1RYJA

Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown
publication title AN NMR APPROACH TO STRUCTURAL PROTEOMICS
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Structural genomics, unknown function
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ryjA00
1AWDA 2CJOA 1TKGA 2H88B 1J7BA 3AEBB 1B9RA 3NVZA 5G5HA 1VDVA 3P4PB 3AE3B 1XLOA 3P1MA 3AE7B 1DGJA 3W9CB 2DWQA 3P63A 2W3SA 4HRSA 4YSXB 2OHFA 3P4SB 1E0ZA 1EWYC 2M56B 2Q5WD 1PFDA 1NENB 5C3JB 3B2GA 2WP9B 3DWMA 1L6UA 4YTPB 1QOAA 1V97A 3L4PA 5EE3A 1TKEA 3AEEB 1YJIA 2K5PA 2W3RA 2G1EA 3AE1B 3SFDB 3SFEB 5G5GA 4US8A 1OQQA 1DOXA 4A9AA 1NVID 2B76B 1FM0D 1NYRA 2WQYB 4IDIA 3B9JA 1JALA 2BS4B 1FMAD 1KFYB 3AE5B 1N5XA 3RPFC 1YQ4B 4ZHPA 3ETRA 3AECB 1WGKA 1IUEA 1OQRA 3BIID 1FFVA 3HRDD 1RWSA 4YTNB 1WYGA 1ZOYB 2WDVB 5C2TB 3B2FA 1F0ZA 1TKYA 3HUIA 3VRAB 3AEFB 1SB3C 3AEAB 5GXGB 3AB5A 3VR9B 1FRRA 1N63A 4C80A 5MPOA 1QOFA 1NYQA 3PO0A 2EKIA 2K22A 1ZUD2 3AE4B 1JW9D 2PIAA 3AEGB 5H8YE 1AYFA 1GAQB 1SIJA 1E10A 1DOYA 4N58A 4YTMB 2WS3B 1XLNA 3VR8B 2H89B 3AM9A 1ZXIA 1KRHA 1XO3A 1PDXA 2MH7A 2WU5B 3LXFA 3P4RB 1N60A 1TJEA 4HROA 1QOGA 1ZP0B 2L83A 4JWSC 3DWGC 2JQRB 2PKOA 3NVYA 1L6VA 3ZYYX 4FXCA 1L5PA 2W55A 1RM6C 2AX5A 2W54A 2PVOD 5AUIA 1WWTA 1YJJA 3W5UB 2FBWB 2MJEA 2KAJA 1JRPA 1FIQA 2BS2B 1E7PB 1QLBB 2E3TA 3ABVB 5EE1A 1FO4A 1FFUA 1FXIA 4US9A 4YT0B 1JWBD 1FXAA 1YQ3B 2M19A 3AN1A 2Y5CA 3EUB2 4JX1C 1QT9A 1OFFA 1V8CA 1TYGB 1WXQA 3AE8B 1N62A 3NVWA 4WWMA 5EE9A 1CZPA 3FAHA 2HTME 2BS3B 2N0SB 3HVZA 3CIRB 3LB8C 4YSZB 4JWUC 3AE9B 3NRZA 1WRIA 3AEDB 1UWMA 3CWIA 1R7SA 4N6EB 1NEKB 4YXDB 3VRBB 1GPXA 2WU2B 2ACZB 1QOBA 1RYJA 1XLQA 2QJLA 4C7ZA 1SF0A 2QIEB 1A70A 1KF6B 2WDQB 4KX6B 1VJKA 1I7HA 2CU3A 4ZOHC 1PUTA 1ROEA 1N5WA 1VLBA 2WDRB 4YSYB 1CJEA 2K9XA 3KWLA 3FC4A 3AV8A 3P4QB 2MJ3A 5H92C 1DOIA 4USAA 1JROA 5EE0A 3SR6A 3NVVA 2DBYA 4ZHOA 2BT6A 1QF6A 2PVGC 3AH7A 4ITKA 1JQ4A 2JX5A 4P6VF 3WCQA 2LEKA 4N59A 1E9MA 1J7AA 2KMMA 3NS1A 5AUKA 4C7YA 3AE2B 1N61A 2L52A 1FRDA 1L0VB 3AMZA 1XLPA 2CJNA 4LTUA 1T3QA 1RFKA 4WQMA 1J7CA 1NI3A 3AE6B 3W5VB 2MJDA 1E6EB 2WLBA 1JWAD
chains in the Genus database with same CATH superfamily
1J7BA 4M0WB 1C79A 4URKA 3ZDMC 2LASA 4ICUA 2O2VA 2XN9C 4O1NA 4I6LB 1UUPA 5D94A 1ZDVA 1T0RC 1NENB 4BOZB 1QOAA 1WZ0A 4NZLB 3VTWA 4P7IA 2G1EA 4KDLB 4F1SA 4LNKA 4WAAA 4G50A 2YLMA 5HKHA 2KMCA 1ZGUB 4HJGE 3PTFC 1IPGA 1L4ZB 1ZW7A 3DOWA 2J42A 2BTEA 1MHXA 1UD7A 4NY0A 4XYCA 4WJPA 3L17A 1TS3A 4B0EA 1KTKA 3WIMA 2QMTA 2DNFA 1HE8A 2K8CA 2KTRA 3RULA 4B6WA 2M17A 2ZNVC 3ABVB 3PVLA 5DPRA 3GZNI 1N6ZA 3H9DA 1OFFA 1GG3A 3PHWB 2BS3B 3OWEB 3PLUA 2FCSA 1GJZA 1OGWA 2LGIA 1GPXA 2V9HA 1D5MC 4OVVA 4BZAA 4JQWC 4EZLA 1S1QB 2CU3A 4FBJB 4REZA 5LLIA 5BYRA 3AV8A 2JZ3B 4GDKB 2N4FA 1V6EA 2ASQA 4GN1A 1V86A 3WANA 1L4DB 2XBBC 3H7SA 3DCGA 3DVNV 1IBXB 3B1LX 2JPHA 1H8CA 1B9RA 4PS7A 3U7ZA 4M02A 2KWCA 1YN4A 2OJRA 2FUG1 3R66C 1Q1OA 3DBLI 1PFDA 2KFKA 2ON8A 1E7VA 2R2QA 2PJHA 1ESFA 2GB1A 5I4DA 1SJHD 3C8YA 3DQVA 2M8SA 1ACCA 3IG3A 1STEA 3B0AA 4NQKE 3APFA 3AEFB 3AEAB 2C7MB 1PGXA 3UF8A 2DZJA 2K1FA 3UI3A 1NDDA 1EUVB 1HTQA 1V81A 3AM9A 1SBBB 1ZXIA 3DBRB 3LXFA 3MFGA 2L83A 1MG8A 4GGQA 1ZPSA 4GLSC 1L0YB 1WWTA 4W9CA 2WGSA 4HK2A 3MP9A 4KSKC 2N7EA 2BWES 1JCKB 3HK0A 4M00A 4XDDA 1WXQA 3VQIA 1VD2A 3CIRB 3TJPA 3NG0A 3BVZA 3KWVA 2A4ZA 1XXGA 1T0QC 5LXIB 4W9JA 2V3SA 4C7ZA 1SF0A 1JMLA 1A70A 3PHXB 2C7HA 1WSPA 3FILA 2JXTA 2WXOA 1C76A 2NTSA 1UZXB 3P4QB 4GXBA 4K3CA 1EWCA 2M0XA 2PVGC 4ITKA 4ARCA 2BB6A 1OEYA 1F52A 2L32A 1N61A 2L52A 1ENFA 1BT0A 4FJVB 3KLSX 2MJDA 3H1UA 4A55A 2DAFA 2K8HA 3Q3OC 3ZIMA 4XE0A 1WMHA 3V6EB 5IN7A 1XEEA 2FE8A 1GOZA 4ACFA 3W9CB 3VAWA 3P63A 4YSXB 2O6VD 1EWYC 3ZVVA 4JE3B 3PLVA 1I42A 3TUOA 2B76B 4MH0E 4AJYB 2EMTA 3Q3JA 2L00B 4ZHPA 4KZ0A 4CYEA 3VRAB 4C80A 2DZIA 1EM7A 4AWJA 1AN8A 2PW9A 1AYFA 1SIJA 4N58A 2D3CA 4LNFA 2DYOA 3SDLC 3EGRA 1KLGD 1L6VA 1YJJA 2MJEA 2KAJA 4AQ7A 2BB5A 3L08A 4RNAA 1FO4A 2Y5PA 2L7RA 4MGYE 1JWBD 1P1AA 1LQBA 3O65B 2PLPA 1MI0A 5G2NA 2K3UA 2LVOA 3GP7A 4EOYA 1ZDXA 2C5LC 3VH4B 1QOBA 1F2RI 3VXWA 1WJ4A 4MACA 4RM9A 2DYMA 1RFAA 1ZKHA 2GBJA 2L3ZA 2KVRA 3GS2A 1A5RA 2KTRB 4AUQC 1V5OA 3SR6A 2BGFA 2MW5A 3QWZB 4WQMA 3X0WA 4W9GA 4LK0M 3HM3A 2H88B 3PT2B 2N1VA 1E8WA 4HDQA 2O6VB 2GLSA 2N9PC 4NQLB 2KT7A 1P9DU 4RGTA 2OHFA 2MP2B 1SE9A 4K7WA 4MGZE 1F77A 3L54A 5C3JB 4W9LA 1HZ5A 3R2TA 4HLEA 1YIWA 3V3XA 1IGCA 3NHEB 3RPFC 3T9LA 3ETRA 4KVGB 2WDTB 2D11A 4HVBA 1SJED 2JWZA 2IDYA 3RNFC 1VZ8A 2JYTA 2EKEC 5BMGA 4PK1A 1I4PA 3V62A 3VVWB 2LWPA 3MJWA 3VR8B 3J9CA 3U8ZA 2J4XA 2L1AA 1VR9A 1XO3A 2LUMA 2ZZPB 2W55A 2BBCA 4JLCA 4R3DA 3N1ZC 5AUIA 2KFKB 2KC1A 1E90A 1FFUA 1WJ6A 3QJZA 1FXAA 3AN1A 2Y5CA 3AE8B 3EFCA 1TY2A 1B1ZA 2G4DB 2V4IB 3LB8C 2GBNA 2OEDA 2MRPA 1HA5A 2MBEA 4E3CA 3PZDA 5BYSA 4GMVA 2JSVX 4W9KA 4A3OA 3GE3C 4FN2A 3TEYA 3JYUA 3VFKA 2WDQB 1I4RA 2I38A 4AS1A 2QDFA 1WX7A 1MG4A 2INNE 3NS1A 4PT5A 3R2IA 1FNUA 1K50A 4WWPA 2IPKD 4CQNA 2RMMA 2IO0B 1K53A 3A4SC 3AEBB 1E8XA 5J2RA 1MPEA 3WAPA 4B9KA 3T3OA 2ZW0A 1LGRA 4TQ0A 2Z0DB 4LNNA 4D2KA 4ICVA 3NZSA 4WURA 1WGRA 4MEMA 1L6UA 4MDKE 3L16A 3FILB 1OQQA 5TR5A 4KSLC 1YD8U 1K51A 1YQ4B 1UH6A 4E71A 5L83A 3VR9B 4ASWC 1R4NI 2NBVB 2G9HD 2BPSA 1P0RA 3DBHB 3N1YC 1WMHB 1YOVB 3Q14C 1GNUA 3I5JC 4IWPA 2PKOA 2DX5B 2MHJA 3QIJA 1RAXA 2KZRA 4A90A 4L23A 1P7FA 4M8MA 1YQ3B 1FNVA 2UYZB 3A4RA 5JHAA 4W9EA 3JSVA 3W1SA 4W9FA 3AEDB 3QQ8B 2WXKA 1HXYD 4KIKA 2KKCA 1WZ3A 3L10B 3WAOA 1OEYJ 2LMCA 2WXFA 1S3SG 1WE7A 1JWUD 3X23A 3AH7A 4IM3A 3QARA 1E9MA 3BINA 4WJQA 5C1ZA 2V0GA 5J17A 4HPMB 2CJNA 3GZNB 3BYYB 4ZRIA 1J7CA 2KDMA 3ALBA 1AWDA 2CKHB 2JRHA 4P1CC 2GOWA 5E6JA 2N7DA 4KGSA 4FHKA 2ZJDA 1WY8A 4RF1A 3DWMA 2INPE 1TKEA 3OLMD 4WQOB 5G55A 1C3TA 2ZPYA 2PE9A 3ZNHB 3UGBB 3RCZA 1XQQA 3KVFB 3UQAA 4G0NB 5GXGB 3B08A 1NYQA 2BKFA 3PO0A 1JW9D 4HPLB 4K7UA 1DOYA 1EF1A 1TGZB 1TIFA 4MGKE 1Q0WB 2AEHA 1ZXHA 1N60A 2DZKA 1C4AA 2DAJA 2I1JA 4BKSD 1RM6C 3ZJVA 1FXTB 3M95A 4RGOS 3DBLB 2D3AA 1FXIA 2KMAA 2D10A 2HE7A 4WWMA 2KLGA 3E9SA 3QA8A 3HVZA 2L76A 4BKTA 2AQ2B 4C4VA 4OVZA 1EU4A 1GUAB 4N6EB 2WXNA 2C9WB 4PS8A 3VDZA 5DPSA 3T8MA 4OHJA 4IKGA 2KQ7A 2L05A 2JF5A 2QSDA 5HG2A 3Q3NC 3CMMB 1E8YA 2MJ3A 1JROA 3L0WB 1TBEA 2LJIA 1FPYA 4PS3A 2LEKA 4YWGG 4PYZA 4OZAA 3AE2B 3I57A 3NOBA 1FRDA 1XLPA 3TEWA 1BUIC 1TKGA 3W2DA 5G5HA 5JXVA 1SE2A 5FK9C 2QEJC 1HTOA 2JYEA 4LNOA 3Q8AA 3SEBA 2BYFA 1UWXA 2RPVA 3B2GA 3ZKJC 2WXHA 2J7QB 4A9AA 1FM0D 2SAKA 3SD5A 1JALA 3SHQA 4AJWA 4W9IA 4WAFA 2V4LA 4XWWA 3N30A 1QOFA 2EKIA 2M0AA 2D2QA 3NZUA 2GI9A 1YX6B 3NY5A 1PDXA 1ZP0B 2KN5A 4WJOA 2JQRB 2MBOA 4GDLA 3RT3B 2I1KA 3PV1A 3ZW3A 1L7YA 3OG5A 4IWQA 2IJ0A 2WXLA 4OZCA 3M3JA 5AZHA 4RF0A 4RFBA 3AU4A 1F1HA 3HVDA 5HI1A 4NAWA 1D6EC 1YN5A 3MTNB 3EECA 2QILA 2BYEA 2KYWA 1VJKA 1QQRA 4IG7B 4ANVA 4EEWA 1XCTL 3BZDB 2IY0B 4WWOA 2PEAA 4RM8A 2ZW1A 4W9DA 1QF6A 4JIOU 5D3DA 4DBGA 4ZYSA 2ZNVB 1GB4A 2MCNB 4C00A 1TS5A 2QC8A 4BKGA 2IO1B 3RNCC 3R7RA 3V05A 2ZPNA 2D3BA 4B95A 1FCLA 1UNSA 4DXAB 4A8XC 4NJ7A 4AOFA 2JUOA 3QK0A 4K7SA 2KO3A 4JGHB 4FJYA 5EE3A 1J0GA 3A33B 4IDIA 1FMAD 1D5XC 3HRDD 3GE8C 3N20C 1KH0A 2YVCA 4EUTA 2KACA 1SB3C 2WXPA 3UQBA 2MBQA 1D5ZC 3NJTA 2ZEQA 3PS6A 2MX2A 1GAQB 4P16A 1D4BA 1E10A 2RSUA 1Y8RC 4TQ1A 2NTTA 3JW0X 3RI7C 2LGDA 3ML8A 4MSMB 2BYVE 3EC8A 1V1PB 1V8CA 3DVNU 1N62A 3K9OB 1E8ZA 1WRIA 4N9F4 4B0MA 1R7SA 3N9YC 4KKIA 3VTVA 4HKZE 2QJLA 2O2VB 2GMIC 4ANXA 5D6JB 2KWDA 1SXTA 4TSSA 2INCC 1VLBA 2WDRB 3VH3B 3C0RB 4TUUA 2K9XA 4IOIE 3ONSA 1JQ4A 3TMPB 4ARIA 1ET9A 5HHDG 2JX5A 2RGFA 3AXCA 5JH5C 1V49A 2IGHA 3IVFA 3RNAC 5L95C 4XX5A 4A20A 3AMZA 4LTUA 1WM2A 4FJZA 1WR1A 2AQ1B 3VTUA 2WXMA 1KLVA 3A9JA 4BFRA 2WXGA 1VDVA 2LJ5A 1SSNA 2BYTA 3P1MA 4FULA 3QC8B 4MT5A 3H6NA 2SEBD 2DWQA 2W3SA 1E0ZA 2JZZA 4IC7B 3AEEB 3SFDB 1WRDB 1P7EA 2KJRA 5JZEB 2LHDA 2NBWB 3Q2AC 3B9JA 2BS4B 1WGKA 2FCNA 2FNJB 5MPOA 2LVPA 2EMSA 2FIDA 4LDTB 4YTMB 1XLNA 4M0WA 1D3ZA 1WGDA 2J53A 1KRHA 3DVGX 3O13A 5JHBA 2BQQA 2D07B 1HZ6A 4H2AA 3Q69A 4HKQA 4DHJD 2JU6X 1J8CA 3UIOB 2PE6B 4GSWA 2QCZA 1EU3A 3Q8BA 5DPWA 3I9V1 4JX1C 2ZCBA 3NVWA 2K8BA 3R3MA 3QHTA 3APCA 5CHWA 2HTME 2L0TA 1K52A 3C19A 1SIFA 4BBNF 2V3PA 1R4NB 5D3IB 4ZRKA 2KNBA 1ROEA 4MSQB 4KKJA 1CK1A 4NAMA 4NNJB 4USAA 5IP4D 3K9PB 1I4QA 4OW0A 3U52E 3ZQ4A 2WXQA 1T0YA 4IUMB 4HPPA 5CTRC 3UINB 2VH1A 5IAAC 3RUIB 1RFKA 3ENEA 4HCNB 4LCDE 3NVZA 2KFJA 4TV3A 1CQVA 1Z2MA 3IHPC 3LJ3A 4HJKA 4NAWB 2JVCA 2XK5A 2NPTA 3IXSA 2Q5WD 1WM3A 4YTPB 2N1WA 4ZRQA 3L4PA 3AE1B 2LXAA 4P1BC 2K25A 4FHJA 1TTNA 2XNAC 2L8JA 2KN4A 4GDKA 3P2BA 2ONQA 3BIID 2HD5B 3AULA 1ZOYB 5C2TB 3RYTA 3AB5A 2Y3AA 4K81A 2K22A 2RDHA 4RGMA 2BF8B 4DHJB 2G45B 2H89B 1WXMA 3OAWA 3DVGY 3P4RB 4WH4A 4IW0A 2W54A 3I3TB 2IGDA 1T0SC 2LVQA 1E7PB 2CHXA 1WJNA 1MFWA 3MC8A 1FNWA 4YT0B 2RDGA 3Q8EA 1QT9A 2MLBA 2JY6A 4YSZB 3AE9B 3NRZA 2JT4B 3A9KA 2GBRA 4M01A 5E6NA 2WNMA 2G3QB 1WIAA 2KQ4X 3ZJTA 3KH0A 2J0JA 3TEZA 1L2NA 2DBYA 4BVUC 4XGAB 4LNIA 1VRAB 3N3KB 4J6IA 2N9LA 1YMHE 2MA9B 3W5VB 3WAMA 1WGGA 3Q3FA 4IWOA 3H8HA 4BAXA 1OTRB 2CU1A 3AE3B 1SE4A 2CHZA 3PSEB 5DCNA 3ZRFA 4OZBA 2YEPB 2VZKD 1I4HA 2WP9B 3MHZA 3MC0B 1BXTA 3BVGA 1NVID 2X38A 2IGGA 1N5XA 4DK5A 3ZXRA 3VUYA 1AW7A 1RWSA 2NR2A 3HUIA 1UF0A 2HJ1A 2NCNA 1JWMD 4DWFA 1ZUD2 3R7QA 4RGNA 1WXSA 2N9EB 2LUEA 1MHHE 3M62B 2WYQA 4G11A 3EHVA 1VCBA 2E6XA 4HROA 3OJ3A 4DDID 2PMVA 2JZPA 2GRIA 3NVYA 1SE3A 2AX5A 2KC2A 3P42A 3SU8X 3EUB2 4LJPB 2M19A 3BVMA 4WWNA 4HDOA 2LXCA 1YQBA 1TYGB 5EE9A 3RZWC 4F7ZA 4XDCA 4KDIC 3ZJUA 1WX9A 2PTLA 3CWIA 2BW2A 3TIXA 2DZMA 2WU2B 4I6NB 3ZTCA 2KHWB 4L2YA 2REXA 1R4MI 4GU2A 4MELA 1V9JA 2FUHB 2FCQA 2K39A 1YX5B 3KWLA 4DXGA 5H92C 3NVVA 2J0MA 2Z8LA 3Q3MC 1U4AA 4DQOC 4X57B 4N59A 5AUKA 4OVUA 3RN9C 3LDZE 3EFUA 1L0VB 2YEPF 1IYFA 4W9HA 2WLBA 1MVKA 4MJSA 1JWSD 2KDFB 3GB1A 4GIVA 2RPQA 2VZKB 2LGSA 4IM2A 1X1MA 1XLOA 3AE7B 1DGJA 3KYCD 1FD6A 4EKUA 2K6QA 1T5XD 5T8IA 1PGBA 1V97A 4CO7A 1UELA 2MBBB 1WYWB 2RR9A 1DOXA 2Z0EB 4M8NA 2WHIA 3IT4B 3PGEA 3Q6BA 4IM0A 3CF6E 3BYTB 2KANA 3TSSA 1WGHA 1XT9B 1KJTA 1OQRA 1FFVA 2LZ6A 2R2OA 2D5GA 3TL5A 2IO3B 1N63A 1YNTE 3CSFA 3W1SC 4J3OD 2PIAA 4MM3A 4HXDA 3TCAA 1UGMA 4KGTA 2O6VA 2V1YA 2VH2A 4XWTA 3Q8FA 2AL3A 1F2RC 2KX0A 2XK5B 1KLUD 4FXCA 4A3PA 2NPTB 2MP2A 2NVUI 2FBWB 1JRPA 1TS2A 3EA6A 1UBIA 4US9A 4KV2A 2LGXA 2J0KA 3DHIC 5D7GA 2XEWA 3IBEA 5D2MB 4TMAB 1RYJA 3V61A 4CHKA 2KOXA 4NPNA 4ZOHC 2D3GA 1GC6A 2C7NB 1XF5L 1TZOA 3ZO5B 1CJEA 3M63B 5FR3A 4K3BA 1DOIA 3W1YA 3V6CB 5E6OA 2BT6A 3L13A 1FEHA 1WFYA 4WJNA 2KMMA 3DBSA 2WXIA 2NBUA 3AE6B 1NI3A 2CR5A 1E6EB 2ZCCA 3N32A 3A9KB 1LM8B 4II2B 2Y5BB 1GB1A 2K6DB 2L0FA 3GOEA 2RD0A 1E5WA 3SFEB 3NZ3A 4FA6A 3R8BA 1IP9A 5HFYA 2KXJA 1Q5WB 4BBNC 2WX0A 5EDSA 1VZ6A 3JSVB 2G4SA 1IUEA 4YTNB 2WDVB 4RCOA 1F0ZA 2N9XA 2C60A 1FRRA 3MC9A 3AU5A 4KIKB 5H8YE 3A1QA 2KDIA 4KGRA 1NI2A 2DYBA 2LFIA 1WR6E 2MH7A 3DHGC 2CS4A 1Y56A 4JL9A 3RNEC 3RZFA 1JRUA 4ZDVA 5CX3A 3Q8CA 3FKYA 2E3TA 2AQ3B 5EE1A 3H7PA 2WX1A 3U4EG 2INDC 4ANUA 5AZGA 3V60A 3U2SC 5LXHA 2BVCA 1M94A 4I6PA 3ZRCA 1TY0A 2HTHA 3VRBB 1WGYA 1XLQA 2KWUB 4RH6A 4LDTD 4EZKA 3IT6B 3ZNGC 1I7HA 2KVZA 1YJ1A 4ZYNA 3ML9A 5DPTA 1H4RA 1I4XA 1KM7A 3AI5A 4ZHOA 4HWIB 3KUZA 1WF9A 4II3B 2DHZA 2RDBC 1C9FA 1WI0A 2BKRB 2KTFA 3KUCB 4L1BA 1RRBA 2WXRA 3DBRI 2QHOA 3RFZB 1KOTA 2KDEB 4K1RB 3NS8A 1E7UA 1TT5B 2M1MA 1C4CA 4WIPA 1J19A 3ZXVA 1TS4A 2N9KA 4UDUC 5IA7A 2HJ8A 3D32A 3E56A 2MWSB 2HDEA 2N7JA 3HHMA 5FR6A 2WQYB 2AYOB 1UBQA 1QKZA 1GC7A 2V3NA 4C4VB 5C23A 5IO9A 3B2FA 2KD0A 4DXFA 2JXXA 2KJHB 4S17A 4ZRJA 5KHOA 1Z5SB 2MQJA 2DLBA 3U30A 4MJSB 2I2YA 1SEBD 1V1OA 2BWFA 3TBLD 3VUWA 4LLGM 4JWSC 2W9NA 3ZTDA 3ZYYX 1HQRD 2KX3A 4ANWA 3HIZA 2PVOD 4P6VF 3ECIA 2AL6A 2BS2B 2DENB 2KDBA 1QLBB 5GMVA 4GB9A 2J52A 2LD9A 1C4PA 1MJDA 1P3QU 1F9JA 2WWZA 1CZPA 3ZGZA 1K8RB 1NEKB 1C77A 2ACZB 1QZEA 3APDA 2LRWA 1TZ1A 5J18A 4MM3B 1PUTA 1I35A 1VZ7A 1EO6A 2VRRB 1NBFC 1ET6A 1V5TA 4A6QA 4ZRPA 4EFOA 3IAM1 4C7YA 5BMIA 2TSSA 2M4NA 1PGAA 1AARA 2LRUA 2ZVOA 3S2AA 2IBIB 3RD2A 2R61A 3T3NA 5FKAC 2EELA 3P4PB 2ICIA 3ZNID 4DHZE 2KWVB 4GDLB 4Q2JA 3ZDTA 3DHHC 1YN3A 3ZLZA 1YJIA 2K5PA 5IKCM 4XZ4A 5G5GA 1WX8A 1NYRA 1BMLC 5CHFA 1ZE3D 3AECB 3JVZX 2NS5A 2CHWA 3QCAA 3IAS1 3URYA 4TKNA 1P98A 3IFWB 3AE4B 1SGHA 3AEGB 2KQSA 3TEXA 1EF5A 3PRMB 3RMKC 4LJOB 1RLFA 4NJ6A 5TSSA 3NUHB 2WU5B 1QOGA 1V2YA 2MEKA 1L5PA 3PZ8A 1IGDA 3PZ7A 1FIQA 3PRPB 2IO2B 1LO5D 1LXDA 2IZVB 2OJWA 2UWQA 5LNK1 5AEKB 1I4GA 1IBXA 4FLHA 1UWMA 2KK8A 4YXDB 1C78A 3ZNZB 3DDCB 5BO4B 3A1QB 2IY1B 2W82A 1CMXB 4KX6B 1WXAA 2MBHA 4BKSA 3PREA 4E74A 4S0RA 1DYQA 4HEA1 4YSYB 3FC4A 1G6JA 4NJCA 5EE0A 5KHQA 3BK2A 4JPSA 2JWUA 3UIPB 1OQYA 3WCQA 4HCPB 4RMAA 3WA0A 3QX1A 2B3AA 3H7PB 3RNGC 2GBKA 4MH8A 3HM6X 3RNBC 3VUXA 2Z59B 1T3QA 4BOSC 2CJOA 4G3XB 3MHSD 5AZFA 2ZVNA 5BMHA 3CSTA 5E6PA 4XC2A 4DHZB 4MGIE 3BWUD 4GOCA 3LYYA 2UU7A 4HRSA 1WH3A 2GBMA 3P4SB 2M56B 1R4MB 4FADA 4F8CB 2W3RA 5IOIA 4US8A 1WXVA 2FCMA 3ZUNA 1T6BX 4QAYA 1WJUA 3AE5B 1KFYB 4EZJA 3PPAA 4DDGD 1L0XB 3DPDA 3QAQA 3OJ4B 5CHVC 1WYGA 1V80A 3KYDD 2LHEA 1TKYA 2AWTA 1XD3B 3KW5B 4EE2A 1PQSA 2WS3B 3KQ4A 1TJEA 3DWGC 4KZCA 1ISNA 2PPHA 3W5UB 4AP4C 4PYUA 3WALA 1PYWD 1UGJA 1FCCC 2FIFA 3FAHA 2N0SB 2K0PA 3I63C 4JWUC 3A9JB 3MJ5A 1LFDA 1XCQL 2MSED 1M4VA 3KUDB 4C56C 2KLCA 2QIEB 2WXJA 1HEZE 1KF6B 2X8XX 3N1XC 2IYDB 1N5WA 3PRZA 1Q10A 2A5UA 3BY4B 1C1YB 2NMQA 2LGYA 3BK1A 2LI5A 1J7AA 2JRIB 1QILA 2OOBB 1V1PA 2KJ6A 2FAZA 1WE6A 4YL8A 3DBHI 3U7DA 5BYQA 3VHTC 1JWAD
chains in the Genus database with same CATH topology
3AEBB 1J7BA 1MPEA 3T3OA 2WXGA 1VDVA 1SSNA 2ZW0A 1C79A 2BYTA 3P1MA 4MT5A 2SEBD 2DWQA 4TQ0A 2W3SA 2XN9C 4O1NA 4D2KA 1GB1A 1E0ZA 1UUPA 1ZDVA 1NENB 4WURA 1L6UA 1QOAA 4NZLB 3AEEB 2G1EA 3FILB 3NZ3A 3SFDB 3SFEB 1OQQA 3R8BA 1P7EA 5HFYA 2LHDA 1VZ6A 3B9JA 2BS4B 1K51A 1YQ4B 4HJGE 1WGKA 1IUEA 4YTNB 1L4ZB 2WDVB 2J42A 4RCOA 1F0ZA 3VR9B 2BTEA 1FRRA 1MHXA 5MPOA 5H8YE 2G9HD 4YTMB 4KGRA 1XLNA 4M0WA 1TS3A 2LFIA 2J53A 1KRHA 4B0EA 3O13A 1KTKA 2MH7A 1HZ6A 4H2AA 3Q69A 2QMTA 2PKOA 1Y56A 4HKQA 2JU6X 4A90A 3Q8CA 4L23A 2E3TA 2AQ3B 3ABVB 1P7FA 5EE1A 1EU3A 3Q8BA 3I9V1 1YQ3B 1FNVA 4JX1C 3U4EG 1OFFA 3NVWA 3U2SC 2HTME 2BS3B 3OWEB 1K52A 3W1SA 3AEDB 2WXKA 1TY0A 2LGIA 3VRBB 1GPXA 1HXYD 1XLQA 4RH6A 1D5MC 2V3PA 3IT6B 1I7HA 5D3IB 2LMCA 2CU3A 1ROEA 2WXFA 4REZA 5BYRA 3AV8A 4KKJA 1CK1A 4NAMA 1JWUD 1I4XA 4GDKB 4USAA 1I4QA 4ZHOA 4OW0A 3AH7A 3U52E 1L4DB 1E9MA 3ZQ4A 2WXQA 1C9FA 2V0GA 2CJNA 3BYYB 1RFKA 1IBXB 1J7CA 2KDMA 4L1BA 1AWDA 2WXRA 1B9RA 3RFZB 3NVZA 1CQVA 3U7ZA 4NAWB 5E6JA 1YN4A 2FUG1 4KGSA 1C4CA 4WIPA 3IXSA 2Q5WD 1PFDA 2ON8A 4RF1A 3DWMA 4YTPB 1TS4A 2INPE 2N9KA 4UDUC 3L4PA 4ZRQA 1ESFA 1TKEA 2GB1A 3AE1B 5I4DA 1SJHD 2XNAC 3E56A 2HDEA 2N7JA 2KN4A 3C8YA 2WQYB 2ONQA 1QKZA 1ACCA 2V3NA 3BIID 1STEA 1ZOYB 5C2TB 3B2FA 3AEFB 4DXFA 3AEAB 5GXGB 3AB5A 1PGXA 2Y3AA 1NYQA 3PO0A 2K22A 3UI3A 2RDHA 1JW9D 4RGMA 1DOYA 2DLBA 2H89B 1SBBB 3AM9A 2I2YA 1ZXIA 1SEBD 1V1OA 1ZXHA 3LXFA 1N60A 3P4RB 3MFGA 1C4AA 4WH4A 2L83A 4JWSC 4LLGM 1ZPSA 4GLSC 3ZYYX 1HQRD 1L0YB 1RM6C 2W54A 2PVOD 2IGDA 1WWTA 3ZJVA 4P6VF 2BS2B 1E7PB 1QLBB 3MP9A 4RGOS 1JCKB 1FNWA 1FXIA 4YT0B 2J52A 2RDGA 1C4PA 3Q8EA 4XDDA 1QT9A 1WXQA 4WWMA 3VQIA 3E9SA 1CZPA 3HVZA 2AQ2B 3CIRB 3ZGZA 4YSZB 3AE9B 3BVZA 3NRZA 3KWVA 1EU4A 4OVZA 1XXGA 4N6EB 1NEKB 1C77A 2ACZB 2WXNA 4C7ZA 1SF0A 1JMLA 4OHJA 2WNMA 4IKGA 1A70A 4MM3B 1PUTA 1WSPA 2KQ4X 2QSDA 5HG2A 3FILA 2JXTA 2WXOA 3ZJTA 1C76A 2NTSA 3TEZA 3P4QB 2MJ3A 1VZ7A 1JROA 1ET6A 1EWCA 2DBYA 2PVGC 4ITKA 2LJIA 4A6QA 4ARCA 2BB6A 4ZRPA 2LEKA 4YWGG 2L32A 3IAM1 4C7YA 5BMIA 2TSSA 4OZAA 1PGAA 3AE2B 3I57A 1N61A 1VRAB 2L52A 1ENFA 1FRDA 2N9LA 1XLPA 3TEWA 2R61A 1YMHE 1BUIC 2MJDA 3KLSX 3W5VB 4A55A 3T3NA 5FKAC 3H8HA 1TKGA 3W2DA 4XE0A 5G5HA 2EELA 3P4PB 5JXVA 2ICIA 1SE2A 1XEEA 5FK9C 3AE3B 1SE4A 2QEJC 2FE8A 1GOZA 3W9CB 2JYEA 3P63A 3Q8AA 4GDLB 3SEBA 4YSXB 4OZBA 4Q2JA 2YEPB 1UWXA 1EWYC 2VZKD 2RPVA 3B2GA 1I4HA 2WP9B 3MHZA 1YN3A 3MC0B 1YJIA 2K5PA 2WXHA 4JE3B 5G5GA 1BXTA 4A9AA 3BVGA 3TUOA 1NVID 2B76B 1FM0D 1NYRA 1BMLC 2SAKA 2X38A 1JALA 2IGGA 1N5XA 1ZE3D 4ZHPA 3AECB 1AW7A 1RWSA 4WAFA 3IAS1 3URYA 3VRAB 3HUIA 4XWWA 4C80A 1JWMD 1QOFA 1EM7A 2EKIA 1ZUD2 2M0AA 3AE4B 2GI9A 3AEGB 1AN8A 2PW9A 1AYFA 4RGNA 1SIJA 3TEXA 4N58A 1MHHE 2DYOA 5TSSA 1PDXA 3NUHB 2WU5B 2E6XA 3EGRA 4HROA 1QOGA 1ZP0B 1KLGD 2PMVA 2JQRB 2JZPA 2GRIA 3NVYA 1L6VA 2MEKA 1L5PA 1SE3A 3PZ8A 2AX5A 1IGDA 3PZ7A 1YJJA 2MJEA 3P42A 2KAJA 1FIQA 4AQ7A 2BB5A 4RNAA 1FO4A 2Y5PA 1LO5D 2IJ0A 1JWBD 2WXLA 3EUB2 2M19A 3BVMA 4OZCA 5LNK1 5EE9A 1TYGB 1I4GA 4RF0A 1IBXA 4RFBA 4XDCA 3ZJUA 2PLPA 1MI0A 2K3UA 2PTLA 1UWMA 3CWIA 2BW2A 3HVDA 5HI1A 3GP7A 4YXDB 1ZDXA 1C78A 2WU2B 1D6EC 1YN5A 1QOBA 1F2RI 4L2YA 2QILA 2WXMA 4MACA 2DYMA 2W82A 4KX6B 1VJKA 1QQRA 1XCTL 1DYQA 3BZDB 4HEA1 4YSYB 3KWLA 3FC4A 3GS2A 4DXGA 2ZW1A 5H92C 4NJCA 5EE0A 3SR6A 3BK2A 3NVVA 4JPSA 1QF6A 2JWUA 2Z8LA 4DQOC 3WCQA 5D3DA 4N59A 4ZYSA 5AUKA 1GB4A 1TS5A 4MH8A 1L0VB 2YEPF 4WQMA 1T3QA 4LK0M 3V05A 2WLBA 1FCLA 2CJOA 2H88B 1MVKA 1UNSA 1JWSD 3GB1A 5BMHA 2VZKB 4A8XC 1XLOA 3AE7B 1DGJA 3BWUD 1FD6A 3LYYA 4HRSA 4RGTA 2OHFA 1T5XD 3P4SB 2M56B 1F77A 5C3JB 5T8IA 1PGBA 1V97A 5EE3A 2W3RA 1HZ5A 4US8A 1DOXA 3R2TA 3V3XA 1T6BX 3IT4B 1IGCA 4IDIA 1FMAD 1KFYB 1D5XC 3AE5B 3BYTB 3RPFC 3TSSA 3ETRA 1L0XB 3HRDD 1OQRA 1FFVA 1SJED 1WYGA 1KH0A 2IDYA 2D5GA 1VZ8A 2LHEA 1TKYA 2KACA 1SB3C 2WXPA 2JYTA 5BMGA 1D5ZC 1N63A 1YNTE 1I4PA 4J3OD 2PIAA 4EE2A 1GAQB 4P16A 1D4BA 1E10A 4KGTA 2WS3B 3VR8B 3J9CA 2J4XA 2L1AA 1VR9A 3KQ4A 4XWTA 1XO3A 3Q8FA 4TQ1A 2NTTA 1TJEA 2LUMA 1F2RC 3DWGC 1KLUD 4FXCA 2W55A 2BBCA 4R3DA 5AUIA 3W5UB 2FBWB 1JRPA 1TS2A 1FFUA 3EA6A 4US9A 1FXAA 3AN1A 2Y5CA 1V1PB 1V8CA 3AE8B 1N62A 1PYWD 1TY2A 1FCCC 1UGJA 3FAHA 1B1ZA 2N0SB 2K0PA 2V4IB 3LB8C 4JWUC 1WRIA 2OEDA 5D7GA 4B0MA 1HA5A 1R7SA 3N9YC 3MJ5A 4KKIA 1XCQL 4HKZE 1M4VA 4TMAB 5BYSA 1RYJA 2JSVX 2QJLA 4C56C 2QIEB 3TEYA 2KWDA 2WXJA 1HEZE 1KF6B 2WDQB 1SXTA 4TSSA 4ZOHC 1VLBA 1N5WA 2WDRB 1I4RA 1XF5L 1TZOA 1CJEA 1Q10A 2I38A 2K9XA 4IOIE 5FR3A 1DOIA 4AS1A 2NMQA 2BT6A 1JQ4A 4ARIA 1ET9A 5HHDG 2JX5A 1FEHA 3BK1A 1J7AA 2INNE 2KMMA 3NS1A 1QILA 4PT5A 3R2IA 2WXIA 1V1PA 2IGHA 1FNUA 3AMZA 4LTUA 1K50A 3AE6B 1NI3A 2IPKD 1E6EB 4CQNA 2AQ1B 5BYQA 2RMMA 1JWAD 1K53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  2CJO A;  1TKG A;  2H88 B;  1J7B A;  3AEB B;  1B9R A;  3NVZ A;  5G5H A;  1VDV A;  3P4P B;  3AE3 B;  1XLO A;  3P1M A;  3AE7 B;  1DGJ A;  3W9C B;  2DWQ A;  3P63 A;  2W3S A;  4HRS A;  4YSX B;  2OHF A;  3P4S B;  1E0Z A;  1EWY C;  2M56 B;  2Q5W D;  1PFD A;  1NEN B;  5C3J B;  3B2G A;  2WP9 B;  3DWM A;  1L6U A;  4YTP B;  1QOA A;  1V97 A;  3L4P A;  5EE3 A;  1TKE A;  3AEE B;  1YJI A;  2K5P A;  2W3R A;  2G1E A;  3AE1 B;  3SFD B;  3SFE B;  5G5G A;  4US8 A;  1OQQ A;  1DOX A;  4A9A A;  1NVI D;  2B76 B;  1FM0 D;  1NYR A;  2WQY B;  4IDI A;  3B9J A;  1JAL A;  2BS4 B;  1FMA D;  1KFY B;  3AE5 B;  1N5X A;  3RPF C;  1YQ4 B;  4ZHP A;  3ETR A;  3AEC B;  1WGK A;  1IUE A;  1OQR A;  3BII D;  1FFV A;  3HRD D;  1RWS A;  4YTN B;  1WYG A;  1ZOY B;  2WDV B;  5C2T B;  3B2F A;  1F0Z A;  1TKY A;  3HUI A;  3VRA B;  3AEF B;  1SB3 C;  3AEA B;  5GXG B;  3AB5 A;  3VR9 B;  1FRR A;  1N63 A;  4C80 A;  5MPO A;  1QOF A;  1NYQ A;  3PO0 A;  2EKI A;  2K22 A;  1ZUD 2;  3AE4 B;  1JW9 D;  2PIA A;  3AEG B;  5H8Y E;  1AYF A;  1GAQ B;  1SIJ A;  1E10 A;  1DOY A;  4N58 A;  4YTM B;  2WS3 B;  1XLN A;  3VR8 B;  2H89 B;  3AM9 A;  1ZXI A;  1KRH A;  1XO3 A;  1PDX A;  2MH7 A;  2WU5 B;  3LXF A;  3P4R B;  1N60 A;  1TJE A;  4HRO A;  1QOG A;  1ZP0 B;  2L83 A;  4JWS C;  3DWG C;  2JQR B;  2PKO A;  3NVY A;  1L6V A;  3ZYY X;  4FXC A;  1L5P A;  2W55 A;  1RM6 C;  2AX5 A;  2W54 A;  2PVO D;  5AUI A;  1WWT A;  1YJJ A;  3W5U B;  2FBW B;  2MJE A;  2KAJ A;  1JRP A;  1FIQ A;  2BS2 B;  1E7P B;  1QLB B;  2E3T A;  3ABV B;  5EE1 A;  1FO4 A;  1FFU A;  1FXI A;  4US9 A;  4YT0 B;  1JWB D;  1FXA A;  1YQ3 B;  2M19 A;  3AN1 A;  2Y5C A;  3EUB 2;  4JX1 C;  1QT9 A;  1OFF A;  1V8C A;  1TYG B;  1WXQ A;  3AE8 B;  1N62 A;  3NVW A;  4WWM A;  5EE9 A;  1CZP A;  3FAH A;  2HTM E;  2BS3 B;  2N0S B;  3HVZ A;  3CIR B;  3LB8 C;  4YSZ B;  4JWU C;  3AE9 B;  3NRZ A;  1WRI A;  3AED B;  1UWM A;  3CWI A;  1R7S A;  4N6E B;  1NEK B;  4YXD B;  3VRB B;  1GPX A;  2WU2 B;  2ACZ B;  1QOB A;  1RYJ A;  1XLQ A;  2QJL A;  4C7Z A;  1SF0 A;  2QIE B;  1A70 A;  1KF6 B;  2WDQ B;  4KX6 B;  1VJK A;  1I7H A;  2CU3 A;  4ZOH C;  1PUT A;  1ROE A;  1N5W A;  1VLB A;  2WDR B;  4YSY B;  1CJE A;  2K9X A;  3KWL A;  3FC4 A;  3AV8 A;  3P4Q B;  2MJ3 A;  5H92 C;  1DOI A;  4USA A;  1JRO A;  5EE0 A;  3SR6 A;  3NVV A;  2DBY A;  4ZHO A;  2BT6 A;  1QF6 A;  2PVG C;  3AH7 A;  4ITK A;  1JQ4 A;  2JX5 A;  4P6V F;  3WCQ A;  2LEK A;  4N59 A;  1E9M A;  1J7A A;  2KMM A;  3NS1 A;  5AUK A;  4C7Y A;  3AE2 B;  1N61 A;  2L52 A;  1FRD A;  1L0V B;  3AMZ A;  1XLP A;  2CJN A;  4LTU A;  1T3Q A;  1RFK A;  4WQM A;  1J7C A;  1NI3 A;  3AE6 B;  3W5V B;  2MJD A;  1E6E B;  2WLB A;  1JWA D; 
#chains in the Genus database with same CATH topology
 1J7B A;  4M0W B;  1C79 A;  4URK A;  3ZDM C;  2LAS A;  4ICU A;  2O2V A;  2XN9 C;  4O1N A;  4I6L B;  1UUP A;  5D94 A;  1ZDV A;  1T0R C;  1NEN B;  4BOZ B;  1QOA A;  1WZ0 A;  4NZL B;  3VTW A;  4P7I A;  2G1E A;  4KDL B;  4F1S A;  4LNK A;  4WAA A;  4G50 A;  2YLM A;  5HKH A;  2KMC A;  1ZGU B;  4HJG E;  3PTF C;  1IPG A;  1L4Z B;  1ZW7 A;  3DOW A;  2J42 A;  2BTE A;  1MHX A;  1UD7 A;  4NY0 A;  4XYC A;  4WJP A;  3L17 A;  1TS3 A;  4B0E A;  1KTK A;  3WIM A;  2QMT A;  2DNF A;  1HE8 A;  2K8C A;  2KTR A;  3RUL A;  4B6W A;  2M17 A;  2ZNV C;  3ABV B;  3PVL A;  5DPR A;  3GZN I;  1N6Z A;  3H9D A;  1OFF A;  1GG3 A;  3PHW B;  2BS3 B;  3OWE B;  3PLU A;  2FCS A;  1GJZ A;  1OGW A;  2LGI A;  1GPX A;  2V9H A;  1D5M C;  4OVV A;  4BZA A;  4JQW C;  4EZL A;  1S1Q B;  2CU3 A;  4FBJ B;  4REZ A;  5LLI A;  5BYR A;  3AV8 A;  2JZ3 B;  4GDK B;  2N4F A;  1V6E A;  2ASQ A;  4GN1 A;  1V86 A;  3WAN A;  1L4D B;  2XBB C;  3H7S A;  3DCG A;  3DVN V;  1IBX B;  3B1L X;  2JPH A;  1H8C A;  1B9R A;  4PS7 A;  3U7Z A;  4M02 A;  2KWC A;  1YN4 A;  2OJR A;  2FUG 1;  3R66 C;  1Q1O A;  3DBL I;  1PFD A;  2KFK A;  2ON8 A;  1E7V A;  2R2Q A;  2PJH A;  1ESF A;  2GB1 A;  5I4D A;  1SJH D;  3C8Y A;  3DQV A;  2M8S A;  1ACC A;  3IG3 A;  1STE A;  3B0A A;  4NQK E;  3APF A;  3AEF B;  3AEA B;  2C7M B;  1PGX A;  3UF8 A;  2DZJ A;  2K1F A;  3UI3 A;  1NDD A;  1EUV B;  1HTQ A;  1V81 A;  3AM9 A;  1SBB B;  1ZXI A;  3DBR B;  3LXF A;  3MFG A;  2L83 A;  1MG8 A;  4GGQ A;  1ZPS A;  4GLS C;  1L0Y B;  1WWT A;  4W9C A;  2WGS A;  4HK2 A;  3MP9 A;  4KSK C;  2N7E A;  2BWE S;  1JCK B;  3HK0 A;  4M00 A;  4XDD A;  1WXQ A;  3VQI A;  1VD2 A;  3CIR B;  3TJP A;  3NG0 A;  3BVZ A;  3KWV A;  2A4Z A;  1XXG A;  1T0Q C;  5LXI B;  4W9J A;  2V3S A;  4C7Z A;  1SF0 A;  1JML A;  1A70 A;  3PHX B;  2C7H A;  1WSP A;  3FIL A;  2JXT A;  2WXO A;  1C76 A;  2NTS A;  1UZX B;  3P4Q B;  4GXB A;  4K3C A;  1EWC A;  2M0X A;  2PVG C;  4ITK A;  4ARC A;  2BB6 A;  1OEY A;  1F52 A;  2L32 A;  1N61 A;  2L52 A;  1ENF A;  1BT0 A;  4FJV B;  3KLS X;  2MJD A;  3H1U A;  4A55 A;  2DAF A;  2K8H A;  3Q3O C;  3ZIM A;  4XE0 A;  1WMH A;  3V6E B;  5IN7 A;  1XEE A;  2FE8 A;  1GOZ A;  4ACF A;  3W9C B;  3VAW A;  3P63 A;  4YSX B;  2O6V D;  1EWY C;  3ZVV A;  4JE3 B;  3PLV A;  1I42 A;  3TUO A;  2B76 B;  4MH0 E;  4AJY B;  2EMT A;  3Q3J A;  2L00 B;  4ZHP A;  4KZ0 A;  4CYE A;  3VRA B;  4C80 A;  2DZI A;  1EM7 A;  4AWJ A;  1AN8 A;  2PW9 A;  1AYF A;  1SIJ A;  4N58 A;  2D3C A;  4LNF A;  2DYO A;  3SDL C;  3EGR A;  1KLG D;  1L6V A;  1YJJ A;  2MJE A;  2KAJ A;  4AQ7 A;  2BB5 A;  3L08 A;  4RNA A;  1FO4 A;  2Y5P A;  2L7R A;  4MGY E;  1JWB D;  1P1A A;  1LQB A;  3O65 B;  2PLP A;  1MI0 A;  5G2N A;  2K3U A;  2LVO A;  3GP7 A;  4EOY A;  1ZDX A;  2C5L C;  3VH4 B;  1QOB A;  1F2R I;  3VXW A;  1WJ4 A;  4MAC A;  4RM9 A;  2DYM A;  1RFA A;  1ZKH A;  2GBJ A;  2L3Z A;  2KVR A;  3GS2 A;  1A5R A;  2KTR B;  4AUQ C;  1V5O A;  3SR6 A;  2BGF A;  2MW5 A;  3QWZ B;  4WQM A;  3X0W A;  4W9G A;  4LK0 M;  3HM3 A;  2H88 B;  3PT2 B;  2N1V A;  1E8W A;  4HDQ A;  2O6V B;  2GLS A;  2N9P C;  4NQL B;  2KT7 A;  1P9D U;  4RGT A;  2OHF A;  2MP2 B;  1SE9 A;  4K7W A;  4MGZ E;  1F77 A;  3L54 A;  5C3J B;  4W9L A;  1HZ5 A;  3R2T A;  4HLE A;  1YIW A;  3V3X A;  1IGC A;  3NHE B;  3RPF C;  3T9L A;  3ETR A;  4KVG B;  2WDT B;  2D11 A;  4HVB A;  1SJE D;  2JWZ A;  2IDY A;  3RNF C;  1VZ8 A;  2JYT A;  2EKE C;  5BMG A;  4PK1 A;  1I4P A;  3V62 A;  3VVW B;  2LWP A;  3MJW A;  3VR8 B;  3J9C A;  3U8Z A;  2J4X A;  2L1A A;  1VR9 A;  1XO3 A;  2LUM A;  2ZZP B;  2W55 A;  2BBC A;  4JLC A;  4R3D A;  3N1Z C;  5AUI A;  2KFK B;  2KC1 A;  1E90 A;  1FFU A;  1WJ6 A;  3QJZ A;  1FXA A;  3AN1 A;  2Y5C A;  3AE8 B;  3EFC A;  1TY2 A;  1B1Z A;  2G4D B;  2V4I B;  3LB8 C;  2GBN A;  2OED A;  2MRP A;  1HA5 A;  2MBE A;  4E3C A;  3PZD A;  5BYS A;  4GMV A;  2JSV X;  4W9K A;  4A3O A;  3GE3 C;  4FN2 A;  3TEY A;  3JYU A;  3VFK A;  2WDQ B;  1I4R A;  2I38 A;  4AS1 A;  2QDF A;  1WX7 A;  1MG4 A;  2INN E;  3NS1 A;  4PT5 A;  3R2I A;  1FNU A;  1K50 A;  4WWP A;  2IPK D;  4CQN A;  2RMM A;  2IO0 B;  1K53 A;  3A4S C;  3AEB B;  1E8X A;  5J2R A;  1MPE A;  3WAP A;  4B9K A;  3T3O A;  2ZW0 A;  1LGR A;  4TQ0 A;  2Z0D B;  4LNN A;  4D2K A;  4ICV A;  3NZS A;  4WUR A;  1WGR A;  4MEM A;  1L6U A;  4MDK E;  3L16 A;  3FIL B;  1OQQ A;  5TR5 A;  4KSL C;  1YD8 U;  1K51 A;  1YQ4 B;  1UH6 A;  4E71 A;  5L83 A;  3VR9 B;  4ASW C;  1R4N I;  2NBV B;  2G9H D;  2BPS A;  1P0R A;  3DBH B;  3N1Y C;  1WMH B;  1YOV B;  3Q14 C;  1GNU A;  3I5J C;  4IWP A;  2PKO A;  2DX5 B;  2MHJ A;  3QIJ A;  1RAX A;  2KZR A;  4A90 A;  4L23 A;  1P7F A;  4M8M A;  1YQ3 B;  1FNV A;  2UYZ B;  3A4R A;  5JHA A;  4W9E A;  3JSV A;  3W1S A;  4W9F A;  3AED B;  3QQ8 B;  2WXK A;  1HXY D;  4KIK A;  2KKC A;  1WZ3 A;  3L10 B;  3WAO A;  1OEY J;  2LMC A;  2WXF A;  1S3S G;  1WE7 A;  1JWU D;  3X23 A;  3AH7 A;  4IM3 A;  3QAR A;  1E9M A;  3BIN A;  4WJQ A;  5C1Z A;  2V0G A;  5J17 A;  4HPM B;  2CJN A;  3GZN B;  3BYY B;  4ZRI A;  1J7C A;  2KDM A;  3ALB A;  1AWD A;  2CKH B;  2JRH A;  4P1C C;  2GOW A;  5E6J A;  2N7D A;  4KGS A;  4FHK A;  2ZJD A;  1WY8 A;  4RF1 A;  3DWM A;  2INP E;  1TKE A;  3OLM D;  4WQO B;  5G55 A;  1C3T A;  2ZPY A;  2PE9 A;  3ZNH B;  3UGB B;  3RCZ A;  1XQQ A;  3KVF B;  3UQA A;  4G0N B;  5GXG B;  3B08 A;  1NYQ A;  2BKF A;  3PO0 A;  1JW9 D;  4HPL B;  4K7U A;  1DOY A;  1EF1 A;  1TGZ B;  1TIF A;  4MGK E;  1Q0W B;  2AEH A;  1ZXH A;  1N60 A;  2DZK A;  1C4A A;  2DAJ A;  2I1J A;  4BKS D;  1RM6 C;  3ZJV A;  1FXT B;  3M95 A;  4RGO S;  3DBL B;  2D3A A;  1FXI A;  2KMA A;  2D10 A;  2HE7 A;  4WWM A;  2KLG A;  3E9S A;  3QA8 A;  3HVZ A;  2L76 A;  4BKT A;  2AQ2 B;  4C4V A;  4OVZ A;  1EU4 A;  1GUA B;  4N6E B;  2WXN A;  2C9W B;  4PS8 A;  3VDZ A;  5DPS A;  3T8M A;  4OHJ A;  4IKG A;  2KQ7 A;  2L05 A;  2JF5 A;  2QSD A;  5HG2 A;  3Q3N C;  3CMM B;  1E8Y A;  2MJ3 A;  1JRO A;  3L0W B;  1TBE A;  2LJI A;  1FPY A;  4PS3 A;  2LEK A;  4YWG G;  4PYZ A;  4OZA A;  3AE2 B;  3I57 A;  3NOB A;  1FRD A;  1XLP A;  3TEW A;  1BUI C;  1TKG A;  3W2D A;  5G5H A;  5JXV A;  1SE2 A;  5FK9 C;  2QEJ C;  1HTO A;  2JYE A;  4LNO A;  3Q8A A;  3SEB A;  2BYF A;  1UWX A;  2RPV A;  3B2G A;  3ZKJ C;  2WXH A;  2J7Q B;  4A9A A;  1FM0 D;  2SAK A;  3SD5 A;  1JAL A;  3SHQ A;  4AJW A;  4W9I A;  4WAF A;  2V4L A;  4XWW A;  3N30 A;  1QOF A;  2EKI A;  2M0A A;  2D2Q A;  3NZU A;  2GI9 A;  1YX6 B;  3NY5 A;  1PDX A;  1ZP0 B;  2KN5 A;  4WJO A;  2JQR B;  2MBO A;  4GDL A;  3RT3 B;  2I1K A;  3PV1 A;  3ZW3 A;  1L7Y A;  3OG5 A;  4IWQ A;  2IJ0 A;  2WXL A;  4OZC A;  3M3J A;  5AZH A;  4RF0 A;  4RFB A;  3AU4 A;  1F1H A;  3HVD A;  5HI1 A;  4NAW A;  1D6E C;  1YN5 A;  3MTN B;  3EEC A;  2QIL A;  2BYE A;  2KYW A;  1VJK A;  1QQR A;  4IG7 B;  4ANV A;  4EEW A;  1XCT L;  3BZD B;  2IY0 B;  4WWO A;  2PEA A;  4RM8 A;  2ZW1 A;  4W9D A;  1QF6 A;  4JIO U;  5D3D A;  4DBG A;  4ZYS A;  2ZNV B;  1GB4 A;  2MCN B;  4C00 A;  1TS5 A;  2QC8 A;  4BKG A;  2IO1 B;  3RNC C;  3R7R A;  3V05 A;  2ZPN A;  2D3B A;  4B95 A;  1FCL A;  1UNS A;  4DXA B;  4A8X C;  4NJ7 A;  4AOF A;  2JUO A;  3QK0 A;  4K7S A;  2KO3 A;  4JGH B;  4FJY A;  5EE3 A;  1J0G A;  3A33 B;  4IDI A;  1FMA D;  1D5X C;  3HRD D;  3GE8 C;  3N20 C;  1KH0 A;  2YVC A;  4EUT A;  2KAC A;  1SB3 C;  2WXP A;  3UQB A;  2MBQ A;  1D5Z C;  3NJT A;  2ZEQ A;  3PS6 A;  2MX2 A;  1GAQ B;  4P16 A;  1D4B A;  1E10 A;  2RSU A;  1Y8R C;  4TQ1 A;  2NTT A;  3JW0 X;  3RI7 C;  2LGD A;  3ML8 A;  4MSM B;  2BYV E;  3EC8 A;  1V1P B;  1V8C A;  3DVN U;  1N62 A;  3K9O B;  1E8Z A;  1WRI A;  4N9F 4;  4B0M A;  1R7S A;  3N9Y C;  4KKI A;  3VTV A;  4HKZ E;  2QJL A;  2O2V B;  2GMI C;  4ANX A;  5D6J B;  2KWD A;  1SXT A;  4TSS A;  2INC C;  1VLB A;  2WDR B;  3VH3 B;  3C0R B;  4TUU A;  2K9X A;  4IOI E;  3ONS A;  1JQ4 A;  3TMP B;  4ARI A;  1ET9 A;  5HHD G;  2JX5 A;  2RGF A;  3AXC A;  5JH5 C;  1V49 A;  2IGH A;  3IVF A;  3RNA C;  5L95 C;  4XX5 A;  4A20 A;  3AMZ A;  4LTU A;  1WM2 A;  4FJZ A;  1WR1 A;  2AQ1 B;  3VTU A;  2WXM A;  1KLV A;  3A9J A;  4BFR A;  2WXG A;  1VDV A;  2LJ5 A;  1SSN A;  2BYT A;  3P1M A;  4FUL A;  3QC8 B;  4MT5 A;  3H6N A;  2SEB D;  2DWQ A;  2W3S A;  1E0Z A;  2JZZ A;  4IC7 B;  3AEE B;  3SFD B;  1WRD B;  1P7E A;  2KJR A;  5JZE B;  2LHD A;  2NBW B;  3Q2A C;  3B9J A;  2BS4 B;  1WGK A;  2FCN A;  2FNJ B;  5MPO A;  2LVP A;  2EMS A;  2FID A;  4LDT B;  4YTM B;  1XLN A;  4M0W A;  1D3Z A;  1WGD A;  2J53 A;  1KRH A;  3DVG X;  3O13 A;  5JHB A;  2BQQ A;  2D07 B;  1HZ6 A;  4H2A A;  3Q69 A;  4HKQ A;  4DHJ D;  2JU6 X;  1J8C A;  3UIO B;  2PE6 B;  4GSW A;  2QCZ A;  1EU3 A;  3Q8B A;  5DPW A;  3I9V 1;  4JX1 C;  2ZCB A;  3NVW A;  2K8B A;  3R3M A;  3QHT A;  3APC A;  5CHW A;  2HTM E;  2L0T A;  1K52 A;  3C19 A;  1SIF A;  4BBN F;  2V3P A;  1R4N B;  5D3I B;  4ZRK A;  2KNB A;  1ROE A;  4MSQ B;  4KKJ A;  1CK1 A;  4NAM A;  4NNJ B;  4USA A;  5IP4 D;  3K9P B;  1I4Q A;  4OW0 A;  3U52 E;  3ZQ4 A;  2WXQ A;  1T0Y A;  4IUM B;  4HPP A;  5CTR C;  3UIN B;  2VH1 A;  5IAA C;  3RUI B;  1RFK A;  3ENE A;  4HCN B;  4LCD E;  3NVZ A;  2KFJ A;  4TV3 A;  1CQV A;  1Z2M A;  3IHP C;  3LJ3 A;  4HJK A;  4NAW B;  2JVC A;  2XK5 A;  2NPT A;  3IXS A;  2Q5W D;  1WM3 A;  4YTP B;  2N1W A;  4ZRQ A;  3L4P A;  3AE1 B;  2LXA A;  4P1B C;  2K25 A;  4FHJ A;  1TTN A;  2XNA C;  2L8J A;  2KN4 A;  4GDK A;  3P2B A;  2ONQ A;  3BII D;  2HD5 B;  3AUL A;  1ZOY B;  5C2T B;  3RYT A;  3AB5 A;  2Y3A A;  4K81 A;  2K22 A;  2RDH A;  4RGM A;  2BF8 B;  4DHJ B;  2G45 B;  2H89 B;  1WXM A;  3OAW A;  3DVG Y;  3P4R B;  4WH4 A;  4IW0 A;  2W54 A;  3I3T B;  2IGD A;  1T0S C;  2LVQ A;  1E7P B;  2CHX A;  1WJN A;  1MFW A;  3MC8 A;  1FNW A;  4YT0 B;  2RDG A;  3Q8E A;  1QT9 A;  2MLB A;  2JY6 A;  4YSZ B;  3AE9 B;  3NRZ A;  2JT4 B;  3A9K A;  2GBR A;  4M01 A;  5E6N A;  2WNM A;  2G3Q B;  1WIA A;  2KQ4 X;  3ZJT A;  3KH0 A;  2J0J A;  3TEZ A;  1L2N A;  2DBY A;  4BVU C;  4XGA B;  4LNI A;  1VRA B;  3N3K B;  4J6I A;  2N9L A;  1YMH E;  2MA9 B;  3W5V B;  3WAM A;  1WGG A;  3Q3F A;  4IWO A;  3H8H A;  4BAX A;  1OTR B;  2CU1 A;  3AE3 B;  1SE4 A;  2CHZ A;  3PSE B;  5DCN A;  3ZRF A;  4OZB A;  2YEP B;  2VZK D;  1I4H A;  2WP9 B;  3MHZ A;  3MC0 B;  1BXT A;  3BVG A;  1NVI D;  2X38 A;  2IGG A;  1N5X A;  4DK5 A;  3ZXR A;  3VUY A;  1AW7 A;  1RWS A;  2NR2 A;  3HUI A;  1UF0 A;  2HJ1 A;  2NCN A;  1JWM D;  4DWF A;  1ZUD 2;  3R7Q A;  4RGN A;  1WXS A;  2N9E B;  2LUE A;  1MHH E;  3M62 B;  2WYQ A;  4G11 A;  3EHV A;  1VCB A;  2E6X A;  4HRO A;  3OJ3 A;  4DDI D;  2PMV A;  2JZP A;  2GRI A;  3NVY A;  1SE3 A;  2AX5 A;  2KC2 A;  3P42 A;  3SU8 X;  3EUB 2;  4LJP B;  2M19 A;  3BVM A;  4WWN A;  4HDO A;  2LXC A;  1YQB A;  1TYG B;  5EE9 A;  3RZW C;  4F7Z A;  4XDC A;  4KDI C;  3ZJU A;  1WX9 A;  2PTL A;  3CWI A;  2BW2 A;  3TIX A;  2DZM A;  2WU2 B;  4I6N B;  3ZTC A;  2KHW B;  4L2Y A;  2REX A;  1R4M I;  4GU2 A;  4MEL A;  1V9J A;  2FUH B;  2FCQ A;  2K39 A;  1YX5 B;  3KWL A;  4DXG A;  5H92 C;  3NVV A;  2J0M A;  2Z8L A;  3Q3M C;  1U4A A;  4DQO C;  4X57 B;  4N59 A;  5AUK A;  4OVU A;  3RN9 C;  3LDZ E;  3EFU A;  1L0V B;  2YEP F;  1IYF A;  4W9H A;  2WLB A;  1MVK A;  4MJS A;  1JWS D;  2KDF B;  3GB1 A;  4GIV A;  2RPQ A;  2VZK B;  2LGS A;  4IM2 A;  1X1M A;  1XLO A;  3AE7 B;  1DGJ A;  3KYC D;  1FD6 A;  4EKU A;  2K6Q A;  1T5X D;  5T8I A;  1PGB A;  1V97 A;  4CO7 A;  1UEL A;  2MBB B;  1WYW B;  2RR9 A;  1DOX A;  2Z0E B;  4M8N A;  2WHI A;  3IT4 B;  3PGE A;  3Q6B A;  4IM0 A;  3CF6 E;  3BYT B;  2KAN A;  3TSS A;  1WGH A;  1XT9 B;  1KJT A;  1OQR A;  1FFV A;  2LZ6 A;  2R2O A;  2D5G A;  3TL5 A;  2IO3 B;  1N63 A;  1YNT E;  3CSF A;  3W1S C;  4J3O D;  2PIA A;  4MM3 A;  4HXD A;  3TCA A;  1UGM A;  4KGT A;  2O6V A;  2V1Y A;  2VH2 A;  4XWT A;  3Q8F A;  2AL3 A;  1F2R C;  2KX0 A;  2XK5 B;  1KLU D;  4FXC A;  4A3P A;  2NPT B;  2MP2 A;  2NVU I;  2FBW B;  1JRP A;  1TS2 A;  3EA6 A;  1UBI A;  4US9 A;  4KV2 A;  2LGX A;  2J0K A;  3DHI C;  5D7G A;  2XEW A;  3IBE A;  5D2M B;  4TMA B;  1RYJ A;  3V61 A;  4CHK A;  2KOX A;  4NPN A;  4ZOH C;  2D3G A;  1GC6 A;  2C7N B;  1XF5 L;  1TZO A;  3ZO5 B;  1CJE A;  3M63 B;  5FR3 A;  4K3B A;  1DOI A;  3W1Y A;  3V6C B;  5E6O A;  2BT6 A;  3L13 A;  1FEH A;  1WFY A;  4WJN A;  2KMM A;  3DBS A;  2WXI A;  2NBU A;  3AE6 B;  1NI3 A;  2CR5 A;  1E6E B;  2ZCC A;  3N32 A;  3A9K B;  1LM8 B;  4II2 B;  2Y5B B;  1GB1 A;  2K6D B;  2L0F A;  3GOE A;  2RD0 A;  1E5W A;  3SFE B;  3NZ3 A;  4FA6 A;  3R8B A;  1IP9 A;  5HFY A;  2KXJ A;  1Q5W B;  4BBN C;  2WX0 A;  5EDS A;  1VZ6 A;  3JSV B;  2G4S A;  1IUE A;  4YTN B;  2WDV B;  4RCO A;  1F0Z A;  2N9X A;  2C60 A;  1FRR A;  3MC9 A;  3AU5 A;  4KIK B;  5H8Y E;  3A1Q A;  2KDI A;  4KGR A;  1NI2 A;  2DYB A;  2LFI A;  1WR6 E;  2MH7 A;  3DHG C;  2CS4 A;  1Y56 A;  4JL9 A;  3RNE C;  3RZF A;  1JRU A;  4ZDV A;  5CX3 A;  3Q8C A;  3FKY A;  2E3T A;  2AQ3 B;  5EE1 A;  3H7P A;  2WX1 A;  3U4E G;  2IND C;  4ANU A;  5AZG A;  3V60 A;  3U2S C;  5LXH A;  2BVC A;  1M94 A;  4I6P A;  3ZRC A;  1TY0 A;  2HTH A;  3VRB B;  1WGY A;  1XLQ A;  2KWU B;  4RH6 A;  4LDT D;  4EZK A;  3IT6 B;  3ZNG C;  1I7H A;  2KVZ A;  1YJ1 A;  4ZYN A;  3ML9 A;  5DPT A;  1H4R A;  1I4X A;  1KM7 A;  3AI5 A;  4ZHO A;  4HWI B;  3KUZ A;  1WF9 A;  4II3 B;  2DHZ A;  2RDB C;  1C9F A;  1WI0 A;  2BKR B;  2KTF A;  3KUC B;  4L1B A;  1RRB A;  2WXR A;  3DBR I;  2QHO A;  3RFZ B;  1KOT A;  2KDE B;  4K1R B;  3NS8 A;  1E7U A;  1TT5 B;  2M1M A;  1C4C A;  4WIP A;  1J19 A;  3ZXV A;  1TS4 A;  2N9K A;  4UDU C;  5IA7 A;  2HJ8 A;  3D32 A;  3E56 A;  2MWS B;  2HDE A;  2N7J A;  3HHM A;  5FR6 A;  2WQY B;  2AYO B;  1UBQ A;  1QKZ A;  1GC7 A;  2V3N A;  4C4V B;  5C23 A;  5IO9 A;  3B2F A;  2KD0 A;  4DXF A;  2JXX A;  2KJH B;  4S17 A;  4ZRJ A;  5KHO A;  1Z5S B;  2MQJ A;  2DLB A;  3U30 A;  4MJS B;  2I2Y A;  1SEB D;  1V1O A;  2BWF A;  3TBL D;  3VUW A;  4LLG M;  4JWS C;  2W9N A;  3ZTD A;  3ZYY X;  1HQR D;  2KX3 A;  4ANW A;  3HIZ A;  2PVO D;  4P6V F;  3ECI A;  2AL6 A;  2BS2 B;  2DEN B;  2KDB A;  1QLB B;  5GMV A;  4GB9 A;  2J52 A;  2LD9 A;  1C4P A;  1MJD A;  1P3Q U;  1F9J A;  2WWZ A;  1CZP A;  3ZGZ A;  1K8R B;  1NEK B;  1C77 A;  2ACZ B;  1QZE A;  3APD A;  2LRW A;  1TZ1 A;  5J18 A;  4MM3 B;  1PUT A;  1I35 A;  1VZ7 A;  1EO6 A;  2VRR B;  1NBF C;  1ET6 A;  1V5T A;  4A6Q A;  4ZRP A;  4EFO A;  3IAM 1;  4C7Y A;  5BMI A;  2TSS A;  2M4N A;  1PGA A;  1AAR A;  2LRU A;  2ZVO A;  3S2A A;  2IBI B;  3RD2 A;  2R61 A;  3T3N A;  5FKA C;  2EEL A;  3P4P B;  2ICI A;  3ZNI D;  4DHZ E;  2KWV B;  4GDL B;  4Q2J A;  3ZDT A;  3DHH C;  1YN3 A;  3ZLZ A;  1YJI A;  2K5P A;  5IKC M;  4XZ4 A;  5G5G A;  1WX8 A;  1NYR A;  1BML C;  5CHF A;  1ZE3 D;  3AEC B;  3JVZ X;  2NS5 A;  2CHW A;  3QCA A;  3IAS 1;  3URY A;  4TKN A;  1P98 A;  3IFW B;  3AE4 B;  1SGH A;  3AEG B;  2KQS A;  3TEX A;  1EF5 A;  3PRM B;  3RMK C;  4LJO B;  1RLF A;  4NJ6 A;  5TSS A;  3NUH B;  2WU5 B;  1QOG A;  1V2Y A;  2MEK A;  1L5P A;  3PZ8 A;  1IGD A;  3PZ7 A;  1FIQ A;  3PRP B;  2IO2 B;  1LO5 D;  1LXD A;  2IZV B;  2OJW A;  2UWQ A;  5LNK 1;  5AEK B;  1I4G A;  1IBX A;  4FLH A;  1UWM A;  2KK8 A;  4YXD B;  1C78 A;  3ZNZ B;  3DDC B;  5BO4 B;  3A1Q B;  2IY1 B;  2W82 A;  1CMX B;  4KX6 B;  1WXA A;  2MBH A;  4BKS A;  3PRE A;  4E74 A;  4S0R A;  1DYQ A;  4HEA 1;  4YSY B;  3FC4 A;  1G6J A;  4NJC A;  5EE0 A;  5KHQ A;  3BK2 A;  4JPS A;  2JWU A;  3UIP B;  1OQY A;  3WCQ A;  4HCP B;  4RMA A;  3WA0 A;  3QX1 A;  2B3A A;  3H7P B;  3RNG C;  2GBK A;  4MH8 A;  3HM6 X;  3RNB C;  3VUX A;  2Z59 B;  1T3Q A;  4BOS C;  2CJO A;  4G3X B;  3MHS D;  5AZF A;  2ZVN A;  5BMH A;  3CST A;  5E6P A;  4XC2 A;  4DHZ B;  4MGI E;  3BWU D;  4GOC A;  3LYY A;  2UU7 A;  4HRS A;  1WH3 A;  2GBM A;  3P4S B;  2M56 B;  1R4M B;  4FAD A;  4F8C B;  2W3R A;  5IOI A;  4US8 A;  1WXV A;  2FCM A;  3ZUN A;  1T6B X;  4QAY A;  1WJU A;  3AE5 B;  1KFY B;  4EZJ A;  3PPA A;  4DDG D;  1L0X B;  3DPD A;  3QAQ A;  3OJ4 B;  5CHV C;  1WYG A;  1V80 A;  3KYD D;  2LHE A;  1TKY A;  2AWT A;  1XD3 B;  3KW5 B;  4EE2 A;  1PQS A;  2WS3 B;  3KQ4 A;  1TJE A;  3DWG C;  4KZC A;  1ISN A;  2PPH A;  3W5U B;  4AP4 C;  4PYU A;  3WAL A;  1PYW D;  1UGJ A;  1FCC C;  2FIF A;  3FAH A;  2N0S B;  2K0P A;  3I63 C;  4JWU C;  3A9J B;  3MJ5 A;  1LFD A;  1XCQ L;  2MSE D;  1M4V A;  3KUD B;  4C56 C;  2KLC A;  2QIE B;  2WXJ A;  1HEZ E;  1KF6 B;  2X8X X;  3N1X C;  2IYD B;  1N5W A;  3PRZ A;  1Q10 A;  2A5U A;  3BY4 B;  1C1Y B;  2NMQ A;  2LGY A;  3BK1 A;  2LI5 A;  1J7A A;  2JRI B;  1QIL A;  2OOB B;  1V1P A;  2KJ6 A;  2FAZ A;  1WE6 A;  4YL8 A;  3DBH I;  3U7D A;  5BYQ A;  3VHT C;  1JWA D; 
#chains in the Genus database with same CATH homology
 3AEB B;  1J7B A;  1MPE A;  3T3O A;  2WXG A;  1VDV A;  1SSN A;  2ZW0 A;  1C79 A;  2BYT A;  3P1M A;  4MT5 A;  2SEB D;  2DWQ A;  4TQ0 A;  2W3S A;  2XN9 C;  4O1N A;  4D2K A;  1GB1 A;  1E0Z A;  1UUP A;  1ZDV A;  1NEN B;  4WUR A;  1L6U A;  1QOA A;  4NZL B;  3AEE B;  2G1E A;  3FIL B;  3NZ3 A;  3SFD B;  3SFE B;  1OQQ A;  3R8B A;  1P7E A;  5HFY A;  2LHD A;  1VZ6 A;  3B9J A;  2BS4 B;  1K51 A;  1YQ4 B;  4HJG E;  1WGK A;  1IUE A;  4YTN B;  1L4Z B;  2WDV B;  2J42 A;  4RCO A;  1F0Z A;  3VR9 B;  2BTE A;  1FRR A;  1MHX A;  5MPO A;  5H8Y E;  2G9H D;  4YTM B;  4KGR A;  1XLN A;  4M0W A;  1TS3 A;  2LFI A;  2J53 A;  1KRH A;  4B0E A;  3O13 A;  1KTK A;  2MH7 A;  1HZ6 A;  4H2A A;  3Q69 A;  2QMT A;  2PKO A;  1Y56 A;  4HKQ A;  2JU6 X;  4A90 A;  3Q8C A;  4L23 A;  2E3T A;  2AQ3 B;  3ABV B;  1P7F A;  5EE1 A;  1EU3 A;  3Q8B A;  3I9V 1;  1YQ3 B;  1FNV A;  4JX1 C;  3U4E G;  1OFF A;  3NVW A;  3U2S C;  2HTM E;  2BS3 B;  3OWE B;  1K52 A;  3W1S A;  3AED B;  2WXK A;  1TY0 A;  2LGI A;  3VRB B;  1GPX A;  1HXY D;  1XLQ A;  4RH6 A;  1D5M C;  2V3P A;  3IT6 B;  1I7H A;  5D3I B;  2LMC A;  2CU3 A;  1ROE A;  2WXF A;  4REZ A;  5BYR A;  3AV8 A;  4KKJ A;  1CK1 A;  4NAM A;  1JWU D;  1I4X A;  4GDK B;  4USA A;  1I4Q A;  4ZHO A;  4OW0 A;  3AH7 A;  3U52 E;  1L4D B;  1E9M A;  3ZQ4 A;  2WXQ A;  1C9F A;  2V0G A;  2CJN A;  3BYY B;  1RFK A;  1IBX B;  1J7C A;  2KDM A;  4L1B A;  1AWD A;  2WXR A;  1B9R A;  3RFZ B;  3NVZ A;  1CQV A;  3U7Z A;  4NAW B;  5E6J A;  1YN4 A;  2FUG 1;  4KGS A;  1C4C A;  4WIP A;  3IXS A;  2Q5W D;  1PFD A;  2ON8 A;  4RF1 A;  3DWM A;  4YTP B;  1TS4 A;  2INP E;  2N9K A;  4UDU C;  3L4P A;  4ZRQ A;  1ESF A;  1TKE A;  2GB1 A;  3AE1 B;  5I4D A;  1SJH D;  2XNA C;  3E56 A;  2HDE A;  2N7J A;  2KN4 A;  3C8Y A;  2WQY B;  2ONQ A;  1QKZ A;  1ACC A;  2V3N A;  3BII D;  1STE A;  1ZOY B;  5C2T B;  3B2F A;  3AEF B;  4DXF A;  3AEA B;  5GXG B;  3AB5 A;  1PGX A;  2Y3A A;  1NYQ A;  3PO0 A;  2K22 A;  3UI3 A;  2RDH A;  1JW9 D;  4RGM A;  1DOY A;  2DLB A;  2H89 B;  1SBB B;  3AM9 A;  2I2Y A;  1ZXI A;  1SEB D;  1V1O A;  1ZXH A;  3LXF A;  1N60 A;  3P4R B;  3MFG A;  1C4A A;  4WH4 A;  2L83 A;  4JWS C;  4LLG M;  1ZPS A;  4GLS C;  3ZYY X;  1HQR D;  1L0Y B;  1RM6 C;  2W54 A;  2PVO D;  2IGD A;  1WWT A;  3ZJV A;  4P6V F;  2BS2 B;  1E7P B;  1QLB B;  3MP9 A;  4RGO S;  1JCK B;  1FNW A;  1FXI A;  4YT0 B;  2J52 A;  2RDG A;  1C4P A;  3Q8E A;  4XDD A;  1QT9 A;  1WXQ A;  4WWM A;  3VQI A;  3E9S A;  1CZP A;  3HVZ A;  2AQ2 B;  3CIR B;  3ZGZ A;  4YSZ B;  3AE9 B;  3BVZ A;  3NRZ A;  3KWV A;  1EU4 A;  4OVZ A;  1XXG A;  4N6E B;  1NEK B;  1C77 A;  2ACZ B;  2WXN A;  4C7Z A;  1SF0 A;  1JML A;  4OHJ A;  2WNM A;  4IKG A;  1A70 A;  4MM3 B;  1PUT A;  1WSP A;  2KQ4 X;  2QSD A;  5HG2 A;  3FIL A;  2JXT A;  2WXO A;  3ZJT A;  1C76 A;  2NTS A;  3TEZ A;  3P4Q B;  2MJ3 A;  1VZ7 A;  1JRO A;  1ET6 A;  1EWC A;  2DBY A;  2PVG C;  4ITK A;  2LJI A;  4A6Q A;  4ARC A;  2BB6 A;  4ZRP A;  2LEK A;  4YWG G;  2L32 A;  3IAM 1;  4C7Y A;  5BMI A;  2TSS A;  4OZA A;  1PGA A;  3AE2 B;  3I57 A;  1N61 A;  1VRA B;  2L52 A;  1ENF A;  1FRD A;  2N9L A;  1XLP A;  3TEW A;  2R61 A;  1YMH E;  1BUI C;  2MJD A;  3KLS X;  3W5V B;  4A55 A;  3T3N A;  5FKA C;  3H8H A;  1TKG A;  3W2D A;  4XE0 A;  5G5H A;  2EEL A;  3P4P B;  5JXV A;  2ICI A;  1SE2 A;  1XEE A;  5FK9 C;  3AE3 B;  1SE4 A;  2QEJ C;  2FE8 A;  1GOZ A;  3W9C B;  2JYE A;  3P63 A;  3Q8A A;  4GDL B;  3SEB A;  4YSX B;  4OZB A;  4Q2J A;  2YEP B;  1UWX A;  1EWY C;  2VZK D;  2RPV A;  3B2G A;  1I4H A;  2WP9 B;  3MHZ A;  1YN3 A;  3MC0 B;  1YJI A;  2K5P A;  2WXH A;  4JE3 B;  5G5G A;  1BXT A;  4A9A A;  3BVG A;  3TUO A;  1NVI D;  2B76 B;  1FM0 D;  1NYR A;  1BML C;  2SAK A;  2X38 A;  1JAL A;  2IGG A;  1N5X A;  1ZE3 D;  4ZHP A;  3AEC B;  1AW7 A;  1RWS A;  4WAF A;  3IAS 1;  3URY A;  3VRA B;  3HUI A;  4XWW A;  4C80 A;  1JWM D;  1QOF A;  1EM7 A;  2EKI A;  1ZUD 2;  2M0A A;  3AE4 B;  2GI9 A;  3AEG B;  1AN8 A;  2PW9 A;  1AYF A;  4RGN A;  1SIJ A;  3TEX A;  4N58 A;  1MHH E;  2DYO A;  5TSS A;  1PDX A;  3NUH B;  2WU5 B;  2E6X A;  3EGR A;  4HRO A;  1QOG A;  1ZP0 B;  1KLG D;  2PMV A;  2JQR B;  2JZP A;  2GRI A;  3NVY A;  1L6V A;  2MEK A;  1L5P A;  1SE3 A;  3PZ8 A;  2AX5 A;  1IGD A;  3PZ7 A;  1YJJ A;  2MJE A;  3P42 A;  2KAJ A;  1FIQ A;  4AQ7 A;  2BB5 A;  4RNA A;  1FO4 A;  2Y5P A;  1LO5 D;  2IJ0 A;  1JWB D;  2WXL A;  3EUB 2;  2M19 A;  3BVM A;  4OZC A;  5LNK 1;  5EE9 A;  1TYG B;  1I4G A;  4RF0 A;  1IBX A;  4RFB A;  4XDC A;  3ZJU A;  2PLP A;  1MI0 A;  2K3U A;  2PTL A;  1UWM A;  3CWI A;  2BW2 A;  3HVD A;  5HI1 A;  3GP7 A;  4YXD B;  1ZDX A;  1C78 A;  2WU2 B;  1D6E C;  1YN5 A;  1QOB A;  1F2R I;  4L2Y A;  2QIL A;  2WXM A;  4MAC A;  2DYM A;  2W82 A;  4KX6 B;  1VJK A;  1QQR A;  1XCT L;  1DYQ A;  3BZD B;  4HEA 1;  4YSY B;  3KWL A;  3FC4 A;  3GS2 A;  4DXG A;  2ZW1 A;  5H92 C;  4NJC A;  5EE0 A;  3SR6 A;  3BK2 A;  3NVV A;  4JPS A;  1QF6 A;  2JWU A;  2Z8L A;  4DQO C;  3WCQ A;  5D3D A;  4N59 A;  4ZYS A;  5AUK A;  1GB4 A;  1TS5 A;  4MH8 A;  1L0V B;  2YEP F;  4WQM A;  1T3Q A;  4LK0 M;  3V05 A;  2WLB A;  1FCL A;  2CJO A;  2H88 B;  1MVK A;  1UNS A;  1JWS D;  3GB1 A;  5BMH A;  2VZK B;  4A8X C;  1XLO A;  3AE7 B;  1DGJ A;  3BWU D;  1FD6 A;  3LYY A;  4HRS A;  4RGT A;  2OHF A;  1T5X D;  3P4S B;  2M56 B;  1F77 A;  5C3J B;  5T8I A;  1PGB A;  1V97 A;  5EE3 A;  2W3R A;  1HZ5 A;  4US8 A;  1DOX A;  3R2T A;  3V3X A;  1T6B X;  3IT4 B;  1IGC A;  4IDI A;  1FMA D;  1KFY B;  1D5X C;  3AE5 B;  3BYT B;  3RPF C;  3TSS A;  3ETR A;  1L0X B;  3HRD D;  1OQR A;  1FFV A;  1SJE D;  1WYG A;  1KH0 A;  2IDY A;  2D5G A;  1VZ8 A;  2LHE A;  1TKY A;  2KAC A;  1SB3 C;  2WXP A;  2JYT A;  5BMG A;  1D5Z C;  1N63 A;  1YNT E;  1I4P A;  4J3O D;  2PIA A;  4EE2 A;  1GAQ B;  4P16 A;  1D4B A;  1E10 A;  4KGT A;  2WS3 B;  3VR8 B;  3J9C A;  2J4X A;  2L1A A;  1VR9 A;  3KQ4 A;  4XWT A;  1XO3 A;  3Q8F A;  4TQ1 A;  2NTT A;  1TJE A;  2LUM A;  1F2R C;  3DWG C;  1KLU D;  4FXC A;  2W55 A;  2BBC A;  4R3D A;  5AUI A;  3W5U B;  2FBW B;  1JRP A;  1TS2 A;  1FFU A;  3EA6 A;  4US9 A;  1FXA A;  3AN1 A;  2Y5C A;  1V1P B;  1V8C A;  3AE8 B;  1N62 A;  1PYW D;  1TY2 A;  1FCC C;  1UGJ A;  3FAH A;  1B1Z A;  2N0S B;  2K0P A;  2V4I B;  3LB8 C;  4JWU C;  1WRI A;  2OED A;  5D7G A;  4B0M A;  1HA5 A;  1R7S A;  3N9Y C;  3MJ5 A;  4KKI A;  1XCQ L;  4HKZ E;  1M4V A;  4TMA B;  5BYS A;  1RYJ A;  2JSV X;  2QJL A;  4C56 C;  2QIE B;  3TEY A;  2KWD A;  2WXJ A;  1HEZ E;  1KF6 B;  2WDQ B;  1SXT A;  4TSS A;  4ZOH C;  1VLB A;  1N5W A;  2WDR B;  1I4R A;  1XF5 L;  1TZO A;  1CJE A;  1Q10 A;  2I38 A;  2K9X A;  4IOI E;  5FR3 A;  1DOI A;  4AS1 A;  2NMQ A;  2BT6 A;  1JQ4 A;  4ARI A;  1ET9 A;  5HHD G;  2JX5 A;  1FEH A;  3BK1 A;  1J7A A;  2INN E;  2KMM A;  3NS1 A;  1QIL A;  4PT5 A;  3R2I A;  2WXI A;  1V1P A;  2IGH A;  1FNU A;  3AMZ A;  4LTU A;  1K50 A;  3AE6 B;  1NI3 A;  2IPK D;  1E6E B;  4CQN A;  2AQ1 B;  5BYQ A;  2RMM A;  1JWA D;  1K53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...