1RYJA

Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown
publication title AN NMR APPROACH TO STRUCTURAL PROTEOMICS
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Structural genomics, unknown function
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ryjA00
1FFUA 1YQ4B 2CJOA 3HRDD 3AE9B 2H88B 1NI3A 1JW9D 3P4RB 1DGJA 1V97A 4ZHPA 3CWIA 1RM6C 2W55A 4YSYB 1EWYC 1ZUD2 2G1EA 1QOGA 2CU3A 3EUB2 1QT9A 4YT0B 4YTNB 1QOFA 2BS3B 3B2FA 5H8YE 5C3JB 5MPOA 1FXAA 1AWDA 1JROA 5EE1A 1FRRA 1N60A 1N62A 3AEEB 5G5HA 1YJJA 1L6VA 3SR6A 2WS3B 1XLOA 2WU5B 5H92C 1I7HA 1J7BA 1E7PB 1T3QA 1DOXA 2N0SB 1FFVA 2PVOD 3NS1A 1E0ZA 1WXQA 1CZPA 2KMMA 2L83A 3FC4A 3AMZA 1FIQA 4JX1C 3AB5A 1V8CA 3AE3B 4JWSC 3AE2B 4C80A 3ZYYX 4FXCA 3B9JA 5AUIA 2MH7A 3VR8B 1NENB 3NVYA 1OFFA 3P4QB 1N63A 2B76B 3AE1B 4JWUC 1PUTA 1FM0D 1JQ4A 2MJ3A 5G5GA 3VR9B 3SFDB 4C7ZA 1KFYB 4LTUA 1B9RA 4P6VF 3WCQA 3AH7A 3P1MA 4USAA 1N5XA 4HROA 1AYFA 3W5UB 1WRIA 1WWTA 2WU2B 3AE7B 5GXGB 3NRZA 1NYQA 1N5WA 1SIJA 1XLQA 2OHFA 2QIEB 3NVVA 1YQ3B 3FAHA 4ZOHC 3CIRB 3W5VB 2HTME 4YSXB 1F0ZA 3VRAB 3SFEB 4N6EB 4US9A 1GAQB 3AEAB 2W54A 3LB8C 1N61A 3NVWA 2DWQA 2H89B 3B2GA 2WDVB 1ZXIA 3AV8A 2K9XA 1WGKA 1NVID 2BS4B 4N59A 1KRHA 1PDXA 5EE0A 1RWSA 1VLBA 3AEGB 3AN1A 2JQRB 4HRSA 4US8A 2KAJA 1E10A 1QOBA 1QLBB 1RFKA 2JX5A 3HVZA 1ROEA 2WDRB 2WQYB 2K22A 4ZHOA 1DOYA 3DWMA 2Y5CA 2WLBA 1E9MA 1TYGB 2DBYA 2E3TA 1L5PA 3AEFB 4WWMA 1QF6A 2ACZB 3W9CB 1SF0A 2K5PA 1JALA 1WYGA 1FMAD 2LEKA 2WP9B 2BS2B 1XLPA 3KWLA 3AM9A 4YXDB 2MJEA 2FBWB 2QJLA 1JWAD 1L6UA 3AE5B 1XLNA 1NYRA 2M56B 5EE3A 2W3RA 3AE8B 1A70A 3L4PA 3BIID 1RYJA 2PVGC 4A9AA 5C2TB 3P4PB 1JRPA 1CJEA 1IUEA 1ZOYB 1VDVA 1OQQA 1ZP0B 4YTPB 5AUKA 1VJKA 2BT6A 3RPFC 2PIAA 2M19A 2PKOA 3HUIA 3NVZA 1PFDA 4YTMB 1NEKB 1OQRA 4N58A 3ETRA 1FRDA 1FXIA 3AEBB 4WQMA 1XO3A 5EE9A 4KX6B 3P63A 3AE4B 1J7CA 2WDQB 4ITKA 1TKGA 1UWMA 1GPXA 2Q5WD 3P4SB 1QOAA 3AE6B 1R7SA 1TJEA 2AX5A 4YSZB 2W3SA 4IDIA 1E6EB 2L52A 2CJNA 3AEDB 3LXFA 3DWGC 1TKYA 1TKEA 1DOIA 2EKIA 2MJDA 3ABVB 3AECB 4C7YA 1JWBD 3VRBB 1L0VB 1FO4A 1YJIA 1SB3C 3PO0A 1J7AA 1KF6B
chains in the Genus database with same CATH superfamily
1BUIC 3HRDD 4ZHPA 3RD2A 5DPSA 1YD8U 1KH0A 4P1CC 4RF0A 4YWGG 3ALBA 2FCNA 4TUUA 2SAKA 4AP4C 4NZLB 1TS5A 4FN2A 1SXTA 5H92C 1P7EA 1J19A 2L83A 3FC4A 4MELA 2NTSA 5CHVC 3AB5A 4IWQA 4WJQA 3EFUA 2B76B 2WXMA 1PGAA 3DBRI 3WCQA 4USAA 4LNOA 3IBEA 1ISNA 3MJ5A 4F1SA 3PRMB 2DYMA 3FILB 2PW9A 3NVVA 4MJSB 2RR9A 2IO0B 4HCNB 1SSNA 2H89B 1F52A 2IJ0A 2BS4B 5EE0A 4AS1A 4HRSA 3T8MA 3ZRCA 1HQRD 3UQBA 2DYBA 2IBIB 2MRPA 2ACZB 3W9CB 2L05A 1IPGA 2WP9B 1OGWA 3AU5A 1KTKA 1G6JA 1V80A 3QC8B 2KC2A 3KVFB 3Q8FA 4QAYA 2G3QB 3L4PA 1CQVA 4OVVA 1TIFA 1WFYA 1TS4A 1E8ZA 1YNTE 1FCLA 4M8NA 1MHHE 4ZRQA 2UU7A 4RGNA 4MSMB 1GG3A 3UINB 4RM9A 4DHJB 2GRIA 2Q5WD 1QOAA 2RD0A 2MEKA 2HTHA 1V1PA 3H9DA 1VZ8A 4YSZB 3L10B 2MLBA 4EFOA 3RFZB 2EKIA 4W9HA 3KQ4A 1AN8A 2OEDA 3BK2A 3DHGC 3ZXRA 1C3TA 1ZUD2 2RPVA 4LNNA 1EF1A 4J6IA 3ML9A 2EMTA 2KWDA 3ZDMC 3AMZA 1WMHA 3DPDA 5IO9A 2PTLA 2JRHA 1ET6A 3A9KA 3NVYA 4WIPA 2KC1A 2KVRA 3UI3A 3H7PB 5D3DA 5IN7A 4IKGA 2VRRB 1UD7A 3P1MA 3V3XA 4DHZB 3WANA 3QIJA 3BYYB 4FBJB 2V3PA 3UF8A 5FKAC 2O2VA 4D2KA 1FCCC 2LJIA 2XBBC 2BB5A 1NVID 4RGOS 3P42A 3GOEA 2V9HA 3ONSA 4GXBA 2KWCA 1YN5A 4MM3A 3IG3A 3PLUA 2BF8B 1PGBA 3ZJUA 3IT4B 2PLPA 2WDTB 1T0QC 2FUG1 1L6UA 3KLSX 4KVGB 1SE3A 4K3CA 1D5XC 2ZCCA 4A9AA 5C2TB 1V86A 5BYQA 1CJEA 4DXGA 1HE8A 1OQQA 3ZGZA 1MFWA 2L76A 3NJTA 3U7ZA 4ANXA 1SE4A 1C9FA 4F7ZA 2PJHA 2D2QA 2IY1B 4NPNA 1TJEA 5E6JA 3L08A 4BKGA 4LDTB 3MC8A 1I4GA 1UBIA 2LVPA 2GLSA 3HK0A 1Z5SB 3SEBA 5HG2A 3OJ3A 5G5HA 4NAWB 4P7IA 4OZAA 3GS2A 4L2YA 3I5JC 2DX5B 3U8ZA 3RNGC 5J2RA 5KHOA 3RZWC 5IA7A 1EO6A 4P16A 2BWES 2BQQA 3PZ8A 4RFBA 5AZFA 1AYFA 1V1PB 2BYVE 3K9PB 2L00B 3NRZA 1SIJA 4IM2A 1XD3B 2LGSA 4CQNA 3UIPB 4RGTA 4I6NB 1R4NI 3WIMA 3GE8C 4XWTA 3ZXVA 3V6EB 2JQRB 3O13A 4PS3A 3NG0A 4H2AA 2KDIA 2JYEA 3PV1A 2VZKB 4IM3A 2LD9A 2KDFB 2PE6B 3WAMA 4AOFA 1ZKHA 1L5PA 3IXSA 1WYGA 4HVBA 3L16A 1XLPA 1WMHB 2LRUA 4AUQC 3A9KB 2LUEA 1HXYD 3VUYA 4ZRPA 3V6CB 1WGRA 2WXHA 1ZGUB 2JWUA 2HE7A 1WRDB 5GMVA 4BBNC 2O2VB 4EE2A 1MG4A 1TZOA 3B1LX 4EZJA 1ZDVA 2WYQA 4KKIA 1H8CA 2AX5A 3N1ZC 1WE6A 3RNAC 2DZJA 1TS3A 2XK5A 2D3CA 4I6PA 4MM3B 2WXNA 2BS3B 4BAXA 1YQ4B 1ENFA 1A5RA 1C4CA 1NI3A 3DDCB 1JWSD 1OQYA 5HHDG 1V5OA 2RSUA 3DBLB 4KGRA 1JROA 3DHHC 3M3JA 2K8CA 4IW0A 3KYCD 4IUMB 1CZPA 2N1VA 2MX2A 3TSSA 2NMQA 2KQ7A 2QEJC 3Q3MC 1D6EC 1J0GA 4LJPB 2INCC 1MPEA 2C7NB 1WX8A 1ACCA 5FR3A 2KFKA 1XQQA 3W5VB 2NCNA 5JH5C 1E8XA 1YJ1A 2KACA 2GOWA 2WXGA 4KZCA 1L7YA 1WGKA 2L3ZA 4FLHA 1NBFC 4US8A 4ASWC 1ROEA 3PRZA 2K22A 1V1OA 2Y5CA 1I35A 2K5PA 2A4ZA 1S1QB 1QILA 3HM6X 3N1YC 4GDKA 5I4DA 2KD0A 5CHFA 1RYJA 3IT6B 5GXGB 1VDVA 1E7UA 3TEWA 2KVZA 3MHSD 3GE3C 1FRDA 2MBQA 3BINA 3KUCB 1VRAB 2JSVX 2W3SA 2J53A 3QARA 2V1YA 2XNAC 3DWGC 1TKYA 4YSXB 4GU2A 3ZNHB 2H88B 2WXFA 3VH3B 2W55A 4PYUA 4HKZE 3MC9A 4BOZB 3AXCA 5C3JB 5DPRA 3VFKA 1WXSA 1R4MB 3MTNB 4OHJA 3GZNI 4O1NA 1YN4A 4BKTA 1N6ZA 2K0PA 4S17A 1RRBA 3UGBB 4WQOB 2DNFA 4A90A 2VH2A 5G5GA 3MC0B 3R2TA 4C7ZA 1ZW7A 2FIFA 1WR6E 3NUHB 4EZKA 2YEPB 3JW0X 2DLBA 4FJYA 4XGAB 3ZTDA 2XK5B 4BBNF 2KOXA 2HTME 2V4LA 2I1KA 5G55A 3VRAB 2J0MA 1GAQB 4W9CA 4KDIC 4XYCA 3IVFA 1TZ1A 2LVOA 1KRHA 4DXAB 1RWSA 3AEGB 1T5XD 3J9CA 1TY0A 2JX5A 3HVZA 4HKQA 4ZHOA 3RN9C 3ECIA 3E56A 1JALA 2PMVA 2O6VA 2MJEA 2MWSB 2QJLA 3ZJTA 5HKHA 2DZMA 4FHKA 4ANVA 4IM0A 4EOYA 2KFKB 4ICUA 4W9JA 1OQRA 1C79A 4MSQB 3PT2B 1XO3A 1Z2MA 2JT4B 3ZUNA 1GB4A 3A9JA 4TQ1A 4RMAA 1WR1A 3TUOA 1HTQA 1F2RI 2BPSA 1XCTL 1K50A 2ZVNA 1YMHE 3ABVB 1ESFA 4AJYB 3V61A 3KUDB 4K1RB 1SIFA 4JQWC 2NBUA 3X23A 4E71A 1I4HA 4MH0E 1ZPSA 1MJDA 5H8YE 4RCOA 4GDKB 2WS3B 1P98A 1T3QA 2PVOD 2WWZA 1UGMA 3Q3JA 3P2BA 3PZDA 5E6OA 1LM8B 1IYFA 4NJCA 4ZDVA 1QZEA 4WH4A 4OW0A 4DWFA 3QCAA 1D5MC 1D5ZC 4LTUA 1B9RA 2QILA 3N9YC 1WSPA 3LYYA 2OOBB 4XX5A 1V9JA 4HPMB 2KLCA 3DBHI 3DVNU 2WXPA 4NJ7A 4US9A 3Q3FA 1U4AA 1IGDA 4CO7A 3Q69A 3H8HA 2LRWA 4N59A 1UBQA 2B3AA 2CS4A 1WJ4A 2BKRB 1KOTA 3VTUA 4K7UA 4GB9A 4HDOA 1I4PA 4URKA 1QF6A 1TY2A 4GN1A 2QC8A 3O65B 1E8WA 2KFJA 4CYEA 3RMKC 1GC7A 2JY6A 2ON8A 2LASA 4PT5A 3NZSA 2PVGC 1XCQL 1WX9A 2K1FA 1C77A 2D5GA 2KWUB 5CHWA 3SDLC 2IY0B 5G2NA 2OJWA 2FCQA 1WXAA 5L83A 2NPTB 3L0WB 2DAJA 2PEAA 3U30A 2YVCA 3L13A 4C4VA 2LHEA 1DOIA 2DAFA 4DHZE 2C7MB 3TEXA 1SE2A 1FO4A 1F9JA 3P4RB 3MJWA 2LGDA 2BYTA 3EUB2 4FADA 1Y8RC 2O6VB 1SEBD 1FRRA 3R8BA 2GMIC 1GUAB 2D3GA 2N0SB 2ZCBA 2L0TA 3R3MA 3I3TB 2ICIA 2RDHA 5J18A 2KTFA 2SEBD 2FIDA 2GBRA 4JWUC 3JVZX 2X38A 3A9JB 1FNUA 4TKNA 4ZRKA 3NS8A 4NJ6A 4ZOHC 1MI0A 3C8YA 5LXIB 2K3UA 3HHMA 2MP2A 4ANUA 3SHQA 1V5TA 2M0XA 3B2GA 1VLBA 2BTEA 1JRUA 3VXWA 5BO4B 1NDDA 4W9FA 1QOBA 4ARCA 1LQBA 1KLUD 3KWVA 3UIOB 1SJHD 2E3TA 3AEFB 4OZBA 3QJZA 1FD6A 2AQ1B 2KMCA 3AM9A 1GJZA 4LJOB 3TCAA 1D4BA 3M62B 1WGHA 3AI5A 3OJ4B 4OVZA 2K8BA 3AE8B 3ML8A 1HZ6A 5E6PA 4WJNA 1ET9A 1JRPA 1CMXB 5AUKA 3DBSA 5D3IB 4ZYSA 1WIAA 2CHZA 2K25A 3BVMA 1FXIA 2NTTA 3NZ3A 5EE9A 4LNIA 3P63A 3V60A 1GPXA 1TGZB 1AARA 3H1UA 4RH6A 1L0XB 1GOZA 3LDZE 3ZKJC 4UDUC 2J7QB 1SB3C 1DOXA 2AWTA 3I63C 3EHVA 1DGJA 3KUZA 3OWEB 1ZDXA 3B2FA 3W1SC 4LNFA 1YJJA 4FJVB 3TEYA 3BVGA 2JZZA 5AZHA 2KQ4X 5D6JB 3W1YA 2I2YA 1V8CA 2PE9A 1UZXB 2J0JA 3VR8B 3PZ7A 1KLGD 4WJOA 1OFFA 3T3NA 2AYOB 1N63A 2J0KA 2G4DB 2AEHA 3W5UB 3ZTCA 1WRIA 4C4VB 2HDEA 2N4FA 4NQKE 3SU8X 1TTNA 5LNK1 1K8RB 2UWQA 2MHJA 3OLMD 3S2AA 4X57B 2MBEA 2NBVB 4MH8A 5BMGA 4JGHB 3BYTB 2A5UA 1RFKA 2KZRA 4G0NB 2AQ2B 1E9MA 1TYGB 4IWOA 1Q0WB 1I42A 4L1BA 3Q8CA 3VVWB 5L95C 2QSDA 1KLVA 1UELA 2MSED 4EUTA 4DQOC 3AE5B 3WALA 1NI2A 3OG5A 3DVGY 4FULA 3C19A 3PTFC 4NY0A 2K8HA 4YTMB 3DBRB 1RLFA 4KX6B 1H4RA 1T0SC 2WDQB 1B1ZA 2IDYA 3PPAA 3I9V1 2L52A 1C1YB 1WY8A 4RM8A 3AECB 2BVCA 2KLGA 4DK5A 3ZYYX 2Z0DB 3AE9B 5BMHA 1V97A 1Y56A 2L1AA 4ZRJA 2HD5B 2BWFA 4GIVA 2UYZB 3WAOA 1T0RC 2REXA 4CHKA 1XT9B 4HK2A 2E6XA 1WGDA 1XLOA 4ZYNA 1I7HA 1FFVA 2VH1A 1E0ZA 4PS8A 3AE3B 3IAS1 3AE2B 4C80A 3VHTC 2IO2B 3NY5A 4KGSA 3P4QB 2J4XA 2G4SA 3AE1B 1YOVB 3RZFA 2DYOA 4LDTD 2IYDB 1KM7A 5TSSA 1N5WA 1YQ3B 2WX0A 4W9IA 2QMTA 3EC8A 3V62A 4NQLB 3ZQ4A 3APCA 3QWZB 5KHQA 2W54A 3HIZA 1M94A 1ZXIA 1E7VA 2JUOA 3W2DA 4W9EA 2BW2A 4YL8A 4WWMA 2N7DA 1JWAD 2CR5A 4XDCA 3N3KB 1XLNA 1WXVA 1C4PA 1SGHA 3P4PB 4YTPB 3R2IA 2LZ6A 1JCKB 3PREA 4B6WA 1TBEA 3RI7C 1WJ6A 3ZO5B 3DVGX 1WM3A 2KKCA 2VZKD 4BKSD 1FEHA 3P4SB 2Z59B 4K3BA 2L32A 3LXFA 1HZ5A 1WGYA 4GGQA 1WXMA 2WXLA 2JZPA 4KSLC 1F1HA 3TJPA 4YTNB 1M4VA 1AWDA 2LWPA 2CU1A 4DDID 1C4AA 3NS1A 1P7FA 5LXHA 1WM2A 3JYUA 1WXQA 4MDKE 2Z0EB 4WURA 1L4DB 2ONQA 3WA0A 2BKFA 2MH7A 3VTVA 2MJ3A 3URYA 3VR9B 1PGXA 2R2OA 1K53A 1XLQA 2L8JA 5TR5A 3N1XC 3A4SC 2KDEB 4JE3B 2RMMA 3U4EG 2KN5A 2K9XA 4HWIB 4MGIE 5EDSA 2KAJA 3N20C 2Y5PA 1P3QU 4WJPA 1MVKA 3DWMA 1GNUA 1SF0A 3Q3NC 4W9DA 1XEEA 2ZW1A 3IAM1 1A70A 2WXIA 4HEA1 3JSVA 2D07B 2FCSA 1ZOYB 1YIWA 4XE0A 1T6BX 3VQIA 2WGSA 5C23A 1PFDA 1V6EA 5E6NA 4A55A 2D3BA 4WQMA 4DBGA 4HXDA 3PHXB 3Q8BA 4JPSA 4F8CB 4ITKA 2LJ5A 2N1WA 3ZDTA 1PYWD 3BZDB 4IDIA 1E6EB 1L0VB 4WAFA 1VZ7A 3Q2AC 2ZVOA 2G1EA 1BT0A 2CU3A 2BYEA 1E5WA 2M0AA 1OEYA 4M0WA 1C78A 4XDDA 5HFYA 2LHDA 4JX1C 4REZA 2WX1A 3APFA 4XWWA 2INPE 2D10A 4GMVA 1PUTA 3RCZA 1CK1A 2KJHB 5FR6A 2MCNB 2HJ1A 3UQAA 2KO3A 4W9LA 1I4XA 4I6LB 1F0ZA 3NZUA 1VR9A 4N6EB 2W82A 2WNMA 3NVWA 1PDXA 2IGGA 2ZNVC 2EMSA 1QLBB 4TMAB 2TSSA 2WQYB 3N32A 4IG7B 2DBYA 1TT5B 4JL9A 3Q8AA 1EF5A 2QCZA 1BMLC 2D11A 2LI5A 5DPWA 3RNFC 4MGYE 2LGXA 5BMIA 3BIID 2KMAA 4XZ4A 1GB1A 3Q6BA 1SJED 4GOCA 2ZPYA 1STEA 2M19A 3NVZA 2CKHB 4C56C 4JIOU 4KIKA 1YN3A 3DOWA 4HPLB 3W1SA 3AE6B 3VDZA 3VUXA 3QX1A 4A3OA 1T0YA 4FJZA 4C7YA 4G50A 4R3DA 2D3AA 3VH4B 2NR2A 2CJOA 3FKYA 4BZAA 1FNVA 5AEKB 1QT9A 1VCBA 1FXAA 2BYFA 2R61A 1D3ZA 1N60A 3GP7A 4KV2A 2INDC 2KT7A 1L6VA 2BB6A 4MT5A 3JSVB 3QAQA 1WH3A 1UGJA 4EEWA 2KQSA 2FAZA 3OAWA 3R7RA 2KMMA 4TQ0A 4IWPA 2KDBA 4MEMA 3D32A 2N9EB 3DHIC 1V49A 2GBJA 2LMCA 3EECA 3U7DA 2L7RA 4HJGE 1VD2A 3RNBC 2KYWA 2NS5A 5HI1A 4B0MA 4EKUA 3N30A 2IO3B 2JRIB 2LUMA 3FAHA 2V0GA 1LFDA 3DVNV 2YEPF 3VAWA 1EU3A 2KN4A 2MBOA 4NAWA 2JXXA 3LB8C 1OEYJ 2LGIA 3B08A 4G11A 4ZRIA 4A20A 3TL5A 2DENB 4DDGD 1WGGA 1YQBA 2XEWA 1EU4A 4M00A 5JZEB 3DBLI 3R7QA 1WX7A 2KWVB 1RFAA 2WXJA 4M0WB 4W9KA 1P9DU 3B0AA 3L54A 1L4ZB 3GZNB 2LEKA 1WZ3A 1WF9A 2JYTA 4E3CA 2J42A 2GB1A 4ARIA 2MBHA 2DHZA 1V2YA 1MHXA 2KX0A 2FUHB 3CSFA 1IUEA 1K52A 2M4NA 2BT6A 4N9F4 2ZW0A 5C1ZA 3EGRA 2M17A 4K7SA 1YX5B 2N9XA 1KJTA 2K6QA 2C9WB 3PSEB 4AWJA 1E8YA 1E90A 1TKGA 4BKSA 4IOIE 4GSWA 4TV3A 1TKEA 4TSSA 3ZRFA 3VRBB 2JWZA 4P6VF 3T9LA 3U2SC 1JW9D 2RPQA 3Q3OC 4AQ7A 4WWNA 4YT0B 1P1AA 3HM3A 4RF1A 3U52E 2IO1B 1N62A 3AEEB 3DQVA 2WU5B 1TS2A 3NHEB 2ASQA 2PPHA 3CF6E 3EA6A 4JWSC 5AUIA 1WZ0A 4KIKB 1FM0D 2GBKA 3QK0A 2Z8LA 4M01A 1MG8A 5CTRC 4HROA 3AU4A 1WI0A 2WU2B 4W9GA 2QIEB 3HVDA 3VTWA 5IOIA 2O6VD 4LNKA 2K39A 1SBBB 1F2RC 3H6NA 4DHJD 1WYWB 4HLEA 2DZKA 1IBXA 2MW5A 4GLSC 2WXOA 1Q10A 4L23A 3LJ3A 2M8SA 2R2QA 2C60A 2Y5BB 2MBBB 2WLBA 1R4MI 1FMAD 3ZLZA 2WXRA 4YXDB 2KXJA 1ZXHA 2V3NA 1NYRA 2N7JA 3I57A 3ZJVA 2W9NA 2K6DB 1IGCA 1JWUD 3KYDD 4II2B 1VJKA 2PIAA 4GDLA 2PKOA 3TMPB 2KHWB 1NEKB 1Q1OA 2N9KA 4K81A 1OTRB 4N58A 3BVZA 1J8CA 1K51A 4K7WA 4B9KA 2JZ3B 3A4RA 1HTOA 3X0WA 2JVCA 2GBMA 1GC6A 5D94A 1P0RA 3DBHB 4E74A 1HEZE 3AEDB 4OZCA 2NVUI 1EWCA 3PGEA 5JHAA 2HJ8A 1J7AA 1KF6B 4LLGM 3WAPA 1QKZA 2CHWA 4B95A 1EWYC 1XF5L 3ZIMA 5BYSA 4RNAA 4J3OD 2MP2B 3BY4B 1WJUA 1J7BA 5FK9C 2IZVB 1BXTA 4KDLB 3E9SA 3L17A 3BWUD 3GB1A 2EKEC 5BYRA 1NENB 3SD5A 4OVUA 1WJNA 3K9OB 3M63B 4NAMA 3QHTA 4M8MA 4MGZE 4FA6A 3AE7B 1X1MA 1IP9A 3H7SA 2KNBA 4MACA 1WE7A 1Q5WB 2JF5A 3APDA 1N61A 4II3B 3AV8A 3ZNZB 4PYZA 3PHWB 4KGTA 2WDRB 2LXCA 2WXQA 1DOYA 1LO5D 4EZLA 2FE8A 4BFRA 3Q8EA 3A1QA 2BS2B 5D2MB 4HPPA 2FBWB 3ZNID 3M95A 2X8XX 5EE3A 5JHBA 2IPKD 2KK8A 2KANA 1EM7A 4PS7A 4A8XC 2ZZPB 4AJWA 1UH6A 2MQJA 2QHOA 3MHZA 2AQ3B 3ETRA 1L0YB 3C0RB 3AE4B 3EFCA 2C7HA 4FHJA 2C5LC 4C00A 1IBXB 4HDQA 1LXDA 4KKJA 3IFWB 1JWBD 3ZVVA 2BGFA 1HA5A 1FFUA 1UNSA 2L0FA 1RM6C 3A33B 4YSYB 1QOGA 2V4IB 1FPYA 5J17A 1QOFA 3KW5B 5AZGA 1JWMD 1FXTB 1E7PB 3PVLA 5IAAC 3ENEA 5IP4D 4LK0M 4S0RA 2KJ6A 4GDLB 4PK1A 3B9JA 2N7EA 2GI9A 1JQ4A 2RDBC 3SFDB 3AH7A 4WAAA 3QA8A 1N5XA 2Y3AA 4IC7B 1PQSA 2KTRA 1VZ6A 4ANWA 3MP9A 3SFEB 2I1JA 3AEAB 3CMMB 5JXVA 4MGKE 2DWQA 2IGDA 2WDVB 2JU6X 3NOBA 4P1BC 3RUIB 1V81A 2YLMA 3QQ8B 2CHXA 2MA9B 2V3SA 3TBLD 3ZW3A 3KWLA 2OJRA 4A6QA 3ZNGC 2M56B 4A3PA 4HJKA 1JMLA 2I38A 3RPFC 3HUIA 3TEZA 3PLVA 2LXAA 1C76A 3CSTA 3AEBB 4M02A 2ZJDA 2IGHA 1YX6B 1J7CA 1I4QA 1UWMA 2LVQA 2N9PC 5LLIA 1R7SA 1FNWA 2RGFA 3FILA 4MJSA 3RULA 1EUVB 2JPHA 3DCGA 3R66C 2FNJB 4Q2JA 3CWIA 2ZPNA 3A1QB 2GBNA 3AULA 5MPOA 5EE1A 2QDFA 3SR6A 2FCMA 2NBWB 4G3XB 4B0EA 3TIXA 2INNE 2LGYA 2WXKA 3RNCC 1FIQA 2NPTA 1L2NA 1LGRA 4ICVA 1R4NB 4FXCA 4KSKC 2BBCA 2EELA 1UUPA 1KFYB 4JLCA 2J52A 1DYQA 3BK1A 1WWTA 4WWPA 1NYQA 2OHFA 4ACFA 3CIRB 2AL6A 3VUWA 1RAXA 5D7GA 3Q14C 4WWOA 2G9HD 1AW7A 3RT3B 5DCNA 1F77A 3AN1A 1E10A 2XN9C 1SE9A 2JXTA 2WHIA 4BVUC 5DPTA 2ZEQA 3MFGA 1S3SG 1I4RA 3T3OA 4XC2A 1UWXA 2N9LA 4LCDE 1UF0A 2RDGA 4HCPB 2W3RA 2KDMA 2ZNVB 1ZP0B 3RYTA 1XXGA 3KH0A 3PRPB 2KX3A 5IKCM 1ZE3D 5T8IA 2KTRB 3V05A 3RNEC 4RGMA 4NNJB 4DXFA 3H7PA 2LFIA 3IHPC 3PS6A 2DZIA 5CX3A 4KZ0A 2CJNA 4BOSC 2AL3A 2MJDA 2G45B 2KJRA 1QQRA 1YJIA 2M1MA 3PO0A
chains in the Genus database with same CATH topology
3U2SC 1BUIC 3AE9B 2H88B 3HRDD 1JW9D 5BMHA 2WXFA 1V97A 1Y56A 4ZHPA 2L1AA 2W55A 1KH0A 4AQ7A 4YT0B 4HKZE 4RF0A 4YWGG 5C3JB 4RF1A 3U52E 2SAKA 4NZLB 1TS5A 1N62A 2E6XA 3AEEB 4OHJA 1SXTA 1XLOA 2WU5B 4O1NA 5H92C 1I7HA 1TS2A 1YN4A 1FFVA 1E0ZA 1P7EA 2L83A 3FC4A 2K0PA 2NTSA 3EA6A 3AB5A 4JWSC 3AE3B 3IAS1 3AE2B 4C80A 5AUIA 4KGSA 3P4QB 2J4XA 4A90A 2B76B 3AE1B 1FM0D 2WXMA 1PGAA 2DYOA 5G5GA 3MC0B 3R2TA 2Z8LA 4C7ZA 3WCQA 4USAA 3NUHB 3MJ5A 4HROA 2YEPB 2WU2B 5TSSA 2DYMA 1N5WA 2DLBA 2PW9A 2QIEB 3FILB 3HVDA 1YQ3B 3NVVA 2QMTA 2HTME 3VRAB 3ZQ4A 1SBBB 1F2RC 1GAQB 1SSNA 2W54A 2H89B 2IJ0A 1ZXIA 2BS4B 5EE0A 1KRHA 1RWSA 1IBXA 3AEGB 4AS1A 1T5XD 4GLSC 2WXOA 4HRSA 3W2DA 1Q10A 3J9CA 1TY0A 2JX5A 1HQRD 3HVZA 4L23A 4HKQA 4ZHOA 2BW2A 3E56A 2WLBA 4WWMA 2ACZB 3W9CB 1JALA 1FMAD 2WP9B 2PMVA 2WXRA 4YXDB 1KTKA 2MJEA 2QJLA 1JWAD 3ZJTA 4XDCA 1XLNA 1ZXHA 2V3NA 3Q8FA 1NYRA 2N7JA 1C4PA 3L4PA 3I57A 3ZJVA 1IGCA 1JWUD 3P4PB 1CQVA 4YTPB 3R2IA 1VJKA 1JCKB 2PIAA 2PKOA 1TS4A 1NEKB 1YNTE 1OQRA 1C79A 2N9KA 4N58A 3BVZA 1FCLA 1MHHE 4ZRQA 1XO3A 1K51A 4RGNA 1GB4A 2VZKD 4TQ1A 1FEHA 2GRIA 2Q5WD 1QOAA 3P4SB 1F2RI 2MEKA 3TUOA 1V1PA 1VZ8A 4YSZB 1HEZE 2L32A 3AEDB 1XCTL 4OZCA 1K50A 3LXFA 1YMHE 1HZ5A 2EKIA 3ABVB 3RFZB 1EWCA 1ESFA 1J7AA 1KF6B 3KQ4A 4LLGM 1AN8A 2OEDA 2WXLA 3BK2A 1I4HA 2JZPA 1QKZA 1EWYC 1ZPSA 1ZUD2 2RPVA 1XF5L 4YTNB 1M4VA 5H8YE 1AWDA 5BYSA 4RNAA 4RCOA 4J3OD 1C4AA 4GDKB 2WS3B 1J7BA 1T3QA 5FK9C 1BXTA 1P7FA 2KWDA 2PVOD 3E9SA 3NS1A 1WXQA 3BWUD 3AMZA 4WURA 3GB1A 1L4DB 2ONQA 5BYRA 2PTLA 2MH7A 1ET6A 1NENB 3NVYA 4NJCA 4WIPA 2MJ3A 4OW0A 4WH4A 3URYA 3UI3A 1D5MC 1D5ZC 1PGXA 4LTUA 4NAMA 5D3DA 3VR9B 2QILA 4IKGA 1B9RA 3N9YC 3P1MA 1K53A 1WSPA 3V3XA 3LYYA 3AE7B 3BYYB 1XLQA 2V3PA 4MACA 5FKAC 2WXPA 4JE3B 2RMMA 4D2KA 1FCCC 4US9A 2LJIA 1IGDA 1N61A 3U4EG 3Q69A 2BB5A 3H8HA 3AV8A 2K9XA 1NVID 4RGOS 4N59A 3P42A 2KAJA 2Y5PA 4KGTA 1YN5A 2WDRB 2WXQA 1DOYA 1LO5D 1MVKA 3DWMA 1I4PA 2FE8A 1QF6A 1SF0A 1TY2A 3Q8EA 1PGBA 3ZJUA 2BS2B 3IT4B 2PLPA 2FBWB 2FUG1 1L6UA 3KLSX 1XEEA 1SE3A 2ON8A 2ZW1A 5EE3A 3IAM1 1A70A 2WXIA 4HEA1 4PT5A 1D5XC 2IPKD 2PVGC 4A9AA 5C2TB 1XCQL 1EM7A 1ZOYB 1CJEA 1C77A 2D5GA 1T6BX 1OQQA 4XE0A 5BYQA 4A8XC 4DXGA 3VQIA 3MHZA 1PFDA 3ZGZA 2AQ3B 3ETRA 4A55A 1L0YB 4WQMA 3U7ZA 3Q8BA 3AE4B 4JPSA 1SE4A 4ITKA 1C9FA 1PYWD 1TJEA 3BZDB 4IDIA 1E6EB 1IBXB 2LHEA 4KKJA 1DOIA 1JWBD 1L0VB 5E6JA 3TEXA 1SE2A 1FO4A 1HA5A 4WAFA 1VZ7A 1FFUA 1UNSA 3P4RB 1I4GA 1RM6C 2BYTA 4YSYB 2G1EA 3EUB2 1QOGA 2CU3A 2V4IB 1QOFA 1SEBD 3SEBA 5HG2A 1FRRA 5G5HA 3R8BA 1JWMD 2M0AA 4NAWB 1E7PB 2N0SB 4M0WA 1C78A 4OZAA 4XDDA 5HFYA 2LHDA 4LK0M 3GS2A 4GDLB 4JX1C 4L2YA 4REZA 2ICIA 2RDHA 4XWWA 3B9JA 2SEBD 2INPE 4P16A 2GI9A 4JWUC 1PUTA 1JQ4A 3PZ8A 4RFBA 1CK1A 2X38A 1FNUA 3SFDB 3AH7A 1N5XA 1AYFA 1V1PB 2Y3AA 3NRZA 1SIJA 4ZOHC 1MI0A 3C8YA 1I4XA 1VZ6A 2K3UA 3MP9A 4CQNA 1F0ZA 3SFEB 1VR9A 4N6EB 2W82A 3AEAB 2WNMA 4RGTA 5JXVA 3NVWA 2DWQA 3B2GA 2IGDA 2WDVB 2JU6X 1PDXA 4XWTA 2IGGA 1VLBA 2BTEA 2JQRB 3O13A 4H2AA 1QOBA 4ARCA 1QLBB 1KLUD 2JYEA 4TMAB 2TSSA 2WQYB 2VZKB 3KWVA 2DBYA 1SJHD 3Q8AA 2E3TA 1L5PA 3AEFB 3IXSA 4OZBA 1FD6A 1WYGA 2AQ1B 1XLPA 3KWLA 3AM9A 1BMLC 1D4BA 4A6QA 4OVZA 2M56B 5BMIA 3AE8B 1HXYD 3BIID 1HZ6A 1GB1A 1JMLA 1SJED 1ET9A 4ZRPA 1JRPA 2I38A 5AUKA 3RPFC 1STEA 2M19A 3HUIA 5D3IB 3TEZA 4ZYSA 3NVZA 2WXHA 2JWUA 1C76A 3BVMA 1FXIA 2NTTA 3AEBB 3NZ3A 4C56C 5EE9A 3P63A 2IGHA 4EE2A 1J7CA 1YN3A 1I4QA 1TZOA 1UWMA 1GPXA 3W1SA 1ZDVA 3AE6B 4KKIA 1R7SA 2AX5A 4RH6A 1L0XB 1GOZA 1FNWA 3FILA 4C7YA 4R3DA 1TS3A 4UDUC 4MM3B 1SB3C 2WXNA 1DOXA 2BS3B 1YQ4B 2CJOA 1ENFA 1C4CA 1NI3A 1DGJA 3OWEB 4Q2JA 3CWIA 1ZDXA 1JWSD 1FNVA 5HHDG 1QT9A 3B2FA 5MPOA 4KGRA 1FXAA 1JROA 5EE1A 2R61A 1N60A 3GP7A 1YJJA 1L6VA 2BB6A 4MT5A 3SR6A 3TEYA 3BVGA 4B0EA 1UGJA 2INNE 2KQ4X 2WXKA 1CZPA 2KMMA 4TQ0A 1FIQA 3TSSA 2I2YA 2NMQA 1V8CA 2QEJC 3ZYYX 4FXCA 1D6EC 3VR8B 3PZ7A 1KLGD 1OFFA 2BBCA 2EELA 2LMCA 3T3NA 1MPEA 1N63A 1UUPA 1ACCA 1KFYB 4HJGE 2J52A 1DYQA 5HI1A 4B0MA 3W5UB 5FR3A 1WRIA 3BK1A 1WWTA 2HDEA 1NYQA 2OHFA 2LUMA 3FAHA 2V0GA 3CIRB 3W5VB 2YEPF 1EU3A 2KN4A 5LNK1 5D7GA 2KACA 2G9HD 3LB8C 1AW7A 2WXGA 2LGIA 1WGKA 4MH8A 1F77A 5BMGA 3AN1A 3BYTB 4US8A 1E10A 1RFKA 1ROEA 2XN9C 1EU4A 2AQ2B 2K22A 1V1OA 2Y5CA 1E9MA 1TYGB 2JXTA 4L1BA 2WXJA 3Q8CA 2QSDA 2K5PA 1L4ZB 2LEKA 2JYTA 2J42A 3MFGA 2GB1A 4ARIA 1I4RA 3T3OA 1UWXA 2N9LA 4DQOC 3AE5B 1QILA 2RDGA 5I4DA 2W3RA 1MHXA 1RYJA 3IT6B 2KDMA 1IUEA 1K52A 1VDVA 5GXGB 1ZP0B 3TEWA 2BT6A 1XXGA 2ZW0A 3EGRA 4YTMB 1FRDA 1ZE3D 5T8IA 3V05A 4KX6B 2WDQB 4RGMA 1TKGA 4DXFA 1VRAB 4IOIE 2LFIA 1B1ZA 2IDYA 3I9V1 2JSVX 2W3SA 2L52A 2J53A 2CJNA 2XNAC 3DWGC 1TKYA 1TKEA 2MJDA 3AECB 4TSSA 1QQRA 4YSXB 3VRBB 1YJIA 4P6VF 3PO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFU A;  1YQ4 B;  2CJO A;  3HRD D;  3AE9 B;  2H88 B;  1NI3 A;  1JW9 D;  3P4R B;  1DGJ A;  1V97 A;  4ZHP A;  3CWI A;  1RM6 C;  2W55 A;  4YSY B;  1EWY C;  1ZUD 2;  2G1E A;  1QOG A;  2CU3 A;  3EUB 2;  1QT9 A;  4YT0 B;  4YTN B;  1QOF A;  2BS3 B;  3B2F A;  5H8Y E;  5C3J B;  5MPO A;  1FXA A;  1AWD A;  1JRO A;  5EE1 A;  1FRR A;  1N60 A;  1N62 A;  3AEE B;  5G5H A;  1YJJ A;  1L6V A;  3SR6 A;  2WS3 B;  1XLO A;  2WU5 B;  5H92 C;  1I7H A;  1J7B A;  1E7P B;  1T3Q A;  1DOX A;  2N0S B;  1FFV A;  2PVO D;  3NS1 A;  1E0Z A;  1WXQ A;  1CZP A;  2KMM A;  2L83 A;  3FC4 A;  3AMZ A;  1FIQ A;  4JX1 C;  3AB5 A;  1V8C A;  3AE3 B;  4JWS C;  3AE2 B;  4C80 A;  3ZYY X;  4FXC A;  3B9J A;  5AUI A;  2MH7 A;  3VR8 B;  1NEN B;  3NVY A;  1OFF A;  3P4Q B;  1N63 A;  2B76 B;  3AE1 B;  4JWU C;  1PUT A;  1FM0 D;  1JQ4 A;  2MJ3 A;  5G5G A;  3VR9 B;  3SFD B;  4C7Z A;  1KFY B;  4LTU A;  1B9R A;  4P6V F;  3WCQ A;  3AH7 A;  3P1M A;  4USA A;  1N5X A;  4HRO A;  1AYF A;  3W5U B;  1WRI A;  1WWT A;  2WU2 B;  3AE7 B;  5GXG B;  3NRZ A;  1NYQ A;  1N5W A;  1SIJ A;  1XLQ A;  2OHF A;  2QIE B;  3NVV A;  1YQ3 B;  3FAH A;  4ZOH C;  3CIR B;  3W5V B;  2HTM E;  4YSX B;  1F0Z A;  3VRA B;  3SFE B;  4N6E B;  4US9 A;  1GAQ B;  3AEA B;  2W54 A;  3LB8 C;  1N61 A;  3NVW A;  2DWQ A;  2H89 B;  3B2G A;  2WDV B;  1ZXI A;  3AV8 A;  2K9X A;  1WGK A;  1NVI D;  2BS4 B;  4N59 A;  1KRH A;  1PDX A;  5EE0 A;  1RWS A;  1VLB A;  3AEG B;  3AN1 A;  2JQR B;  4HRS A;  4US8 A;  2KAJ A;  1E10 A;  1QOB A;  1QLB B;  1RFK A;  2JX5 A;  3HVZ A;  1ROE A;  2WDR B;  2WQY B;  2K22 A;  4ZHO A;  1DOY A;  3DWM A;  2Y5C A;  2WLB A;  1E9M A;  1TYG B;  2DBY A;  2E3T A;  1L5P A;  3AEF B;  4WWM A;  1QF6 A;  2ACZ B;  3W9C B;  1SF0 A;  2K5P A;  1JAL A;  1WYG A;  1FMA D;  2LEK A;  2WP9 B;  2BS2 B;  1XLP A;  3KWL A;  3AM9 A;  4YXD B;  2MJE A;  2FBW B;  2QJL A;  1JWA D;  1L6U A;  3AE5 B;  1XLN A;  1NYR A;  2M56 B;  5EE3 A;  2W3R A;  3AE8 B;  1A70 A;  3L4P A;  3BII D;  1RYJ A;  2PVG C;  4A9A A;  5C2T B;  3P4P B;  1JRP A;  1CJE A;  1IUE A;  1ZOY B;  1VDV A;  1OQQ A;  1ZP0 B;  4YTP B;  5AUK A;  1VJK A;  2BT6 A;  3RPF C;  2PIA A;  2M19 A;  2PKO A;  3HUI A;  3NVZ A;  1PFD A;  4YTM B;  1NEK B;  1OQR A;  4N58 A;  3ETR A;  1FRD A;  1FXI A;  3AEB B;  4WQM A;  1XO3 A;  5EE9 A;  4KX6 B;  3P63 A;  3AE4 B;  1J7C A;  2WDQ B;  4ITK A;  1TKG A;  1UWM A;  1GPX A;  2Q5W D;  3P4S B;  1QOA A;  3AE6 B;  1R7S A;  1TJE A;  2AX5 A;  4YSZ B;  2W3S A;  4IDI A;  1E6E B;  2L52 A;  2CJN A;  3AED B;  3LXF A;  3DWG C;  1TKY A;  1TKE A;  1DOI A;  2EKI A;  2MJD A;  3ABV B;  3AEC B;  4C7Y A;  1JWB D;  3VRB B;  1L0V B;  1FO4 A;  1YJI A;  1SB3 C;  3PO0 A;  1J7A A;  1KF6 B; 
#chains in the Genus database with same CATH topology
 1BUI C;  3HRD D;  4ZHP A;  3RD2 A;  5DPS A;  1YD8 U;  1KH0 A;  4P1C C;  4RF0 A;  4YWG G;  3ALB A;  2FCN A;  4TUU A;  2SAK A;  4AP4 C;  4NZL B;  1TS5 A;  4FN2 A;  1SXT A;  5H92 C;  1P7E A;  1J19 A;  2L83 A;  3FC4 A;  4MEL A;  2NTS A;  5CHV C;  3AB5 A;  4IWQ A;  4WJQ A;  3EFU A;  2B76 B;  2WXM A;  1PGA A;  3DBR I;  3WCQ A;  4USA A;  4LNO A;  3IBE A;  1ISN A;  3MJ5 A;  4F1S A;  3PRM B;  2DYM A;  3FIL B;  2PW9 A;  3NVV A;  4MJS B;  2RR9 A;  2IO0 B;  4HCN B;  1SSN A;  2H89 B;  1F52 A;  2IJ0 A;  2BS4 B;  5EE0 A;  4AS1 A;  4HRS A;  3T8M A;  3ZRC A;  1HQR D;  3UQB A;  2DYB A;  2IBI B;  2MRP A;  2ACZ B;  3W9C B;  2L05 A;  1IPG A;  2WP9 B;  1OGW A;  3AU5 A;  1KTK A;  1G6J A;  1V80 A;  3QC8 B;  2KC2 A;  3KVF B;  3Q8F A;  4QAY A;  2G3Q B;  3L4P A;  1CQV A;  4OVV A;  1TIF A;  1WFY A;  1TS4 A;  1E8Z A;  1YNT E;  1FCL A;  4M8N A;  1MHH E;  4ZRQ A;  2UU7 A;  4RGN A;  4MSM B;  1GG3 A;  3UIN B;  4RM9 A;  4DHJ B;  2GRI A;  2Q5W D;  1QOA A;  2RD0 A;  2MEK A;  2HTH A;  1V1P A;  3H9D A;  1VZ8 A;  4YSZ B;  3L10 B;  2MLB A;  4EFO A;  3RFZ B;  2EKI A;  4W9H A;  3KQ4 A;  1AN8 A;  2OED A;  3BK2 A;  3DHG C;  3ZXR A;  1C3T A;  1ZUD 2;  2RPV A;  4LNN A;  1EF1 A;  4J6I A;  3ML9 A;  2EMT A;  2KWD A;  3ZDM C;  3AMZ A;  1WMH A;  3DPD A;  5IO9 A;  2PTL A;  2JRH A;  1ET6 A;  3A9K A;  3NVY A;  4WIP A;  2KC1 A;  2KVR A;  3UI3 A;  3H7P B;  5D3D A;  5IN7 A;  4IKG A;  2VRR B;  1UD7 A;  3P1M A;  3V3X A;  4DHZ B;  3WAN A;  3QIJ A;  3BYY B;  4FBJ B;  2V3P A;  3UF8 A;  5FKA C;  2O2V A;  4D2K A;  1FCC C;  2LJI A;  2XBB C;  2BB5 A;  1NVI D;  4RGO S;  3P42 A;  3GOE A;  2V9H A;  3ONS A;  4GXB A;  2KWC A;  1YN5 A;  4MM3 A;  3IG3 A;  3PLU A;  2BF8 B;  1PGB A;  3ZJU A;  3IT4 B;  2PLP A;  2WDT B;  1T0Q C;  2FUG 1;  1L6U A;  3KLS X;  4KVG B;  1SE3 A;  4K3C A;  1D5X C;  2ZCC A;  4A9A A;  5C2T B;  1V86 A;  5BYQ A;  1CJE A;  4DXG A;  1HE8 A;  1OQQ A;  3ZGZ A;  1MFW A;  2L76 A;  3NJT A;  3U7Z A;  4ANX A;  1SE4 A;  1C9F A;  4F7Z A;  2PJH A;  2D2Q A;  2IY1 B;  4NPN A;  1TJE A;  5E6J A;  3L08 A;  4BKG A;  4LDT B;  3MC8 A;  1I4G A;  1UBI A;  2LVP A;  2GLS A;  3HK0 A;  1Z5S B;  3SEB A;  5HG2 A;  3OJ3 A;  5G5H A;  4NAW B;  4P7I A;  4OZA A;  3GS2 A;  4L2Y A;  3I5J C;  2DX5 B;  3U8Z A;  3RNG C;  5J2R A;  5KHO A;  3RZW C;  5IA7 A;  1EO6 A;  4P16 A;  2BWE S;  2BQQ A;  3PZ8 A;  4RFB A;  5AZF A;  1AYF A;  1V1P B;  2BYV E;  3K9P B;  2L00 B;  3NRZ A;  1SIJ A;  4IM2 A;  1XD3 B;  2LGS A;  4CQN A;  3UIP B;  4RGT A;  4I6N B;  1R4N I;  3WIM A;  3GE8 C;  4XWT A;  3ZXV A;  3V6E B;  2JQR B;  3O13 A;  4PS3 A;  3NG0 A;  4H2A A;  2KDI A;  2JYE A;  3PV1 A;  2VZK B;  4IM3 A;  2LD9 A;  2KDF B;  2PE6 B;  3WAM A;  4AOF A;  1ZKH A;  1L5P A;  3IXS A;  1WYG A;  4HVB A;  3L16 A;  1XLP A;  1WMH B;  2LRU A;  4AUQ C;  3A9K B;  2LUE A;  1HXY D;  3VUY A;  4ZRP A;  3V6C B;  1WGR A;  2WXH A;  1ZGU B;  2JWU A;  2HE7 A;  1WRD B;  5GMV A;  4BBN C;  2O2V B;  4EE2 A;  1MG4 A;  1TZO A;  3B1L X;  4EZJ A;  1ZDV A;  2WYQ A;  4KKI A;  1H8C A;  2AX5 A;  3N1Z C;  1WE6 A;  3RNA C;  2DZJ A;  1TS3 A;  2XK5 A;  2D3C A;  4I6P A;  4MM3 B;  2WXN A;  2BS3 B;  4BAX A;  1YQ4 B;  1ENF A;  1A5R A;  1C4C A;  1NI3 A;  3DDC B;  1JWS D;  1OQY A;  5HHD G;  1V5O A;  2RSU A;  3DBL B;  4KGR A;  1JRO A;  3DHH C;  3M3J A;  2K8C A;  4IW0 A;  3KYC D;  4IUM B;  1CZP A;  2N1V A;  2MX2 A;  3TSS A;  2NMQ A;  2KQ7 A;  2QEJ C;  3Q3M C;  1D6E C;  1J0G A;  4LJP B;  2INC C;  1MPE A;  2C7N B;  1WX8 A;  1ACC A;  5FR3 A;  2KFK A;  1XQQ A;  3W5V B;  2NCN A;  5JH5 C;  1E8X A;  1YJ1 A;  2KAC A;  2GOW A;  2WXG A;  4KZC A;  1L7Y A;  1WGK A;  2L3Z A;  4FLH A;  1NBF C;  4US8 A;  4ASW C;  1ROE A;  3PRZ A;  2K22 A;  1V1O A;  2Y5C A;  1I35 A;  2K5P A;  2A4Z A;  1S1Q B;  1QIL A;  3HM6 X;  3N1Y C;  4GDK A;  5I4D A;  2KD0 A;  5CHF A;  1RYJ A;  3IT6 B;  5GXG B;  1VDV A;  1E7U A;  3TEW A;  2KVZ A;  3MHS D;  3GE3 C;  1FRD A;  2MBQ A;  3BIN A;  3KUC B;  1VRA B;  2JSV X;  2W3S A;  2J53 A;  3QAR A;  2V1Y A;  2XNA C;  3DWG C;  1TKY A;  4YSX B;  4GU2 A;  3ZNH B;  2H88 B;  2WXF A;  3VH3 B;  2W55 A;  4PYU A;  4HKZ E;  3MC9 A;  4BOZ B;  3AXC A;  5C3J B;  5DPR A;  3VFK A;  1WXS A;  1R4M B;  3MTN B;  4OHJ A;  3GZN I;  4O1N A;  1YN4 A;  4BKT A;  1N6Z A;  2K0P A;  4S17 A;  1RRB A;  3UGB B;  4WQO B;  2DNF A;  4A90 A;  2VH2 A;  5G5G A;  3MC0 B;  3R2T A;  4C7Z A;  1ZW7 A;  2FIF A;  1WR6 E;  3NUH B;  4EZK A;  2YEP B;  3JW0 X;  2DLB A;  4FJY A;  4XGA B;  3ZTD A;  2XK5 B;  4BBN F;  2KOX A;  2HTM E;  2V4L A;  2I1K A;  5G55 A;  3VRA B;  2J0M A;  1GAQ B;  4W9C A;  4KDI C;  4XYC A;  3IVF A;  1TZ1 A;  2LVO A;  1KRH A;  4DXA B;  1RWS A;  3AEG B;  1T5X D;  3J9C A;  1TY0 A;  2JX5 A;  3HVZ A;  4HKQ A;  4ZHO A;  3RN9 C;  3ECI A;  3E56 A;  1JAL A;  2PMV A;  2O6V A;  2MJE A;  2MWS B;  2QJL A;  3ZJT A;  5HKH A;  2DZM A;  4FHK A;  4ANV A;  4IM0 A;  4EOY A;  2KFK B;  4ICU A;  4W9J A;  1OQR A;  1C79 A;  4MSQ B;  3PT2 B;  1XO3 A;  1Z2M A;  2JT4 B;  3ZUN A;  1GB4 A;  3A9J A;  4TQ1 A;  4RMA A;  1WR1 A;  3TUO A;  1HTQ A;  1F2R I;  2BPS A;  1XCT L;  1K50 A;  2ZVN A;  1YMH E;  3ABV B;  1ESF A;  4AJY B;  3V61 A;  3KUD B;  4K1R B;  1SIF A;  4JQW C;  2NBU A;  3X23 A;  4E71 A;  1I4H A;  4MH0 E;  1ZPS A;  1MJD A;  5H8Y E;  4RCO A;  4GDK B;  2WS3 B;  1P98 A;  1T3Q A;  2PVO D;  2WWZ A;  1UGM A;  3Q3J A;  3P2B A;  3PZD A;  5E6O A;  1LM8 B;  1IYF A;  4NJC A;  4ZDV A;  1QZE A;  4WH4 A;  4OW0 A;  4DWF A;  3QCA A;  1D5M C;  1D5Z C;  4LTU A;  1B9R A;  2QIL A;  3N9Y C;  1WSP A;  3LYY A;  2OOB B;  4XX5 A;  1V9J A;  4HPM B;  2KLC A;  3DBH I;  3DVN U;  2WXP A;  4NJ7 A;  4US9 A;  3Q3F A;  1U4A A;  1IGD A;  4CO7 A;  3Q69 A;  3H8H A;  2LRW A;  4N59 A;  1UBQ A;  2B3A A;  2CS4 A;  1WJ4 A;  2BKR B;  1KOT A;  3VTU A;  4K7U A;  4GB9 A;  4HDO A;  1I4P A;  4URK A;  1QF6 A;  1TY2 A;  4GN1 A;  2QC8 A;  3O65 B;  1E8W A;  2KFJ A;  4CYE A;  3RMK C;  1GC7 A;  2JY6 A;  2ON8 A;  2LAS A;  4PT5 A;  3NZS A;  2PVG C;  1XCQ L;  1WX9 A;  2K1F A;  1C77 A;  2D5G A;  2KWU B;  5CHW A;  3SDL C;  2IY0 B;  5G2N A;  2OJW A;  2FCQ A;  1WXA A;  5L83 A;  2NPT B;  3L0W B;  2DAJ A;  2PEA A;  3U30 A;  2YVC A;  3L13 A;  4C4V A;  2LHE A;  1DOI A;  2DAF A;  4DHZ E;  2C7M B;  3TEX A;  1SE2 A;  1FO4 A;  1F9J A;  3P4R B;  3MJW A;  2LGD A;  2BYT A;  3EUB 2;  4FAD A;  1Y8R C;  2O6V B;  1SEB D;  1FRR A;  3R8B A;  2GMI C;  1GUA B;  2D3G A;  2N0S B;  2ZCB A;  2L0T A;  3R3M A;  3I3T B;  2ICI A;  2RDH A;  5J18 A;  2KTF A;  2SEB D;  2FID A;  2GBR A;  4JWU C;  3JVZ X;  2X38 A;  3A9J B;  1FNU A;  4TKN A;  4ZRK A;  3NS8 A;  4NJ6 A;  4ZOH C;  1MI0 A;  3C8Y A;  5LXI B;  2K3U A;  3HHM A;  2MP2 A;  4ANU A;  3SHQ A;  1V5T A;  2M0X A;  3B2G A;  1VLB A;  2BTE A;  1JRU A;  3VXW A;  5BO4 B;  1NDD A;  4W9F A;  1QOB A;  4ARC A;  1LQB A;  1KLU D;  3KWV A;  3UIO B;  1SJH D;  2E3T A;  3AEF B;  4OZB A;  3QJZ A;  1FD6 A;  2AQ1 B;  2KMC A;  3AM9 A;  1GJZ A;  4LJO B;  3TCA A;  1D4B A;  3M62 B;  1WGH A;  3AI5 A;  3OJ4 B;  4OVZ A;  2K8B A;  3AE8 B;  3ML8 A;  1HZ6 A;  5E6P A;  4WJN A;  1ET9 A;  1JRP A;  1CMX B;  5AUK A;  3DBS A;  5D3I B;  4ZYS A;  1WIA A;  2CHZ A;  2K25 A;  3BVM A;  1FXI A;  2NTT A;  3NZ3 A;  5EE9 A;  4LNI A;  3P63 A;  3V60 A;  1GPX A;  1TGZ B;  1AAR A;  3H1U A;  4RH6 A;  1L0X B;  1GOZ A;  3LDZ E;  3ZKJ C;  4UDU C;  2J7Q B;  1SB3 C;  1DOX A;  2AWT A;  3I63 C;  3EHV A;  1DGJ A;  3KUZ A;  3OWE B;  1ZDX A;  3B2F A;  3W1S C;  4LNF A;  1YJJ A;  4FJV B;  3TEY A;  3BVG A;  2JZZ A;  5AZH A;  2KQ4 X;  5D6J B;  3W1Y A;  2I2Y A;  1V8C A;  2PE9 A;  1UZX B;  2J0J A;  3VR8 B;  3PZ7 A;  1KLG D;  4WJO A;  1OFF A;  3T3N A;  2AYO B;  1N63 A;  2J0K A;  2G4D B;  2AEH A;  3W5U B;  3ZTC A;  1WRI A;  4C4V B;  2HDE A;  2N4F A;  4NQK E;  3SU8 X;  1TTN A;  5LNK 1;  1K8R B;  2UWQ A;  2MHJ A;  3OLM D;  3S2A A;  4X57 B;  2MBE A;  2NBV B;  4MH8 A;  5BMG A;  4JGH B;  3BYT B;  2A5U A;  1RFK A;  2KZR A;  4G0N B;  2AQ2 B;  1E9M A;  1TYG B;  4IWO A;  1Q0W B;  1I42 A;  4L1B A;  3Q8C A;  3VVW B;  5L95 C;  2QSD A;  1KLV A;  1UEL A;  2MSE D;  4EUT A;  4DQO C;  3AE5 B;  3WAL A;  1NI2 A;  3OG5 A;  3DVG Y;  4FUL A;  3C19 A;  3PTF C;  4NY0 A;  2K8H A;  4YTM B;  3DBR B;  1RLF A;  4KX6 B;  1H4R A;  1T0S C;  2WDQ B;  1B1Z A;  2IDY A;  3PPA A;  3I9V 1;  2L52 A;  1C1Y B;  1WY8 A;  4RM8 A;  3AEC B;  2BVC A;  2KLG A;  4DK5 A;  3ZYY X;  2Z0D B;  3AE9 B;  5BMH A;  1V97 A;  1Y56 A;  2L1A A;  4ZRJ A;  2HD5 B;  2BWF A;  4GIV A;  2UYZ B;  3WAO A;  1T0R C;  2REX A;  4CHK A;  1XT9 B;  4HK2 A;  2E6X A;  1WGD A;  1XLO A;  4ZYN A;  1I7H A;  1FFV A;  2VH1 A;  1E0Z A;  4PS8 A;  3AE3 B;  3IAS 1;  3AE2 B;  4C80 A;  3VHT C;  2IO2 B;  3NY5 A;  4KGS A;  3P4Q B;  2J4X A;  2G4S A;  3AE1 B;  1YOV B;  3RZF A;  2DYO A;  4LDT D;  2IYD B;  1KM7 A;  5TSS A;  1N5W A;  1YQ3 B;  2WX0 A;  4W9I A;  2QMT A;  3EC8 A;  3V62 A;  4NQL B;  3ZQ4 A;  3APC A;  3QWZ B;  5KHQ A;  2W54 A;  3HIZ A;  1M94 A;  1ZXI A;  1E7V A;  2JUO A;  3W2D A;  4W9E A;  2BW2 A;  4YL8 A;  4WWM A;  2N7D A;  1JWA D;  2CR5 A;  4XDC A;  3N3K B;  1XLN A;  1WXV A;  1C4P A;  1SGH A;  3P4P B;  4YTP B;  3R2I A;  2LZ6 A;  1JCK B;  3PRE A;  4B6W A;  1TBE A;  3RI7 C;  1WJ6 A;  3ZO5 B;  3DVG X;  1WM3 A;  2KKC A;  2VZK D;  4BKS D;  1FEH A;  3P4S B;  2Z59 B;  4K3B A;  2L32 A;  3LXF A;  1HZ5 A;  1WGY A;  4GGQ A;  1WXM A;  2WXL A;  2JZP A;  4KSL C;  1F1H A;  3TJP A;  4YTN B;  1M4V A;  1AWD A;  2LWP A;  2CU1 A;  4DDI D;  1C4A A;  3NS1 A;  1P7F A;  5LXH A;  1WM2 A;  3JYU A;  1WXQ A;  4MDK E;  2Z0E B;  4WUR A;  1L4D B;  2ONQ A;  3WA0 A;  2BKF A;  2MH7 A;  3VTV A;  2MJ3 A;  3URY A;  3VR9 B;  1PGX A;  2R2O A;  1K53 A;  1XLQ A;  2L8J A;  5TR5 A;  3N1X C;  3A4S C;  2KDE B;  4JE3 B;  2RMM A;  3U4E G;  2KN5 A;  2K9X A;  4HWI B;  4MGI E;  5EDS A;  2KAJ A;  3N20 C;  2Y5P A;  1P3Q U;  4WJP A;  1MVK A;  3DWM A;  1GNU A;  1SF0 A;  3Q3N C;  4W9D A;  1XEE A;  2ZW1 A;  3IAM 1;  1A70 A;  2WXI A;  4HEA 1;  3JSV A;  2D07 B;  2FCS A;  1ZOY B;  1YIW A;  4XE0 A;  1T6B X;  3VQI A;  2WGS A;  5C23 A;  1PFD A;  1V6E A;  5E6N A;  4A55 A;  2D3B A;  4WQM A;  4DBG A;  4HXD A;  3PHX B;  3Q8B A;  4JPS A;  4F8C B;  4ITK A;  2LJ5 A;  2N1W A;  3ZDT A;  1PYW D;  3BZD B;  4IDI A;  1E6E B;  1L0V B;  4WAF A;  1VZ7 A;  3Q2A C;  2ZVO A;  2G1E A;  1BT0 A;  2CU3 A;  2BYE A;  1E5W A;  2M0A A;  1OEY A;  4M0W A;  1C78 A;  4XDD A;  5HFY A;  2LHD A;  4JX1 C;  4REZ A;  2WX1 A;  3APF A;  4XWW A;  2INP E;  2D10 A;  4GMV A;  1PUT A;  3RCZ A;  1CK1 A;  2KJH B;  5FR6 A;  2MCN B;  2HJ1 A;  3UQA A;  2KO3 A;  4W9L A;  1I4X A;  4I6L B;  1F0Z A;  3NZU A;  1VR9 A;  4N6E B;  2W82 A;  2WNM A;  3NVW A;  1PDX A;  2IGG A;  2ZNV C;  2EMS A;  1QLB B;  4TMA B;  2TSS A;  2WQY B;  3N32 A;  4IG7 B;  2DBY A;  1TT5 B;  4JL9 A;  3Q8A A;  1EF5 A;  2QCZ A;  1BML C;  2D11 A;  2LI5 A;  5DPW A;  3RNF C;  4MGY E;  2LGX A;  5BMI A;  3BII D;  2KMA A;  4XZ4 A;  1GB1 A;  3Q6B A;  1SJE D;  4GOC A;  2ZPY A;  1STE A;  2M19 A;  3NVZ A;  2CKH B;  4C56 C;  4JIO U;  4KIK A;  1YN3 A;  3DOW A;  4HPL B;  3W1S A;  3AE6 B;  3VDZ A;  3VUX A;  3QX1 A;  4A3O A;  1T0Y A;  4FJZ A;  4C7Y A;  4G50 A;  4R3D A;  2D3A A;  3VH4 B;  2NR2 A;  2CJO A;  3FKY A;  4BZA A;  1FNV A;  5AEK B;  1QT9 A;  1VCB A;  1FXA A;  2BYF A;  2R61 A;  1D3Z A;  1N60 A;  3GP7 A;  4KV2 A;  2IND C;  2KT7 A;  1L6V A;  2BB6 A;  4MT5 A;  3JSV B;  3QAQ A;  1WH3 A;  1UGJ A;  4EEW A;  2KQS A;  2FAZ A;  3OAW A;  3R7R A;  2KMM A;  4TQ0 A;  4IWP A;  2KDB A;  4MEM A;  3D32 A;  2N9E B;  3DHI C;  1V49 A;  2GBJ A;  2LMC A;  3EEC A;  3U7D A;  2L7R A;  4HJG E;  1VD2 A;  3RNB C;  2KYW A;  2NS5 A;  5HI1 A;  4B0M A;  4EKU A;  3N30 A;  2IO3 B;  2JRI B;  2LUM A;  3FAH A;  2V0G A;  1LFD A;  3DVN V;  2YEP F;  3VAW A;  1EU3 A;  2KN4 A;  2MBO A;  4NAW A;  2JXX A;  3LB8 C;  1OEY J;  2LGI A;  3B08 A;  4G11 A;  4ZRI A;  4A20 A;  3TL5 A;  2DEN B;  4DDG D;  1WGG A;  1YQB A;  2XEW A;  1EU4 A;  4M00 A;  5JZE B;  3DBL I;  3R7Q A;  1WX7 A;  2KWV B;  1RFA A;  2WXJ A;  4M0W B;  4W9K A;  1P9D U;  3B0A A;  3L54 A;  1L4Z B;  3GZN B;  2LEK A;  1WZ3 A;  1WF9 A;  2JYT A;  4E3C A;  2J42 A;  2GB1 A;  4ARI A;  2MBH A;  2DHZ A;  1V2Y A;  1MHX A;  2KX0 A;  2FUH B;  3CSF A;  1IUE A;  1K52 A;  2M4N A;  2BT6 A;  4N9F 4;  2ZW0 A;  5C1Z A;  3EGR A;  2M17 A;  4K7S A;  1YX5 B;  2N9X A;  1KJT A;  2K6Q A;  2C9W B;  3PSE B;  4AWJ A;  1E8Y A;  1E90 A;  1TKG A;  4BKS A;  4IOI E;  4GSW A;  4TV3 A;  1TKE A;  4TSS A;  3ZRF A;  3VRB B;  2JWZ A;  4P6V F;  3T9L A;  3U2S C;  1JW9 D;  2RPQ A;  3Q3O C;  4AQ7 A;  4WWN A;  4YT0 B;  1P1A A;  3HM3 A;  4RF1 A;  3U52 E;  2IO1 B;  1N62 A;  3AEE B;  3DQV A;  2WU5 B;  1TS2 A;  3NHE B;  2ASQ A;  2PPH A;  3CF6 E;  3EA6 A;  4JWS C;  5AUI A;  1WZ0 A;  4KIK B;  1FM0 D;  2GBK A;  3QK0 A;  2Z8L A;  4M01 A;  1MG8 A;  5CTR C;  4HRO A;  3AU4 A;  1WI0 A;  2WU2 B;  4W9G A;  2QIE B;  3HVD A;  3VTW A;  5IOI A;  2O6V D;  4LNK A;  2K39 A;  1SBB B;  1F2R C;  3H6N A;  4DHJ D;  1WYW B;  4HLE A;  2DZK A;  1IBX A;  2MW5 A;  4GLS C;  2WXO A;  1Q10 A;  4L23 A;  3LJ3 A;  2M8S A;  2R2Q A;  2C60 A;  2Y5B B;  2MBB B;  2WLB A;  1R4M I;  1FMA D;  3ZLZ A;  2WXR A;  4YXD B;  2KXJ A;  1ZXH A;  2V3N A;  1NYR A;  2N7J A;  3I57 A;  3ZJV A;  2W9N A;  2K6D B;  1IGC A;  1JWU D;  3KYD D;  4II2 B;  1VJK A;  2PIA A;  4GDL A;  2PKO A;  3TMP B;  2KHW B;  1NEK B;  1Q1O A;  2N9K A;  4K81 A;  1OTR B;  4N58 A;  3BVZ A;  1J8C A;  1K51 A;  4K7W A;  4B9K A;  2JZ3 B;  3A4R A;  1HTO A;  3X0W A;  2JVC A;  2GBM A;  1GC6 A;  5D94 A;  1P0R A;  3DBH B;  4E74 A;  1HEZ E;  3AED B;  4OZC A;  2NVU I;  1EWC A;  3PGE A;  5JHA A;  2HJ8 A;  1J7A A;  1KF6 B;  4LLG M;  3WAP A;  1QKZ A;  2CHW A;  4B95 A;  1EWY C;  1XF5 L;  3ZIM A;  5BYS A;  4RNA A;  4J3O D;  2MP2 B;  3BY4 B;  1WJU A;  1J7B A;  5FK9 C;  2IZV B;  1BXT A;  4KDL B;  3E9S A;  3L17 A;  3BWU D;  3GB1 A;  2EKE C;  5BYR A;  1NEN B;  3SD5 A;  4OVU A;  1WJN A;  3K9O B;  3M63 B;  4NAM A;  3QHT A;  4M8M A;  4MGZ E;  4FA6 A;  3AE7 B;  1X1M A;  1IP9 A;  3H7S A;  2KNB A;  4MAC A;  1WE7 A;  1Q5W B;  2JF5 A;  3APD A;  1N61 A;  4II3 B;  3AV8 A;  3ZNZ B;  4PYZ A;  3PHW B;  4KGT A;  2WDR B;  2LXC A;  2WXQ A;  1DOY A;  1LO5 D;  4EZL A;  2FE8 A;  4BFR A;  3Q8E A;  3A1Q A;  2BS2 B;  5D2M B;  4HPP A;  2FBW B;  3ZNI D;  3M95 A;  2X8X X;  5EE3 A;  5JHB A;  2IPK D;  2KK8 A;  2KAN A;  1EM7 A;  4PS7 A;  4A8X C;  2ZZP B;  4AJW A;  1UH6 A;  2MQJ A;  2QHO A;  3MHZ A;  2AQ3 B;  3ETR A;  1L0Y B;  3C0R B;  3AE4 B;  3EFC A;  2C7H A;  4FHJ A;  2C5L C;  4C00 A;  1IBX B;  4HDQ A;  1LXD A;  4KKJ A;  3IFW B;  1JWB D;  3ZVV A;  2BGF A;  1HA5 A;  1FFU A;  1UNS A;  2L0F A;  1RM6 C;  3A33 B;  4YSY B;  1QOG A;  2V4I B;  1FPY A;  5J17 A;  1QOF A;  3KW5 B;  5AZG A;  1JWM D;  1FXT B;  1E7P B;  3PVL A;  5IAA C;  3ENE A;  5IP4 D;  4LK0 M;  4S0R A;  2KJ6 A;  4GDL B;  4PK1 A;  3B9J A;  2N7E A;  2GI9 A;  1JQ4 A;  2RDB C;  3SFD B;  3AH7 A;  4WAA A;  3QA8 A;  1N5X A;  2Y3A A;  4IC7 B;  1PQS A;  2KTR A;  1VZ6 A;  4ANW A;  3MP9 A;  3SFE B;  2I1J A;  3AEA B;  3CMM B;  5JXV A;  4MGK E;  2DWQ A;  2IGD A;  2WDV B;  2JU6 X;  3NOB A;  4P1B C;  3RUI B;  1V81 A;  2YLM A;  3QQ8 B;  2CHX A;  2MA9 B;  2V3S A;  3TBL D;  3ZW3 A;  3KWL A;  2OJR A;  4A6Q A;  3ZNG C;  2M56 B;  4A3P A;  4HJK A;  1JML A;  2I38 A;  3RPF C;  3HUI A;  3TEZ A;  3PLV A;  2LXA A;  1C76 A;  3CST A;  3AEB B;  4M02 A;  2ZJD A;  2IGH A;  1YX6 B;  1J7C A;  1I4Q A;  1UWM A;  2LVQ A;  2N9P C;  5LLI A;  1R7S A;  1FNW A;  2RGF A;  3FIL A;  4MJS A;  3RUL A;  1EUV B;  2JPH A;  3DCG A;  3R66 C;  2FNJ B;  4Q2J A;  3CWI A;  2ZPN A;  3A1Q B;  2GBN A;  3AUL A;  5MPO A;  5EE1 A;  2QDF A;  3SR6 A;  2FCM A;  2NBW B;  4G3X B;  4B0E A;  3TIX A;  2INN E;  2LGY A;  2WXK A;  3RNC C;  1FIQ A;  2NPT A;  1L2N A;  1LGR A;  4ICV A;  1R4N B;  4FXC A;  4KSK C;  2BBC A;  2EEL A;  1UUP A;  1KFY B;  4JLC A;  2J52 A;  1DYQ A;  3BK1 A;  1WWT A;  4WWP A;  1NYQ A;  2OHF A;  4ACF A;  3CIR B;  2AL6 A;  3VUW A;  1RAX A;  5D7G A;  3Q14 C;  4WWO A;  2G9H D;  1AW7 A;  3RT3 B;  5DCN A;  1F77 A;  3AN1 A;  1E10 A;  2XN9 C;  1SE9 A;  2JXT A;  2WHI A;  4BVU C;  5DPT A;  2ZEQ A;  3MFG A;  1S3S G;  1I4R A;  3T3O A;  4XC2 A;  1UWX A;  2N9L A;  4LCD E;  1UF0 A;  2RDG A;  4HCP B;  2W3R A;  2KDM A;  2ZNV B;  1ZP0 B;  3RYT A;  1XXG A;  3KH0 A;  3PRP B;  2KX3 A;  5IKC M;  1ZE3 D;  5T8I A;  2KTR B;  3V05 A;  3RNE C;  4RGM A;  4NNJ B;  4DXF A;  3H7P A;  2LFI A;  3IHP C;  3PS6 A;  2DZI A;  5CX3 A;  4KZ0 A;  2CJN A;  4BOS C;  2AL3 A;  2MJD A;  2G45 B;  2KJR A;  1QQR A;  1YJI A;  2M1M A;  3PO0 A; 
#chains in the Genus database with same CATH homology
 3U2S C;  1BUI C;  3AE9 B;  2H88 B;  3HRD D;  1JW9 D;  5BMH A;  2WXF A;  1V97 A;  1Y56 A;  4ZHP A;  2L1A A;  2W55 A;  1KH0 A;  4AQ7 A;  4YT0 B;  4HKZ E;  4RF0 A;  4YWG G;  5C3J B;  4RF1 A;  3U52 E;  2SAK A;  4NZL B;  1TS5 A;  1N62 A;  2E6X A;  3AEE B;  4OHJ A;  1SXT A;  1XLO A;  2WU5 B;  4O1N A;  5H92 C;  1I7H A;  1TS2 A;  1YN4 A;  1FFV A;  1E0Z A;  1P7E A;  2L83 A;  3FC4 A;  2K0P A;  2NTS A;  3EA6 A;  3AB5 A;  4JWS C;  3AE3 B;  3IAS 1;  3AE2 B;  4C80 A;  5AUI A;  4KGS A;  3P4Q B;  2J4X A;  4A90 A;  2B76 B;  3AE1 B;  1FM0 D;  2WXM A;  1PGA A;  2DYO A;  5G5G A;  3MC0 B;  3R2T A;  2Z8L A;  4C7Z A;  3WCQ A;  4USA A;  3NUH B;  3MJ5 A;  4HRO A;  2YEP B;  2WU2 B;  5TSS A;  2DYM A;  1N5W A;  2DLB A;  2PW9 A;  2QIE B;  3FIL B;  3HVD A;  1YQ3 B;  3NVV A;  2QMT A;  2HTM E;  3VRA B;  3ZQ4 A;  1SBB B;  1F2R C;  1GAQ B;  1SSN A;  2W54 A;  2H89 B;  2IJ0 A;  1ZXI A;  2BS4 B;  5EE0 A;  1KRH A;  1RWS A;  1IBX A;  3AEG B;  4AS1 A;  1T5X D;  4GLS C;  2WXO A;  4HRS A;  3W2D A;  1Q10 A;  3J9C A;  1TY0 A;  2JX5 A;  1HQR D;  3HVZ A;  4L23 A;  4HKQ A;  4ZHO A;  2BW2 A;  3E56 A;  2WLB A;  4WWM A;  2ACZ B;  3W9C B;  1JAL A;  1FMA D;  2WP9 B;  2PMV A;  2WXR A;  4YXD B;  1KTK A;  2MJE A;  2QJL A;  1JWA D;  3ZJT A;  4XDC A;  1XLN A;  1ZXH A;  2V3N A;  3Q8F A;  1NYR A;  2N7J A;  1C4P A;  3L4P A;  3I57 A;  3ZJV A;  1IGC A;  1JWU D;  3P4P B;  1CQV A;  4YTP B;  3R2I A;  1VJK A;  1JCK B;  2PIA A;  2PKO A;  1TS4 A;  1NEK B;  1YNT E;  1OQR A;  1C79 A;  2N9K A;  4N58 A;  3BVZ A;  1FCL A;  1MHH E;  4ZRQ A;  1XO3 A;  1K51 A;  4RGN A;  1GB4 A;  2VZK D;  4TQ1 A;  1FEH A;  2GRI A;  2Q5W D;  1QOA A;  3P4S B;  1F2R I;  2MEK A;  3TUO A;  1V1P A;  1VZ8 A;  4YSZ B;  1HEZ E;  2L32 A;  3AED B;  1XCT L;  4OZC A;  1K50 A;  3LXF A;  1YMH E;  1HZ5 A;  2EKI A;  3ABV B;  3RFZ B;  1EWC A;  1ESF A;  1J7A A;  1KF6 B;  3KQ4 A;  4LLG M;  1AN8 A;  2OED A;  2WXL A;  3BK2 A;  1I4H A;  2JZP A;  1QKZ A;  1EWY C;  1ZPS A;  1ZUD 2;  2RPV A;  1XF5 L;  4YTN B;  1M4V A;  5H8Y E;  1AWD A;  5BYS A;  4RNA A;  4RCO A;  4J3O D;  1C4A A;  4GDK B;  2WS3 B;  1J7B A;  1T3Q A;  5FK9 C;  1BXT A;  1P7F A;  2KWD A;  2PVO D;  3E9S A;  3NS1 A;  1WXQ A;  3BWU D;  3AMZ A;  4WUR A;  3GB1 A;  1L4D B;  2ONQ A;  5BYR A;  2PTL A;  2MH7 A;  1ET6 A;  1NEN B;  3NVY A;  4NJC A;  4WIP A;  2MJ3 A;  4OW0 A;  4WH4 A;  3URY A;  3UI3 A;  1D5M C;  1D5Z C;  1PGX A;  4LTU A;  4NAM A;  5D3D A;  3VR9 B;  2QIL A;  4IKG A;  1B9R A;  3N9Y C;  3P1M A;  1K53 A;  1WSP A;  3V3X A;  3LYY A;  3AE7 B;  3BYY B;  1XLQ A;  2V3P A;  4MAC A;  5FKA C;  2WXP A;  4JE3 B;  2RMM A;  4D2K A;  1FCC C;  4US9 A;  2LJI A;  1IGD A;  1N61 A;  3U4E G;  3Q69 A;  2BB5 A;  3H8H A;  3AV8 A;  2K9X A;  1NVI D;  4RGO S;  4N59 A;  3P42 A;  2KAJ A;  2Y5P A;  4KGT A;  1YN5 A;  2WDR B;  2WXQ A;  1DOY A;  1LO5 D;  1MVK A;  3DWM A;  1I4P A;  2FE8 A;  1QF6 A;  1SF0 A;  1TY2 A;  3Q8E A;  1PGB A;  3ZJU A;  2BS2 B;  3IT4 B;  2PLP A;  2FBW B;  2FUG 1;  1L6U A;  3KLS X;  1XEE A;  1SE3 A;  2ON8 A;  2ZW1 A;  5EE3 A;  3IAM 1;  1A70 A;  2WXI A;  4HEA 1;  4PT5 A;  1D5X C;  2IPK D;  2PVG C;  4A9A A;  5C2T B;  1XCQ L;  1EM7 A;  1ZOY B;  1CJE A;  1C77 A;  2D5G A;  1T6B X;  1OQQ A;  4XE0 A;  5BYQ A;  4A8X C;  4DXG A;  3VQI A;  3MHZ A;  1PFD A;  3ZGZ A;  2AQ3 B;  3ETR A;  4A55 A;  1L0Y B;  4WQM A;  3U7Z A;  3Q8B A;  3AE4 B;  4JPS A;  1SE4 A;  4ITK A;  1C9F A;  1PYW D;  1TJE A;  3BZD B;  4IDI A;  1E6E B;  1IBX B;  2LHE A;  4KKJ A;  1DOI A;  1JWB D;  1L0V B;  5E6J A;  3TEX A;  1SE2 A;  1FO4 A;  1HA5 A;  4WAF A;  1VZ7 A;  1FFU A;  1UNS A;  3P4R B;  1I4G A;  1RM6 C;  2BYT A;  4YSY B;  2G1E A;  3EUB 2;  1QOG A;  2CU3 A;  2V4I B;  1QOF A;  1SEB D;  3SEB A;  5HG2 A;  1FRR A;  5G5H A;  3R8B A;  1JWM D;  2M0A A;  4NAW B;  1E7P B;  2N0S B;  4M0W A;  1C78 A;  4OZA A;  4XDD A;  5HFY A;  2LHD A;  4LK0 M;  3GS2 A;  4GDL B;  4JX1 C;  4L2Y A;  4REZ A;  2ICI A;  2RDH A;  4XWW A;  3B9J A;  2SEB D;  2INP E;  4P16 A;  2GI9 A;  4JWU C;  1PUT A;  1JQ4 A;  3PZ8 A;  4RFB A;  1CK1 A;  2X38 A;  1FNU A;  3SFD B;  3AH7 A;  1N5X A;  1AYF A;  1V1P B;  2Y3A A;  3NRZ A;  1SIJ A;  4ZOH C;  1MI0 A;  3C8Y A;  1I4X A;  1VZ6 A;  2K3U A;  3MP9 A;  4CQN A;  1F0Z A;  3SFE B;  1VR9 A;  4N6E B;  2W82 A;  3AEA B;  2WNM A;  4RGT A;  5JXV A;  3NVW A;  2DWQ A;  3B2G A;  2IGD A;  2WDV B;  2JU6 X;  1PDX A;  4XWT A;  2IGG A;  1VLB A;  2BTE A;  2JQR B;  3O13 A;  4H2A A;  1QOB A;  4ARC A;  1QLB B;  1KLU D;  2JYE A;  4TMA B;  2TSS A;  2WQY B;  2VZK B;  3KWV A;  2DBY A;  1SJH D;  3Q8A A;  2E3T A;  1L5P A;  3AEF B;  3IXS A;  4OZB A;  1FD6 A;  1WYG A;  2AQ1 B;  1XLP A;  3KWL A;  3AM9 A;  1BML C;  1D4B A;  4A6Q A;  4OVZ A;  2M56 B;  5BMI A;  3AE8 B;  1HXY D;  3BII D;  1HZ6 A;  1GB1 A;  1JML A;  1SJE D;  1ET9 A;  4ZRP A;  1JRP A;  2I38 A;  5AUK A;  3RPF C;  1STE A;  2M19 A;  3HUI A;  5D3I B;  3TEZ A;  4ZYS A;  3NVZ A;  2WXH A;  2JWU A;  1C76 A;  3BVM A;  1FXI A;  2NTT A;  3AEB B;  3NZ3 A;  4C56 C;  5EE9 A;  3P63 A;  2IGH A;  4EE2 A;  1J7C A;  1YN3 A;  1I4Q A;  1TZO A;  1UWM A;  1GPX A;  3W1S A;  1ZDV A;  3AE6 B;  4KKI A;  1R7S A;  2AX5 A;  4RH6 A;  1L0X B;  1GOZ A;  1FNW A;  3FIL A;  4C7Y A;  4R3D A;  1TS3 A;  4UDU C;  4MM3 B;  1SB3 C;  2WXN A;  1DOX A;  2BS3 B;  1YQ4 B;  2CJO A;  1ENF A;  1C4C A;  1NI3 A;  1DGJ A;  3OWE B;  4Q2J A;  3CWI A;  1ZDX A;  1JWS D;  1FNV A;  5HHD G;  1QT9 A;  3B2F A;  5MPO A;  4KGR A;  1FXA A;  1JRO A;  5EE1 A;  2R61 A;  1N60 A;  3GP7 A;  1YJJ A;  1L6V A;  2BB6 A;  4MT5 A;  3SR6 A;  3TEY A;  3BVG A;  4B0E A;  1UGJ A;  2INN E;  2KQ4 X;  2WXK A;  1CZP A;  2KMM A;  4TQ0 A;  1FIQ A;  3TSS A;  2I2Y A;  2NMQ A;  1V8C A;  2QEJ C;  3ZYY X;  4FXC A;  1D6E C;  3VR8 B;  3PZ7 A;  1KLG D;  1OFF A;  2BBC A;  2EEL A;  2LMC A;  3T3N A;  1MPE A;  1N63 A;  1UUP A;  1ACC A;  1KFY B;  4HJG E;  2J52 A;  1DYQ A;  5HI1 A;  4B0M A;  3W5U B;  5FR3 A;  1WRI A;  3BK1 A;  1WWT A;  2HDE A;  1NYQ A;  2OHF A;  2LUM A;  3FAH A;  2V0G A;  3CIR B;  3W5V B;  2YEP F;  1EU3 A;  2KN4 A;  5LNK 1;  5D7G A;  2KAC A;  2G9H D;  3LB8 C;  1AW7 A;  2WXG A;  2LGI A;  1WGK A;  4MH8 A;  1F77 A;  5BMG A;  3AN1 A;  3BYT B;  4US8 A;  1E10 A;  1RFK A;  1ROE A;  2XN9 C;  1EU4 A;  2AQ2 B;  2K22 A;  1V1O A;  2Y5C A;  1E9M A;  1TYG B;  2JXT A;  4L1B A;  2WXJ A;  3Q8C A;  2QSD A;  2K5P A;  1L4Z B;  2LEK A;  2JYT A;  2J42 A;  3MFG A;  2GB1 A;  4ARI A;  1I4R A;  3T3O A;  1UWX A;  2N9L A;  4DQO C;  3AE5 B;  1QIL A;  2RDG A;  5I4D A;  2W3R A;  1MHX A;  1RYJ A;  3IT6 B;  2KDM A;  1IUE A;  1K52 A;  1VDV A;  5GXG B;  1ZP0 B;  3TEW A;  2BT6 A;  1XXG A;  2ZW0 A;  3EGR A;  4YTM B;  1FRD A;  1ZE3 D;  5T8I A;  3V05 A;  4KX6 B;  2WDQ B;  4RGM A;  1TKG A;  4DXF A;  1VRA B;  4IOI E;  2LFI A;  1B1Z A;  2IDY A;  3I9V 1;  2JSV X;  2W3S A;  2L52 A;  2J53 A;  2CJN A;  2XNA C;  3DWG C;  1TKY A;  1TKE A;  2MJD A;  3AEC B;  4TSS A;  1QQR A;  4YSX B;  3VRB B;  1YJI A;  4P6V F;  3PO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...