1RYJA

Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AN NMR APPROACH TO STRUCTURAL PROTEOMICS
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Structural genomics, unknown function
molecule keywords unknown
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ryjA00
3RPFC 2QIEB 3AV8A 3DWGC 1TKYA 3HRDD 4JWSC 1DOYA 1JWAD 1JALA 1JQ4A 1WXQA 2DWQA 2K9XA 2PVGC 1PFDA 2WP9B 1JRPA 5G5GA 2W54A 1AWDA 1TKEA 1TYGB 1QLBB 2BT6A 3AEBB 4USAA 3W9CB 3ZYYX 2PVOD 1KF6B 1CZPA 4YSZB 3SFDB 3B9JA 2WQYB 5H92C 1RYJA 1TJEA 2KMMA 5AUIA 1VLBA 1ZUD2 1KFYB 3AB5A 2LEKA 5AUKA 1E0ZA 4HROA 1QOFA 3BIID 1N5XA 1FMAD 1DGJA 1OQRA 2CJOA 2DBYA 1WWTA 1J7AA 1GAQB 1SB3C 2M56B 2WS3B 4WQMA 1N60A 2WDQB 4HRSA 3AE5B 3NVYA 3DWMA 3NVWA 2BS4B 2JX5A 3AEEB 4YTMB 1J7CA 3P4RB 1OQQA 1N63A 1FIQA 2WU5B 2CU3A 3ABVB 1OFFA 1YJJA 3P4QB 4YT0B 5G5HA 4ZHOA 2HTME 3NVZA 4IDIA 1ZXIA 1ZP0B 2EKIA 2PKOA 3AE3B 4LTUA 5H8YE 1E7PB 1GPXA 3CIRB 4YXDB 3ETRA 3P4SB 4C7YA 1NENB 1E6EB 2K5PA 2CJNA 1QF6A 2KAJA 4P6VF 1VJKA 1CJEA 1V8CA 1ZOYB 4YSXB 3B2FA 2B76B 1JWBD 1XO3A 5C3JB 1QT9A 2N0SB 1AYFA 1N5WA 1QOGA 3LXFA 1JW9D 1ROEA 2L83A 1FFUA 2L52A 1F0ZA 1PDXA 3AE7B 4N58A 1TKGA 3VRAB 3AMZA 3B2GA 2FBWB 1WYGA 1XLOA 2MJDA 4A9AA 2PIAA 3VR9B 2Q5WD 3AN1A 3WCQA 4ZOHC 2WLBA 4YSYB 1DOXA 1B9RA 3HVZA 4C7ZA 2WDVB 1N61A 3AEFB 1FXIA 1FFVA 2W55A 4US9A 3AEAB 1E10A 4YTNB 1XLNA 1RFKA 1A70A 1T3QA 1XLQA 2AX5A 4YTPB 3W5VB 1FXAA 5C2TB 3P4PB 1L5PA 2H89B 3VR8B 5EE0A 5EE9A 1EWYC 2QJLA 3AE9B 3EUB2 3AECB 3HUIA 3NVVA 1FO4A 3P63A 5EE3A 3AE2B 2BS2B 1KRHA 5GXGB 3NS1A 3VRBB 2WDRB 3L4PA 3AH7A 1JROA 2W3RA 4JWUC 1YJIA 2M19A 2Y5CA 3AE6B 3AEDB 4C80A 1NYRA 1R7SA 1PUTA 1SIJA 1DOIA 1SF0A 1YQ4B 1J7BA 1XLPA 2WU2B 2MJEA 1FRDA 2MJ3A 4JX1C 1NEKB 3LB8C 1WGKA 4ITKA 2OHFA 3PO0A 2MH7A 3SR6A 1L6VA 1QOAA 3P1MA 3W5UB 1WRIA 2E3TA 1UWMA 3AE4B 3AE1B 3AEGB 3AM9A 4FXCA 1L0VB 3NRZA 4US8A 1FM0D 2G1EA 2W3SA 3AE8B 3KWLA 1IUEA 2BS3B 1VDVA 4N59A 4N6EB 1N62A 2ACZB 1V97A 1I7HA 2JQRB 5EE1A 1E9MA 2K22A 4ZHPA 1YQ3B 3CWIA 3FC4A 1QOBA 2H88B 4KX6B 4WWMA 1NVID 1RWSA 1FRRA 3FAHA 1RM6C 3SFEB 1NI3A 1L6UA 5MPOA 1NYQA
chains in the Genus database with same CATH superfamily
3RPFC 3H7PB 1JWAD 3ZTCA 1MHXA 2ZW1A 4NJ6A 3RI7C 4ZRJA 4WJNA 1L4DB 4WJOA 4MM3A 2YVCA 3N1YC 3HIZA 2NTTA 2Y3AA 3T3OA 2WDQB 1I4XA 2LVOA 1TY0A 1T5XD 3QHTA 2JX5A 3PRMB 2J0MA 2NS5A 2KDFB 2KKCA 3AE3B 1ISNA 1E7PB 3I3TB 1C78A 4Q2JA 2GBMA 3X23A 1SE4A 3RD2A 4AUQC 2RR9A 4GLSC 3N9YC 2KWCA 4K1RB 1OGWA 4TMAB 3B2GA 5CTRC 1SJHD 5D94A 2MW5A 2PEAA 4ZOHC 3CSTA 1FEHA 1FCCC 2GB1A 4C7ZA 1ACCA 2XBBC 3SU8X 2KX3A 4NQLB 3KWVA 1WI0A 3W5VB 1T0RC 3GZNB 4NAWB 3RUIB 2N1WA 1L5PA 4M0WB 1XCQL 1V86A 3HUIA 5E6NA 2BF8B 2L32A 2WXPA 4HXDA 2IYDB 5TR5A 2WHIA 4RM8A 2W9NA 4KKIA 3TEWA 2JZ3B 2MBOA 1GC7A 3PZ8A 1WGGA 4HK2A 2ZZPB 1KLVA 2L00B 4F8CB 2VZKB 1GJZA 4US8A 3AE8B 2L76A 4W9EA 2IBIB 4KVGB 2PE6B 2RDHA 1TGZB 1XCTL 2YEPF 1TS5A 1P9DU 2CHXA 3DBHI 1Z2MA 1TKYA 3JW0X 2BW2A 4OVZA 1QLBB 5DPRA 1V1OA 4JE3B 4DQOC 5AZHA 1WMHA 2FE8A 2WXLA 1GOZA 1WH3A 4M02A 5I4DA 2WX0A 4HROA 1X1MA 3E56A 5BMGA 1N60A 3NVWA 1C9FA 4XWWA 1ESFA 1FIQA 2GBJA 3ABVB 4ZHOA 4GDKA 2RPVA 2KANA 4OVUA 4A20A 5LNK1 3TSSA 3ENEA 4GDLA 4MJSB 1C1YB 3B2FA 2B76B 3C19A 3X0WA 2L3ZA 4PS3A 1CK1A 3NHEB 2ASQA 2FBWB 1XLOA 2KTFA 4HPPA 3V62A 5L95C 4KZCA 4MSQB 3W1SC 2V4IB 2WDVB 2KWDA 3SDLC 3UQBA 4LNOA 2FCNA 1UBQA 1EF5A 4LDTB 3P4PB 1WM3A 2RSUA 2LGYA 1JWUD 2MBHA 3A4RA 1FO4A 4B0EA 1RRBA 1EWCA 2Z59B 3IFWB 3IAS1 1R7SA 3JVZX 2DZIA 4GMVA 1JWMD 1ZPSA 1NEKB 3DCGA 1H4RA 2KFKA 3VUXA 4ARIA 2A5UA 4DXFA 2LD9A 1IUEA 4HVBA 5EE1A 2A4ZA 4DBGA 2KFKB 3N3KB 1T0SC 4P1BC 4NJCA 1WE6A 2PVGC 1P7FA 4RCOA 1E8YA 1ET9A 2INNE 2LGXA 2J7QB 4AS1A 1L7YA 3DBLI 5AUKA 3ZRFA 4M01A 5D3IB 2KDBA 1DGJA 4EUTA 2VH2A 1IYFA 2INPE 2QMTA 4WAAA 2KAJA 3RULA 1GNUA 2LJIA 4KGTA 5JHAA 2WXGA 4J3OD 4LCDE 1WRDB 1QOGA 2MBEA 2IO0B 5FK9C 1LFDA 3WANA 4IOIE 2KQSA 1WYGA 3ONSA 2RDBC 1B9RA 2PMVA 4HEA1 4LJOB 2FUHB 2NPTB 4MGIE 4ZRPA 1RFKA 4X57B 1FXAA 3HM6X 1YJ1A 1WZ3A 4FBJB 1EWYC 3WIMA 3U7DA 4RM9A 2AL6A 4TSSA 2UWQA 3L4PA 2IY0B 2HDEA 2MJ3A 1A5RA 1V80A 1KJTA 3A1QA 2FIDA 2LUEA 1TY2A 2GI9A 4N59A 4KGSA 3WA0A 2KXJA 1JALA 1Q0WB 2QILA 1PFDA 2VRRB 4F7ZA 1XD3B 2INCC 3A9KA 4RF1A 4XDCA 3GS2A 5FKAC 5FR3A 1FMAD 3I57A 2YLMA 2KO3A 2MCNB 1CQVA 1T0YA 5LXHA 4TKNA 1WSPA 2LZ6A 2KFJA 3Q8BA 2XNAC 1N63A 4HJGE 4K3CA 3VTVA 2GOWA 2HTME 1ZP0B 3PV1A 1C76A 4WWNA 1QF6A 1NENB 4PS7A 1ZOYB 4B0MA 2M17A 1K52A 1WXAA 1YOVB 2WDTB 3TEYA 2L52A 1TS3A 2GBKA 2MJDA 2PIAA 3CSFA 2J52A 1NDDA 2FIFA 1N61A 1TTNA 3MHZA 1M4VA 4L2YA 1IPGA 3WALA 3U52E 4ARCA 2IY1B 1V2YA 2LRUA 3MHSD 1YX6B 3RNAC 3H9DA 2SEBD 1SE9A 2R2QA 5G55A 4XZ4A 3NY5A 1D4BA 2V0GA 4I6PA 1WYWB 4EFOA 3AU5A 2M0XA 1CMXB 3OG5A 3KUCB 3CMMB 4TV3A 5BYRA 3MC9A 1WJ4A 1UWMA 4DHZB 2BB5A 3NS8A 3NRZA 4KGRA 2G1EA 2K25A 3GE8C 2C7MB 4HCPB 3PLUA 4B9KA 4FHJA 4EOYA 1SJED 2ZW0A 2WP9B 4FA6A 3GOEA 2BT6A 4A6QA 2JPHA 3PGEA 2K3UA 3DVNU 4WIPA 1V9JA 3ZLZA 3LJ3A 4OZAA 3L0WB 4HKZE 1TJEA 2FNJB 3UIPB 1F1HA 1I4GA 1MPEA 3B1LX 5JXVA 1N5XA 2KTRB 3SFDB 1GAQB 1MG8A 1WGRA 3RMKC 2AWTA 1R4MB 3PREA 2BS4B 1I4PA 4YT0B 1TS2A 4GXBA 2IZVB 2K8CA 3VQIA 1PGBA 5IP4D 2N0SB 3E9SA 1V1PB 2K0PA 3LXFA 4ZRQA 2L05A 2G45B 1FFUA 3BYYB 3MJWA 3IBEA 4GU2A 1MI0A 4YSYB 2BGFA 3HVZA 5JHBA 2N4FA 1STEA 4CO7A 4ANWA 1NBFC 2M0AA 4W9CA 3TEXA 1E10A 2QSDA 3NG0A 2BYTA 4OHJA 4II3B 4YTPB 2D3BA 4GDKB 1XF5L 1BXTA 1GUAB 4ACFA 1UNSA 2KJRA 1NI2A 2Y5PA 3GB1A 2LJ5A 1WGKA 5J18A 3PO0A 4LNKA 1WZ0A 1JMLA 3W5UB 2DYMA 1AARA 1J19A 3ZXVA 1PYWD 1GB4A 4HPLB 1RWSA 4WWPA 4YL8A 5MPOA 4W9IA 2KACA 1L2NA 2O2VB 4P7IA 3TEZA 1V1PA 2DZKA 1KF6B 1ET6A 2AL3A 1E7VA 4IC7B 3VHTC 1KFYB 4WJPA 1QOFA 4A90A 1PGAA 1SB3C 2QHOA 3KLSX 4HRSA 2ICIA 1J7CA 2B3AA 1VD2A 5LXIB 2GBNA 2PKOA 1D5MC 4RF0A 1ZDVA 3DHHC 2JF5A 1E5WA 2QC8A 2KLCA 4E3CA 1ROEA 2IGHA 2LGIA 3DVNV 4UDUC 4HJKA 4ZRKA 3R7QA 3PZ7A 2FCMA 1T3QA 3T9LA 2AX5A 1AN8A 2HE7A 2DNFA 3EUB2 3NVVA 2KWUB 2BS2B 1WF9A 2OOBB 1JROA 2BQQA 2M19A 1V5OA 3Q14C 4E71A 2MJEA 4JX1C 1D3ZA 1VR9A 2M1MA 2NPTA 2K39A 2L0TA 3M3JA 2IDYA 4DHJB 1EF1A 2E6XA 3I5JC 1AW7A 4W9LA 3L10B 3U4EG 2AYOB 3R66C 3SEBA 1TYGB 3RT3B 2C9WB 2GLSA 4OVVA 4HDQA 4GN1A 1CZPA 4MM3B 1UD7A 4XE0A 4H2AA 2M8SA 4KKJA 2V3NA 4W9GA 2KDEB 1ENFA 5HI1A 3APFA 3DPDA 1LM8B 4KIKA 3BY4B 2N9KA 2DHZA 3B0AA 3QK0A 2WXQA 2J0KA 3U30A 1KM7A 2MHJA 1I35A 3H7PA 4BKTA 3HM3A 1YN5A 1JWBD 2RGFA 2BYEA 1Y8RC 3ALBA 4M00A 2JRIB 2TSSA 1WXMA 2KX0A 3QAQA 3BINA 4WQOB 4DDGD 2BKFA 3IXSA 3A33B 4ANXA 3EECA 2ZPYA 4W9KA 3VR8B 4IW0A 2DENB 1RLFA 2N9PC 4MH0E 4RGTA 5EE3A 4LK0M 3RCZA 3VRBB 5HFYA 2JWZA 2HD5B 2LVQA 5HKHA 1XLPA 4I6LB 4KDIC 5BMHA 2XK5A 3M95A 3M62B 3EHVA 4IWOA 1I4RA 3P1MA 1QOAA 2CHWA 4KZ0A 1V81A 1V97A 1I7HA 1YMHE 4IM2A 2SAKA 1QOBA 4XGAB 4W9HA 1MFWA 1WGYA 3ZRCA 1UH6A 1NI3A 1L0XB 4BOSC 1N6ZA 2BYVE 2L8JA 1DOYA 5CHVC 2KT7A 4BAXA 3NJTA 2N1VA 3DBLB 3SHQA 1LQBA 2W54A 3ZYYX 5HG2A 2PLPA 4C4VA 2V3PA 3ZDMC 4HKQA 3ZJUA 1ZUD2 3EFUA 4RH6A 2JYEA 5BMIA 2CJOA 3ZJVA 3D32A 2NR2A 4ASWC 2V4LA 3ZGZA 4YTMB 1RFAA 3P4RB 1K8RB 3MTNB 3QCAA 5IOIA 2L1AA 1U4AA 2X38A 4S17A 3IAM1 2K5PA 3DBRI 1CJEA 4AQ7A 1UUPA 3DBHB 5IN7A 1AYFA 2QCZA 2MP2B 4MACA 4ZYSA 1YNTE 1PDXA 3RZWC 3EA6A 3VRAB 4A9AA 3DHIC 1EU4A 3NZSA 3VR9B 2C7HA 1GB1A 3KW5B 4REZA 3RYTA 3R3MA 4MSMB 3ML9A 3U2SC 1XLNA 1OEYA 1WM2A 1XLQA 5CX3A 2JRHA 5C23A 2QJLA 3AE9B 4W9JA 4DXAB 4G3XB 4N9F4 4EKUA 4BZAA 1P0RA 1WIAA 3ZQ4A 2LXCA 2IGDA 2KLGA 3AEDB 1KH0A 3W1YA 4JPSA 3B08A 4PK1A 1V6EA 4KSKC 3ZO5B 2LUMA 4MELA 4PT5A 1P7EA 4P1CC 2G4DB 3BYTB 3KUZA 4IKGA 1E9MA 4NAWA 2D10A 5IA7A 2ZJDA 3K9OB 4O1NA 3VUWA 3P42A 5E6OA 1YX5B 5FR6A 3W1SA 1RM6C 3SD5A 4KDLB 2NBWB 4OZCA 2WXKA 5G5GA 3FILA 2CR5A 1SBBB 4M8MA 2KMMA 3I9V1 2LEKA 3MC0B 3IT6B 1WXVA 3AE5B 1ZKHA 2WU5B 3DDCB 3PSEB 2MX2A 2DYBA 5J17A 1RAXA 3ETRA 3WAPA 4JLCA 4DK5A 4MDKE 4KV2A 3PRPB 1JW9D 1S3SG 2LMCA 3FKYA 1TIFA 1YN3A 5DCNA 1HE8A 2HTHA 1WGHA 3QWZB 3AN1A 3KYDD 1Z5SB 3VTWA 2JT4B 2AQ2B 2JWUA 1C4AA 2X8XX 4GB9A 2ZCBA 2H89B 4B6WA 5EE9A 3JYUA 3AULA 2CS4A 1HTOA 4BBNF 1SIFA 3ZDTA 3NS1A 2KJ6A 2WDRB 4JQWC 5KHQA 4MH8A 1LGRA 4LNNA 1FRDA 3LB8C 2IO3B 3PHWB 3L13A 4M0WA 1ZGUB 1L0VB 4DHZE 5DPSA 3RFZB 1WX9A 2J0JA 3IHPC 2JXXA 1GC6A 4BVUC 2IO1B 2V9HA 5AZFA 1FRRA 2LRWA 2N9XA 4WQMA 2RPQA 1SEBD 1NYQA 2FUG1 1SSNA 4JWSC 3WAOA 3TJPA 2KDIA 1ZE3D 2K1FA 2C7NB 3W9CB 5IKCM 5CHWA 2MP2A 1HXYD 1KTKA 3B9JA 2R61A 3Q3FA 3ZNGC 1F77A 3ML8A 5AUIA 2AEHA 3UF8A 1OTRB 3PPAA 1SE2A 4A3PA 1OQRA 3FILB 2WS3B 3L16A 4K7WA 3ZVVA 1E90A 3NZ3A 1WX8A 1SE3A 4NAMA 2O2VA 2J42A 4IM0A 3P4SB 2CJNA 3QARA 3CF6E 4NQKE 2WXJA 4B95A 2UU7A 3NOBA 1FD6A 3UQAA 4MGZE 1YIWA 1YN4A 3EFCA 4URKA 4NNJB 1JCKB 4MJSA 1FPYA 2OEDA 1M94A 3QX1A 3R2TA 4FHKA 2L0FA 1EO6A 2D2QA 1HZ6A 1ZDXA 4WURA 2WXFA 1IBXB 4W9DA 3RNGC 2WXRA 3H1UA 3AECB 2BVCA 3AH7A 5TSSA 3GP7A 2XK5B 2WU2B 1PUTA 1DOIA 2D07B 2WXNA 5AEKB 1G6JA 5DPWA 1TT5B 3QIJA 3AE4B 4GIVA 2UYZB 1WXSA 3DBRB 2JQRB 3TMPB 2L7RA 2H88B 3P2BA 2ZPNA 2J53A 3OWEB 2QIEB 4KIKB 3DWGC 2MBBB 3UGBB 3PHXB 2KN5A 2MWSB 4C4VB 4USAA 1TKEA 3AEBB 3DOWA 3QA8A 2GRIA 2HJ1A 2N9EB 4EZLA 1WJUA 4YSZB 3PT2B 2VH1A 1VLBA 3AB5A 3ZNID 3Q3MC 1K53A 4A55A 3QJZA 3Q8CA 4FADA 3V61A 1HA5A 4ZYNA 3NVYA 1OEYJ 1IGCA 3EC8A 4HWIB 2I1KA 4AWJA 3RNFC 4YXDB 3Q3OC 2D5GA 3ZUNA 3BVMA 4BKSA 1I4QA 2FCSA 5C3JB 3TBLD 4BOZB 3UIOB 3MJ5A 2BWES 4LLGM 4RMAA 2KQ7A 2KHWB 2RDGA 5BYQA 3WCQA 3U7ZA 3OLMD 4G50A 4A3OA 1SGHA 3Q6BA 2CHZA 1FFVA 1VZ7A 3AEAB 5E6PA 2MSED 3AXCA 1UF0A 3KVFB 2JUOA 5JH5C 2MEKA 3ECIA 2WYQA 1UZXB 2ZNVC 1P1AA 4XYCA 1YD8U 1TZ1A 1YJIA 3AE6B 1SIJA 1SF0A 4RNAA 1OQYA 5E6JA 4KSLC 3Q69A 2OHFA 3JSVB 1WFYA 2BBCA 3R8BA 2EELA 1MJDA 2MLBA 2KOXA 3Q3JA 2KN4A 2K8HA 5D7GA 4OW0A 2VZKD 4EE2A 2AQ3B 3ZNHB 4KX6B 4WWMA 4CHKA 4JGHB 2O6VD 1XQQA 1F9JA 2CU1A 4PYZA 4C56C 3AV8A 1JQ4A 2DWQA 2K9XA 4CYEA 4LNIA 4MEMA 1S1QB 2WQYB 5H92C 1RYJA 3OAWA 4K81A 3UINB 3QQ8B 2I1JA 2WXMA 1V5TA 3BVGA 1Q10A 5DPTA 1IBXA 1TBEA 3P4QB 3RN9C 3ZXRA 3NVZA 3AU4A 4C7YA 1Y56A 1E8ZA 5BO4B 1L4ZB 1EUVB 1N5WA 3IT4B 1WE7A 3DHGC 3H6NA 1WR1A 3M63B 4RFBA 5EDSA 2ZNVB 3HVDA 2WX1A 2WLBA 3VUYA 1BT0A 2I38A 2BPSA 3AEFB 4NPNA 1VZ6A 2KC1A 4YTNB 1EM7A 2NBVB 3APDA 4FJZA 2NCNA 5D2MB 2KVZA 4GDLB 5J2RA 2W3RA 4JWUC 1PGXA 2NVUI 3BZDB 1JRUA 3EGRA 1FCLA 2KC2A 2Z8LA 3KH0A 1DYQA 1BMLC 3A9JB 3VAWA 4HCNB 2WNMA 2KJHB 4FN2A 2D3AA 1T6BX 2BS3B 3VH4B 2RD0A 4WJQA 2XN9C 1V49A 4ZHPA 3BK1A 1C4CA 3PZDA 3CWIA 1NVID 3LDZE 2CKHB 3VVWB 2KMAA 3SFEB 2LASA 3N30A 2PJHA 3R2IA 2Y5BB 1XXGA 4AOFA 2KTRA 1E0ZA 2Z0DB 3VFKA 5KHOA 2LWPA 4QAYA 4IWQA 4HDOA 2KNBA 1VRAB 2Z0EB 2G4SA 4AJWA 1F52A 2JZPA 4G0NB 4II2B 5BYSA 2J4XA 3RNCC 2V3SA 4ICVA 4DHJD 1UBIA 3PTFC 3VDZA 1OFFA 2NTSA 3N1XC 2JXTA 2D11A 3C0RB 3OJ3A 4LTUA 3Q8AA 4P6VF 4YSXB 1V8CA 3DVGY 4FJVB 1XO3A 1QT9A 3N20C 4OZBA 5IO9A 2L83A 2LVPA 1D6EC 3AMZA 2KYWA 1K51A 1WR6E 4LJPB 1DOXA 4XX5A 1D5XC 2DAFA 1XT9B 1FXIA 2N9LA 3RNBC 3ZW3A 1F2RI 3GZNI 2KWVB 3A9JA 2LHDA 2NBUA 4NZLB 4AJYB 1R4NB 2WXOA 2DAJA 2DZJA 2N7DA 4E74A 4ANUA 3NZUA 3KQ4A 4EZKA 3URYA 3AE2B 4DDID 1KRHA 1EU3A 2KK8A 1IP9A 2WGSA 1P98A 1NYRA 1FNVA 1ZW7A 3MP9A 2HJ8A 3BVZA 4J6IA 4NJ7A 2MBQA 1J8CA 3SR6A 2E3TA 3Q3NC 2WXHA 1L0YB 5JZEB 3KWLA 4MGKE 1VDVA 1Q1OA 4IM3A 2ZCCA 3T3NA 3FC4A 1J0GA 2QEJC 1WMHB 3H7SA 1L6UA 1F0ZA 4K3BA 3HRDD 1LO5D 2BB6A 1WXQA 4RGMA 2PE9A 3WAMA 3W2DA 2LGDA 4MT5A 1TS4A 2MRPA 2IO2B 1WGDA 2G3QB 4W9FA 5LLIA 4BBNC 4BFRA 2K6QA 1QKZA 2M56B 3R7RA 2ON8A 3DWMA 3AEEB 2CU3A 5G5HA 1YJJA 3DBSA 2V1YA 4IDIA 2EKIA 3H8HA 4EEWA 3CIRB 1E6EB 1QZEA 3ZNZB 2KDMA 1UGMA 2JSVX 3L17A 1F2RC 3AE7B 2LI5A 4N58A 1TKGA 2PPHA 1MHHE 1WY8A 4TQ0A 5IAAC 2MA9B 1T0QC 2REXA 4DWFA 2JYTA 1LXDA 4US9A 5AZGA 2I2YA 1C77A 1A70A 1E8XA 4EZJA 5C2TB 3VXWA 4DXGA 3BWUD 1GG3A 2D3GA 2WXIA 4PS8A 2QDFA 1YQBA 4P16A 3JSVA 2AQ1B 1J7BA 4ZDVA 4FLHA 1D5ZC 4I6NB 3KUDB 1L6VA 1WRIA 1WX7A 5G2NA 3AE1B 4FXCA 1WJ6A 4IUMB 2W3SA 4XDDA 1BUIC 3OJ4B 3K9PB 4BKGA 1P3QU 3DVGX 3FAHA 1FXTB 1QILA 1HTQA 3PS6A 1K50A 5HHDG 1AWDA 1VZ8A 2PVOD 3Q8FA 4HPMB 1HQRD 2JVCA 2BWFA 2N7JA 1MG4A 1J7AA 1KLGD 3V05A 2EMSA 5C1ZA 1OQQA 3AI5A 1B1ZA 3V3XA 1ZXIA 5H8YE 4D2KA 3V60A 3O65B 1VJKA 4G11A 4LNFA 1UGJA 2EMTA 2R2OA 2OJRA 1I4HA 3TCAA 3DQVA 4A8XC 1I42A 4LDTD 2Q5WD 5GMVA 2K6DB 4C00A 1MVKA 3VTUA 2IPKD 1JWSD 5T8IA 4TQ1A 3MC8A 2DLBA 4JIOU 3V6EB 2LFIA 4S0RA 3TUOA 2ZVOA 5EE0A 2JY6A 1VCBA 3VH3B 4M8NA 1IGDA 2LHEA 1E7UA 2BTEA 3A1QB 3P63A 2LGSA 4CQNA 5GXGB 2GMIC 2WWZA 4TUUA 1C79A 2O6VB 4GGQA 2Y5CA 1KOTA 1YQ4B 3N32A 3UI3A 1KLUD 2W82A 4ITKA 2RMMA 2DYOA 3S2AA 2C60A 3GE3C 3L54A 1TZOA 3I63C 2XEWA 2NMQA 1HEZE 4YWGG 3TL5A 4ANVA 2M4NA 4PYUA 2JU6X 2EKEC 4WH4A 3Q8EA 3KYCD 1QQRA 2D3CA 2JZZA 2INDC 1HZ5A 1Q5WB 1JRPA 1FNWA 2N7EA 2OJWA 3T8MA 2C5LC 1UELA 2BKRB 2IJ0A 4R3DA 4IG7B 4HLEA 1R4MI 1FNUA 1R4NI 1SXTA 3L08A 4BKSD 3LYYA 2MQJA 3BIID 2DBYA 1WWTA 2PW9A 2G9HD 3C8YA 4MGYE 2KVRA 3ZKJC 3TIXA 2KMCA 3U8ZA 3QC8B 3PLVA 3A9KB 3PRZA 3IVFA 1C3TA 4ICUA 1GPXA 4XWTA 2DX5B 4JL9A 1ZXHA 1H8CA 3ZJTA 1XEEA 2GBRA 2O6VA 4L1BA 4K7SA 3APCA 4NY0A 4FULA 3MFGA 4GSWA 4XC2A 3BK2A 3IG3A 4RGNA 2W55A 3ZIMA 2FCQA 1PQSA 3RZFA 4IWPA 2ZEQA 3NUHB 3O13A 4AP4C 2DZMA 2ONQA 4ZRIA 3HHMA 2KD0A 4WAFA 5L83A 3J9CA 3Q2AC 3HK0A 4C80A 4RGOS 5D6JB 3ZTDA 1E8WA 3PVLA 2LXAA 2BYFA 4GOCA 2MH7A 3RNEC 4F1SA 5D3DA 2KQ4X 3AEGB 3AM9A 4K7UA 1FM0D 5CHFA 1UWXA 4N6EB 4L23A 1N62A 2K8BA 3N1ZC 1WJNA 2ACZB 4FJYA 2FAZA 2K22A 3A4SC 4WWOA 1YQ3B 2IGGA 2YEPB 1C4PA 2ZVNA 3V6CB 2KZRA 2PTLA
chains in the Genus database with same CATH topology
1SJED 3RPFC 3R2IA 1JWAD 2ZW0A 1MHXA 2WP9B 1XXGA 4OZCA 2WXKA 2ZW1A 5G5GA 1E0ZA 2BT6A 3FILA 4WIPA 4A6QA 2K3UA 4OZAA 1SBBB 1L4DB 4HKZE 1TJEA 2KMMA 3I9V1 1VRAB 2LEKA 1I4GA 1MPEA 5JXVA 3MC0B 1N5XA 2NTTA 3SFDB 2JZPA 2Y3AA 1GAQB 3IT6B 3T3OA 2WDQB 1I4XA 3AE5B 1T5XD 1TY0A 2J4XA 5BYSA 2BS4B 2JX5A 1I4PA 2WU5B 1OFFA 4YT0B 2NTSA 1TS2A 2JXTA 4LTUA 3AE3B 1E7PB 1C78A 3Q8AA 4Q2JA 1PGBA 3VQIA 3ETRA 4P6VF 4YSXB 1V8CA 1SE4A 1XO3A 1QT9A 2N0SB 3E9SA 4GLSC 4OZBA 3N9YC 1V1PB 2K0PA 3LXFA 1JW9D 4ZRQA 2L83A 1FFUA 2LMCA 1D6EC 1YN3A 3BYYB 3AMZA 4TMAB 3B2GA 1K51A 1SJHD 3AN1A 4ZOHC 1FEHA 1MI0A 1FCCC 2GB1A 4YSYB 1D5XC 1DOXA 3HVZA 4C7ZA 1FXIA 2AQ2B 1STEA 2N9LA 2JWUA 2M0AA 1ACCA 3TEXA 1E10A 1C4AA 2QSDA 2BYTA 1F2RI 3KWVA 4OHJA 4YTPB 3W5VB 2LHDA 4NAWB 4GDKB 4NZLB 1L5PA 2H89B 2WXOA 5EE9A 1XCQL 1XF5L 3HUIA 1BXTA 2L32A 3KQ4A 3URYA 2WXPA 1UNSA 3AE2B 1KRHA 3NS1A 2WDRB 1EU3A 4MH8A 2Y5PA 4KKIA 3TEWA 3GB1A 1NYRA 1FRDA 3PZ8A 1FNVA 3LB8C 3MP9A 1WGKA 3BVZA 3PO0A 3SR6A 2VZKB 1JMLA 3W5UB 2E3TA 2WXHA 1L0YB 4M0WA 1L0VB 4US8A 3KWLA 3AE8B 3RFZB 1VDVA 2RDHA 2DYMA 1XCTL 2YEPF 3T3NA 3FC4A 2QEJC 1PYWD 1TS5A 1GB4A 1RWSA 1FRRA 4WQMA 1L6UA 1F0ZA 1SEBD 5MPOA 1NYQA 2FUG1 2KACA 1SSNA 1TKYA 3HRDD 4JWSC 2BW2A 1LO5D 2BB6A 1WXQA 4RGMA 4OVZA 1ZE3D 3W2DA 1QLBB 3W9CB 3TEZA 1V1PA 4MT5A 1TS4A 1V1OA 4JE3B 1KF6B 4DQOC 1HXYD 1KTKA 3B9JA 2FE8A 2R61A 1ET6A 1GOZA 2WXLA 5I4DA 1F77A 5AUIA 1KFYB 1SE2A 4HROA 3E56A 1QOFA 4A90A 1OQRA 1QKZA 2M56B 1PGAA 1SB3C 2WS3B 3FILB 3KLSX 5BMGA 1N60A 4HRSA 2ON8A 2ICIA 3DWMA 3NVWA 1C9FA 3NZ3A 3AEEB 4XWWA 1J7CA 1ESFA 1FIQA 3ABVB 1SE3A 2CU3A 1YJJA 5G5HA 4NAMA 4ZHOA 2J42A 2RPVA 4IDIA 2EKIA 2PKOA 5LNK1 3TSSA 3H8HA 3CIRB 3P4SB 1D5MC 1E6EB 2CJNA 4RF0A 1ZDVA 2KDMA 3B2FA 2B76B 2WXJA 2JSVX 1F2RC 1ROEA 1FD6A 1CK1A 3AE7B 2IGHA 4N58A 2LGIA 1TKGA 1YN4A 2FBWB 1MHHE 1XLOA 4UDUC 4TQ0A 1JCKB 2OEDA 3PZ7A 2V4IB 2JYTA 2KWDA 2WDVB 3R2TA 4US9A 2I2YA 1HZ6A 1C77A 1A70A 1T3QA 2AX5A 5C2TB 1AN8A 1ZDXA 4WURA 2WXFA 1IBXB 4DXGA 3P4PB 1JWUD 2WXRA 3BWUD 3AECB 3EUB2 3NVVA 1FO4A 4B0EA 1EWCA 2BS2B 2WXIA 3AH7A 1JROA 2M19A 5TSSA 3IAS1 3GP7A 4P16A 1R7SA 2WU2B 1PUTA 1DOIA 2AQ1B 1J7BA 2MJEA 2WXNA 4JX1C 1VR9A 1JWMD 1ZPSA 1NEKB 1D5ZC 4ARIA 1L6VA 4DXFA 1WRIA 3AE1B 3AE4B 2IDYA 4FXCA 2W3SA 1IUEA 4XDDA 1BUIC 2JQRB 5EE1A 2H88B 2E6XA 2J53A 3FAHA 1AW7A 1QILA 3OWEB 2QIEB 3DWGC 3U4EG 4NJCA 1K50A 5HHDG 2PVGC 3SEBA 1P7FA 1AWDA 1TKEA 1TYGB 1VZ8A 4RCOA 3AEBB 4USAA 2PVOD 3Q8FA 1HQRD 1ET9A 1CZPA 2GRIA 4MM3B 4YSZB 2INNE 4AS1A 4XE0A 4H2AA 1VLBA 3AB5A 5AUKA 2N7JA 1K53A 4A55A 5D3IB 4KKJA 1DGJA 2V3NA 1J7AA 1ENFA 1KLGD 3Q8CA 5HI1A 3V05A 1HA5A 3NVYA 1IGCA 2INPE 2N9KA 1OQQA 2QMTA 2WXQA 1B1ZA 3V3XA 1ZXIA 5H8YE 4YXDB 4D2KA 2D5GA 2KAJA 1VJKA 3BVMA 2LJIA 1I4QA 1UGJA 4KGTA 1YN5A 1JWBD 5C3JB 1I4HA 2WXGA 4J3OD 3MJ5A 1QOGA 4LLGM 5FK9C 2TSSA 4A8XC 4IOIE 1WYGA 2Q5WD 2RDGA 5BYQA 3WCQA 3U7ZA 1B9RA 2PMVA 1MVKA 4HEA1 1FFVA 1VZ7A 2IPKD 1JWSD 3AEAB 3IXSA 5T8IA 4ZRPA 1RFKA 4TQ1A 2DLBA 2LFIA 1FXAA 3TUOA 3VR8B 5EE0A 1EWYC 1IGDA 2MEKA 2LHEA 2BTEA 4RGTA 3P63A 4TSSA 5EE3A 4CQNA 4LK0M 5GXGB 3VRBB 3L4PA 5HFYA 1C79A 1YJIA 3AE6B 2Y5CA 1SIJA 1YQ4B 1SF0A 1XLPA 2HDEA 3UI3A 1KLUD 4RNAA 2MJ3A 5BMHA 5E6JA 2W82A 4ITKA 3Q69A 2OHFA 2RMMA 2BBCA 3R8BA 2EELA 1I4RA 3P1MA 1QOAA 2DYOA 1TY2A 2KN4A 1TZOA 5D7GA 2GI9A 4OW0A 4N59A 2VZKD 2NMQA 1HEZE 4YWGG 4EE2A 2AQ3B 1I7HA 1V97A 4KGSA 1YMHE 2JU6X 2SAKA 4WH4A 1QOBA 3Q8EA 4KX6B 4WWMA 1QQRA 1NI3A 1L0XB 4C56C 3AV8A 1DOYA 1JALA 1JQ4A 2DWQA 2QILA 2K9XA 1HZ5A 1PFDA 1JRPA 1FNWA 2W54A 3ZYYX 5HG2A 2IJ0A 2PLPA 4R3DA 2V3PA 2WQYB 5H92C 1RYJA 1FNUA 3ZJUA 4HKQA 4RF1A 4XDCA 1ZUD2 3GS2A 4RH6A 1SXTA 5FKAC 5FR3A 3LYYA 2JYEA 5BMIA 3BIID 2DBYA 1FMAD 2CJOA 3I57A 3ZJVA 1WWTA 2PW9A 2G9HD 3C8YA 2WXMA 3BVGA 1CQVA 1Q10A 1WSPA 4YTMB 3ZGZA 3P4RB 2XNAC 3Q8BA 1N63A 3P4QB 1IBXA 4HJGE 2L1AA 2X38A 2HTME 3NVZA 1ZP0B 1GPXA 4XWTA 3IAM1 1C76A 1QF6A 4C7YA 1NENB 2K5PA 1Y56A 1ZXHA 1ZOYB 1CJEA 4B0MA 3ZJTA 4AQ7A 1UUPA 1L4ZB 1XEEA 1K52A 1AYFA 4L1BA 1N5WA 3IT4B 3TEYA 4MACA 2L52A 4ZYSA 1YNTE 1PDXA 4RFBA 3EA6A 3VRAB 1TS3A 3HVDA 4A9AA 2MJDA 1EU4A 2PIAA 3VR9B 3MFGA 2WLBA 1GB1A 2J52A 4REZA 3BK2A 2I38A 3AEFB 1N61A 4RGNA 2W55A 1VZ6A 1XLNA 4YTNB 3U2SC 1EM7A 1XLQA 3MHZA 1M4VA 4L2YA 4ARCA 3U52E 3NUHB 2QJLA 3AE9B 3O13A 2ONQA 2SEBD 4GDLB 4WAFA 3ZQ4A 3J9CA 2W3RA 4JWUC 1PGXA 1D4BA 2IGDA 3AEDB 4C80A 3BZDB 3EGRA 2V0GA 1FCLA 4RGOS 2Z8LA 1KH0A 5BYRA 1DYQA 2MH7A 4JPSA 1BMLC 5D3DA 2KQ4X 3AEGB 1UWMA 2WNMA 2BB5A 2LUMA 3AM9A 1T6BX 3NRZA 4KGRA 1FM0D 2G1EA 1P7EA 4PT5A 1UWXA 3BYTB 2BS3B 4N6EB 4L23A 1N62A 2ACZB 4IKGA 2XN9C 1E9MA 2K22A 4ZHPA 3BK1A 1C4CA 1YQ3B 3CWIA 2IGGA 2YEPB 4O1NA 1C4PA 1NVID 3P42A 3W1SA 1RM6C 3SFEB 2PTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPF C;  2QIE B;  3AV8 A;  3DWG C;  1TKY A;  3HRD D;  4JWS C;  1DOY A;  1JWA D;  1JAL A;  1JQ4 A;  1WXQ A;  2DWQ A;  2K9X A;  2PVG C;  1PFD A;  2WP9 B;  1JRP A;  5G5G A;  2W54 A;  1AWD A;  1TKE A;  1TYG B;  1QLB B;  2BT6 A;  3AEB B;  4USA A;  3W9C B;  3ZYY X;  2PVO D;  1KF6 B;  1CZP A;  4YSZ B;  3SFD B;  3B9J A;  2WQY B;  5H92 C;  1RYJ A;  1TJE A;  2KMM A;  5AUI A;  1VLB A;  1ZUD 2;  1KFY B;  3AB5 A;  2LEK A;  5AUK A;  1E0Z A;  4HRO A;  1QOF A;  3BII D;  1N5X A;  1FMA D;  1DGJ A;  1OQR A;  2CJO A;  2DBY A;  1WWT A;  1J7A A;  1GAQ B;  1SB3 C;  2M56 B;  2WS3 B;  4WQM A;  1N60 A;  2WDQ B;  4HRS A;  3AE5 B;  3NVY A;  3DWM A;  3NVW A;  2BS4 B;  2JX5 A;  3AEE B;  4YTM B;  1J7C A;  3P4R B;  1OQQ A;  1N63 A;  1FIQ A;  2WU5 B;  2CU3 A;  3ABV B;  1OFF A;  1YJJ A;  3P4Q B;  4YT0 B;  5G5H A;  4ZHO A;  2HTM E;  3NVZ A;  4IDI A;  1ZXI A;  1ZP0 B;  2EKI A;  2PKO A;  3AE3 B;  4LTU A;  5H8Y E;  1E7P B;  1GPX A;  3CIR B;  4YXD B;  3ETR A;  3P4S B;  4C7Y A;  1NEN B;  1E6E B;  2K5P A;  2CJN A;  1QF6 A;  2KAJ A;  4P6V F;  1VJK A;  1CJE A;  1V8C A;  1ZOY B;  4YSX B;  3B2F A;  2B76 B;  1JWB D;  1XO3 A;  5C3J B;  1QT9 A;  2N0S B;  1AYF A;  1N5W A;  1QOG A;  3LXF A;  1JW9 D;  1ROE A;  2L83 A;  1FFU A;  2L52 A;  1F0Z A;  1PDX A;  3AE7 B;  4N58 A;  1TKG A;  3VRA B;  3AMZ A;  3B2G A;  2FBW B;  1WYG A;  1XLO A;  2MJD A;  4A9A A;  2PIA A;  3VR9 B;  2Q5W D;  3AN1 A;  3WCQ A;  4ZOH C;  2WLB A;  4YSY B;  1DOX A;  1B9R A;  3HVZ A;  4C7Z A;  2WDV B;  1N61 A;  3AEF B;  1FXI A;  1FFV A;  2W55 A;  4US9 A;  3AEA B;  1E10 A;  4YTN B;  1XLN A;  1RFK A;  1A70 A;  1T3Q A;  1XLQ A;  2AX5 A;  4YTP B;  3W5V B;  1FXA A;  5C2T B;  3P4P B;  1L5P A;  2H89 B;  3VR8 B;  5EE0 A;  5EE9 A;  1EWY C;  2QJL A;  3AE9 B;  3EUB 2;  3AEC B;  3HUI A;  3NVV A;  1FO4 A;  3P63 A;  5EE3 A;  3AE2 B;  2BS2 B;  1KRH A;  5GXG B;  3NS1 A;  3VRB B;  2WDR B;  3L4P A;  3AH7 A;  1JRO A;  2W3R A;  4JWU C;  1YJI A;  2M19 A;  2Y5C A;  3AE6 B;  3AED B;  4C80 A;  1NYR A;  1R7S A;  1PUT A;  1SIJ A;  1DOI A;  1SF0 A;  1YQ4 B;  1J7B A;  1XLP A;  2WU2 B;  2MJE A;  1FRD A;  2MJ3 A;  4JX1 C;  1NEK B;  3LB8 C;  1WGK A;  4ITK A;  2OHF A;  3PO0 A;  2MH7 A;  3SR6 A;  1L6V A;  1QOA A;  3P1M A;  3W5U B;  1WRI A;  2E3T A;  1UWM A;  3AE4 B;  3AE1 B;  3AEG B;  3AM9 A;  4FXC A;  1L0V B;  3NRZ A;  4US8 A;  1FM0 D;  2G1E A;  2W3S A;  3AE8 B;  3KWL A;  1IUE A;  2BS3 B;  1VDV A;  4N59 A;  4N6E B;  1N62 A;  2ACZ B;  1V97 A;  1I7H A;  2JQR B;  5EE1 A;  1E9M A;  2K22 A;  4ZHP A;  1YQ3 B;  3CWI A;  3FC4 A;  1QOB A;  2H88 B;  4KX6 B;  4WWM A;  1NVI D;  1RWS A;  1FRR A;  3FAH A;  1RM6 C;  3SFE B;  1NI3 A;  1L6U A;  5MPO A;  1NYQ A; 
#chains in the Genus database with same CATH topology
 3RPF C;  3H7P B;  1JWA D;  3ZTC A;  1MHX A;  2ZW1 A;  4NJ6 A;  3RI7 C;  4ZRJ A;  4WJN A;  1L4D B;  4WJO A;  4MM3 A;  2YVC A;  3N1Y C;  3HIZ A;  2NTT A;  2Y3A A;  3T3O A;  2WDQ B;  1I4X A;  2LVO A;  1TY0 A;  1T5X D;  3QHT A;  2JX5 A;  3PRM B;  2J0M A;  2NS5 A;  2KDF B;  2KKC A;  3AE3 B;  1ISN A;  1E7P B;  3I3T B;  1C78 A;  4Q2J A;  2GBM A;  3X23 A;  1SE4 A;  3RD2 A;  4AUQ C;  2RR9 A;  4GLS C;  3N9Y C;  2KWC A;  4K1R B;  1OGW A;  4TMA B;  3B2G A;  5CTR C;  1SJH D;  5D94 A;  2MW5 A;  2PEA A;  4ZOH C;  3CST A;  1FEH A;  1FCC C;  2GB1 A;  4C7Z A;  1ACC A;  2XBB C;  3SU8 X;  2KX3 A;  4NQL B;  3KWV A;  1WI0 A;  3W5V B;  1T0R C;  3GZN B;  4NAW B;  3RUI B;  2N1W A;  1L5P A;  4M0W B;  1XCQ L;  1V86 A;  3HUI A;  5E6N A;  2BF8 B;  2L32 A;  2WXP A;  4HXD A;  2IYD B;  5TR5 A;  2WHI A;  4RM8 A;  2W9N A;  4KKI A;  3TEW A;  2JZ3 B;  2MBO A;  1GC7 A;  3PZ8 A;  1WGG A;  4HK2 A;  2ZZP B;  1KLV A;  2L00 B;  4F8C B;  2VZK B;  1GJZ A;  4US8 A;  3AE8 B;  2L76 A;  4W9E A;  2IBI B;  4KVG B;  2PE6 B;  2RDH A;  1TGZ B;  1XCT L;  2YEP F;  1TS5 A;  1P9D U;  2CHX A;  3DBH I;  1Z2M A;  1TKY A;  3JW0 X;  2BW2 A;  4OVZ A;  1QLB B;  5DPR A;  1V1O A;  4JE3 B;  4DQO C;  5AZH A;  1WMH A;  2FE8 A;  2WXL A;  1GOZ A;  1WH3 A;  4M02 A;  5I4D A;  2WX0 A;  4HRO A;  1X1M A;  3E56 A;  5BMG A;  1N60 A;  3NVW A;  1C9F A;  4XWW A;  1ESF A;  1FIQ A;  2GBJ A;  3ABV B;  4ZHO A;  4GDK A;  2RPV A;  2KAN A;  4OVU A;  4A20 A;  5LNK 1;  3TSS A;  3ENE A;  4GDL A;  4MJS B;  1C1Y B;  3B2F A;  2B76 B;  3C19 A;  3X0W A;  2L3Z A;  4PS3 A;  1CK1 A;  3NHE B;  2ASQ A;  2FBW B;  1XLO A;  2KTF A;  4HPP A;  3V62 A;  5L95 C;  4KZC A;  4MSQ B;  3W1S C;  2V4I B;  2WDV B;  2KWD A;  3SDL C;  3UQB A;  4LNO A;  2FCN A;  1UBQ A;  1EF5 A;  4LDT B;  3P4P B;  1WM3 A;  2RSU A;  2LGY A;  1JWU D;  2MBH A;  3A4R A;  1FO4 A;  4B0E A;  1RRB A;  1EWC A;  2Z59 B;  3IFW B;  3IAS 1;  1R7S A;  3JVZ X;  2DZI A;  4GMV A;  1JWM D;  1ZPS A;  1NEK B;  3DCG A;  1H4R A;  2KFK A;  3VUX A;  4ARI A;  2A5U A;  4DXF A;  2LD9 A;  1IUE A;  4HVB A;  5EE1 A;  2A4Z A;  4DBG A;  2KFK B;  3N3K B;  1T0S C;  4P1B C;  4NJC A;  1WE6 A;  2PVG C;  1P7F A;  4RCO A;  1E8Y A;  1ET9 A;  2INN E;  2LGX A;  2J7Q B;  4AS1 A;  1L7Y A;  3DBL I;  5AUK A;  3ZRF A;  4M01 A;  5D3I B;  2KDB A;  1DGJ A;  4EUT A;  2VH2 A;  1IYF A;  2INP E;  2QMT A;  4WAA A;  2KAJ A;  3RUL A;  1GNU A;  2LJI A;  4KGT A;  5JHA A;  2WXG A;  4J3O D;  4LCD E;  1WRD B;  1QOG A;  2MBE A;  2IO0 B;  5FK9 C;  1LFD A;  3WAN A;  4IOI E;  2KQS A;  1WYG A;  3ONS A;  2RDB C;  1B9R A;  2PMV A;  4HEA 1;  4LJO B;  2FUH B;  2NPT B;  4MGI E;  4ZRP A;  1RFK A;  4X57 B;  1FXA A;  3HM6 X;  1YJ1 A;  1WZ3 A;  4FBJ B;  1EWY C;  3WIM A;  3U7D A;  4RM9 A;  2AL6 A;  4TSS A;  2UWQ A;  3L4P A;  2IY0 B;  2HDE A;  2MJ3 A;  1A5R A;  1V80 A;  1KJT A;  3A1Q A;  2FID A;  2LUE A;  1TY2 A;  2GI9 A;  4N59 A;  4KGS A;  3WA0 A;  2KXJ A;  1JAL A;  1Q0W B;  2QIL A;  1PFD A;  2VRR B;  4F7Z A;  1XD3 B;  2INC C;  3A9K A;  4RF1 A;  4XDC A;  3GS2 A;  5FKA C;  5FR3 A;  1FMA D;  3I57 A;  2YLM A;  2KO3 A;  2MCN B;  1CQV A;  1T0Y A;  5LXH A;  4TKN A;  1WSP A;  2LZ6 A;  2KFJ A;  3Q8B A;  2XNA C;  1N63 A;  4HJG E;  4K3C A;  3VTV A;  2GOW A;  2HTM E;  1ZP0 B;  3PV1 A;  1C76 A;  4WWN A;  1QF6 A;  1NEN B;  4PS7 A;  1ZOY B;  4B0M A;  2M17 A;  1K52 A;  1WXA A;  1YOV B;  2WDT B;  3TEY A;  2L52 A;  1TS3 A;  2GBK A;  2MJD A;  2PIA A;  3CSF A;  2J52 A;  1NDD A;  2FIF A;  1N61 A;  1TTN A;  3MHZ A;  1M4V A;  4L2Y A;  1IPG A;  3WAL A;  3U52 E;  4ARC A;  2IY1 B;  1V2Y A;  2LRU A;  3MHS D;  1YX6 B;  3RNA C;  3H9D A;  2SEB D;  1SE9 A;  2R2Q A;  5G55 A;  4XZ4 A;  3NY5 A;  1D4B A;  2V0G A;  4I6P A;  1WYW B;  4EFO A;  3AU5 A;  2M0X A;  1CMX B;  3OG5 A;  3KUC B;  3CMM B;  4TV3 A;  5BYR A;  3MC9 A;  1WJ4 A;  1UWM A;  4DHZ B;  2BB5 A;  3NS8 A;  3NRZ A;  4KGR A;  2G1E A;  2K25 A;  3GE8 C;  2C7M B;  4HCP B;  3PLU A;  4B9K A;  4FHJ A;  4EOY A;  1SJE D;  2ZW0 A;  2WP9 B;  4FA6 A;  3GOE A;  2BT6 A;  4A6Q A;  2JPH A;  3PGE A;  2K3U A;  3DVN U;  4WIP A;  1V9J A;  3ZLZ A;  3LJ3 A;  4OZA A;  3L0W B;  4HKZ E;  1TJE A;  2FNJ B;  3UIP B;  1F1H A;  1I4G A;  1MPE A;  3B1L X;  5JXV A;  1N5X A;  2KTR B;  3SFD B;  1GAQ B;  1MG8 A;  1WGR A;  3RMK C;  2AWT A;  1R4M B;  3PRE A;  2BS4 B;  1I4P A;  4YT0 B;  1TS2 A;  4GXB A;  2IZV B;  2K8C A;  3VQI A;  1PGB A;  5IP4 D;  2N0S B;  3E9S A;  1V1P B;  2K0P A;  3LXF A;  4ZRQ A;  2L05 A;  2G45 B;  1FFU A;  3BYY B;  3MJW A;  3IBE A;  4GU2 A;  1MI0 A;  4YSY B;  2BGF A;  3HVZ A;  5JHB A;  2N4F A;  1STE A;  4CO7 A;  4ANW A;  1NBF C;  2M0A A;  4W9C A;  3TEX A;  1E10 A;  2QSD A;  3NG0 A;  2BYT A;  4OHJ A;  4II3 B;  4YTP B;  2D3B A;  4GDK B;  1XF5 L;  1BXT A;  1GUA B;  4ACF A;  1UNS A;  2KJR A;  1NI2 A;  2Y5P A;  3GB1 A;  2LJ5 A;  1WGK A;  5J18 A;  3PO0 A;  4LNK A;  1WZ0 A;  1JML A;  3W5U B;  2DYM A;  1AAR A;  1J19 A;  3ZXV A;  1PYW D;  1GB4 A;  4HPL B;  1RWS A;  4WWP A;  4YL8 A;  5MPO A;  4W9I A;  2KAC A;  1L2N A;  2O2V B;  4P7I A;  3TEZ A;  1V1P A;  2DZK A;  1KF6 B;  1ET6 A;  2AL3 A;  1E7V A;  4IC7 B;  3VHT C;  1KFY B;  4WJP A;  1QOF A;  4A90 A;  1PGA A;  1SB3 C;  2QHO A;  3KLS X;  4HRS A;  2ICI A;  1J7C A;  2B3A A;  1VD2 A;  5LXI B;  2GBN A;  2PKO A;  1D5M C;  4RF0 A;  1ZDV A;  3DHH C;  2JF5 A;  1E5W A;  2QC8 A;  2KLC A;  4E3C A;  1ROE A;  2IGH A;  2LGI A;  3DVN V;  4UDU C;  4HJK A;  4ZRK A;  3R7Q A;  3PZ7 A;  2FCM A;  1T3Q A;  3T9L A;  2AX5 A;  1AN8 A;  2HE7 A;  2DNF A;  3EUB 2;  3NVV A;  2KWU B;  2BS2 B;  1WF9 A;  2OOB B;  1JRO A;  2BQQ A;  2M19 A;  1V5O A;  3Q14 C;  4E71 A;  2MJE A;  4JX1 C;  1D3Z A;  1VR9 A;  2M1M A;  2NPT A;  2K39 A;  2L0T A;  3M3J A;  2IDY A;  4DHJ B;  1EF1 A;  2E6X A;  3I5J C;  1AW7 A;  4W9L A;  3L10 B;  3U4E G;  2AYO B;  3R66 C;  3SEB A;  1TYG B;  3RT3 B;  2C9W B;  2GLS A;  4OVV A;  4HDQ A;  4GN1 A;  1CZP A;  4MM3 B;  1UD7 A;  4XE0 A;  4H2A A;  2M8S A;  4KKJ A;  2V3N A;  4W9G A;  2KDE B;  1ENF A;  5HI1 A;  3APF A;  3DPD A;  1LM8 B;  4KIK A;  3BY4 B;  2N9K A;  2DHZ A;  3B0A A;  3QK0 A;  2WXQ A;  2J0K A;  3U30 A;  1KM7 A;  2MHJ A;  1I35 A;  3H7P A;  4BKT A;  3HM3 A;  1YN5 A;  1JWB D;  2RGF A;  2BYE A;  1Y8R C;  3ALB A;  4M00 A;  2JRI B;  2TSS A;  1WXM A;  2KX0 A;  3QAQ A;  3BIN A;  4WQO B;  4DDG D;  2BKF A;  3IXS A;  3A33 B;  4ANX A;  3EEC A;  2ZPY A;  4W9K A;  3VR8 B;  4IW0 A;  2DEN B;  1RLF A;  2N9P C;  4MH0 E;  4RGT A;  5EE3 A;  4LK0 M;  3RCZ A;  3VRB B;  5HFY A;  2JWZ A;  2HD5 B;  2LVQ A;  5HKH A;  1XLP A;  4I6L B;  4KDI C;  5BMH A;  2XK5 A;  3M95 A;  3M62 B;  3EHV A;  4IWO A;  1I4R A;  3P1M A;  1QOA A;  2CHW A;  4KZ0 A;  1V81 A;  1V97 A;  1I7H A;  1YMH E;  4IM2 A;  2SAK A;  1QOB A;  4XGA B;  4W9H A;  1MFW A;  1WGY A;  3ZRC A;  1UH6 A;  1NI3 A;  1L0X B;  4BOS C;  1N6Z A;  2BYV E;  2L8J A;  1DOY A;  5CHV C;  2KT7 A;  4BAX A;  3NJT A;  2N1V A;  3DBL B;  3SHQ A;  1LQB A;  2W54 A;  3ZYY X;  5HG2 A;  2PLP A;  4C4V A;  2V3P A;  3ZDM C;  4HKQ A;  3ZJU A;  1ZUD 2;  3EFU A;  4RH6 A;  2JYE A;  5BMI A;  2CJO A;  3ZJV A;  3D32 A;  2NR2 A;  4ASW C;  2V4L A;  3ZGZ A;  4YTM B;  1RFA A;  3P4R B;  1K8R B;  3MTN B;  3QCA A;  5IOI A;  2L1A A;  1U4A A;  2X38 A;  4S17 A;  3IAM 1;  2K5P A;  3DBR I;  1CJE A;  4AQ7 A;  1UUP A;  3DBH B;  5IN7 A;  1AYF A;  2QCZ A;  2MP2 B;  4MAC A;  4ZYS A;  1YNT E;  1PDX A;  3RZW C;  3EA6 A;  3VRA B;  4A9A A;  3DHI C;  1EU4 A;  3NZS A;  3VR9 B;  2C7H A;  1GB1 A;  3KW5 B;  4REZ A;  3RYT A;  3R3M A;  4MSM B;  3ML9 A;  3U2S C;  1XLN A;  1OEY A;  1WM2 A;  1XLQ A;  5CX3 A;  2JRH A;  5C23 A;  2QJL A;  3AE9 B;  4W9J A;  4DXA B;  4G3X B;  4N9F 4;  4EKU A;  4BZA A;  1P0R A;  1WIA A;  3ZQ4 A;  2LXC A;  2IGD A;  2KLG A;  3AED B;  1KH0 A;  3W1Y A;  4JPS A;  3B08 A;  4PK1 A;  1V6E A;  4KSK C;  3ZO5 B;  2LUM A;  4MEL A;  4PT5 A;  1P7E A;  4P1C C;  2G4D B;  3BYT B;  3KUZ A;  4IKG A;  1E9M A;  4NAW A;  2D10 A;  5IA7 A;  2ZJD A;  3K9O B;  4O1N A;  3VUW A;  3P42 A;  5E6O A;  1YX5 B;  5FR6 A;  3W1S A;  1RM6 C;  3SD5 A;  4KDL B;  2NBW B;  4OZC A;  2WXK A;  5G5G A;  3FIL A;  2CR5 A;  1SBB B;  4M8M A;  2KMM A;  3I9V 1;  2LEK A;  3MC0 B;  3IT6 B;  1WXV A;  3AE5 B;  1ZKH A;  2WU5 B;  3DDC B;  3PSE B;  2MX2 A;  2DYB A;  5J17 A;  1RAX A;  3ETR A;  3WAP A;  4JLC A;  4DK5 A;  4MDK E;  4KV2 A;  3PRP B;  1JW9 D;  1S3S G;  2LMC A;  3FKY A;  1TIF A;  1YN3 A;  5DCN A;  1HE8 A;  2HTH A;  1WGH A;  3QWZ B;  3AN1 A;  3KYD D;  1Z5S B;  3VTW A;  2JT4 B;  2AQ2 B;  2JWU A;  1C4A A;  2X8X X;  4GB9 A;  2ZCB A;  2H89 B;  4B6W A;  5EE9 A;  3JYU A;  3AUL A;  2CS4 A;  1HTO A;  4BBN F;  1SIF A;  3ZDT A;  3NS1 A;  2KJ6 A;  2WDR B;  4JQW C;  5KHQ A;  4MH8 A;  1LGR A;  4LNN A;  1FRD A;  3LB8 C;  2IO3 B;  3PHW B;  3L13 A;  4M0W A;  1ZGU B;  1L0V B;  4DHZ E;  5DPS A;  3RFZ B;  1WX9 A;  2J0J A;  3IHP C;  2JXX A;  1GC6 A;  4BVU C;  2IO1 B;  2V9H A;  5AZF A;  1FRR A;  2LRW A;  2N9X A;  4WQM A;  2RPQ A;  1SEB D;  1NYQ A;  2FUG 1;  1SSN A;  4JWS C;  3WAO A;  3TJP A;  2KDI A;  1ZE3 D;  2K1F A;  2C7N B;  3W9C B;  5IKC M;  5CHW A;  2MP2 A;  1HXY D;  1KTK A;  3B9J A;  2R61 A;  3Q3F A;  3ZNG C;  1F77 A;  3ML8 A;  5AUI A;  2AEH A;  3UF8 A;  1OTR B;  3PPA A;  1SE2 A;  4A3P A;  1OQR A;  3FIL B;  2WS3 B;  3L16 A;  4K7W A;  3ZVV A;  1E90 A;  3NZ3 A;  1WX8 A;  1SE3 A;  4NAM A;  2O2V A;  2J42 A;  4IM0 A;  3P4S B;  2CJN A;  3QAR A;  3CF6 E;  4NQK E;  2WXJ A;  4B95 A;  2UU7 A;  3NOB A;  1FD6 A;  3UQA A;  4MGZ E;  1YIW A;  1YN4 A;  3EFC A;  4URK A;  4NNJ B;  1JCK B;  4MJS A;  1FPY A;  2OED A;  1M94 A;  3QX1 A;  3R2T A;  4FHK A;  2L0F A;  1EO6 A;  2D2Q A;  1HZ6 A;  1ZDX A;  4WUR A;  2WXF A;  1IBX B;  4W9D A;  3RNG C;  2WXR A;  3H1U A;  3AEC B;  2BVC A;  3AH7 A;  5TSS A;  3GP7 A;  2XK5 B;  2WU2 B;  1PUT A;  1DOI A;  2D07 B;  2WXN A;  5AEK B;  1G6J A;  5DPW A;  1TT5 B;  3QIJ A;  3AE4 B;  4GIV A;  2UYZ B;  1WXS A;  3DBR B;  2JQR B;  3TMP B;  2L7R A;  2H88 B;  3P2B A;  2ZPN A;  2J53 A;  3OWE B;  2QIE B;  4KIK B;  3DWG C;  2MBB B;  3UGB B;  3PHX B;  2KN5 A;  2MWS B;  4C4V B;  4USA A;  1TKE A;  3AEB B;  3DOW A;  3QA8 A;  2GRI A;  2HJ1 A;  2N9E B;  4EZL A;  1WJU A;  4YSZ B;  3PT2 B;  2VH1 A;  1VLB A;  3AB5 A;  3ZNI D;  3Q3M C;  1K53 A;  4A55 A;  3QJZ A;  3Q8C A;  4FAD A;  3V61 A;  1HA5 A;  4ZYN A;  3NVY A;  1OEY J;  1IGC A;  3EC8 A;  4HWI B;  2I1K A;  4AWJ A;  3RNF C;  4YXD B;  3Q3O C;  2D5G A;  3ZUN A;  3BVM A;  4BKS A;  1I4Q A;  2FCS A;  5C3J B;  3TBL D;  4BOZ B;  3UIO B;  3MJ5 A;  2BWE S;  4LLG M;  4RMA A;  2KQ7 A;  2KHW B;  2RDG A;  5BYQ A;  3WCQ A;  3U7Z A;  3OLM D;  4G50 A;  4A3O A;  1SGH A;  3Q6B A;  2CHZ A;  1FFV A;  1VZ7 A;  3AEA B;  5E6P A;  2MSE D;  3AXC A;  1UF0 A;  3KVF B;  2JUO A;  5JH5 C;  2MEK A;  3ECI A;  2WYQ A;  1UZX B;  2ZNV C;  1P1A A;  4XYC A;  1YD8 U;  1TZ1 A;  1YJI A;  3AE6 B;  1SIJ A;  1SF0 A;  4RNA A;  1OQY A;  5E6J A;  4KSL C;  3Q69 A;  2OHF A;  3JSV B;  1WFY A;  2BBC A;  3R8B A;  2EEL A;  1MJD A;  2MLB A;  2KOX A;  3Q3J A;  2KN4 A;  2K8H A;  5D7G A;  4OW0 A;  2VZK D;  4EE2 A;  2AQ3 B;  3ZNH B;  4KX6 B;  4WWM A;  4CHK A;  4JGH B;  2O6V D;  1XQQ A;  1F9J A;  2CU1 A;  4PYZ A;  4C56 C;  3AV8 A;  1JQ4 A;  2DWQ A;  2K9X A;  4CYE A;  4LNI A;  4MEM A;  1S1Q B;  2WQY B;  5H92 C;  1RYJ A;  3OAW A;  4K81 A;  3UIN B;  3QQ8 B;  2I1J A;  2WXM A;  1V5T A;  3BVG A;  1Q10 A;  5DPT A;  1IBX A;  1TBE A;  3P4Q B;  3RN9 C;  3ZXR A;  3NVZ A;  3AU4 A;  4C7Y A;  1Y56 A;  1E8Z A;  5BO4 B;  1L4Z B;  1EUV B;  1N5W A;  3IT4 B;  1WE7 A;  3DHG C;  3H6N A;  1WR1 A;  3M63 B;  4RFB A;  5EDS A;  2ZNV B;  3HVD A;  2WX1 A;  2WLB A;  3VUY A;  1BT0 A;  2I38 A;  2BPS A;  3AEF B;  4NPN A;  1VZ6 A;  2KC1 A;  4YTN B;  1EM7 A;  2NBV B;  3APD A;  4FJZ A;  2NCN A;  5D2M B;  2KVZ A;  4GDL B;  5J2R A;  2W3R A;  4JWU C;  1PGX A;  2NVU I;  3BZD B;  1JRU A;  3EGR A;  1FCL A;  2KC2 A;  2Z8L A;  3KH0 A;  1DYQ A;  1BML C;  3A9J B;  3VAW A;  4HCN B;  2WNM A;  2KJH B;  4FN2 A;  2D3A A;  1T6B X;  2BS3 B;  3VH4 B;  2RD0 A;  4WJQ A;  2XN9 C;  1V49 A;  4ZHP A;  3BK1 A;  1C4C A;  3PZD A;  3CWI A;  1NVI D;  3LDZ E;  2CKH B;  3VVW B;  2KMA A;  3SFE B;  2LAS A;  3N30 A;  2PJH A;  3R2I A;  2Y5B B;  1XXG A;  4AOF A;  2KTR A;  1E0Z A;  2Z0D B;  3VFK A;  5KHO A;  2LWP A;  4QAY A;  4IWQ A;  4HDO A;  2KNB A;  1VRA B;  2Z0E B;  2G4S A;  4AJW A;  1F52 A;  2JZP A;  4G0N B;  4II2 B;  5BYS A;  2J4X A;  3RNC C;  2V3S A;  4ICV A;  4DHJ D;  1UBI A;  3PTF C;  3VDZ A;  1OFF A;  2NTS A;  3N1X C;  2JXT A;  2D11 A;  3C0R B;  3OJ3 A;  4LTU A;  3Q8A A;  4P6V F;  4YSX B;  1V8C A;  3DVG Y;  4FJV B;  1XO3 A;  1QT9 A;  3N20 C;  4OZB A;  5IO9 A;  2L83 A;  2LVP A;  1D6E C;  3AMZ A;  2KYW A;  1K51 A;  1WR6 E;  4LJP B;  1DOX A;  4XX5 A;  1D5X C;  2DAF A;  1XT9 B;  1FXI A;  2N9L A;  3RNB C;  3ZW3 A;  1F2R I;  3GZN I;  2KWV B;  3A9J A;  2LHD A;  2NBU A;  4NZL B;  4AJY B;  1R4N B;  2WXO A;  2DAJ A;  2DZJ A;  2N7D A;  4E74 A;  4ANU A;  3NZU A;  3KQ4 A;  4EZK A;  3URY A;  3AE2 B;  4DDI D;  1KRH A;  1EU3 A;  2KK8 A;  1IP9 A;  2WGS A;  1P98 A;  1NYR A;  1FNV A;  1ZW7 A;  3MP9 A;  2HJ8 A;  3BVZ A;  4J6I A;  4NJ7 A;  2MBQ A;  1J8C A;  3SR6 A;  2E3T A;  3Q3N C;  2WXH A;  1L0Y B;  5JZE B;  3KWL A;  4MGK E;  1VDV A;  1Q1O A;  4IM3 A;  2ZCC A;  3T3N A;  3FC4 A;  1J0G A;  2QEJ C;  1WMH B;  3H7S A;  1L6U A;  1F0Z A;  4K3B A;  3HRD D;  1LO5 D;  2BB6 A;  1WXQ A;  4RGM A;  2PE9 A;  3WAM A;  3W2D A;  2LGD A;  4MT5 A;  1TS4 A;  2MRP A;  2IO2 B;  1WGD A;  2G3Q B;  4W9F A;  5LLI A;  4BBN C;  4BFR A;  2K6Q A;  1QKZ A;  2M56 B;  3R7R A;  2ON8 A;  3DWM A;  3AEE B;  2CU3 A;  5G5H A;  1YJJ A;  3DBS A;  2V1Y A;  4IDI A;  2EKI A;  3H8H A;  4EEW A;  3CIR B;  1E6E B;  1QZE A;  3ZNZ B;  2KDM A;  1UGM A;  2JSV X;  3L17 A;  1F2R C;  3AE7 B;  2LI5 A;  4N58 A;  1TKG A;  2PPH A;  1MHH E;  1WY8 A;  4TQ0 A;  5IAA C;  2MA9 B;  1T0Q C;  2REX A;  4DWF A;  2JYT A;  1LXD A;  4US9 A;  5AZG A;  2I2Y A;  1C77 A;  1A70 A;  1E8X A;  4EZJ A;  5C2T B;  3VXW A;  4DXG A;  3BWU D;  1GG3 A;  2D3G A;  2WXI A;  4PS8 A;  2QDF A;  1YQB A;  4P16 A;  3JSV A;  2AQ1 B;  1J7B A;  4ZDV A;  4FLH A;  1D5Z C;  4I6N B;  3KUD B;  1L6V A;  1WRI A;  1WX7 A;  5G2N A;  3AE1 B;  4FXC A;  1WJ6 A;  4IUM B;  2W3S A;  4XDD A;  1BUI C;  3OJ4 B;  3K9P B;  4BKG A;  1P3Q U;  3DVG X;  3FAH A;  1FXT B;  1QIL A;  1HTQ A;  3PS6 A;  1K50 A;  5HHD G;  1AWD A;  1VZ8 A;  2PVO D;  3Q8F A;  4HPM B;  1HQR D;  2JVC A;  2BWF A;  2N7J A;  1MG4 A;  1J7A A;  1KLG D;  3V05 A;  2EMS A;  5C1Z A;  1OQQ A;  3AI5 A;  1B1Z A;  3V3X A;  1ZXI A;  5H8Y E;  4D2K A;  3V60 A;  3O65 B;  1VJK A;  4G11 A;  4LNF A;  1UGJ A;  2EMT A;  2R2O A;  2OJR A;  1I4H A;  3TCA A;  3DQV A;  4A8X C;  1I42 A;  4LDT D;  2Q5W D;  5GMV A;  2K6D B;  4C00 A;  1MVK A;  3VTU A;  2IPK D;  1JWS D;  5T8I A;  4TQ1 A;  3MC8 A;  2DLB A;  4JIO U;  3V6E B;  2LFI A;  4S0R A;  3TUO A;  2ZVO A;  5EE0 A;  2JY6 A;  1VCB A;  3VH3 B;  4M8N A;  1IGD A;  2LHE A;  1E7U A;  2BTE A;  3A1Q B;  3P63 A;  2LGS A;  4CQN A;  5GXG B;  2GMI C;  2WWZ A;  4TUU A;  1C79 A;  2O6V B;  4GGQ A;  2Y5C A;  1KOT A;  1YQ4 B;  3N32 A;  3UI3 A;  1KLU D;  2W82 A;  4ITK A;  2RMM A;  2DYO A;  3S2A A;  2C60 A;  3GE3 C;  3L54 A;  1TZO A;  3I63 C;  2XEW A;  2NMQ A;  1HEZ E;  4YWG G;  3TL5 A;  4ANV A;  2M4N A;  4PYU A;  2JU6 X;  2EKE C;  4WH4 A;  3Q8E A;  3KYC D;  1QQR A;  2D3C A;  2JZZ A;  2IND C;  1HZ5 A;  1Q5W B;  1JRP A;  1FNW A;  2N7E A;  2OJW A;  3T8M A;  2C5L C;  1UEL A;  2BKR B;  2IJ0 A;  4R3D A;  4IG7 B;  4HLE A;  1R4M I;  1FNU A;  1R4N I;  1SXT A;  3L08 A;  4BKS D;  3LYY A;  2MQJ A;  3BII D;  2DBY A;  1WWT A;  2PW9 A;  2G9H D;  3C8Y A;  4MGY E;  2KVR A;  3ZKJ C;  3TIX A;  2KMC A;  3U8Z A;  3QC8 B;  3PLV A;  3A9K B;  3PRZ A;  3IVF A;  1C3T A;  4ICU A;  1GPX A;  4XWT A;  2DX5 B;  4JL9 A;  1ZXH A;  1H8C A;  3ZJT A;  1XEE A;  2GBR A;  2O6V A;  4L1B A;  4K7S A;  3APC A;  4NY0 A;  4FUL A;  3MFG A;  4GSW A;  4XC2 A;  3BK2 A;  3IG3 A;  4RGN A;  2W55 A;  3ZIM A;  2FCQ A;  1PQS A;  3RZF A;  4IWP A;  2ZEQ A;  3NUH B;  3O13 A;  4AP4 C;  2DZM A;  2ONQ A;  4ZRI A;  3HHM A;  2KD0 A;  4WAF A;  5L83 A;  3J9C A;  3Q2A C;  3HK0 A;  4C80 A;  4RGO S;  5D6J B;  3ZTD A;  1E8W A;  3PVL A;  2LXA A;  2BYF A;  4GOC A;  2MH7 A;  3RNE C;  4F1S A;  5D3D A;  2KQ4 X;  3AEG B;  3AM9 A;  4K7U A;  1FM0 D;  5CHF A;  1UWX A;  4N6E B;  4L23 A;  1N62 A;  2K8B A;  3N1Z C;  1WJN A;  2ACZ B;  4FJY A;  2FAZ A;  2K22 A;  3A4S C;  4WWO A;  1YQ3 B;  2IGG A;  2YEP B;  1C4P A;  2ZVN A;  3V6C B;  2KZR A;  2PTL A; 
#chains in the Genus database with same CATH homology
 1SJE D;  3RPF C;  3R2I A;  1JWA D;  2ZW0 A;  1MHX A;  2WP9 B;  1XXG A;  4OZC A;  2WXK A;  2ZW1 A;  5G5G A;  1E0Z A;  2BT6 A;  3FIL A;  4WIP A;  4A6Q A;  2K3U A;  4OZA A;  1SBB B;  1L4D B;  4HKZ E;  1TJE A;  2KMM A;  3I9V 1;  1VRA B;  2LEK A;  1I4G A;  1MPE A;  5JXV A;  3MC0 B;  1N5X A;  2NTT A;  3SFD B;  2JZP A;  2Y3A A;  1GAQ B;  3IT6 B;  3T3O A;  2WDQ B;  1I4X A;  3AE5 B;  1T5X D;  1TY0 A;  2J4X A;  5BYS A;  2BS4 B;  2JX5 A;  1I4P A;  2WU5 B;  1OFF A;  4YT0 B;  2NTS A;  1TS2 A;  2JXT A;  4LTU A;  3AE3 B;  1E7P B;  1C78 A;  3Q8A A;  4Q2J A;  1PGB A;  3VQI A;  3ETR A;  4P6V F;  4YSX B;  1V8C A;  1SE4 A;  1XO3 A;  1QT9 A;  2N0S B;  3E9S A;  4GLS C;  4OZB A;  3N9Y C;  1V1P B;  2K0P A;  3LXF A;  1JW9 D;  4ZRQ A;  2L83 A;  1FFU A;  2LMC A;  1D6E C;  1YN3 A;  3BYY B;  3AMZ A;  4TMA B;  3B2G A;  1K51 A;  1SJH D;  3AN1 A;  4ZOH C;  1FEH A;  1MI0 A;  1FCC C;  2GB1 A;  4YSY B;  1D5X C;  1DOX A;  3HVZ A;  4C7Z A;  1FXI A;  2AQ2 B;  1STE A;  2N9L A;  2JWU A;  2M0A A;  1ACC A;  3TEX A;  1E10 A;  1C4A A;  2QSD A;  2BYT A;  1F2R I;  3KWV A;  4OHJ A;  4YTP B;  3W5V B;  2LHD A;  4NAW B;  4GDK B;  4NZL B;  1L5P A;  2H89 B;  2WXO A;  5EE9 A;  1XCQ L;  1XF5 L;  3HUI A;  1BXT A;  2L32 A;  3KQ4 A;  3URY A;  2WXP A;  1UNS A;  3AE2 B;  1KRH A;  3NS1 A;  2WDR B;  1EU3 A;  4MH8 A;  2Y5P A;  4KKI A;  3TEW A;  3GB1 A;  1NYR A;  1FRD A;  3PZ8 A;  1FNV A;  3LB8 C;  3MP9 A;  1WGK A;  3BVZ A;  3PO0 A;  3SR6 A;  2VZK B;  1JML A;  3W5U B;  2E3T A;  2WXH A;  1L0Y B;  4M0W A;  1L0V B;  4US8 A;  3KWL A;  3AE8 B;  3RFZ B;  1VDV A;  2RDH A;  2DYM A;  1XCT L;  2YEP F;  3T3N A;  3FC4 A;  2QEJ C;  1PYW D;  1TS5 A;  1GB4 A;  1RWS A;  1FRR A;  4WQM A;  1L6U A;  1F0Z A;  1SEB D;  5MPO A;  1NYQ A;  2FUG 1;  2KAC A;  1SSN A;  1TKY A;  3HRD D;  4JWS C;  2BW2 A;  1LO5 D;  2BB6 A;  1WXQ A;  4RGM A;  4OVZ A;  1ZE3 D;  3W2D A;  1QLB B;  3W9C B;  3TEZ A;  1V1P A;  4MT5 A;  1TS4 A;  1V1O A;  4JE3 B;  1KF6 B;  4DQO C;  1HXY D;  1KTK A;  3B9J A;  2FE8 A;  2R61 A;  1ET6 A;  1GOZ A;  2WXL A;  5I4D A;  1F77 A;  5AUI A;  1KFY B;  1SE2 A;  4HRO A;  3E56 A;  1QOF A;  4A90 A;  1OQR A;  1QKZ A;  2M56 B;  1PGA A;  1SB3 C;  2WS3 B;  3FIL B;  3KLS X;  5BMG A;  1N60 A;  4HRS A;  2ON8 A;  2ICI A;  3DWM A;  3NVW A;  1C9F A;  3NZ3 A;  3AEE B;  4XWW A;  1J7C A;  1ESF A;  1FIQ A;  3ABV B;  1SE3 A;  2CU3 A;  1YJJ A;  5G5H A;  4NAM A;  4ZHO A;  2J42 A;  2RPV A;  4IDI A;  2EKI A;  2PKO A;  5LNK 1;  3TSS A;  3H8H A;  3CIR B;  3P4S B;  1D5M C;  1E6E B;  2CJN A;  4RF0 A;  1ZDV A;  2KDM A;  3B2F A;  2B76 B;  2WXJ A;  2JSV X;  1F2R C;  1ROE A;  1FD6 A;  1CK1 A;  3AE7 B;  2IGH A;  4N58 A;  2LGI A;  1TKG A;  1YN4 A;  2FBW B;  1MHH E;  1XLO A;  4UDU C;  4TQ0 A;  1JCK B;  2OED A;  3PZ7 A;  2V4I B;  2JYT A;  2KWD A;  2WDV B;  3R2T A;  4US9 A;  2I2Y A;  1HZ6 A;  1C77 A;  1A70 A;  1T3Q A;  2AX5 A;  5C2T B;  1AN8 A;  1ZDX A;  4WUR A;  2WXF A;  1IBX B;  4DXG A;  3P4P B;  1JWU D;  2WXR A;  3BWU D;  3AEC B;  3EUB 2;  3NVV A;  1FO4 A;  4B0E A;  1EWC A;  2BS2 B;  2WXI A;  3AH7 A;  1JRO A;  2M19 A;  5TSS A;  3IAS 1;  3GP7 A;  4P16 A;  1R7S A;  2WU2 B;  1PUT A;  1DOI A;  2AQ1 B;  1J7B A;  2MJE A;  2WXN A;  4JX1 C;  1VR9 A;  1JWM D;  1ZPS A;  1NEK B;  1D5Z C;  4ARI A;  1L6V A;  4DXF A;  1WRI A;  3AE1 B;  3AE4 B;  2IDY A;  4FXC A;  2W3S A;  1IUE A;  4XDD A;  1BUI C;  2JQR B;  5EE1 A;  2H88 B;  2E6X A;  2J53 A;  3FAH A;  1AW7 A;  1QIL A;  3OWE B;  2QIE B;  3DWG C;  3U4E G;  4NJC A;  1K50 A;  5HHD G;  2PVG C;  3SEB A;  1P7F A;  1AWD A;  1TKE A;  1TYG B;  1VZ8 A;  4RCO A;  3AEB B;  4USA A;  2PVO D;  3Q8F A;  1HQR D;  1ET9 A;  1CZP A;  2GRI A;  4MM3 B;  4YSZ B;  2INN E;  4AS1 A;  4XE0 A;  4H2A A;  1VLB A;  3AB5 A;  5AUK A;  2N7J A;  1K53 A;  4A55 A;  5D3I B;  4KKJ A;  1DGJ A;  2V3N A;  1J7A A;  1ENF A;  1KLG D;  3Q8C A;  5HI1 A;  3V05 A;  1HA5 A;  3NVY A;  1IGC A;  2INP E;  2N9K A;  1OQQ A;  2QMT A;  2WXQ A;  1B1Z A;  3V3X A;  1ZXI A;  5H8Y E;  4YXD B;  4D2K A;  2D5G A;  2KAJ A;  1VJK A;  3BVM A;  2LJI A;  1I4Q A;  1UGJ A;  4KGT A;  1YN5 A;  1JWB D;  5C3J B;  1I4H A;  2WXG A;  4J3O D;  3MJ5 A;  1QOG A;  4LLG M;  5FK9 C;  2TSS A;  4A8X C;  4IOI E;  1WYG A;  2Q5W D;  2RDG A;  5BYQ A;  3WCQ A;  3U7Z A;  1B9R A;  2PMV A;  1MVK A;  4HEA 1;  1FFV A;  1VZ7 A;  2IPK D;  1JWS D;  3AEA B;  3IXS A;  5T8I A;  4ZRP A;  1RFK A;  4TQ1 A;  2DLB A;  2LFI A;  1FXA A;  3TUO A;  3VR8 B;  5EE0 A;  1EWY C;  1IGD A;  2MEK A;  2LHE A;  2BTE A;  4RGT A;  3P63 A;  4TSS A;  5EE3 A;  4CQN A;  4LK0 M;  5GXG B;  3VRB B;  3L4P A;  5HFY A;  1C79 A;  1YJI A;  3AE6 B;  2Y5C A;  1SIJ A;  1YQ4 B;  1SF0 A;  1XLP A;  2HDE A;  3UI3 A;  1KLU D;  4RNA A;  2MJ3 A;  5BMH A;  5E6J A;  2W82 A;  4ITK A;  3Q69 A;  2OHF A;  2RMM A;  2BBC A;  3R8B A;  2EEL A;  1I4R A;  3P1M A;  1QOA A;  2DYO A;  1TY2 A;  2KN4 A;  1TZO A;  5D7G A;  2GI9 A;  4OW0 A;  4N59 A;  2VZK D;  2NMQ A;  1HEZ E;  4YWG G;  4EE2 A;  2AQ3 B;  1I7H A;  1V97 A;  4KGS A;  1YMH E;  2JU6 X;  2SAK A;  4WH4 A;  1QOB A;  3Q8E A;  4KX6 B;  4WWM A;  1QQR A;  1NI3 A;  1L0X B;  4C56 C;  3AV8 A;  1DOY A;  1JAL A;  1JQ4 A;  2DWQ A;  2QIL A;  2K9X A;  1HZ5 A;  1PFD A;  1JRP A;  1FNW A;  2W54 A;  3ZYY X;  5HG2 A;  2IJ0 A;  2PLP A;  4R3D A;  2V3P A;  2WQY B;  5H92 C;  1RYJ A;  1FNU A;  3ZJU A;  4HKQ A;  4RF1 A;  4XDC A;  1ZUD 2;  3GS2 A;  4RH6 A;  1SXT A;  5FKA C;  5FR3 A;  3LYY A;  2JYE A;  5BMI A;  3BII D;  2DBY A;  1FMA D;  2CJO A;  3I57 A;  3ZJV A;  1WWT A;  2PW9 A;  2G9H D;  3C8Y A;  2WXM A;  3BVG A;  1CQV A;  1Q10 A;  1WSP A;  4YTM B;  3ZGZ A;  3P4R B;  2XNA C;  3Q8B A;  1N63 A;  3P4Q B;  1IBX A;  4HJG E;  2L1A A;  2X38 A;  2HTM E;  3NVZ A;  1ZP0 B;  1GPX A;  4XWT A;  3IAM 1;  1C76 A;  1QF6 A;  4C7Y A;  1NEN B;  2K5P A;  1Y56 A;  1ZXH A;  1ZOY B;  1CJE A;  4B0M A;  3ZJT A;  4AQ7 A;  1UUP A;  1L4Z B;  1XEE A;  1K52 A;  1AYF A;  4L1B A;  1N5W A;  3IT4 B;  3TEY A;  4MAC A;  2L52 A;  4ZYS A;  1YNT E;  1PDX A;  4RFB A;  3EA6 A;  3VRA B;  1TS3 A;  3HVD A;  4A9A A;  2MJD A;  1EU4 A;  2PIA A;  3VR9 B;  3MFG A;  2WLB A;  1GB1 A;  2J52 A;  4REZ A;  3BK2 A;  2I38 A;  3AEF B;  1N61 A;  4RGN A;  2W55 A;  1VZ6 A;  1XLN A;  4YTN B;  3U2S C;  1EM7 A;  1XLQ A;  3MHZ A;  1M4V A;  4L2Y A;  4ARC A;  3U52 E;  3NUH B;  2QJL A;  3AE9 B;  3O13 A;  2ONQ A;  2SEB D;  4GDL B;  4WAF A;  3ZQ4 A;  3J9C A;  2W3R A;  4JWU C;  1PGX A;  1D4B A;  2IGD A;  3AED B;  4C80 A;  3BZD B;  3EGR A;  2V0G A;  1FCL A;  4RGO S;  2Z8L A;  1KH0 A;  5BYR A;  1DYQ A;  2MH7 A;  4JPS A;  1BML C;  5D3D A;  2KQ4 X;  3AEG B;  1UWM A;  2WNM A;  2BB5 A;  2LUM A;  3AM9 A;  1T6B X;  3NRZ A;  4KGR A;  1FM0 D;  2G1E A;  1P7E A;  4PT5 A;  1UWX A;  3BYT B;  2BS3 B;  4N6E B;  4L23 A;  1N62 A;  2ACZ B;  4IKG A;  2XN9 C;  1E9M A;  2K22 A;  4ZHP A;  3BK1 A;  1C4C A;  1YQ3 B;  3CWI A;  2IGG A;  2YEP B;  4O1N A;  1C4P A;  1NVI D;  3P42 A;  3W1S A;  1RM6 C;  3SFE B;  2PTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...