA 1NG9A 5TY0A 3BB3A 1IY2A 1KMHA 4US2R 2C04A 2DPXA 4XH9B 4AKIA 2DR3A 1MR3F 2IXGA 2IC5A 2VP4A 2ZRCA 1W48A 2K5UA 2QMOA 2ZI6A 3R7WA 4OQMA 3OE7A 4LWZA 3BK7A 4D4MA 1T5IA 3GMTA 3HYTA 1E2LA 1E96A 3OF5A 4M21A 1PJRA 1KJYA 3B1VA 2O8CB 5J5CA 1GNPA 2GJSA 3HU3A 4Q02A 1J99A 2HJGA 2EWWA 2VL7A 2XJ9A 3T15A 1E9AA 4TL6A 2VBCA 2YJTD 1Q0UA 2ZR0A 4RZ2A 5IK2D 2JJ1A 2HYIC 2IXFA 3BE4A 5TXGA 1LF5A 4NYJQ 5F2EA 1CU1A 4JLPA 5E3HA 4OHYA 5CYPA 4F4IA 3AVXA 2D4HA 3UMSA 4M53A 4AKEA 4JLBA 1S1CA 1KAOA 5CIQA 4MRVA 1E79A 1GG2A 3DDCA 3O8BA 3OFNA 2WWHA 1Q3HA 3CX6A 4F4JA 2CNWA 2BMEA 3GEHA 4RKEA 4V0KA 3CW2A 1OH8A 1NBMA 5A5GA 1H8HD 2VSXA 3E1SA 4TMKA 1X8KA 2CCKA 5KNDA 3K0AA 2B21A 4TMVA 3SZRA 3EG5A 1UDXA 2DFKB 2Z6VA 3BERA 4HSEA 2DFLA 5LBIA 2OFWA 4AYWA 5C4MA 621PA 4C7OA 4Q4LA 3CZQA 3QI2A 1KI6A 2WPDD 3V00A 1XTSA 4E09A 3OHMA 2R8RA 4K46A 3NKVA 2R9VA 1KO1A 1G1MA 3ZIAA 4BZPA 3PVSA 3Q8XB 1AA9A 1Z83A 2R6DA 1O87A 4LV8B 1ZIOA 3P26A 3BB1A 2W00A 2L0XA 3AVYA 1KI9A 1E98A 1KHTA 1YVDA 3W6PA 4M1MA 3CONA 4URXR 1XEXA 4FMDB 3T1QA 4C0BA 1W47A 2ZRDA 2OBLA 4A8JA 1PVOA 2OUKA 2WSSD 3NIBA 1QHGA 1ZM3A 5E4FA 3SJCA 5F98A 2FG5A 4JL5A 4ZDIA 1AGRA 1XD8A 2QT1A 2G9NA 2FJUA 2JATA 4AYTA 1W36C 2AX4A 4LX0A 4OQXA 2W58A 3T5DA 1ETUA 2ERXA 2UVQA 5AK0A 2F55A 2ZJ5A 3QXJA 1KY3A 3GPLA 1R0WA 3NH9A 5HZHA 5BN3A 5JFGA 4PPNA 2QAGC 1N5KA 1YZNA 1YZLA 4KVAA 1AQYA 2HF8A 1AS2A 4JT4A 1NSTA 3A36A 4PO8A 5GJWC 5JHGB 1EGAA 3CPJB 3RVBA 4A15A 2OAQ1 4OL0A 2JLVA 1Z29A 3NWJA 821PA 2WKQA 3VU9B 4JSTA 3SHFA 2C78A 1GNQA 4YMWA 3TK1A 3K0FB 4QJ3A 3IO3A 1UBGA 3RHFA 1WDTA 1NLFA 1TQ6A 2HXYA 1LV7A 2GESA 4JBWA 3A1VA 3PEUA 1WBDA 1QRAA 5JLJA 1SXJA 3M6AA 2IYXA 1UEIA 4OI0A 4TYQA 2N1BA 3D31A 1EK0A 1P75A 3VU9A 1DG3A 2JLQA 2UKDA 2Z0MA 4B73A 5K8LA 1GILA 2X77A 4AY2A 4MUBA 4ZI3A 4RD6A 2FZLA 4TT3D 4Q00A 4CYMA 2OCYC 1MRNA 1SXJD 3M1IA 4IEIA 3ZJYA 1JI0A 4TLDA 1G9XA 1BMFA 3F5FA 2JASA 3MLEA 2BOVA 4P0TA 4B3CA 4QRHA 5HTKA 3GLIE 3MAAC 2RGNA 2AKYA 1SVLA 1OLOA 1VYUA 5DISB 3HYRA 1YHNA 4PZLA 1KO4A 3IKJA 3EX7C 1XXHA 5FOSA 1R10A 3EC1A 3LWNA 5KNCA 3ZYCA 3FFAA 4LBYA 2WJVA 4L8GA 3MG9A 3VAAA 4MGZR 4MDEA 3OE7D 3TJZA 2ZR9A 3FMIA 4MKGA 2EU8A 1EXMA 4XTRA 2P0EA 1FTSA 1SVWA 1TAGA 3W8RA 1H8ED 2FNAA 2LKCA 3F0TA 4KJZA 2N46A 1QDEA 1NSFA 1HEIA 1HT2E 1OE0A 2QZ4A 4IKEA 2EYQA 2HT1A 4DIEA 2OV2A 4BZXA 2CVFA 3CF0A 1TUIA 1XEWX 3EWSA 3KX2A 3SEAA 3LBHA 1TF7A 1FPMA 1TMKA 1Z8FA 1DOAA 1PLKA 1T3LA 2QPOA 3QEOA 4GOJA 4JLNA 4PHTA 1KOFA 1YZKA 3T35A 3UMFA 1E4YA 3BWDD 2VP5A 2HF9A 1KI6B 2ZE8A 3GJ3A 5JJKA 1G8HA 4A0FA 4YMTA 2ZQ5A 2O8CA 1YJ5A 2KBFA 5J4LA 3QKRB 1G3UA 2FPMA 4Q66C 3THOA 4D4KA 3FHOA 3TVTA 4MKIA 4OBEA 2QY9A 1K5GA 1SKYB 5AUPB 2H57A 3PV0A 3TBKA 1DS6A 4PC6A 2RHDA 5KPJA 1KI7A 4JLMA 2VP2A 1ZNYA 2X2EA 4BFXA 1T5LA 4PZZA 1S1MA 3C5CA 3KQUA 1KK0A 5DGXA 1F48A 1NMYA 1Q22A 1G17A 2HLDD 5CDFA 1KAGA 2YVUA 2JLUA 3NHAA 3MJRA 2IYWA 5FFMA 1ODFA 2BBWA 3FGNA 4I99A 1KNQA 4BFYA 4G5SA 3GJ4A 3IHLA 3KXLA 3BH6A 3U2QA 4GFDA 4Q7MB 2EW1A 4EFNA 1FFHA 4NDZA 4TL9A 3VHXA 1KJWA 4C7OB 4HLCA 3CR8A 3C5HA 3JVVA 1XCPA 4RZXA 3RS2A 3TUZC 1E3MA 3TVDA 4MRNA 4BFTA 2HDNB 4M1SA 1RYFA 2P67A 3AH8A 1GNRA 1ZD8A 2CHQA 4LPKA 3MMPA 3IIJA 1IAQA 3QEJA 2H1LA 4XD7D 2O0JA 1JBKA 2Z83A 2QN6A 2BBTA 1AZSC 2IF0A 1OXXK 5TARA 3ONWA 4NONA 4URZR 4EPWA 2PZFA 3AV0B 5KO2A 2JDID 2O8DB 4QC2A 1W4CA 2R6AA 3C15C 3GLFE 4H9GA 2ZI9A 2ERYA 3P32A 2ZSEA 1NY6A 1U8YA 2OCAA 3C4JA 3KUDA 4KLZA 4GL2A 4FMBB 1F2TB 2ZSAA 4F93B 5EE3A 3SDZA 1NY5A 3X2SA 3DM5A 2ANCA 2J7PD 4JVSB 4UXHA 1AK2A 4ZO4A 4M2LA 3X1WA 4BFSA 1Z6YA 1VKJA 5AUQA 3ADKA 2GAAA 2PZEA 3THWB 2QTFA 1WCV1 3LV8A 1T8UA 3P20A 2BM1A 5FPKA 4NYMR 1TPZA 1ZM7A 2REBA 3CKLA 2GXAA 4TMWA 4O0MA 3VNUA 3P27A 3QXCA 4EKDA 5F3WB 4IDQA 4HAWA 1SULA 1HH4A 2DB3A 4TTRA 4GPTA 1BKDR 4MQBA 3Q5EA 2PEYA 3QVVA 1TUEA 3K0FA 4B3FX 5FTKA 3UXMA 1MOZA 4M1YA 2IXEA 2OHFA 2Q9BA 2QMUA 4KV9A 3SYKA 3G0HA 2J0QA 5FTNA 4D0LB 3MSXA 1AQUA 5FBQB 4LV6A 1M74A 1GVNB 4HB2A 4EFLA 3FOZA 5LB4A 4Q4AA 1E2IA 1E2KA 2ZYUX 3ZS9A 3VX3A 2WKPA 1ELOA 1NLYA 1J2JA 2C99A 2F9LA 2JLZA 1FZQA 5JCZA 4BRWA 4B3XA 1NBME 4GZLA 1S9HA 4HLUC 4MKFA 3RYTC 4POAA 5EZ5A 121PA 4TYNA 5G3ZA 3RRZA 1L7VC 2GEVA 3I5XA 1FTNA 3K70B 4ON9A 2ZRHA 3OEEA 3GLFB 3N2EA 3VX4A 4ZIRB 5TV2A 3WYAA 1FL9A 2J0VA 4BASA 2ZI7A 1NL3A 5JECA 2FFHA 2QM7A 3LXRA 3CRMA 2F6RA 4DCUA 1ZCBA 3C41J 1CJUC 5CIWA 3I8SA 1JJ7A 3QBTA 4B3BA 4CT4B 3KKPA 2CEAA 4BFUA 4RZ3A 5CITA 4RD3A 2B8TA 1QHNA 4Z51A 1P73A 3A58B 5JI3E 1G16A 2EQBA 1RE0A 3U3MA 4A9AA 2E1RA 1NMXA 1ZUIA 3K09A 3RLFA 2OXRA 4ZIRA 2IF2A 5TMPA 1AN0A 4PHGA 3WNDA 2F1IA 4JLKA 4FWIB 2D2EA 2ONKA 2CL0X 1E2PA 4FMCB 4DZZA 2QGNA 3WYFA 3W6NA 4KFTA 1LS1A 4ASUA 1DAGA 4NPHA 2E9SA 4MYHA 4Q9LA 1Z63A 5M04A 2ZJ2A 1DBSA 3WHLA 3WBJA 4FXPA 5FH9A 4B3GA 5BQ5A 4ZPXA 2CDNA 2WMOB 4V0NA 2P65A 3E70C 3PUVA 4LHYA 4UNRA 5CB8A 1CP2A 2GZHA 4OI4A 2ZVQX 1Z0DA 4ZDKA 5H1YA 1ZU4A 2JIZA 2F7SA 3WNCA 3V4FA 3IIMA 4KAXA 3R8FA 2XTNA 1KI3A 1CRQA 1AGPA 2GRJA 4PAQA 2YYZA 3N70A 1TEVA 2WMNB 3OIUA 1U99A 4LCBA 3W9YA 2PH1A 2ZREA 3P1JA 4P31A 3S1AA 1GFIA 2QAGA 1Z2AA 1SGWA 5ANRB 3GFPA 3TAHA 1E79D 1KKMA 1U0JA 3KKQA 3G5UA 3K0CA 3AGQA 4IVPA 1KGDA 1KI2A 1FQKA 3HWSA 2GKSA 1Z47A 4TTQA 2BDTA 4HAVA 1XRJA 4JJKA 3MWKA 4B34A 1SVKA 3MCAA 4E22A 1SXJC 2V6JA 4URVR 1N5IA 3KQKA 4QKQA 4KFUA 4R2IA 1CR1A 1TQ2A 2ZUBA 2OLJA 3NBFA 4MGIR 3PFIA 1IXRC 4CEHB 2QPAA 1II9A 2YINC 4V03A 1EX7A 4RSGA 4JVLA 4B43A 2VEDA 1PUJA 2KWIA 1Y63A 4JLJA 4Z1MA 2ZRMA 2W6JA 3HJNA 4I1VA 1SHKA 2G0TA 3DOEA 3IQWA 4EQ6B 3EASA 2FE4A 2CJWA 3U7EB 4US1R 1XTKA 2ZSBA 5JEEA 2FWRA 1W36B 1XTRA 3RNLA 1ZMXA 2MSDB 5B58C 2FA9A 2CE2X 3CRQA 3LY5A 4CEHA 1JR3D 1Q20A 3H86A 2QPTA 5C18A 5EUQB 2B7BA 1T0HB 3NHBA 1T3SA 4O2RA 2CHGA 2IYTA 1J70A 1M6NA 4GP6A 1XZQA 3FKSD 3BFVA 5L3RA 4P32A 4A1FA 1PLLA 4OJKA 5EXXA 1XJQA 2FGKA 3ETLA 2OZEA 3K70D 3EW9A 1DVRA 4TQAA 3PEWA 1WMSA 1XTJA 1R5NA 2PJZA 2ZR7A 1HY3A 4PC2A 4KBFA 1E94E 4DSTA 2WM9B 4IDPA 1F60A 3AF1A 2QEQA 2WOOA 4PC3A 1E2FA 1KK1A 4DCSA 2CLCX 4O25A 2ZRFA 4DCNA 1OXSC 3BH0A 4LSGA 3B13B 1SVOA 1YZUA 1HURA 3FB4A 3HU2A 3K9HA 2EYUA 1QHYA 2ZYVX 2D7DA 2NPIA 3SI7A 4XTCS 1RRPA 4QJ5A 4UJ5A 4JYBA 3SJZA 5CJ2A 3EA5A 2VHUA 2AD5A 2QG6A 4V02A 4NYIQ 1E9DA 2GJKA 5DYIA 1N6PA 4V0LA 2J1LA 4B48A 4FMCF 1LW7A 1R8SA 2ZRGA 5LD2B 2JIZD 4EFMA 1R0YA 1E2GA 3A1WA 1MV5A 4JJZA 4MYUA 3N2IA 4DEXA 4PAMA 5FOWA 5F9HA 2VP6A 3CRRA 2FEMA 2XNDA 1J8YF 1KIMA 2ZUCA 4PPQA 5AJYA 1W2GA 5JMTA 1P7CA 4Q1AA 4EJSC 4B44A 1N6NA 4URWR 2OCBA 2Q3FA 3UK6A 4IVQA 1QG2A 1P9WA 3CPHA 3QUSA 4XIGS 3FE2A 5EP1A 3WBKA 3VR3A 4OYHA 3IHWA 5CLLA 2QRNA 2YWEA 1NRJB 2RGCA 2IYLD 3SN6A 2QORA 1GDDA 4DLVA 1MO6A 5FBRB 4DLWA 3VR4A 1ONBA 1FX0A 1N25A 4MITA 1T0JB 3LO5A 3CH5A 4DHEA 3C16C 2QMEA 5JJIA 2Z5FA 1R7RA 3ADDA 3GLGB 2F43A 4EPYA 3D6TB 4PAOA 1XF9A 5DHFA 5HE8A 3S1AB 2FSFA 4BLTA 2H7VA 2R6CA 2WVJA 3EZ7A 1NMZA 1HQYE 2ZRJA 3TR5A 4QBGB 3GJ0A 5JZVA 2FZ4A 1XXHE 1UBCA 4TMZA 2FGJA 4Q4HB 2NO1A 2GDJA 4GBMA 1RRGA 4ABYA 3ZD7A 2WIAA 5KSOA 3SFZA 1IHUA 3ND8A 2WWXA 4KBGA 5AJXA 1NKTA 1P61B 5FR2A 4Q19A 3PIRA 4URYR 4XJXA 5JRJA 1MT0A 1BS1A 2J41A 3H84A 3PUYA 3SYLA 5FPTA 1IOZA 1GL9B 1XP8A 2IEZA 2F3TA 4BECA 4HI0E 3AP1A 5AJZA 2GTPA 5GJBA 2KI5A 1FOEB 1TEXA 5C46F 3SNHA 3GFOA 1M7BA 4BFVA 1Z6AA 4DSUA 4ZKDA 4I1OA 2Y8EA 4JYCA 5JS8A 1E0SA 3NDBB 5EE0A 3T1TA 1FMLA 2C03A 2PLRA 3Q72A 4LUCA 1SVMA 2GBLA 3QQ5A 4D0NA 3CX8A 2PLFA 2AKAB 3X1ZA 1DTSA 4B35A 1R0XA 1G5RA 3I8XA 2GCOB 2WZQA 1R4AA 4MA4A 1OKKD 4K81B 1C1YA 3IPXA 3SHWA 5FBVB 1T8TA 5B64A 4IOLA 4Q03A 1ESNA 4RD1A 5CJPA 2WIBA 1OH6A 2IS2A 3PUWA 3FHTA 2VA8A 3RS0A 2X8AA 4B3DA 3DKVA 1IXZA 2XOKA 4L16A 4D4JA 1T9HA 2HT6A 2QE7A 2B7CA 2FV8A 3EZ6A 2A5DA 2VF7A 3I73A 4D0GA 1CEEA 1EFUA 2ZE7A 3GEIA 4DCVA 2QA5A 3TMKA 2RGBA 4PX9A 2ONJA 4B71A 3BJIC 2A7QA 1XZPA 3NEYA 4HAZA 2H5EA 3BBPA 3R9IA 3X1YA 1XB2A 1US8B 1N6IA 2GZAA 5K8TA 4Q1CA 2HYDA 1G3QA 2CLDX 4TTPA 1V43A 1E2NA 4AG5A 4JL8A 3A37A 3U5ZB 2ZROA 1G6HA 3DM9B 1F2UB 2ZETA 3AP3A 4ERNA 4M9ZA 4X8MA 3OEHD 2J45A 2IUUA 2IYQA 5EE5B 2XGJA 1JJVA 2YWGA 5JWHA 1CLUA 2LCFA 4KU4A 2ZTSA 4HDCA 5GVSA 4ZKEA 2J7KA 4LPSA 2V4ZA 1ZNXA 3U4QA 1G41A 4DLTA 2FPLA 2XSZA 5A4JA 3W5JA 1XDBA 3PUXA 4WZAE 3L2OB 3K53A 2XXAB 1Z0FA 4MRPA 2PMKA 1Z28A 4RJLA 1EWQA 2GXQA 1GRQA 3CWZA 2QGZA 2VH5R 2ZU0C 3K0CC 3NXSA 1AJEA 1XFAA 5FUWA 3RRMA 1VECA 2JJ2A 1G5TA 1UEJA 4IHQA 3FKQA 5BYJA 2ODBA 4NE2A 1COWD 1CKEA 2KJQA 4NYIR 2NO9A 2D2FA 1G18A 3VTKA 4EPVA 4QGFA 1EX6A 3HR7A 4BFWA 2IW3A 3G82C 3UWKA 1XD2A 3HU1A 1RIFA 3O8DA 1II8B 1VDZA 3ND9A 2DWPA 1M1YE 2CNWD 2ZJ8A 3FKSA 4DB2A 4GZMA 1FQJA 3RDPA 4IFEA 1E0KA 1H8HA 1F2TA 3OAAD 1G7CA 1P6XA 3KDSE 1FX0B 2JJ8A 1NIPA 4TZ6A 2FSIA 4LOAA 5SZHB 1WQ1R 5FL7D 4LJ4A 2CXXA 4WA7A 3BFKA 4RVCA 1WF3A 1ANKA 1XWIA 4JT2A 4MGYR 1GKYA 1YR9A 4QXAA 1XMJA 4G01B 4KXFB 4BLRA 2Q21A 4HUTA 4A92A 1O3YA 4Q1FA 1Z06A 4NYMQ 2ZRLA 2IBMA 1JQJC 5DI3B 2DBYA 3B60A 4IDNA 3ZVLA 4DSOA 2HJVA 4D6PA 3EARA 1KJZA 3FMFA 3FDIA 3QG5A 2J46A 1EESA 5FL7A 4Y0VA 4AKHA 2F9MA 2ZXUA 4Q48A 1IN6A 1P9NA 4DJTA 1GL6A 4Q4AB 2VHJA 4V0OA 3VKGA 3CF6R 4B47A 2QRZA 1IONA 4FD2A 2ZITA 3B8HA 4LC0A 4MYCA 3WHKA 5HPYB 1S9DA 2HXSA 2WSMA 3FYHA 3NG1A 2V1UA 2IWRA 3BB4A 2NPFA 4YC7A 4DRZA 4Z1MD 2W2VA 1WE2A 3IO5A 3P4YA 3GLGA 4FMDF 2V3CC 4LJAA 3B1WA
chains in the Genus database with same CATH superfamily
3W5DA 4K40A 4PO9A 1HZJA 1VGQA 3RTAA 3SC2B 4LJ9A 1DNPA 3IMKA 2FQQA 2Q3MA 3P0HA 2E87A 3MTEA 4IO0A 4LZPA 5CX4A 3HVKA 3HNPA 3SCZA 1R9NA 1Z88A 2Q6TA 3E27A 3I4FA 1QVAA 1Q19A 3A11A 2XMGA 4NNOA 2G08A 1KEPA 4O1MA 5MN4A 2ZIAA 3FHCB 3VOAA 1ONPA 2IEAA 2HHAA 1W36D 3PXEA 1NVXQ 2P6UA 2NZWA 2VF8A 1SOWA 4BGDA 1O95A 4UUOA 4MDFA 3WLIA 3RAFC 4CGZA 1KMHB 4PS1A 4HDMA 2YVLA 3OA0A 4X9XA 2RHLA 3EF1A 4M89A 5ITZA 1FE8A 1U2DA 3PYMA 4RHCA 3FFXA 3W5HA 2PPVA 2ZBQA 3CVOA 4KREA 1FLVA 2TSYB 3LNCA 3N8KA 4MW6A 3OJFA 4IJMA 2OT3B 4A26A 1TYAE 4LY9A 4UTPA 2PTHA 4IS2A 2F1JA 3V8MA 3VSDA 3U1TA 4CKZA 5IXJA 5L7YA 4M7WA 1SRRA 5T3YA 5AJVB 2HLDA 2XMSA 2E4XA 3DZCA 5C31A 5A7FA 4PY2A 1BD3A 2NQTA 4OHMA 1H66A 2NO6A 4UOQA 3ZDQA 3T9DA 4F7WA 5K7SA 2IOYA 5B3JC 3RYFB 3NBZC 1N7IA 1RRVA 1WULS 2B25A 3BTOA 3BHMA 4Y7CA 3L40A 5IVPA 2KSQA 1S3GA 5EJEA 3KDAA 1S2NA 5A05A 5HGXA 4KQHA 1UK7A 2FMHA 2A2ZA 4FPXA 4GM1A 2PK3A 3VU3A 1UF9A 3ILSA 1V1MA 1F06A 5IDYA 4Q47A 3RLIA 1JEEA 4D5GA 3H11B 5HKKD 5I4CA 4BE7B 5LMZA 1DADA 5I4IA 2O19A 2HSDA 6GPBA 1I24A 2QMYA 2W2MA 3UOWA 3VBCA 1Q1BA 3QKUA 1W85A 1V4VA 3LHSA 4B85A 2I8AA 3MINB 2VTBB 2VOEA 3DZIA 3UWOA 1E2HA 4Q7KA 5TGDA 1JQ3A 2H48A 2FMKA 4HDKB 1NGSA 3I3SR 3RAJA 1SVUA 2ERCA 3AXTA 4TLLB 2QR5A 5KJCA 1NIJA 1ZY2A 3CWCA 3GPIA 3GNQA 3H4IA 4B9AA 2QENA 1A4RA 1LPBB 3I83A 3VGJA 4EIWA 4YGXB 5C32A 1D6NA 2JHCA 4YRLA 4PHCA 3ESAA 5H02A 5HKKA 5M29A 1NJ6A 1AV6A 3WTBA 3LUKA 4Z2AA 2WU3A 1QCDA 4TL8A 1QBKC 3U7JA 4EJ2A 4XVHA 3P9ZA 4XVQA 4FCWA 3QMPA 1FFAA 4TQUS 1VPEA 4JSYA 3ETHA 3OC6A 4AJJA 3HK2A 1C29B 3P97A 5BN5B 4OBXA 4WK4B 2FWMX 1RWPA 4CI0B 3GGJA 5K3BA 1U0TA 2DFDA 4DYDA 4XYLA 6CHYA 4HX9A 2VDOB 1FYFA 4CMCA 2AEEA 2JFNA 2QTLA 4OXNA 4JCCA 4QDTA 3NGXA 4OB6A 3RBVA 4EVSA 4A7PA 3GRAA 4OAOA 4RUKA 4S0XA 2FPRA 5E6SA 2UU9B 2BI7A 2JS7A 2XDWA 2CF6A 2GARA 4OIMA 5DIFA 2X76A 4O4HA 4Q7LA 4W8GA 2FU5C 3JQ7A 4IWYA 2NO7A 2FPGA 4L5BA 3ST7A 4AJ1A 1Z12A 3M6XA 1KEVA 2C31A 2FFBA 1U7TA 3VYWA 3X43A 3OZ7A 4R9VA 3BRWD 2BDUA 1CUCA 1K8RA 3KR9A 1A97A 4PSUA 4BLSA 1ONOA 4E07A 2F1RA 4L28A 2ZPTX 4UPDA 1ZVQA 5EYPB 1Y5IA 5J5AA 4IG9A 1A5BB 3ZI0A 1TD1A 4Y0NA 2OOSA 4D81A 3MJSA 4C4SA 2IEBA 2GD2A 5HEKA 3EUWA 5DCYA 4Z7OB 1G98A 3WE7A 1YA8A 1U9IC 1YRAA 3QBVA 4C0QC 1O08A 1YI0A 3KQPA 4QPPA 1PNRA 4F5DA 1KIFA 1S01A 1P2GA 2EC5A 2YJ5A 4RWZA 3EPJA 4HFMA 1MIHA 4X44A 5C8DA 4DKXA 1SKAA 3AERA 3WMEA 1B8OA 1FNDA 1TQDA 2WTBA 1PJ8A 1IOVA 1MTZA 1MORA 2J9XB 2P9QA 1KE1A 2JLWA 4JIGA 4ZI7F 1R3DA 2ODWA 4OHXA 1DWOA 3KKOA 4RETA 1G8YA 4PE5B 3ZU3A 1GCOA 2NXNA 2HCJB 4RAOA 4B80A 3OBIA 1B73A 3EVCA 3PFWO 1MNQA 2A3NA 4NENA 3PX7A 1MC8A 3CNHA 3ER8A 2IPLA 4ECAA 4FI3C 2CKMA 4DQ0A 3PITA 3FYSA 4MVCA 3VXKA 4DV4B 1GZUA 1LZKA 5DPMA 1ZZEA 3D3EA 4GHWA 2OV6A 4PF1A 2XQFA 1X86B 2GHIA 4EPXA 4EOGA 2V6IA 1T9BA 1HF3A 2VDKB 2XE6A 1WB4A 2ZXFA 4R84A 1ESEA 5AESA 3WA7A 2YJ6A 5F5NA 2HEIA 4AP6A 2R2GA 2YJ3A 2Q1YA 3NKLA 3MHTA 4DAEA 3K30A 3FOCA 4L2IA 2HWYA 4MMXB 5NLLA 3ZOKA 4M0PA 3V7UA 4XWOA 5DNVA 1NOIA 5AW6A 3D81A 4B33A 3TZHA 2PTGA 4JEUA 5GZ3A 2HQBA 2GLTA 2PL3A 3BFXA 3CURA 3IVAA 1HQCA 2C5FA 1V7CA 5K3FA 3OAAA 4CKEA 4HMPA 3U60B 1RQRA 2Q9AA 2AT1A 1RJGA 2HMTA 3I39X 3GAFA 3KYCB 3GJ6A 3MCWA 3RFXA 4B3HA 3SHTA 3V4VB 1C50A 4YRSA 1EG7A 4JX8A 3TFWA 3GOHA 1N0VC 1JKIA 4KG7A 3NTQA 4BJ3A 1ZNZA 3FF1A 4U7JA 3T5GA 2RCNA 3DULA 4LDZA 1OFGA 3CA8A 3WL7A 4YWHA 3HBNA 3P9PA 2RAPA 2VYVA 4AN0A 2PGNA 5KZMB 3AF5A 1ZGZA 5TPWA 1D07A 1W5SA 3M4NA 2J9FA 1HDRA 3X1XA 4QM6A 4FE4A 1MO3A 4R1UA 4U00A 4Y2VA 4B6QA 2XTZA 3I05A 1MFZA 4KH0A 3RSCA 1SHTX 3SBOA 4B3JA 4DLPA 4JJ7A 5LUAA 3QLEA 2JJ2D 3MMXA 2VHCA 1XLTA 2OILA 4D9NA 4ZI2A 1DI0A 3K9FC 1V45E 1MRZA 3KJIA 1EFCA 3ZCTA 1M34E 3JZMA 1O58A 4X93A 1E1CA 2NVUA 2O7RA 2BTQB 2WP0A 3RC3A 3JZDA 1B8NA 3IBYA 4C0HA 1Y48E 2Q28A 3BDIA 3ZE8A 1H2YA 2UXDB 1KYYA 1QCCA 2A0XA 2BHLA 4FYMA 1JLLA 3AUYA 2QT0A 5B57C 2XUPA 4LHZA 1DKLA 3BSYA 5KVVA 1K7EB 4NJEB 5CGZA 3MINA 3PX3A 3R9XA 3AFHA 3W8NA 4ZV4A 1I0IA 1RWQA 2YYAA 3C3PA 3KQTA 1UOQA 3I6IA 1T0PA 1PJTA 4YS6A 3P45A 2P6RA 2D4AA 3HBJA 4D3SA 1G19A 2HWWA 1GV0A 1HE2A 1SBIA 1MOQA 1S8NA 1YNOA 2XVYA 3AQ4A 1JDUA 3K0AB 2V6GA 2AEMA 2GCNA 3DKPA 3IV7A 3KLOA 5CDFE 2XXJA 4UKDA 3ND6A 4UTVA 3DF9A 1GAEO 3OO1A 1GL7A 2XWBF 5DYYA 1F7VA 1NF8A 2NZVG 4REQB 4LY3A 1BYIA 1P60A 1S2DA 1SNYA 4I4TA 1IZ0A 3M6UA 3TPFA 2VNJA 1Q92A 1MKYA 5F51A 3BWXA 3AF6A 3L1IA 3RKSA 2ATVA 1U1CA 1I2ZA 2YZ2A 3QXXA 5A62A 1BRTA 1FW6A 3WK7A 2NG1A 1VP3A 4MVJI 1WW3A 1C2TA 5AUNB 5JT1A 1PD1A 5JDCC 3CLKA 4DR3B 4DEVA 3A8TA 4KZKA 2LW7A 3PEEA 4XQ0A 4YRTA 1E3IA 4XB1A 2IS4A 4UM8B 1CF4A 5JS6A 4JJ4A 4RPCA 3S7TA 5BMVF 3TDMA 1A1VA 1ZMRA 4K05A 4DNPA 3CT4A 3TJMA 4XLZA 5M3BA 3MWLA 4Z8YA 3WFZA 1CQXA 2DOKA 2WICA 3MGGA 4HB4A 2AN1A 4P54A 4YDSA 4F71A 4XKJA 3JAKB 1BHJA 1SEVA 1TW2A 2B7LA 2GJ8A 3ICWA 1C4XA 5LP6A 1CEQA 2GN6A 4H4EA 5EXPA 4EG7A 4DPKA 4DLXA 1N2CE 4EQ6A 3ROZA 1O97D 2H2HA 1KSGA 1PNTA 3KR2A 4GYKA 3NBUA 1RYDA 1DC5A 1X1RA 2H16A 1ABEA 2OWEA 2R5FA 2ZDHA 3F9IA 2G04A 1VCNA 1G64A 2JRCA 5T41A 2G82A 2NZUG 3SM9A 4D3YA 1E3WB 4CNQA 1MH1A 3KTAB 2RFLA 2D5AA 4EITA 2HHCA 1TO2E 3A1EA 4EKEA 4TOIA 3U7QA 4CV0A 5ELXA 3ILXA 4FFSA 1IXYA 4YQFA 4V0ME 1ADBA 1OXBB 1NR7A 3EXHB 4RCYA 1K89A 3DT8A 2OHVA 4P5EA 3HBMA 1T43A 3SR0A 4EZEA 2Y6VA 4FB5A 5KMGB 1N32B 2RG7A 4LOKA 3R8CA 2WUGA 4ZYWA 1Z39A 3C3KA 1NJGA 2WTUA 2RC5A 1JKJA 4RESA 1XPOA 4C76A 1Y34E 2BHNA 2RJOA 2M6LA 3A3KA 1R6BX 3H4MA 1XCOA 3JQAD 3QVJA 1Z6PA 3QHAA 4P4GA 2HLNA 4RMGA 3T3GA 2IV3A 4BP9A 3DE5X 2QP3A 2SKCA 4D6XA 1XWFA 3M5DA 1I6MA 4FKZA 4UFOA 5DYTA 3DE0X 3E5HA 1GTL1 4WNYA 2AXNA 2Q5JA 4FHEA 2V0GA 2A5GA 4RL4A 4TVSA 3DL0A 3DDSA 3R4CA 3H05A 3PGA1 3COYA 4AF6A 1NYRA 3HBLA 2R4QA 2C9OA 5ADHA 4GP9A 1K4YA 4TKUA 3LY9A 3ZHUA 1MB2A 4YAGA 1MU0A 2OC9A 1DFGA 2BBOA 2UYQA 1FS5A 3CEHA 3H2SA 2I1QA 2FVXA 3FOBA 4EJSA 1RABA 4M0LA 1D2HA 1LTQA 1KTVA 4UXIA 4CKYA 2ATCA 4WFIA 2J5QA 2WE8A 4FR2A 4U2DA 1W0JA 1O0SA 1QZXA 2GK7A 2JL1A 2NZ8A 2XMPA 2QVCA 1UAYA 3JYLA 3MTBA 1IN8A 5HQJA 4CDNA 1DRUA 4KWHA 5B1EA 1NPYA 4DR1B 3LK6A 4OEHA 2BFFA 3C6BA 5JWOA 2I2CA 1CUUA 1YC2A 1K5PA 4P4LA 2XI4A 1RLOA 1G20E 2R2AA 2ACEA 4H7PA 3ABZA 3C8UA 4I8XA 4KQ1A 1KY2A 1X80B 1ZLXA 3BHIA 1EFLA 2X41A 3EFOA 1VYHA 2X5OA 5CA1A 5K6TA 1BDBA 4QICA 3UA4A 3D2CA 1PFVA 4GR4A 3WWPA 5HX7A 4HDNA 4ARCA 5A4FS 2YYSA 1JL3A 1Y3HA 3OSZA 5CB6A 4CIYA 5IT9A 3NWEA 5JQGF 2I03A 2ZJAA 3A1UA 3BN3A 2WFLA 3U13A 4ZYVA 5FAKA 2WDZA 2DWCA 2W0MA 3IP5A 2HBYA 4KXWA 1BXGA 5A2QA 3PGMA 2QTGA 2CHVA 3DBOB 1L7MA 3B6JA 1AZLA 4NBTA 3OE5A 4TLCA 3T06B 3JY6A 3I61A 2JFUA 4KE6A 4R1QA 2VSOA 3AY0A 1UBHS 4TYYA 4Q3EA 4DC9A 1H93A 4CF5A 4IP0A 2RAUA 1GKUB 3ZW9A 4LOIA 4QJ4A 4XYGA 5U1PA 3A6JA 3PUKA 4F1JA 5CVTA 3TFOA 3CUVA 3BD6A 3QENA 1T9CA 3EC2A 1GUAA 3PQ2A 3RIEA 5GVRA 3PSHA 1KI1A 3GDOA 1OX4A 4UUAA 3S5UA 1P2VA 3GZJA 4H7FA 4XJTA 3FVRA 3PC2A 3TO5A 4QFDA 2H2DA 3RV3A 2VOJA 3GCDA 3VYSB 2FK8A 4TLAA 1E7SA 3OM9A 1E2EA 1P7ZA 3VKVA 1N0IA 3TAUA 2JD2A 3MFQA 1CQIB 2BCGY 2ZM6B 2J5KA 2XNKA 1N5JA 4PG5A 1YR8A 2ATXA 5JCJA 5B6JA 4RPKA 4C7BA 5IC6A 4JDUA 2MYPA 5K8UA 2MYTA 4KITB 1XYGA 3L77A 3TUIC 3WYBA 2A0WA 1AM4D 3HB1A 3KAPA 5JMOA 2R8PA 2I5PO 3IQGX 4URUR 2M6SA 2X7HA 3MD0A 4IXDA 4NCNA 3H5IA 4OUKX 4PYJA 4CT0A 2QBYB 3IAHA 1CE8A 3TOVA 3ZE2B 1R12A 1NLZA 1TTPB 4P84A 3OLCX 1YL5A 4NF2A 4JZYA 1CUIA 1U3CA 3R40A 2P6OA 3A4IA 2X4IA 1K2WA 4GGPA 2GZ1A 6LDHA 2FSHA 1L5NA 2HA2A 2UYHA 1C4KA 1XNGA 1YZFA 2XWJI 3CU5A 5JU6A 4QU9A 1KH1A 3KAJA 2DXIA 4MW4A 2QVBA 1DHTA 1EFTA 1AU9A 2HNKA 3FCOA 1DCFA 2ILTA 2HSJA 2OXFA 4LW8A 3K6SA 1KJQA 5BN3B 4J0GA 1GPDG 4AZ3A 3QM1A 5AKYA 2G0AA 1OBHA 3KLBA 3R6WA 4J16A 2CVOA 1Y8ZA 5IS2A 3FPKA 1GARA 2ZB3A 1B41A 1I2MA 2Y67A 3R6GA 3VR4D 2A9JA 5AI5A 1SIUA 1KXJA 4PZ0A 4W1RA 3FCAA 3EDRA 1LDYA 4YFYA 3TOZA 3D6VA 3C3DA 3EFBA 4MP3A 5JQGA 4RTLA 2JCSA 1R27A 2BL4A 1HORA 4G8CA 4JI0B 2PSJA 4H0NA 2W7TA 3I9KA 4EATA 4D4GA 1QRUA 2E5LB 4C7KA 1FNMA 5BUSA 5A9TA 4D45A 1ZINA 2REQB 1DO0A 3E9YA 4CCWA 2O0LA 5EZ6B 3TCKA 2XE7A 2CUKA 1AK1A 3E03A 3EAQA 4E5NA 3RT7A 2FXVA 1QH0A 4O02B 4MJ3A 1NQXA 4XQ9A 3RFTA 3SYMA 4GXTA 1MC5A 1F2VA 1WUKS 3OZFA 5LCXA 1HXHA 4EAAA 3U7FB 4PCVA 4TLEA 3V8EA 4MTCA 2ZUSA 5KEIA 1OSNA 2EKZA 1QB7A 4BUZA 3H5WA 5AKEA 4TYPA 3ELWA 1NBMD 4LCJA 2F3UA 3FPEA 1HEYA 1NM5C 4MS4A 3SE0A 1KMMA 3HP1A 4IF6A 1PN3A 2PEZA 2A33A 3GLHE 2X0JA 1MQ8B 2IS1A 2XQJA 1DIGA 3CISA 2VT3A 4NG5A 3HBFA 1L5LA 3OZIA 1VMIA 3AXSA 1WETA 4UNSA 4QOGA 1E62A 4JT9A 1IWPB 3TKLA 1VA5A 1KYTA 2G3YA 2JARA 2Q29A 4I6EA 4B75A 4MGKR 1TJYA 2BFPA 3D7NA 5B2EA 4Y6LA 5BQ3A 2XIJA 4O1HA 1ZO8A 5IK2A 1EHYA 5DX8A 5K0FA 2I2BA 4FB4A 4TWZA 4AXXA 2E6UX 1NQWA 2VRBA 3UATA 4QYSA 2I65A 1QYXA 2QZZA 2ZS7A 3J7TA 1Y7LA 4FNOA 4R7TA 1T8WA 3PIIA 4GX0A 4LHSA 4KQEA 4M9QA 4P4SB 1KVQA 2H52A 3G49A 4FGUA 4M9XA 1ICEA 2WJHA 3DO6A 1UK9A 5HS6A 3ROPA 2N42A 1OGYA 2XCIA 2FKAA 1QH1A 3MT7A 1ONNA 4G8DA 5HJ2A 1SN7A 2UZ1B 4AG6A 3WGVA 1O5OA 3JR7A 3TOSA 4DGSA 3IXQA 3IEVA 1GPYA 4MK4A 1XD2B 2WG1A 4WADA 2TMKA 4JUAA 1OHHD 3FZGA 1TQ4A 3QW4B 5ER6A 3BWYA 1XNHA 4FD3A 4I4LA 1EUDB 4PFSA 5YASA 1WZEA 1XZNA 3KWMA 2IBSA 1HRDA 4P08A 4P81A 2VPWA 421PA 1E9RA 3U4GA 4QDJA 2BUCA 1GZDA 1ZUWA 1NQUA 2ZRQA 4MO2A 5ERGB 1QM5A 4WHMA 2GYYA 4K6KA 3BG5A 3BEOA 3TQFA 2JGRA 4AUNA 3LDFA 5FX2A 1R5BA 4UNIA 1Z2NX 1YKSA 2Y9MB 4L4ZA 2E21A 4OQNA 1KMQA 2E85A 1GKIA 2XXBA 4MINA 5ERXA 1Q95A 4NE9A 3UUWA 1YQTA 4BNXA 1QKKA 1VFNA 4GYJA 4MUEA 4BDSA 4KMRA 3BHJA 1PFQA 2VJBA 3ZXYA 4NK4A 3CLSC 3HGMA 4RQTA 4D8YA 5K03A 3KZNA 4XD7A 1XC7A 1Z26A 4UFNA 1LVGA 1GRVA 1G5IA 3HKCA 4BVHA 1Z37A 5EQTA 3B1ZA 4LGVA 1PL8A 1Y1SA 1CD5A 3FXAA 3IOYA 4GM0A 1NW5A 4PYMA 2I1WA 4ANFA 3K2BA 5HE9A 3DMHA 1ZK4A 2BKEA 4N65A 3DOHA 5IBPA 4ZO8A 4D9EA 5HUHA 4IIXA 1DXQA 1NOKA 2HV8A 3N3BC 3VI3B 4XVUA 1KQGA 2OHOA 4RXUA 2DC1A 4JBNA 2QTWB 2I91A 2QM8A 4WX2B 3ELDA 4E3WA 1GQRA 3JYOA 4I4TF 4JXXA 2L2QA 1NUHA 1YDEA 4GWGA 4MYTA 4QODA 3OU2A 4S1TA 4OO3A 4X1IA 1NVWQ 1UJMA 1VG9B 3OJ0A 4WK2B 3ZQ4A 1OLXA 3BUSA 3QHQA 2F1HA 3DLAA 5HF8A 5KYKA 3SS9X 3TBHA 3ZQKA 1TF5A 3IBFA 1OH7A 4Z4EA 3UJ9A 2Q1TA 3M4ZA 2DPHA 5BXQC 3VNVA 3VR1A 1HUQA 1T2UA 1HV8A 1T26A 1G6OA 1AKEA 3QLVA 4TSFA 3DLBA 3R9WA 1N6KA 3IMFA 2PE5A 1YI8A 1VHQA 2HRRA 1J7KA 5DTQA 2C2OA 4XEHA 4URFA 3K94A 4OHZA 2ZULA 5FNVB 1U3DA 4JLVA 1RWOA 4ZQCB 2Y1DA 4JR2A 3KTDA 2RKWA 3PXAA 3PQDA 1HQKA 3IEKA 1TQHA 1DKPA 3ZLUA 3GEPA 2X9QA 4OYLA 2YN4A 3RUFA 2WFMA 4WL0A 4AP9A 3LXXA 2ZK7A 3QQPA 3QSYA 2Y93A 2MOKA 2Q7DA 3PNLA 4TV8B 3UW3A 2WKWA 1TL7C 1UM9B 4RD2A 1XV5A 1VCMA 5TE9A 2XX3A 4K3UA 2WJJA 2C8LA 3DTVB 3KO8A 3LPMA 4EHLA 4YRMA 3O8CA 3LUDA 2I6FA 3RSOA 2OP0A 4AC9A 1XMVA 2ZI4A 2J09A 4QJBA 4JC8A 3D3KA 2DM6A 3GWZA 1KXZA 1T2DA 1Z08A 5CH3A 5B2ZA 2WJ3A 3TQTA 5ES4B 5KTKA 1Z7WA 2R44A 4W5HA 1E61A 1U5CA 3WSTA 1PTKA 4ZZIA 4OI1A 5JS7A 2ODEA 3N5CA 1AMUA 1PT8A 1S2LA 2CVHA 2WP8J 3DBRB 3A4MA 3PI7A 3RVPA 4W82A 2M6KA 1NJ8A 2CNLA 3ESRA 3LPDA 5CG1A 4CU2A 3N58A 2XD9A 2SNIE 4D6YA 1ZVVA 3Q7PA 2IXAA 4GNKA 4WFJA 4YJHB 5FUVA 1EFDN 4DDVA 4C3ZA 3FDJA 5B7NA 5KNDH 1XEFA 3B2EA 2M1XA 3KB1A 5AJTA 3TZEA 3ZHXA 4F4DA 4PC7A 5DM2A 1Z5ZA 1EGVB 2QKYA 5IEJA 4XFJA 2IYAA 3GRPA 1IZ7A 3TRFA 2BSQA 1MJGA 9LDTA 3ZOZA 2PZMA 1JAZA 2DY1A 1EU1A 2FLWA 1N57A 3DV9A 1P5RA 2GVZC 1QCZA 4HYEA 2YS6A 4KR3A 4HV4A 2ZEJA 3IDQA 1V96A 4CXMA 4ZOCA 1WHTB 3BD8A 1UQRA 3NVMB 3A1TA 5FBLB 3N76A 4FVTA 3QOXA 3C6YA 1WXQA 1E2QA 1H2WA 1Q57A 2JEZA 2Y77A 2N3ZA 3U4QB 1J5XA 3OQIB 5K0NA 221PA 4B4UA 5JAOA 4X8OA 1VPLA 4FHGA 1QMGA 1DT5A 4IY1A 4L15A 3FPLA 4PAWA 4Q1BA 2QQEA 3RWOA 4BO5A 1ENPA 1GZVA 3EUEA 1I4LD 4R1OA 4X60A 4IRMA 1K68A 1NVGA 5L3SB 3V2UA 3D4BA 3HG7A 2GTIA 3CNOA 1XHEA 3H0KA 2WUEA 3PKIA 1LY1A 4TUYA 3VNRA 4CG2A 4DV5B 2CDCA 1KJJA 3MFYA 5FO0A 4F12A 1ISRA 4CMEC 3EIOA 3T7AA 4YCJA 3MRTA 1TDJA 1LGYA 3I04A 2XMRA 1J0CA 4HNHA 2D2VA 1BEUB 3ZW7A 3NH6A 5BSTA 4HN9A 2XUQA 3U40A 1SUIA 1YHYA 2EFDB 1HG0A 1P45A 3Q3JB 1M73E 2Z2XA 1X3SA 2X8JA 3CZMA 3BRSA 4EY4A 2FLVA 3RSQA 1QK3A 2NXEA 3BQMB 1ZOLA 4QBFA 3H97A 4Y2YA 3NXKA 3N2KB 4JU8A 4XSHA 1C3OB 3TM5A 4WOPA 1RXVA 1UCFA 4GZ5A 5DBFA 4OP2A 2B69A 4EGQA 5D86A 2YKGA 1ADYA 1YC5A 2HBRA 3EMBA 1BW9B 1C41A 2AUNA 2CZCA 1GGEA 1HEUA 4PCLA 4EARA 4POOA 3SDBA 3SQWA 3QLJA 5ED4A 1VHLA 3ASZA 5LP6C 4YQEA 5E2IA 1XZDA 2AC7A 4MYSA 3W1VA 2P5TB 1KO5A 1U8AA 3PGVA 4JUIA 3GD7A 4FDMA 2UZIR 1JPJA 3OEWA 1LPOA 2EF0A 1NNI1 1W88B 3RVSA 4XGNA 4DMUB 1A2BA 2CBZA 2O2YA 3CZCA 3OECA 1SOUA 3GP8A 4HWTA 4QWMA 1D2NA 4AECA 4DN6A 5K45A 4LRYA 3IT1A 2HPAA 2BKLA 4FJ1A 4OHFA 4IMJB 1VIYA 3VTFA 4DXHA 5FUMA 4NARA 4C9BA 1Y9EA 3SQOA 4BLQA 5L51A 1OREA 1TFUA 1OLXB 2JFZA 3WL4A 4D8XA 4AZ0B 5KOJA 2MSEB 1H65A 1OFTA 3FFTA 2OB1A 4DBLC 4QVKA 1YS9A 1SZPA 4QPZA 5TDHA 1JQLB 4N0QA 4ROSA 2PZJA 4H1UA 1DRVA 2OA0A 1T6NA 3CJQA 1GP2A 3ETNA 1XJCA 3TINA 2VQSA 4FBGA 3UAXA 4YAJA 1X19A 2G6BA 1F20A 2ECOA 2IZ1A 2X58A 2UZAA 1JE1A 2CNKA 2D13A 3SVZA 1ZISA 1IJFA 1YF3A 2PWBA 3ESYA 2ZJ4A 4QGGA 3VVCA 2XUZA 3PC7A 3R9KA 4CM9D 1RWXA 3FMOB 5KCMA 3ZCVA 4QQKA 2O0MA 5JSKA 2GCOA 1A82A 1Q44A 3RT9A 1RXEA 5BY2A 5AVSA 4EMTA 4EDHA 3VISA 4Y6GB 5LXTB 1WA5A 3GBPA 3VMMA 4ETIA 4QOEA 3GAMA 1RPTA 2G83A 2VJKA 3PTLA 4WNAB 4R0VA 3KKKA 4C5CA 4EHIA 1Y3BE 1QOQB 1FQWA 2IUYA 1OGJA 4R2WA 8OHMA 1ZP6A 3E5RA 1QFJA 3UCEA 3GJ8A 1IXSB 4MGHA 5DT2A 2AN5A 4NZOA 4L0DA 2QRLA 1P4HA 4BPBA 2E6KA 3DYIA 4JH0A 1FPQA 5EXDA 3PDJA 3Q0EA 4CCYA 1QVVA 2NTYC 4OGGA 4TX1A 3IURA 3UFXB 1VSUA 3FUXA 3L02A 2A14A 3NAZA 4OJTA 1B3BA 4MI6A 4OHKA 1I7NA 2XB8A 1JA9A 3BD7A 1IHXA 4PIMA 4ZOLB 2G1JA 2OMEA 3RUIA 2QE6A 2AOWA 1Z3IX 1EB8A 2B8WA 4JI8B 2W8ZA 2WTAA 2WT8A 2HN9A 3UMRA 1R8JA 1NVUQ 4G1UC 3S40A 4CFZA 4EG8A 2F3RA 4L02A 1KZGB 5TIIA 2B4AA 1C9KA 2PMEA 3DV0B 3NTOA 2DHRA 2P2SA 2VPXA 1X13A 2KE5A 2NUBA 3MWDB 4QXMA 5G40A 5KAMA 3DHEA 4K6MA 2C0PA 4NMXB 2QAIA 4S05A 5FOTA 4DVGA 1GRCA 3GUCA 4PPFA 3BF8A 3FWKA 3IVGA 3FPJA 1EJ0A 4QTYA 1D1TA 1W4BA 2HRZA 2GAOA 1ACLA 1KDZA 3ZZ1A 4MA5A 1LX6A 1WHTA 1ZA1A 4OXQA 3EXHC 4LZWA 5TB5A 1U0BB 1WPRA 3RCBA 5KBYA 2V5AA 5M34A 3VZDA 3VR2A 3DQQA 4CVNA 2IL1A 3FZQA 4AQDA 5THXA 1JDNA 1PR1A 2PJDA 3HNRA 4RABA 4IQ0A 5CTAA 3OUZA 3IPAA 3BFJA 3ML1A 1G6KA 3FDFA 4JA2A 1BQ3A 1NW7A 2GN9A 1D6SA 1RPNA 2P3OA 5CH8A 3ZH2A 4CDGA 4LQ4A 5JNTA 3BWVA 4W5QA 4XCXA 1PX0A 3U0BA 1TM1E 1VQ1A 3JQFC 3AOGA 2VYCA 3GXOA 3K4HA 3EA4A 3TQRA 1Y1RA 5DTEA 2CXHA 1P81A 3VYUB 4EY6A 3QE2A 3ZLVA 2O8BA 1ORVA 3RS5A 5A4AA 2ZIVB 5ALUA 2WU1A 3AILA 1U8UA 3Q41A 4QPNA 3MYYA 3PXGA 3MRSA 3EWNA 2CMHA 1UJ2A 4BLOA 3L7IA 2XYVA 1HE4A 2RAFA 1YV9A 3BORA 3MZ0A 1T15A 4C4YA 3GUZA 3MCTA 2YIDA 3N87A 2C9ZA 2G76A 2GCPA 2JAXA 3AL2A 3N0XA 2OHIA 1LS6A 3W2GA 4B87A 4UQOA 3BQNB 3DAFA 2HU8A 1S6YA 2WU8A 1BHO1 1BW9A 2WV9A 2YMMA 4OQPA 3EWAA 3V80A 3TIFA 2BJWA 3VHQA 1D2MA 4BC1A 5NULA 3EY4A 4DCTA 2JGAA 2R5WA 2E4VA 1XRLA 2QRPA 2II6A 3KBOA 3LLSA 4E5DA 4ZU1X 1IB6A 3OLYA 4KCGA 5EOVA 1EJ6A 3BSSA 4E6PA 4UTXA 2AZ4A 2VJNA 2NTNA 3AR6A 1U0OC 4EGJA 1UMBA 4TXLA 5DB4A 2H2AA 4JWTA 2HU5A 1TTTA 2OO3A 3LT4A 2GYVA 2IZ5A 3TLZA 3HA3A 1SURA 3WRYC 1PIWA 4EYSA 1E3QA 5AWFC 3ZX4A 2I1VB 1GN9A 2YNMD 4N3CA 4JYZA 3TTVA 4P4TA 2QYTA 1DAKA 4JI7B 2PIAA 3LT2A 3UV7A 4CLRA 3SS8A 1JHQA 2DRIA 2C7GA 1KF0A 3TNFA 1NV8A 4TKVA 3VYTB 4FS8A 4D82A 1OB5A 1I80A 4GMGA 3T54A 4YR9A 3Q87B 3OOSA 4FHZA 2NU9B 1KJIA 2P9BA 1E6WA 1GG5A 1TIKA 2SKDA 2CYBA 4H7JA 4DLKA 1DAFA 2Q5FA 2R7MA 2BELA 3F49S 2G07A 3S1LA 1Z8HA 4LJ8A 1J00A 4DABA 2C3UA 3R3YA 2X86A 2HDHA 3FMVA 4W5NA 2A0KA 1XVTA 2C9CA 1K06A 3FH0A 3HA5A 3LCCA 3QPUA 1THZA 4PYOA 4YMUA 3ZLJA 1RWKA 3NTXA 1QU2A 1FP6A 2OQIA 2ZATA 3VU0A 2ROQA 4EX7A 1CUBA 4UZEA 5GM1A 5EHZA 2J0EA 1X2BA 1YOVA 4KE8A 1IEQA 1L4NA 2OBNA 4FFMA 3QF7A 4Z3OA 3J81k 5DYNA 2GK4A 4B2LA 5IJXA 2HHJA 1EP1B 3SG0A 4V0RA 5JHHB 5DU2A 3GNLA 5HQ3A 3JZIA 1BXZA 4OGFA 2DFNA 3Q4GA 1U04A 2G8NA 1Q17A 4CV3A 1WKBA 4EHNA 1FXUA 2XUOA 3AW8A 4PYKA 1WZ2A 1W59A 4F4CA 4DBLE 2PRZA 4KGVA 2IT1A 5MGNA 1E0DA 3DLPX 1CS0A 1NAIA 4DA9A 4DQUA 1T6YA 1ICIA 2FHPA 3DTNA 4J1SA 3H75A 2K2QB 1T2NA 5C37A 3BILA 1NN5A 2X3UA 1M33A 1Q14A 2DE0X 1B23P 3BKWA 4U2CA 1TO1E 2HUNA 2Z56A 3QIAA 5LC1A 4A2CA 3DE3X 5I4KA 2AA3A 5G4LA 3HUUA 1X92A 2WJAA 1QIDA 4FFLA 1FDSA 3HXPA 3LFUA 5ALTA 2H7YA 5LOVB 1ZN7A 3UCXA 4MWGA 2Q49A 2FWIA 2I8LA 1XD9A 3DQPA 3MAJA 4FYVA 4PRYA 4QPDA 2H59A 2HKIA 2QTBA 1XCMA 3VJKA 5BR1A 4M22A 2DMRA 4WBNA 2Y66A 3RG8A 3AJ9A 3OO0A 4K28A 3D3WA 3RU2A 1XMOB 4LAFA 1QGAA 2W6PA 1P2TA 5TQVA 5MN6A 4JJ8A 4NBUA 1GCGA 4G0NA 1M1XB 4P5PA 2PGOA 4BGUA 4LRWA 5FWAA 2RHOA 4IEFB 5ARDA 4ZK2A 2EATA 2NZYA 4LQCA 3D59A 5ETJA 5EUMA 1QKIA 3WL3A 2D0DA 1YQGA 1V3UA 3N2GB 1QOZA 2E4ZA 4FKMA 5GONB 5LQUA 4KWIA 1IBRA 2AMJA 3WP0A 2ZPAA 5FKJA 2N75A 3EB9A 3LAWA 4X1KB 4EYOA 3PHGA 3R9XB 2JC3A 4B6EA 2F67A 2GJ9A 1PDVA 5I9SA 4F92B 3Q9NA 3FA2A 1KEUA 3RWMB 1WRBA 2FK7A 3CM0A 4IDOA 4DUGA 4LJRA 4WXRA 5AUOB 4MB0A 1UMKA 1CQPA 2DF8A 2YXLA 2EL9A 4IHJB 4DMRA 3HM9A 2OAGA 2Q2VA 3OPYI 3DTYA 1U7OA 4HLUA 3EF3A 1VJCA 1JALA 3NHZA 4H7DA 1OYOA 1QTRA 4O4JA 4DM4A 2JAHA 2PLAA 4O29A 4AT1A 1CT9A 2CLLB 4KACA 3R6TA 3KSRA 2QK4A 1T5HX 2Q3JA 5DHRA 1QTQA 2PUGA 2E1PA 1DX6A 1KYQA 2CZQA 1BIFA 5IEBA 4RYLA 4YONB 3Q7EA 3PI6A 4YNBA 5EWLA 4JJ6A 5F3RA 1R0BA 1JZQA 5L3ZA 4IMRA 2XRYA 5B4VA 1P5ZB 2OGTA 3B36A 3BCSA 4KQGA 1MHTA 1J20A 2B2CA 1EWYA 2A1IA 3IIKA 1HDZA 5A0TA 1XQYA 1ULBA 4XUDA 4DG9A 2AOTB 2YWRA 2OD9A 3BL8A 2CKDA 3KXKA 4DA8A 1O94C 5G1PA 2H3EA 4JR1A 3B9PA 4QYMA 2LCQA 5FPPA 2K7FA 4MYDA 2O7NA 3TUJC 2XY4A 2PBFA 3N8NA 4M1TA 1SXGA 1K2VN 3ANMA 3JAKA 4LI3X 1OB2A 4ZT3A 4WNIA 4L75A 5EP4A 1IZ8A 4O2LA 1LRKA 5IXYA 3LUFA 4XOIA 4J76A 4YP9A 1YIDA 1MP0A 4K9DA 2B2XA 3DF7A 4IUCS 2K6GA 2Z08A 2BEWA 1U2QA 1C4OA 3C3AA 1Q2UA 3DHWC 3O9ZA 1OR8A 4QPJC 1GQQA 2OE2A 4C4PA 5IVKA 4C88A 3RJ9A 4DSZA 4LHXA 5JY6A 3CBGA 3ORSA 3AEQA 3S2IA 3EMKA 3SOZA 3NI2A 5JYEA 3DO5A 5HKOA 1MB3A 4KYUA 1DJPA 4RK4A 2GA8A 2JHAA 1DIRA 1U2GA 3CLVA 3U7QB 4YHHB 3NBQA 1GTRA 1OFUX 1P1IA 1X9IA 3DCNA 3JYQA 1EXWA 2V5UA 4NBNA 4OKIA 1BMTA 1ZH2A 1OLUA 1ZIDA 1Q7CA 3EIWA 5JD6A 3U62A 1NXOA 2I8CA 1Y3DE 2I71A 2XCOA 5BVHA 4RKYA 4RHFA 4KN8A 5CFQA 2QLMA 4L9WA 3RODA 1ULZA 2E55A 3OZUA 1HT0A 4U2BA 3WYEA 3TLBA 5PGMA