1RYJA

Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
b'MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown
publication title AN NMR APPROACH TO STRUCTURAL PROTEOMICS
pubmed doi rcsb
source organism Methanothermococcus thermolithotrophicus
molecule tags Structural genomics, unknown function
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ryjA00
3P1MA 3NRZA 3AEFB 2M19A 1JQ4A 1OQQA 4ZHPA 3PO0A 1ZOYB 4JWSC 3RPFC 1E9MA 1KF6B 1TKGA 3AE3B 2QJLA 4P6VF 1PFDA 1SF0A 1JALA 1FRRA 2L83A 1VDVA 2WDQB 3VRBB 1DOXA 3P4PB 4ITKA 5EE1A 5G5HA 1GAQB 1N60A 2W55A 3FAHA 1V8CA 3DWGC 1WGKA 3WCQA 2PVOD 3AH7A 2MH7A 4YSXB 1N61A 1NI3A 1QOFA 1VJKA 2WU2B 3AEGB 2E3TA 1RWSA 1DOYA 1E7PB 2EKIA 1XLOA 2K9XA 3HVZA 1JW9D 3P63A 1FO4A 1R7SA 1TKYA 1RYJA 1XLQA 5G5GA 2Q5WD 3LB8C 2WDRB 3AE1B 3ETRA 1AWDA 2AX5A 3AB5A 4YSYB 1QLBB 4WWMA 1TKEA 2HTME 1PUTA 1SIJA 5EE9A 1JROA 2WP9B 1QF6A 3NVWA 4YTPB 2N0SB 2H89B 3CWIA 4US8A 1ZUD2 2BS2B 3P4RB 3AN1A 4LTUA 1NYRA 1OFFA 2CJOA 2WDVB 3AEDB 1DOIA 1DGJA 3AE4B 1QOAA 2CJNA 3NS1A 2BT6A 4YXDB 3AE9B 3AEEB 3AECB 1E0ZA 3AEAB 3B2GA 5C2TB 3AM9A 2WS3B 3FC4A 4JWUC 4N6EB 2JQRB 2Y5CA 1QOBA 1WWTA 1J7BA 2M56B 1QT9A 1UWMA 2PVGC 2W3RA 1FFVA 4YTNB 4JX1C 1I7HA 4N58A 1GPXA 1VLBA 1CJEA 2CU3A 2PIAA 1ZP0B 1QOGA 4ZOHC 4C7YA 3CIRB 1JRPA 2DWQA 2WU5B 5AUIA 2PKOA 3B2FA 4YSZB 4KX6B 3DWMA 3BIID 2H88B 2OHFA 2ACZB 3B9JA 2LEKA 3AE5B 4FXCA 4IDIA 5H8YE 3W5UB 2MJ3A 4HROA 1RM6C 1B9RA 2MJEA 1A70A 1E10A 1N63A 2W54A 4C80A 1WYGA 3ABVB 3P4SB 1YJIA 2MJDA 4YTMB 1N5WA 3SFEB 3AV8A 4USAA 3ZYYX 4US9A 1XO3A 4YT0B 5C3JB 3NVZA 1FIQA 1NVID 1WXQA 3AE2B 3EUB2 1YQ4B 1E6EB 1NYQA 3AE7B 3AEBB 1FM0D 1V97A 1IUEA 3HRDD 1CZPA 3P4QB 1EWYC 1FFUA 3VR9B 3AE8B 4A9AA 3SFDB 5GXGB 3VRAB 5AUKA 1F0ZA 1L0VB 1AYFA 2DBYA 1YJJA 3W5VB 1KRHA 3KWLA 1ROEA 2B76B 2BS3B 1L6VA 1XLPA 1YQ3B 2WQYB 4C7ZA 3HUIA 5EE3A 1L5PA 1FMAD 1OQRA 2K22A 2FBWB 2KAJA 1NENB 2JX5A 2K5PA 1TJEA 1N62A 3VR8B 1JWAD 1PDXA 2L52A 4WQMA 3SR6A 5MPOA 2KMMA 3NVYA 1RFKA 2BS4B 1J7CA 4ZHOA 1FXAA 3AE6B 1JWBD 2QIEB 3L4PA 4HRSA 4N59A 5EE0A 3W9CB 1KFYB 3NVVA 1J7AA 1NEKB 2G1EA 1T3QA 1SB3C 1TYGB 1N5XA 1WRIA 3AMZA 1ZXIA 2WLBA 2W3SA 5H92C 3LXFA 1L6UA 1FXIA 1FRDA 1XLNA
chains in the Genus database with same CATH superfamily
2WXGA 3A4SC 3L10B 3TIXA 2AQ2B 2D10A 2KWUB 4FHJA 1WH3A 1J8CA 2VZKD 2AQ3B 4I6PA 3IBEA 4NY0A 1I4GA 2K8BA 3WCQA 5CHVC 2JYTA 1QOFA 4DHZE 1DOYA 3WAMA 1ISNA 1SJED 3P63A 4YSYB 4EEWA 2QMTA 1SE9A 4BBNC 2HTME 2C7NB 3RMKC 1JROA 3T3NA 1ET6A 2M0AA 2I2YA 4BVUC 3M95A 3ML8A 2BYEA 1YX6B 2RDBC 1RRBA 3NOBA 1QILA 2B3AA 5L95C 4CYEA 2PW9A 2KZRA 5IN7A 5GMVA 3I63C 1CJEA 2K8CA 1Z2MA 5CHWA 1PGBA 2HJ1A 1I4QA 4FXCA 1P7EA 2MLBA 3ZDTA 2ACZB 2ONQA 2K8HA 2O2VB 5H8YE 4ZRQA 3QIJA 4WQOB 4CO7A 4YTMB 3CSFA 1EWCA 4USAA 2IY0B 4ZRIA 3KW5B 1FXTB 2JF5A 3ZJTA 1AW7A 2ZVOA 1F0ZA 1CQVA 3D32A 3WAOA 1L6VA 4BKGA 1WZ3A 2C9WB 1NDDA 4TV3A 3APFA 1J7AA 1N5XA 2N9EB 1MHHE 1N6ZA 1ZDVA 1FRDA 1V9JA 4XGAB 1XCQL 4FJYA 4YWGG 4J6IA 4IW0A 2KN5A 3UINB 1HXYD 1P1AA 2WDQB 2MQJA 4KDLB 2PLPA 4ZYNA 4NZLB 4BKSD 1R4NB 1HZ6A 1P7FA 4W9KA 3KUZA 3PS6A 3S2AA 3NG0A 3AXCA 3N1YC 4ICUA 4KDIC 2L05A 1IGDA 4RCOA 3IXSA 1SBBB 1YX5B 1I4PA 2Z0EB 1J7BA 4N58A 1EF1A 4W9FA 5JHAA 3AU5A 4YSZB 1T5XD 3DWMA 1D3ZA 3V61A 3KQ4A 4JIOU 1NI2A 3PZ8A 4I6LB 3IT6B 4KIKA 2WDTB 4GB9A 3L0WB 3U4EG 3NZ3A 2JPHA 3ZYYX 3VFKA 1BT0A 4P7IA 1AARA 2Y5BB 3ML9A 1IGCA 1TS4A 1D5XC 1EM7A 3AE8B 3VRAB 5AUKA 1AYFA 4DXAB 4NAWA 2J0JA 4W9IA 2WQYB 1XF5L 3ECIA 2KHWB 2EMTA 1FMAD 3VR8B 3N20C 3Q3MC 2IZVB 1WR1A 3A4RA 3GE8C 2AEHA 4NQLB 3TEYA 2V0GA 3RI7C 4ZOHC 3PO0A 5JH5C 3A9JA 4PK1A 1P3QU 3LJ3A 4BKSA 4E3CA 5BYSA 1VCBA 5EE1A 4XWTA 4DWFA 1N60A 1WR6E 3ZLZA 1WMHA 5T8IA 3GZNI 4WWOA 5HI1A 2W82A 1WE6A 4MACA 3UGBB 3MJWA 2KWVB 4RM9A 1XLQA 3TUOA 3AE1B 3NHEB 2TSSA 3PPAA 5TSSA 4GDLA 2C7MB 1YMHE 2LI5A 1C78A 1UBQA 3FILA 3DPDA 1YN5A 4MH0E 1E0ZA 4A55A 4GMVA 4ACFA 3MP9A 2K0PA 1UWMA 2UYZB 2REXA 4M0WA 3PGEA 3PLVA 1YN3A 2DWQA 2BYVE 2JZZA 3AE5B 2J42A 3Q3JA 2LJ5A 1EU3A 3NZSA 3QWZB 4HXDA 4HJKA 2X38A 4KSKC 2LXCA 4X57B 1XO3A 4M02A 3VRBB 1FM0D 1HE8A 1V97A 3AULA 3PHXB 1J19A 4CHKA 4IC7B 3RNCC 1G6JA 2N9KA 1E5WA 1R4NI 3VUYA 2KJ6A 3JSVA 4C7ZA 3DVNV 4B6WA 2K6QA 1NENB 4II3B 3CSTA 1MJDA 2DZMA 3NVYA 4LNOA 4NJ7A 2BS4B 3APDA 1FXAA 2V4IB 3PVLA 2QHOA 1V81A 2MBBB 4M8NA 2VH2A 2KK8A 3A1QB 1XLNA 4A3PA 1TY0A 1DYQA 1SJHD 4OZAA 1I35A 2LFIA 3PT2B 2DAFA 1E9MA 1V5TA 1UGMA 2XK5A 1XD3B 2L83A 3SD5A 4F8CB 1VDVA 3BYYB 3H8HA 3P4PB 3HIZA 3T3OA 2KLGA 3TCAA 2L1AA 1CK1A 4MELA 4HCNB 4F1SA 3HVZA 4ICVA 2AYOB 1LO5D 1GB1A 2RDHA 2KKCA 4RGMA 2CHXA 1ZPSA 2C7HA 1QF6A 1I42A 2BS2B 3AN1A 3RULA 2CJOA 4PS8A 1DGJA 4WJPA 5JXVA 2MEKA 3IG3A 1V1OA 3AM9A 1F77A 3MFGA 4WJOA 4IKGA 2I38A 3ALBA 3LDZE 1YJ1A 2XNAC 1GB4A 3CIRB 3AU4A 4RF1A 3T9LA 2E6XA 2HDEA 4W9CA 4K81A 2LRUA 2RSUA 1RM6C 5LLIA 4IOIE 2W54A 4L23A 1F52A 4XWWA 1KLVA 3R8BA 2YLMA 4A9AA 4HK2A 5C1ZA 4EKUA 1S1QB 4IWOA 1IBXA 3IT4B 2ZPYA 4W9JA 5EE3A 2N7JA 2KAJA 5IA7A 2IPKD 5D3DA 3U8ZA 3WIMA 1E7UA 2SAKA 4ZRKA 3MC8A 4HCPB 1WF9A 1AN8A 2G4DB 3DBHB 4M01A 2ZNVB 4XE0A 4FA6A 1TBEA 1WI0A 3AEFB 1KJTA 4ZHPA 4TQ0A 2KQ4X 2BVCA 2ICIA 2Z59B 3QJZA 4OZBA 4WH4A 2R2QA 4P6VF 2LUEA 2ZZPB 4RM8A 2L7RA 5G5HA 4BBNF 4E71A 5BMGA 2MH7A 2VRRB 1VJKA 3ZJUA 3H6NA 3N1XC 2V1YA 2N9PC 1JRUA 3EECA 4II2B 1ESFA 1V80A 2K6DB 3AB5A 2KVRA 4FJVB 2O6VB 1WXSA 1K51A 2JT4B 1I4HA 2M4NA 5D94A 3L54A 3NS1A 3AECB 4I6NB 3AEAB 3N9YC 2BB5A 2YEPB 2FIDA 2GBMA 1Q5WB 1E7VA 3IVFA 2KC2A 2KJRA 1GOZA 3B1LX 1TTNA 2JWUA 2KFKA 4FN2A 4HKZE 5E6NA 1JRPA 4EFOA 1TS3A 3BIID 2LEKA 2LZ6A 3V60A 2MJDA 2LGDA 3X23A 3DBRB 4BAXA 2WXIA 3WA0A 2LHEA 3AE2B 3BK1A 3AEBB 1C1YB 3P2BA 3OWEB 5KHOA 1KRHA 2KTRB 4AS1A 2V4LA 3TBLD 2LWPA 4PS3A 2FBWB 1FNVA 4WAFA 2LASA 1RFKA 2EELA 3GS2A 1TIFA 4HPLB 5DPWA 3DCGA 3JYUA 2C5LC 1IP9A 2AL3A 1ZGUB 2BW2A 2M19A 2JRHA 2JWZA 1M4VA 4C4VB 4D2KA 4JWSC 3DBSA 4H2AA 3A33B 3Q8FA 2WXNA 1GAQB 2W55A 2ZW0A 4K7UA 1N61A 4GSWA 3Q3FA 4NAMA 2GBJA 2BB6A 1FO4A 1TKYA 2GRIA 3IAM1 4G3XB 2WDRB 2XBBC 2DYOA 1E8XA 2WXKA 2MW5A 4EZKA 2WXHA 1Y56A 3VH4B 1V86A 2CR5A 3DOWA 1B1ZA 4G11A 1TY2A 1QOAA 4WWNA 4B9KA 2PTLA 3U2SC 3UQBA 3VQIA 1VR9A 5FR6A 5E6OA 2L76A 2MHJA 2RPVA 4URKA 4YTNB 1I7HA 1WY8A 1UD7A 1ZDXA 1QOGA 3B08A 2WX0A 3BYTB 3DBHI 3EC8A 5IO9A 3VTVA 4KKJA 2OHFA 3Q14C 3EHVA 1T6BX 1A70A 1UGJA 1WGHA 3P4SB 2N7DA 4L1BA 3NVZA 1WXQA 1C4CA 4MM3B 5IOIA 1ZXHA 4BOSC 4GDKA 2DBYA 1WX8A 1WGRA 5G2NA 4GN1A 4MJSA 1OQRA 2N7EA 2D2QA 5D3IB 4FADA 3DBLI 2QSDA 3GZNB 4HWIB 2M0XA 4XZ4A 3RNBC 1MHXA 4IWPA 4MGIE 4ZRJA 1TYGB 3AMZA 1ENFA 1Z5SB 3QHTA 1PGAA 3V6EB 2GLSA 5DPSA 4LJOB 2WXMA 1LFDA 3OG5A 3ZRFA 4BOZB 4G50A 2Y5PA 2XEWA 3AE3B 1PFDA 2GB1A 5AEKB 4NJ6A 3K9PB 4ITKA 1SEBD 1ET9A 3L17A 3QARA 4AJWA 2M17A 3DBRI 2V3PA 2NPTA 2ZJDA 2LD9A 4JE3B 4KKIA 5FKAC 4EZJA 1TS5A 1L4DB 1WXMA 1SIJA 2ASQA 3VTWA 5BYRA 1HTOA 1NBFC 3H7PB 1UH6A 2PEAA 4NJCA 4MGZE 2IDYA 2WS3B 4A6QA 5LXHA 2Y5CA 3X0WA 3NZUA 5D2MB 1WJ6A 2WU5B 2ZEQA 3SDLC 3B2FA 2HE7A 5HKHA 3B9JA 5BYQA 2ZPNA 3OAWA 4ZRPA 3W1SC 5FK9C 4LLGM 2J0MA 2KN4A 2MX2A 1C4PA 2IY1B 3VUXA 5AZGA 4O1NA 4LNIA 2FCMA 3SFDB 1YN4A 2MRPA 3QC8B 3ENEA 2QCZA 2KDMA 2NBWB 2KWDA 3PRPB 2N9XA 2KMMA 2JXTA 3BY4B 4BKTA 3UQAA 5LXIB 3Q3OC 5BMHA 4W9HA 2LGIA 2RR9A 1F2RI 1WSPA 1ZOYB 4HPMB 3N32A 2MBQA 2OOBB 3HHMA 1UBIA 2QJLA 3URYA 4RGOS 3Q8EA 1KTKA 2FUHB 3KH0A 1MG4A 3AH7A 2DYMA 2MBEA 3ZW3A 2J4XA 1RYJA 2G4SA 2O2VA 1SIFA 2ZCBA 1TKEA 3IFWB 2MA9B 2WP9B 4C56C 3P4RB 1OFFA 1SXTA 3ZTDA 3KYDD 1QKZA 1ZKHA 3Q69A 5KHQA 2JQRB 1I4RA 1WWTA 4OVUA 4DBGA 1E8ZA 1T0QC 1UZXB 2UWQA 3KYCD 3ZXVA 1GG3A 3ZJVA 3RZWC 4GIVA 4C7YA 2ZCCA 3N1ZC 2JRIB 3SFEB 2LGSA 1P98A 2WXFA 4JPSA 2DZJA 3PHWB 1NVID 2WXJA 3AE7B 3P4QB 4K7WA 2IBIB 1L0VB 1Q0WB 3I5JC 2M1MA 3I57A 1JCKB 2L52A 1F2RC 2JXXA 2WHIA 1K8RB 3W9CB 1D6EC 4FULA 4LNKA 1WRIA 3ONSA 4LJPB 1E8WA 2NTTA 5H92C 3VXWA 5G5GA 1V2YA 2D11A 3ZQ4A 1UUPA 1TZOA 2BGFA 1WX9A 3VAWA 4P1CC 1JALA 3HVDA 2R61A 3FAHA 3DWGC 2JSVX 1V1PB 1VZ8A 3PREA 1VZ6A 1MFWA 1XLOA 4ZDVA 5TR5A 3R66C 1MVKA 1L0XB 1BUIC 2MCNB 2K1FA 3R7RA 3RT3B 1V5OA 4LTUA 2JZPA 4A90A 1RLFA 5BO4B 4F7ZA 2CHWA 4MSMB 1U4AA 3T8MA 4XDCA 4AQ7A 3CF6E 4RGNA 1KOTA 1ZP0B 3I9V1 4LDTB 2LVOA 2L3ZA 3KVFB 2J52A 5BMIA 2KWCA 4WIPA 1OEYA 2A5UA 2WXLA 2AWTA 2WYQA 3NUHB 3PV1A 2DHZA 4HDOA 1WGYA 2PMVA 3BINA 5CTRC 3ABVB 1OGWA 1N5WA 3AV8A 3VUWA 1YQ4B 2GMIC 1WM3A 4KZCA 1IUEA 2IGHA 4CQNA 1UNSA 2D5GA 1F9JA 1JMLA 2OJWA 1YJJA 4FBJB 4W9GA 2KXJA 1OTRB 1FNUA 3UI3A 3E56A 4M00A 3RYTA 1E8YA 2K22A 1C3TA 2KT7A 4FLHA 2J7QB 3L4PA 2ON8A 1J0GA 2NBVB 3Q3NC 1XCTL 1SB3C 1T3QA 2G1EA 4KV2A 4HLEA 2NBUA 3RD2A 3VTUA 1GC7A 1MPEA 2SEBD 4LDTD 4DK5A 2A4ZA 3PTFC 4K3BA 2KACA 2GBNA 1FRRA 2QDFA 3R3MA 2FCSA 2MP2B 3BWUD 3M62B 2J0KA 3AEGB 4DXGA 3HM3A 1RWSA 3VDZA 2EKIA 2WX1A 4KGTA 1HQRD 1QZEA 3V6CB 1BXTA 5HG2A 2CKHB 3RUIB 1PUTA 2IO2B 2DX5B 2DYBA 1FCCC 2JUOA 2IO3B 2LRWA 4LNNA 4BZAA 4NQKE 3B2GA 3W1YA 3TEXA 4WWPA 1KLUD 1KLGD 4JQWC 3L08A 3N30A 2M56B 4YL8A 3H1UA 1A5RA 1VLBA 3RNAC 3M3JA 3MC9A 1T0SC 2UU7A 2FUG1 2OEDA 4KX6B 3DBLB 3PZ7A 3VVWB 3IAS1 1RFAA 2D3GA 3A1QA 1E90A 1K50A 2DLBA 4DQOC 2QEJC 4US9A 5C3JB 2KO3A 2KYWA 2LUMA 1C76A 2M8SA 4GXBA 1C9FA 2KDIA 3VH3B 1JWSD 2INDC 3W5VB 3ZVVA 3B0AA 2BF8B 1XLPA 1ZE3D 2YVCA 3PRZA 2INCC 1KH0A 1GNUA 2IO0B 2KOXA 4B0MA 2K39A 1FEHA 1VRAB 4IM2A 4ANWA 1NEKB 3ZIMA 4KGRA 2V3SA 3NRZA 2BPSA 4WJNA 2KDFB 2WXOA 4S17A 2O6VD 5I4DA 3EGRA 1GUAB 1P0RA 3DVNU 1YQBA 3L13A 2WU2B 4HPPA 1KM7A 4KZ0A 1WIAA 1H4RA 2Z0DB 2HJ8A 3K9OB 1XT9B 4WWMA 5EE9A 1WE7A 4RMAA 4RNAA 2ZW1A 4YXDB 3AE9B 3TJPA 2BKRB 3ZGZA 5C2TB 4TMAB 4N6EB 2GOWA 1L0YB 4TKNA 3SHQA 1FFVA 4DHJB 2Y3AA 4Q2JA 2PJHA 1Y8RC 3FKYA 1HEZE 2LGYA 4IG7B 1LXDA 2GBRA 4DHZB 3DQVA 1SGHA 3DHGC 1PYWD 2H88B 4IDIA 2FE8A 4HROA 3GP7A 2IGGA 2WXPA 1YJIA 2YEPF 2JYEA 1M94A 5LNK1 1IYFA 5AZHA 2D3AA 4MGYE 2R2OA 1UF0A 3H7SA 2EKEC 2XN9C 2LJIA 1R4MI 1LM8B 3DVGX 4OW0A 1V6EA 2MBOA 2JZ3B 3ZNHB 1PDXA 3SR6A 2HD5B 3W1SA 1J7CA 1JWBD 1WJNA 4HRSA 2O6VA 1KFYB 3NVVA 1D5ZC 2MWSB 3V62A 2JU6X 3LXFA 4KIKB 2ZVNA 3HUIA 1Q1OA 4DHJD 2N9LA 3Q8BA 1WGGA 1C79A 5IAAC 2KQSA 4NAWB 3NJTA 4NNJB 3TEWA 3W2DA 2D3BA 1OEYJ 2KD0A 2K25A 2VH1A 2AX5A 1H8CA 3DDCB 3A9KA 3NY5A 1F1HA 4YTPB 2N0SB 2L0TA 5FR3A 4K3CA 2JVCA 3ZRCA 3A9JB 2BTEA 3L16A 1WZ0A 4PYZA 2WGSA 4PYUA 1L2NA 1S3SG 2KTRA 2WXQA 2G45B 1XQQA 3MTNB 5IKCM 2K3UA 1WMHB 2CU3A 5HHDG 3QAQA 3M63B 3E9SA 1YIWA 4AJYB 2RD0A 3W5UB 2D3CA 2KDEB 3NS8A 1QQRA 2ZNVC 1CMXB 1D4BA 4WAAA 4GDLB 4MSQB 4KVGB 3FILB 3KUCB 4C4VA 1NYQA 1E6EB 1FNWA 3VR9B 1FFUA 2KX3A 1SE4A 3KWLA 2QC8A 1ROEA 5CHFA 1WXAA 4M0WB 4TSSA 4GLSC 2JX5A 4AUQC 3R2IA 5E6PA 4ARIA 4JLCA 3JW0X 3MJ5A 3PSEB 1BMLC 3BZDB 3U7ZA 2WLBA 3CWIA 4JL9A 3AE4B 1MG8A 3RPFC 1WM2A 4PS7A 1SF0A 3QQ8B 1DOXA 2PPHA 3RNEC 1WJUA 3JSVB 3SEBA 3PLUA 3O13A 2NTSA 3PRMB 1Q10A 3V05A 4A20A 1JW9D 3MHSD 2LVQA 3ETRA 3TSSA 1AWDA 2Z8LA 2RGFA 1P9DU 3R2TA 2LMCA 4PT5A 4ANXA 1NYRA 4MM3A 4ANUA 4ZYSA 1UELA 3DHHC 2IJ0A 3KLSX 2XK5B 2KMAA 4RH6A 2PIAA 3BK2A 4MDKE 3BVMA 4MEMA 4OVZA 4JGHB 3EFUA 3RCZA 5CX3A 2PKOA 2D07B 3C0RB 5JZEB 2MJ3A 2W9NA 1N63A 2V9HA 4NPNA 4UDUC 2BWFA 4IM0A 4IUMB 2RPQA 3BVZA 2GBKA 3UIPB 4XC2A 3HRDD 1CZPA 1EWYC 4MT5A 2KNBA 1TS2A 3N3KB 3TEZA 2JY6A 3P42A 5AZFA 1T0RC 4LK0M 2DZKA 1E10A 4C80A 2K5PA 1JWAD 2N1VA 4RF0A 4AOFA 5G55A 2MSED 1K52A 2KDBA 2NR2A 4EOYA 2WWZA 2W3SA 3ZNID 2PE9A 3H7PA 3GOEA 4DDID 1GC6A 3TMPB 2L0FA 4REZA 2QILA 4LCDE 1IBXB 3WAPA 1V8CA 2E3TA 1K53A 2KTFA 3GE3C 4HJGE 2IYDB 4KGSA 1LGRA 3GB1A 4OVVA 1QLBB 1YD8U 4R3DA 3CMMB 3NVWA 2H89B 1ZUD2 4TQ1A 4P1BC 3OLMD 1EU4A 1DOIA 2MBHA 4K7SA 2KLCA 2FAZA 2RMMA 1HTQA 1QOBA 3C19A 2PVGC 2L8JA 3ZNZB 2FIFA 1JWUD 1L4ZB 1WXVA 4A3OA 5AUIA 1SE3A 4XX5A 3J9CA 3EA6A 2KQ7A 3BVGA 1PGXA 1YOVB 3Q8AA 1XEEA 1SE2A 2DZIA 3EUB2 1EF5A 2BBCA 5DCNA 5GXGB 3I3TB 2DAJA 1VD2A 2LHDA 4OHJA 3RZFA 3ZO5B 2V3NA 4ARCA 1L5PA 1HA5A 3H9DA 3KWVA 1N62A 2KFJA 2KFKB 4L2YA 4WQMA 3VHTC 3QA8A 1TGZB 3AE6B 2QIEB 1YNTE 2I1KA 3IHPC 1FXIA 1JQ4A 4EE2A 1L7YA 1V49A 1OQQA 5DPTA 3DVGY 3RNFC 5DPRA 2INPE 3UIOB 1KF6B 2BWES 3Q8CA 3ZKJC 1VZ7A 4BFRA 4HKQA 2X8XX 3ZDMC 2KVZA 1MI0A 4YSXB 1WGKA 3OJ4B 1NI3A 5IP4D 1LQBA 4C00A 3ZUNA 1JWMD 3U7DA 1R7SA 2KMCA 2Q5WD 1WYWB 5HFYA 3OJ3A 4XYCA 2BYTA 2N1WA 3EFCA 5L83A 1TT5B 2BKFA 2LVPA 4US8A 4B0EA 2GI9A 1SSNA 2L32A 3C8YA 4K1RB 4EUTA 3AEDB 4AP4C 4ASWC 3U52E 2CJNA 1WGDA 4GOCA 2FNJB 1IPGA 5C23A 3APCA 3Q6BA 3V3XA 3FC4A 1EUVB 3SU8X 3AI5A 3ZNGC 2AQ1B 4G0NB 2LGXA 3PZDA 1GPXA 3TL5A 4W9DA 3LYYA 1RAXA 2C60A 1R4MB 3HM6X 2KANA 3RN9C 3RNGC 4HVBA 4KSLC 5J2RA 5EDSA 3ZXRA 2L00B 2DNFA 4WJQA 4LNFA 2PE6B 3WANA 3R7QA 2G3QB 2B76B 2IO1B 3MC0B 1YQ3B 1V1PA 1FD6A 4E74A 2DENB 4HEA1 1TJEA 5MPOA 5E6JA 2NMQA 4ZHOA 2NCNA 1D5MC 4GGQA 5EE0A 4N59A 3DHIC 2CS4A 4DXFA 1EO6A 1WFYA 4IWQA 3Q2AC 3UF8A 4B95A 1L6UA 2W3RA 3P1MA 2J53A 2IGDA 5JHBA 4OZCA 4MH8A 3HK0A 3O65B 4RFBA 1TKGA 1I4XA 4GDKB 3JVZX 1TZ1A 2INNE 3U30A 1WJ4A 3MHZA 2PVOD 4S0RA 2NVUI 4MJSB 1UWXA 1WRDB 1E7PB 2I1JA 2K9XA 2KC1A 4FJZA 1C4AA 3RFZB 3LB8C 2KJHB 1HZ5A 2G9HD 2CU1A 2BYFA 2FCQA 3QX1A 2WDVB 2BT6A 3QCAA 3A9KB 3AEEB 1FPYA 1PQSA 4N9F4 4HDQA 2HTHA 4FHKA 4JWUC 5J18A 1QT9A 4P16A 5D6JB 4JX1C 1GJZA 3ZTCA 4QAYA 4J3OD 2NS5A 2VZKB 1OQYA 4GU2A 3QK0A 4RGTA 2NPTB 1X1MA 4MGKE 2LXAA 4WURA 1B9RA 2CHZA 2MJEA 4ANVA 1WYGA 1ZW7A 2EMSA 4YT0B 1FIQA 4W9LA 4M8MA 4DDGD 2WNMA 2KX0A 1T0YA 2AL6A 4AWJA 5D7GA 2BS3B 2MP2A 1WX7A 1XXGA 2WXRA 4W9EA 1C77A 5J17A 3KUDB 1STEA 4IM3A 2BQQA 1ACCA 3WALA 4XDDA 4TUUA 2RDGA 2N4FA 1FCLA 2OJRA 2FCNA 4EZLA 1ZXIA 4A8XC
chains in the Genus database with same CATH topology
2WXGA 3AEFB 3ZQ4A 1UUPA 4ZHPA 4TQ0A 2AQ2B 1TZOA 2KQ4X 2ICIA 3RPFC 2VZKD 4OZBA 4WH4A 4P6VF 2AQ3B 1SF0A 1JALA 3HVDA 1DOXA 2R61A 1I4GA 5G5HA 3FAHA 3WCQA 3DWGC 2JYTA 5BMGA 2JSVX 1V1PB 2MH7A 3SEBA 3ZJUA 1QOFA 1VJKA 1VZ8A 1VZ6A 1DOYA 3O13A 1XLOA 2NTSA 1Q10A 3V05A 1SJED 1JW9D 1MVKA 3P63A 1L0XB 1BUIC 1ESFA 3ETRA 3TSSA 1AWDA 2Z8LA 3AB5A 4YSYB 2QMTA 2HTME 3R2TA 1JROA 3T3NA 2LMCA 1K51A 4LTUA 4PT5A 1I4HA 1NYRA 1ET6A 2M0AA 2I2YA 2JZPA 4A90A 3NS1A 4ZYSA 3AECB 3AEAB 2IJ0A 3N9YC 2BB5A 2YEPB 3KLSX 1QILA 4XDCA 4AQ7A 2PW9A 1GOZA 1CJEA 4RGNA 4RH6A 2PIAA 3BK2A 2JWUA 1ZP0B 3BVMA 3I9V1 4HKZE 4OVZA 1JRPA 1PGBA 2J52A 5BMIA 1TS3A 2PKOA 1I4QA 4FXCA 1P7EA 3BIID 2ACZB 2ONQA 2LEKA 4WIPA 2WXLA 5H8YE 4ZRQA 2MJ3A 3NUHB 2PMVA 1N63A 3ABVB 4YTMB 2MJDA 4UDUC 1N5WA 1EWCA 3AV8A 4USAA 2WXIA 3BVZA 2LHEA 3AE2B 3BK1A 1YQ4B 3HRDD 3AEBB 1IUEA 1CZPA 2IGHA 1EWYC 4MT5A 3ZJTA 4CQNA 1UNSA 2D5GA 1AW7A 3OWEB 1JMLA 1TS2A 1F0ZA 1CQVA 1YJJA 3TEZA 1KRHA 4AS1A 1FNUA 3UI3A 3E56A 1L6VA 3P42A 4LK0M 2K22A 1E10A 4C80A 2FBWB 2K5PA 1JWAD 1FNVA 4RF0A 4WAFA 1RFKA 2EELA 3GS2A 3L4PA 1K52A 2ON8A 1J7AA 1XCTL 1SB3C 1T3QA 2G1EA 1N5XA 1MHHE 2W3SA 2BW2A 1ZDVA 1MPEA 1FRDA 2SEBD 2M19A 1XCQL 1M4VA 4D2KA 4YWGG 4JWSC 4H2AA 1HXYD 3Q8FA 2KACA 4REZA 2QILA 1IBXB 1FRRA 2WXNA 2WDQB 2PLPA 1GAQB 2W55A 2ZW0A 1V8CA 3BWUD 1N61A 3AEGB 4DXGA 2E3TA 4NAMA 1K53A 1RWSA 4NZLB 2EKIA 4HJGE 4KGTA 2BB6A 1FO4A 1TKYA 1HQRD 2GRIA 3IAM1 2WDRB 4KGSA 3GB1A 1BXTA 1QLBB 2DYOA 2WXKA 5HG2A 1HZ6A 1P7FA 2WXHA 1Y56A 4R3DA 1PUTA 3NVWA 2H89B 1B1ZA 1ZUD2 4TQ1A 1TY2A 1EU4A 1DOIA 1FCCC 1QOAA 2PTLA 1IGDA 4RCOA 3IXSA 1SBBB 3U2SC 3B2GA 3VQIA 3TEXA 1VR9A 2RMMA 1KLUD 1KLGD 1I4PA 1QOBA 1J7BA 2M56B 2PVGC 2RPVA 4YTNB 1I7HA 4N58A 1VLBA 1JWUD 1ZDXA 1QOGA 1L4ZB 3BYTB 2FUG1 1SE3A 2OEDA 5AUIA 4YSZB 4KKJA 1T5XD 4KX6B 3DWMA 2OHFA 3KQ4A 3PZ7A 3J9CA 1T6BX 3EA6A 1A70A 3BVGA 3PZ8A 1UGJA 3IAS1 3IT6B 1PGXA 3P4SB 1K50A 2DLBA 3U4EG 3NZ3A 4L1BA 4DQOC 3ZYYX 2QEJC 4US9A 1XEEA 1SE2A 3NVZA 3Q8AA 1WXQA 3EUB2 1C4CA 5C3JB 4MM3B 2LUMA 1C76A 2BBCA 1C9FA 1IGCA 1ZXHA 1TS4A 1D5XC 1EM7A 3AE8B 1JWSD 5GXGB 3VRAB 5AUKA 1AYFA 2DBYA 3W5VB 2LHDA 4OHJA 1XLPA 2WQYB 1XF5L 1ZE3D 2V3NA 4ARCA 1L5PA 1FMAD 1OQRA 1HA5A 3KWVA 5D3IB 1N62A 4L2YA 3VR8B 4WQMA 1KH0A 2QSDA 4B0MA 1MHXA 3AE6B 2QIEB 1FEHA 1VRAB 1YNTE 1NEKB 1TYGB 3AMZA 1ENFA 3TEYA 2V0GA 4KGRA 1FXIA 4ZOHC 1PGAA 3NRZA 1JQ4A 4EE2A 1OQQA 3PO0A 2WXMA 2WXOA 2INPE 2Y5PA 5BYSA 1KF6B 3AE3B 5I4DA 3EGRA 1PFDA 2GB1A 3Q8CA 1VZ7A 4HKQA 4ITKA 5EE1A 4XWTA 1N60A 1MI0A 1SEBD 4YSXB 1WGKA 5T8IA 2WU2B 1NI3A 1ET9A 5HI1A 2W82A 4MACA 1JWMD 1R7SA 1XLQA 2V3PA 3TUOA 2Q5WD 3AE1B 4JE3B 4KKIA 5HFYA 2BYTA 4WWMA 5FKAC 1TS5A 1L4DB 2TSSA 1SIJA 5EE9A 5BYRA 5TSSA 4US8A 4RNAA 4B0EA 2GI9A 1YMHE 1SSNA 2L32A 3C8YA 1C78A 3AEDB 2ZW1A 3FILA 3U52E 2CJNA 4NJCA 4YXDB 3AE9B 1YN5A 1E0ZA 4A55A 3ZGZA 5C2TB 4TMAB 2IDYA 3V3XA 2WS3B 3FC4A 4A6QA 4N6EB 2Y5CA 2AQ1B 2K0PA 3MP9A 1L0YB 1UWMA 1FFVA 1GPXA 2Y3AA 4Q2JA 4M0WA 3LYYA 1HEZE 1YN3A 2DWQA 2WU5B 3B2FA 1PYWD 2H88B 3B9JA 3AE5B 4IDIA 5BYQA 2FE8A 4ZRPA 2J42A 4HROA 3GP7A 2IGGA 5FK9C 2WXPA 4LLGM 1EU3A 2KN4A 1YJIA 1C4PA 2X38A 2YEPF 1XO3A 2JYEA 5LNK1 3VRBB 1FM0D 1V97A 4O1NA 3SFDB 1YN4A 2N9KA 2B76B 2XN9C 2LJIA 3MC0B 1YQ3B 1V1PA 2KDMA 4C7ZA 1FD6A 2KWDA 4OW0A 1NENB 4HEA1 1TJEA 1PDXA 3SR6A 5MPOA 2KMMA 3NVYA 3W1SA 5E6JA 2BS4B 2NMQA 1J7CA 2JXTA 4ZHOA 1FXAA 2V4IB 1JWBD 1D5MC 4HRSA 4N59A 5EE0A 4DXFA 1KFYB 3NVVA 1D5ZC 5BMHA 2LGIA 2JU6X 3LXFA 1L6UA 1XLNA 2W3RA 3HUIA 3P1MA 2J53A 2IGDA 1TY0A 1DYQA 1F2RI 1WSPA 4OZCA 1SJHD 1ZOYB 4OZAA 4MH8A 2N9LA 3Q8BA 2LFIA 4RFBA 1E9MA 1TKGA 1I4XA 2QJLA 4GDKB 3URYA 4RGOS 1C79A 2INNE 3Q8EA 2L83A 3MHZA 4NAWB 1VDVA 1KTKA 3BYYB 3H8HA 3P4PB 3T3OA 2L1AA 2PVOD 3AH7A 1UWXA 1CK1A 1E7PB 3TEWA 3W2DA 2K9XA 2DYMA 3HVZA 1C4AA 2J4XA 1RYJA 1LO5D 1GB1A 3RFZB 2RDHA 3LB8C 4RGMA 2AX5A 1HZ5A 1TKEA 1ZPSA 2G9HD 2WP9B 1QF6A 4YTPB 2N0SB 4C56C 2BS2B 3P4RB 3AN1A 2CJOA 1OFFA 2WDVB 1SXTA 5FR3A 1DGJA 5JXVA 2BT6A 2MEKA 2BTEA 3AEEB 1QKZA 1V1OA 3AM9A 3Q69A 4JWUC 2JQRB 1F77A 1I4RA 1WWTA 3MFGA 2WXQA 1QT9A 4P16A 4IKGA 4JX1C 2I38A 2K3UA 4J3OD 2CU3A 3ZJVA 2XNAC 5HHDG 1GB4A 4C7YA 2VZKB 3CIRB 4RF1A 3E9SA 2E6XA 2HDEA 4RGTA 3W5UB 4WURA 1RM6C 1B9RA 2MJEA 4IOIE 1QQRA 2W54A 1WYGA 4L23A 1D4BA 3SFEB 4GDLB 4JPSA 2WXFA 4XWWA 4YT0B 1FIQA 1NVID 2WXJA 3FILB 1E6EB 1NYQA 3AE7B 2WNMA 1FNWA 3P4QB 3VR9B 1FFUA 3R8BA 4A9AA 1L0VB 1IBXA 1SE4A 3KWLA 1ROEA 3IT4B 5D7GA 2BS3B 3I57A 1XXGA 2WXRA 5EE3A 4TSSA 1C77A 2N7JA 2KAJA 4GLSC 2JX5A 2IPKD 1JCKB 1STEA 2L52A 3R2IA 1F2RC 5D3DA 4ARIA 1ACCA 4XDDA 2RDGA 3MJ5A 2SAKA 1FCLA 3W9CB 1BMLC 3BZDB 1D6EC 3U7ZA 1WRIA 1AN8A 1ZXIA 4A8XC 2NTTA 2WLBA 4XE0A 5H92C 3CWIA 5G5GA 3AE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1M A;  3NRZ A;  3AEF B;  2M19 A;  1JQ4 A;  1OQQ A;  4ZHP A;  3PO0 A;  1ZOY B;  4JWS C;  3RPF C;  1E9M A;  1KF6 B;  1TKG A;  3AE3 B;  2QJL A;  4P6V F;  1PFD A;  1SF0 A;  1JAL A;  1FRR A;  2L83 A;  1VDV A;  2WDQ B;  3VRB B;  1DOX A;  3P4P B;  4ITK A;  5EE1 A;  5G5H A;  1GAQ B;  1N60 A;  2W55 A;  3FAH A;  1V8C A;  3DWG C;  1WGK A;  3WCQ A;  2PVO D;  3AH7 A;  2MH7 A;  4YSX B;  1N61 A;  1NI3 A;  1QOF A;  1VJK A;  2WU2 B;  3AEG B;  2E3T A;  1RWS A;  1DOY A;  1E7P B;  2EKI A;  1XLO A;  2K9X A;  3HVZ A;  1JW9 D;  3P63 A;  1FO4 A;  1R7S A;  1TKY A;  1RYJ A;  1XLQ A;  5G5G A;  2Q5W D;  3LB8 C;  2WDR B;  3AE1 B;  3ETR A;  1AWD A;  2AX5 A;  3AB5 A;  4YSY B;  1QLB B;  4WWM A;  1TKE A;  2HTM E;  1PUT A;  1SIJ A;  5EE9 A;  1JRO A;  2WP9 B;  1QF6 A;  3NVW A;  4YTP B;  2N0S B;  2H89 B;  3CWI A;  4US8 A;  1ZUD 2;  2BS2 B;  3P4R B;  3AN1 A;  4LTU A;  1NYR A;  1OFF A;  2CJO A;  2WDV B;  3AED B;  1DOI A;  1DGJ A;  3AE4 B;  1QOA A;  2CJN A;  3NS1 A;  2BT6 A;  4YXD B;  3AE9 B;  3AEE B;  3AEC B;  1E0Z A;  3AEA B;  3B2G A;  5C2T B;  3AM9 A;  2WS3 B;  3FC4 A;  4JWU C;  4N6E B;  2JQR B;  2Y5C A;  1QOB A;  1WWT A;  1J7B A;  2M56 B;  1QT9 A;  1UWM A;  2PVG C;  2W3R A;  1FFV A;  4YTN B;  4JX1 C;  1I7H A;  4N58 A;  1GPX A;  1VLB A;  1CJE A;  2CU3 A;  2PIA A;  1ZP0 B;  1QOG A;  4ZOH C;  4C7Y A;  3CIR B;  1JRP A;  2DWQ A;  2WU5 B;  5AUI A;  2PKO A;  3B2F A;  4YSZ B;  4KX6 B;  3DWM A;  3BII D;  2H88 B;  2OHF A;  2ACZ B;  3B9J A;  2LEK A;  3AE5 B;  4FXC A;  4IDI A;  5H8Y E;  3W5U B;  2MJ3 A;  4HRO A;  1RM6 C;  1B9R A;  2MJE A;  1A70 A;  1E10 A;  1N63 A;  2W54 A;  4C80 A;  1WYG A;  3ABV B;  3P4S B;  1YJI A;  2MJD A;  4YTM B;  1N5W A;  3SFE B;  3AV8 A;  4USA A;  3ZYY X;  4US9 A;  1XO3 A;  4YT0 B;  5C3J B;  3NVZ A;  1FIQ A;  1NVI D;  1WXQ A;  3AE2 B;  3EUB 2;  1YQ4 B;  1E6E B;  1NYQ A;  3AE7 B;  3AEB B;  1FM0 D;  1V97 A;  1IUE A;  3HRD D;  1CZP A;  3P4Q B;  1EWY C;  1FFU A;  3VR9 B;  3AE8 B;  4A9A A;  3SFD B;  5GXG B;  3VRA B;  5AUK A;  1F0Z A;  1L0V B;  1AYF A;  2DBY A;  1YJJ A;  3W5V B;  1KRH A;  3KWL A;  1ROE A;  2B76 B;  2BS3 B;  1L6V A;  1XLP A;  1YQ3 B;  2WQY B;  4C7Z A;  3HUI A;  5EE3 A;  1L5P A;  1FMA D;  1OQR A;  2K22 A;  2FBW B;  2KAJ A;  1NEN B;  2JX5 A;  2K5P A;  1TJE A;  1N62 A;  3VR8 B;  1JWA D;  1PDX A;  2L52 A;  4WQM A;  3SR6 A;  5MPO A;  2KMM A;  3NVY A;  1RFK A;  2BS4 B;  1J7C A;  4ZHO A;  1FXA A;  3AE6 B;  1JWB D;  2QIE B;  3L4P A;  4HRS A;  4N59 A;  5EE0 A;  3W9C B;  1KFY B;  3NVV A;  1J7A A;  1NEK B;  2G1E A;  1T3Q A;  1SB3 C;  1TYG B;  1N5X A;  1WRI A;  3AMZ A;  1ZXI A;  2WLB A;  2W3S A;  5H92 C;  3LXF A;  1L6U A;  1FXI A;  1FRD A;  1XLN A; 
#chains in the Genus database with same CATH topology
 2WXG A;  3A4S C;  3L10 B;  3TIX A;  2AQ2 B;  2D10 A;  2KWU B;  4FHJ A;  1WH3 A;  1J8C A;  2VZK D;  2AQ3 B;  4I6P A;  3IBE A;  4NY0 A;  1I4G A;  2K8B A;  3WCQ A;  5CHV C;  2JYT A;  1QOF A;  4DHZ E;  1DOY A;  3WAM A;  1ISN A;  1SJE D;  3P63 A;  4YSY B;  4EEW A;  2QMT A;  1SE9 A;  4BBN C;  2HTM E;  2C7N B;  3RMK C;  1JRO A;  3T3N A;  1ET6 A;  2M0A A;  2I2Y A;  4BVU C;  3M95 A;  3ML8 A;  2BYE A;  1YX6 B;  2RDB C;  1RRB A;  3NOB A;  1QIL A;  2B3A A;  5L95 C;  4CYE A;  2PW9 A;  2KZR A;  5IN7 A;  5GMV A;  3I63 C;  1CJE A;  2K8C A;  1Z2M A;  5CHW A;  1PGB A;  2HJ1 A;  1I4Q A;  4FXC A;  1P7E A;  2MLB A;  3ZDT A;  2ACZ B;  2ONQ A;  2K8H A;  2O2V B;  5H8Y E;  4ZRQ A;  3QIJ A;  4WQO B;  4CO7 A;  4YTM B;  3CSF A;  1EWC A;  4USA A;  2IY0 B;  4ZRI A;  3KW5 B;  1FXT B;  2JF5 A;  3ZJT A;  1AW7 A;  2ZVO A;  1F0Z A;  1CQV A;  3D32 A;  3WAO A;  1L6V A;  4BKG A;  1WZ3 A;  2C9W B;  1NDD A;  4TV3 A;  3APF A;  1J7A A;  1N5X A;  2N9E B;  1MHH E;  1N6Z A;  1ZDV A;  1FRD A;  1V9J A;  4XGA B;  1XCQ L;  4FJY A;  4YWG G;  4J6I A;  4IW0 A;  2KN5 A;  3UIN B;  1HXY D;  1P1A A;  2WDQ B;  2MQJ A;  4KDL B;  2PLP A;  4ZYN A;  4NZL B;  4BKS D;  1R4N B;  1HZ6 A;  1P7F A;  4W9K A;  3KUZ A;  3PS6 A;  3S2A A;  3NG0 A;  3AXC A;  3N1Y C;  4ICU A;  4KDI C;  2L05 A;  1IGD A;  4RCO A;  3IXS A;  1SBB B;  1YX5 B;  1I4P A;  2Z0E B;  1J7B A;  4N58 A;  1EF1 A;  4W9F A;  5JHA A;  3AU5 A;  4YSZ B;  1T5X D;  3DWM A;  1D3Z A;  3V61 A;  3KQ4 A;  4JIO U;  1NI2 A;  3PZ8 A;  4I6L B;  3IT6 B;  4KIK A;  2WDT B;  4GB9 A;  3L0W B;  3U4E G;  3NZ3 A;  2JPH A;  3ZYY X;  3VFK A;  1BT0 A;  4P7I A;  1AAR A;  2Y5B B;  3ML9 A;  1IGC A;  1TS4 A;  1D5X C;  1EM7 A;  3AE8 B;  3VRA B;  5AUK A;  1AYF A;  4DXA B;  4NAW A;  2J0J A;  4W9I A;  2WQY B;  1XF5 L;  3ECI A;  2KHW B;  2EMT A;  1FMA D;  3VR8 B;  3N20 C;  3Q3M C;  2IZV B;  1WR1 A;  3A4R A;  3GE8 C;  2AEH A;  4NQL B;  3TEY A;  2V0G A;  3RI7 C;  4ZOH C;  3PO0 A;  5JH5 C;  3A9J A;  4PK1 A;  1P3Q U;  3LJ3 A;  4BKS A;  4E3C A;  5BYS A;  1VCB A;  5EE1 A;  4XWT A;  4DWF A;  1N60 A;  1WR6 E;  3ZLZ A;  1WMH A;  5T8I A;  3GZN I;  4WWO A;  5HI1 A;  2W82 A;  1WE6 A;  4MAC A;  3UGB B;  3MJW A;  2KWV B;  4RM9 A;  1XLQ A;  3TUO A;  3AE1 B;  3NHE B;  2TSS A;  3PPA A;  5TSS A;  4GDL A;  2C7M B;  1YMH E;  2LI5 A;  1C78 A;  1UBQ A;  3FIL A;  3DPD A;  1YN5 A;  4MH0 E;  1E0Z A;  4A55 A;  4GMV A;  4ACF A;  3MP9 A;  2K0P A;  1UWM A;  2UYZ B;  2REX A;  4M0W A;  3PGE A;  3PLV A;  1YN3 A;  2DWQ A;  2BYV E;  2JZZ A;  3AE5 B;  2J42 A;  3Q3J A;  2LJ5 A;  1EU3 A;  3NZS A;  3QWZ B;  4HXD A;  4HJK A;  2X38 A;  4KSK C;  2LXC A;  4X57 B;  1XO3 A;  4M02 A;  3VRB B;  1FM0 D;  1HE8 A;  1V97 A;  3AUL A;  3PHX B;  1J19 A;  4CHK A;  4IC7 B;  3RNC C;  1G6J A;  2N9K A;  1E5W A;  1R4N I;  3VUY A;  2KJ6 A;  3JSV A;  4C7Z A;  3DVN V;  4B6W A;  2K6Q A;  1NEN B;  4II3 B;  3CST A;  1MJD A;  2DZM A;  3NVY A;  4LNO A;  4NJ7 A;  2BS4 B;  3APD A;  1FXA A;  2V4I B;  3PVL A;  2QHO A;  1V81 A;  2MBB B;  4M8N A;  2VH2 A;  2KK8 A;  3A1Q B;  1XLN A;  4A3P A;  1TY0 A;  1DYQ A;  1SJH D;  4OZA A;  1I35 A;  2LFI A;  3PT2 B;  2DAF A;  1E9M A;  1V5T A;  1UGM A;  2XK5 A;  1XD3 B;  2L83 A;  3SD5 A;  4F8C B;  1VDV A;  3BYY B;  3H8H A;  3P4P B;  3HIZ A;  3T3O A;  2KLG A;  3TCA A;  2L1A A;  1CK1 A;  4MEL A;  4HCN B;  4F1S A;  3HVZ A;  4ICV A;  2AYO B;  1LO5 D;  1GB1 A;  2RDH A;  2KKC A;  4RGM A;  2CHX A;  1ZPS A;  2C7H A;  1QF6 A;  1I42 A;  2BS2 B;  3AN1 A;  3RUL A;  2CJO A;  4PS8 A;  1DGJ A;  4WJP A;  5JXV A;  2MEK A;  3IG3 A;  1V1O A;  3AM9 A;  1F77 A;  3MFG A;  4WJO A;  4IKG A;  2I38 A;  3ALB A;  3LDZ E;  1YJ1 A;  2XNA C;  1GB4 A;  3CIR B;  3AU4 A;  4RF1 A;  3T9L A;  2E6X A;  2HDE A;  4W9C A;  4K81 A;  2LRU A;  2RSU A;  1RM6 C;  5LLI A;  4IOI E;  2W54 A;  4L23 A;  1F52 A;  4XWW A;  1KLV A;  3R8B A;  2YLM A;  4A9A A;  4HK2 A;  5C1Z A;  4EKU A;  1S1Q B;  4IWO A;  1IBX A;  3IT4 B;  2ZPY A;  4W9J A;  5EE3 A;  2N7J A;  2KAJ A;  5IA7 A;  2IPK D;  5D3D A;  3U8Z A;  3WIM A;  1E7U A;  2SAK A;  4ZRK A;  3MC8 A;  4HCP B;  1WF9 A;  1AN8 A;  2G4D B;  3DBH B;  4M01 A;  2ZNV B;  4XE0 A;  4FA6 A;  1TBE A;  1WI0 A;  3AEF B;  1KJT A;  4ZHP A;  4TQ0 A;  2KQ4 X;  2BVC A;  2ICI A;  2Z59 B;  3QJZ A;  4OZB A;  4WH4 A;  2R2Q A;  4P6V F;  2LUE A;  2ZZP B;  4RM8 A;  2L7R A;  5G5H A;  4BBN F;  4E71 A;  5BMG A;  2MH7 A;  2VRR B;  1VJK A;  3ZJU A;  3H6N A;  3N1X C;  2V1Y A;  2N9P C;  1JRU A;  3EEC A;  4II2 B;  1ESF A;  1V80 A;  2K6D B;  3AB5 A;  2KVR A;  4FJV B;  2O6V B;  1WXS A;  1K51 A;  2JT4 B;  1I4H A;  2M4N A;  5D94 A;  3L54 A;  3NS1 A;  3AEC B;  4I6N B;  3AEA B;  3N9Y C;  2BB5 A;  2YEP B;  2FID A;  2GBM A;  1Q5W B;  1E7V A;  3IVF A;  2KC2 A;  2KJR A;  1GOZ A;  3B1L X;  1TTN A;  2JWU A;  2KFK A;  4FN2 A;  4HKZ E;  5E6N A;  1JRP A;  4EFO A;  1TS3 A;  3BII D;  2LEK A;  2LZ6 A;  3V60 A;  2MJD A;  2LGD A;  3X23 A;  3DBR B;  4BAX A;  2WXI A;  3WA0 A;  2LHE A;  3AE2 B;  3BK1 A;  3AEB B;  1C1Y B;  3P2B A;  3OWE B;  5KHO A;  1KRH A;  2KTR B;  4AS1 A;  2V4L A;  3TBL D;  2LWP A;  4PS3 A;  2FBW B;  1FNV A;  4WAF A;  2LAS A;  1RFK A;  2EEL A;  3GS2 A;  1TIF A;  4HPL B;  5DPW A;  3DCG A;  3JYU A;  2C5L C;  1IP9 A;  2AL3 A;  1ZGU B;  2BW2 A;  2M19 A;  2JRH A;  2JWZ A;  1M4V A;  4C4V B;  4D2K A;  4JWS C;  3DBS A;  4H2A A;  3A33 B;  3Q8F A;  2WXN A;  1GAQ B;  2W55 A;  2ZW0 A;  4K7U A;  1N61 A;  4GSW A;  3Q3F A;  4NAM A;  2GBJ A;  2BB6 A;  1FO4 A;  1TKY A;  2GRI A;  3IAM 1;  4G3X B;  2WDR B;  2XBB C;  2DYO A;  1E8X A;  2WXK A;  2MW5 A;  4EZK A;  2WXH A;  1Y56 A;  3VH4 B;  1V86 A;  2CR5 A;  3DOW A;  1B1Z A;  4G11 A;  1TY2 A;  1QOA A;  4WWN A;  4B9K A;  2PTL A;  3U2S C;  3UQB A;  3VQI A;  1VR9 A;  5FR6 A;  5E6O A;  2L76 A;  2MHJ A;  2RPV A;  4URK A;  4YTN B;  1I7H A;  1WY8 A;  1UD7 A;  1ZDX A;  1QOG A;  3B08 A;  2WX0 A;  3BYT B;  3DBH I;  3EC8 A;  5IO9 A;  3VTV A;  4KKJ A;  2OHF A;  3Q14 C;  3EHV A;  1T6B X;  1A70 A;  1UGJ A;  1WGH A;  3P4S B;  2N7D A;  4L1B A;  3NVZ A;  1WXQ A;  1C4C A;  4MM3 B;  5IOI A;  1ZXH A;  4BOS C;  4GDK A;  2DBY A;  1WX8 A;  1WGR A;  5G2N A;  4GN1 A;  4MJS A;  1OQR A;  2N7E A;  2D2Q A;  5D3I B;  4FAD A;  3DBL I;  2QSD A;  3GZN B;  4HWI B;  2M0X A;  4XZ4 A;  3RNB C;  1MHX A;  4IWP A;  4MGI E;  4ZRJ A;  1TYG B;  3AMZ A;  1ENF A;  1Z5S B;  3QHT A;  1PGA A;  3V6E B;  2GLS A;  5DPS A;  4LJO B;  2WXM A;  1LFD A;  3OG5 A;  3ZRF A;  4BOZ B;  4G50 A;  2Y5P A;  2XEW A;  3AE3 B;  1PFD A;  2GB1 A;  5AEK B;  4NJ6 A;  3K9P B;  4ITK A;  1SEB D;  1ET9 A;  3L17 A;  3QAR A;  4AJW A;  2M17 A;  3DBR I;  2V3P A;  2NPT A;  2ZJD A;  2LD9 A;  4JE3 B;  4KKI A;  5FKA C;  4EZJ A;  1TS5 A;  1L4D B;  1WXM A;  1SIJ A;  2ASQ A;  3VTW A;  5BYR A;  1HTO A;  1NBF C;  3H7P B;  1UH6 A;  2PEA A;  4NJC A;  4MGZ E;  2IDY A;  2WS3 B;  4A6Q A;  5LXH A;  2Y5C A;  3X0W A;  3NZU A;  5D2M B;  1WJ6 A;  2WU5 B;  2ZEQ A;  3SDL C;  3B2F A;  2HE7 A;  5HKH A;  3B9J A;  5BYQ A;  2ZPN A;  3OAW A;  4ZRP A;  3W1S C;  5FK9 C;  4LLG M;  2J0M A;  2KN4 A;  2MX2 A;  1C4P A;  2IY1 B;  3VUX A;  5AZG A;  4O1N A;  4LNI A;  2FCM A;  3SFD B;  1YN4 A;  2MRP A;  3QC8 B;  3ENE A;  2QCZ A;  2KDM A;  2NBW B;  2KWD A;  3PRP B;  2N9X A;  2KMM A;  2JXT A;  3BY4 B;  4BKT A;  3UQA A;  5LXI B;  3Q3O C;  5BMH A;  4W9H A;  2LGI A;  2RR9 A;  1F2R I;  1WSP A;  1ZOY B;  4HPM B;  3N32 A;  2MBQ A;  2OOB B;  3HHM A;  1UBI A;  2QJL A;  3URY A;  4RGO S;  3Q8E A;  1KTK A;  2FUH B;  3KH0 A;  1MG4 A;  3AH7 A;  2DYM A;  2MBE A;  3ZW3 A;  2J4X A;  1RYJ A;  2G4S A;  2O2V A;  1SIF A;  2ZCB A;  1TKE A;  3IFW B;  2MA9 B;  2WP9 B;  4C56 C;  3P4R B;  1OFF A;  1SXT A;  3ZTD A;  3KYD D;  1QKZ A;  1ZKH A;  3Q69 A;  5KHQ A;  2JQR B;  1I4R A;  1WWT A;  4OVU A;  4DBG A;  1E8Z A;  1T0Q C;  1UZX B;  2UWQ A;  3KYC D;  3ZXV A;  1GG3 A;  3ZJV A;  3RZW C;  4GIV A;  4C7Y A;  2ZCC A;  3N1Z C;  2JRI B;  3SFE B;  2LGS A;  1P98 A;  2WXF A;  4JPS A;  2DZJ A;  3PHW B;  1NVI D;  2WXJ A;  3AE7 B;  3P4Q B;  4K7W A;  2IBI B;  1L0V B;  1Q0W B;  3I5J C;  2M1M A;  3I57 A;  1JCK B;  2L52 A;  1F2R C;  2JXX A;  2WHI A;  1K8R B;  3W9C B;  1D6E C;  4FUL A;  4LNK A;  1WRI A;  3ONS A;  4LJP B;  1E8W A;  2NTT A;  5H92 C;  3VXW A;  5G5G A;  1V2Y A;  2D11 A;  3ZQ4 A;  1UUP A;  1TZO A;  2BGF A;  1WX9 A;  3VAW A;  4P1C C;  1JAL A;  3HVD A;  2R61 A;  3FAH A;  3DWG C;  2JSV X;  1V1P B;  1VZ8 A;  3PRE A;  1VZ6 A;  1MFW A;  1XLO A;  4ZDV A;  5TR5 A;  3R66 C;  1MVK A;  1L0X B;  1BUI C;  2MCN B;  2K1F A;  3R7R A;  3RT3 B;  1V5O A;  4LTU A;  2JZP A;  4A90 A;  1RLF A;  5BO4 B;  4F7Z A;  2CHW A;  4MSM B;  1U4A A;  3T8M A;  4XDC A;  4AQ7 A;  3CF6 E;  4RGN A;  1KOT A;  1ZP0 B;  3I9V 1;  4LDT B;  2LVO A;  2L3Z A;  3KVF B;  2J52 A;  5BMI A;  2KWC A;  4WIP A;  1OEY A;  2A5U A;  2WXL A;  2AWT A;  2WYQ A;  3NUH B;  3PV1 A;  2DHZ A;  4HDO A;  1WGY A;  2PMV A;  3BIN A;  5CTR C;  3ABV B;  1OGW A;  1N5W A;  3AV8 A;  3VUW A;  1YQ4 B;  2GMI C;  1WM3 A;  4KZC A;  1IUE A;  2IGH A;  4CQN A;  1UNS A;  2D5G A;  1F9J A;  1JML A;  2OJW A;  1YJJ A;  4FBJ B;  4W9G A;  2KXJ A;  1OTR B;  1FNU A;  3UI3 A;  3E56 A;  4M00 A;  3RYT A;  1E8Y A;  2K22 A;  1C3T A;  2KT7 A;  4FLH A;  2J7Q B;  3L4P A;  2ON8 A;  1J0G A;  2NBV B;  3Q3N C;  1XCT L;  1SB3 C;  1T3Q A;  2G1E A;  4KV2 A;  4HLE A;  2NBU A;  3RD2 A;  3VTU A;  1GC7 A;  1MPE A;  2SEB D;  4LDT D;  4DK5 A;  2A4Z A;  3PTF C;  4K3B A;  2KAC A;  2GBN A;  1FRR A;  2QDF A;  3R3M A;  2FCS A;  2MP2 B;  3BWU D;  3M62 B;  2J0K A;  3AEG B;  4DXG A;  3HM3 A;  1RWS A;  3VDZ A;  2EKI A;  2WX1 A;  4KGT A;  1HQR D;  1QZE A;  3V6C B;  1BXT A;  5HG2 A;  2CKH B;  3RUI B;  1PUT A;  2IO2 B;  2DX5 B;  2DYB A;  1FCC C;  2JUO A;  2IO3 B;  2LRW A;  4LNN A;  4BZA A;  4NQK E;  3B2G A;  3W1Y A;  3TEX A;  4WWP A;  1KLU D;  1KLG D;  4JQW C;  3L08 A;  3N30 A;  2M56 B;  4YL8 A;  3H1U A;  1A5R A;  1VLB A;  3RNA C;  3M3J A;  3MC9 A;  1T0S C;  2UU7 A;  2FUG 1;  2OED A;  4KX6 B;  3DBL B;  3PZ7 A;  3VVW B;  3IAS 1;  1RFA A;  2D3G A;  3A1Q A;  1E90 A;  1K50 A;  2DLB A;  4DQO C;  2QEJ C;  4US9 A;  5C3J B;  2KO3 A;  2KYW A;  2LUM A;  1C76 A;  2M8S A;  4GXB A;  1C9F A;  2KDI A;  3VH3 B;  1JWS D;  2IND C;  3W5V B;  3ZVV A;  3B0A A;  2BF8 B;  1XLP A;  1ZE3 D;  2YVC A;  3PRZ A;  2INC C;  1KH0 A;  1GNU A;  2IO0 B;  2KOX A;  4B0M A;  2K39 A;  1FEH A;  1VRA B;  4IM2 A;  4ANW A;  1NEK B;  3ZIM A;  4KGR A;  2V3S A;  3NRZ A;  2BPS A;  4WJN A;  2KDF B;  2WXO A;  4S17 A;  2O6V D;  5I4D A;  3EGR A;  1GUA B;  1P0R A;  3DVN U;  1YQB A;  3L13 A;  2WU2 B;  4HPP A;  1KM7 A;  4KZ0 A;  1WIA A;  1H4R A;  2Z0D B;  2HJ8 A;  3K9O B;  1XT9 B;  4WWM A;  5EE9 A;  1WE7 A;  4RMA A;  4RNA A;  2ZW1 A;  4YXD B;  3AE9 B;  3TJP A;  2BKR B;  3ZGZ A;  5C2T B;  4TMA B;  4N6E B;  2GOW A;  1L0Y B;  4TKN A;  3SHQ A;  1FFV A;  4DHJ B;  2Y3A A;  4Q2J A;  2PJH A;  1Y8R C;  3FKY A;  1HEZ E;  2LGY A;  4IG7 B;  1LXD A;  2GBR A;  4DHZ B;  3DQV A;  1SGH A;  3DHG C;  1PYW D;  2H88 B;  4IDI A;  2FE8 A;  4HRO A;  3GP7 A;  2IGG A;  2WXP A;  1YJI A;  2YEP F;  2JYE A;  1M94 A;  5LNK 1;  1IYF A;  5AZH A;  2D3A A;  4MGY E;  2R2O A;  1UF0 A;  3H7S A;  2EKE C;  2XN9 C;  2LJI A;  1R4M I;  1LM8 B;  3DVG X;  4OW0 A;  1V6E A;  2MBO A;  2JZ3 B;  3ZNH B;  1PDX A;  3SR6 A;  2HD5 B;  3W1S A;  1J7C A;  1JWB D;  1WJN A;  4HRS A;  2O6V A;  1KFY B;  3NVV A;  1D5Z C;  2MWS B;  3V62 A;  2JU6 X;  3LXF A;  4KIK B;  2ZVN A;  3HUI A;  1Q1O A;  4DHJ D;  2N9L A;  3Q8B A;  1WGG A;  1C79 A;  5IAA C;  2KQS A;  4NAW B;  3NJT A;  4NNJ B;  3TEW A;  3W2D A;  2D3B A;  1OEY J;  2KD0 A;  2K25 A;  2VH1 A;  2AX5 A;  1H8C A;  3DDC B;  3A9K A;  3NY5 A;  1F1H A;  4YTP B;  2N0S B;  2L0T A;  5FR3 A;  4K3C A;  2JVC A;  3ZRC A;  3A9J B;  2BTE A;  3L16 A;  1WZ0 A;  4PYZ A;  2WGS A;  4PYU A;  1L2N A;  1S3S G;  2KTR A;  2WXQ A;  2G45 B;  1XQQ A;  3MTN B;  5IKC M;  2K3U A;  1WMH B;  2CU3 A;  5HHD G;  3QAQ A;  3M63 B;  3E9S A;  1YIW A;  4AJY B;  2RD0 A;  3W5U B;  2D3C A;  2KDE B;  3NS8 A;  1QQR A;  2ZNV C;  1CMX B;  1D4B A;  4WAA A;  4GDL B;  4MSQ B;  4KVG B;  3FIL B;  3KUC B;  4C4V A;  1NYQ A;  1E6E B;  1FNW A;  3VR9 B;  1FFU A;  2KX3 A;  1SE4 A;  3KWL A;  2QC8 A;  1ROE A;  5CHF A;  1WXA A;  4M0W B;  4TSS A;  4GLS C;  2JX5 A;  4AUQ C;  3R2I A;  5E6P A;  4ARI A;  4JLC A;  3JW0 X;  3MJ5 A;  3PSE B;  1BML C;  3BZD B;  3U7Z A;  2WLB A;  3CWI A;  4JL9 A;  3AE4 B;  1MG8 A;  3RPF C;  1WM2 A;  4PS7 A;  1SF0 A;  3QQ8 B;  1DOX A;  2PPH A;  3RNE C;  1WJU A;  3JSV B;  3SEB A;  3PLU A;  3O13 A;  2NTS A;  3PRM B;  1Q10 A;  3V05 A;  4A20 A;  1JW9 D;  3MHS D;  2LVQ A;  3ETR A;  3TSS A;  1AWD A;  2Z8L A;  2RGF A;  1P9D U;  3R2T A;  2LMC A;  4PT5 A;  4ANX A;  1NYR A;  4MM3 A;  4ANU A;  4ZYS A;  1UEL A;  3DHH C;  2IJ0 A;  3KLS X;  2XK5 B;  2KMA A;  4RH6 A;  2PIA A;  3BK2 A;  4MDK E;  3BVM A;  4MEM A;  4OVZ A;  4JGH B;  3EFU A;  3RCZ A;  5CX3 A;  2PKO A;  2D07 B;  3C0R B;  5JZE B;  2MJ3 A;  2W9N A;  1N63 A;  2V9H A;  4NPN A;  4UDU C;  2BWF A;  4IM0 A;  4IUM B;  2RPQ A;  3BVZ A;  2GBK A;  3UIP B;  4XC2 A;  3HRD D;  1CZP A;  1EWY C;  4MT5 A;  2KNB A;  1TS2 A;  3N3K B;  3TEZ A;  2JY6 A;  3P42 A;  5AZF A;  1T0R C;  4LK0 M;  2DZK A;  1E10 A;  4C80 A;  2K5P A;  1JWA D;  2N1V A;  4RF0 A;  4AOF A;  5G55 A;  2MSE D;  1K52 A;  2KDB A;  2NR2 A;  4EOY A;  2WWZ A;  2W3S A;  3ZNI D;  2PE9 A;  3H7P A;  3GOE A;  4DDI D;  1GC6 A;  3TMP B;  2L0F A;  4REZ A;  2QIL A;  4LCD E;  1IBX B;  3WAP A;  1V8C A;  2E3T A;  1K53 A;  2KTF A;  3GE3 C;  4HJG E;  2IYD B;  4KGS A;  1LGR A;  3GB1 A;  4OVV A;  1QLB B;  1YD8 U;  4R3D A;  3CMM B;  3NVW A;  2H89 B;  1ZUD 2;  4TQ1 A;  4P1B C;  3OLM D;  1EU4 A;  1DOI A;  2MBH A;  4K7S A;  2KLC A;  2FAZ A;  2RMM A;  1HTQ A;  1QOB A;  3C19 A;  2PVG C;  2L8J A;  3ZNZ B;  2FIF A;  1JWU D;  1L4Z B;  1WXV A;  4A3O A;  5AUI A;  1SE3 A;  4XX5 A;  3J9C A;  3EA6 A;  2KQ7 A;  3BVG A;  1PGX A;  1YOV B;  3Q8A A;  1XEE A;  1SE2 A;  2DZI A;  3EUB 2;  1EF5 A;  2BBC A;  5DCN A;  5GXG B;  3I3T B;  2DAJ A;  1VD2 A;  2LHD A;  4OHJ A;  3RZF A;  3ZO5 B;  2V3N A;  4ARC A;  1L5P A;  1HA5 A;  3H9D A;  3KWV A;  1N62 A;  2KFJ A;  2KFK B;  4L2Y A;  4WQM A;  3VHT C;  3QA8 A;  1TGZ B;  3AE6 B;  2QIE B;  1YNT E;  2I1K A;  3IHP C;  1FXI A;  1JQ4 A;  4EE2 A;  1L7Y A;  1V49 A;  1OQQ A;  5DPT A;  3DVG Y;  3RNF C;  5DPR A;  2INP E;  3UIO B;  1KF6 B;  2BWE S;  3Q8C A;  3ZKJ C;  1VZ7 A;  4BFR A;  4HKQ A;  2X8X X;  3ZDM C;  2KVZ A;  1MI0 A;  4YSX B;  1WGK A;  3OJ4 B;  1NI3 A;  5IP4 D;  1LQB A;  4C00 A;  3ZUN A;  1JWM D;  3U7D A;  1R7S A;  2KMC A;  2Q5W D;  1WYW B;  5HFY A;  3OJ3 A;  4XYC A;  2BYT A;  2N1W A;  3EFC A;  5L83 A;  1TT5 B;  2BKF A;  2LVP A;  4US8 A;  4B0E A;  2GI9 A;  1SSN A;  2L32 A;  3C8Y A;  4K1R B;  4EUT A;  3AED B;  4AP4 C;  4ASW C;  3U52 E;  2CJN A;  1WGD A;  4GOC A;  2FNJ B;  1IPG A;  5C23 A;  3APC A;  3Q6B A;  3V3X A;  3FC4 A;  1EUV B;  3SU8 X;  3AI5 A;  3ZNG C;  2AQ1 B;  4G0N B;  2LGX A;  3PZD A;  1GPX A;  3TL5 A;  4W9D A;  3LYY A;  1RAX A;  2C60 A;  1R4M B;  3HM6 X;  2KAN A;  3RN9 C;  3RNG C;  4HVB A;  4KSL C;  5J2R A;  5EDS A;  3ZXR A;  2L00 B;  2DNF A;  4WJQ A;  4LNF A;  2PE6 B;  3WAN A;  3R7Q A;  2G3Q B;  2B76 B;  2IO1 B;  3MC0 B;  1YQ3 B;  1V1P A;  1FD6 A;  4E74 A;  2DEN B;  4HEA 1;  1TJE A;  5MPO A;  5E6J A;  2NMQ A;  4ZHO A;  2NCN A;  1D5M C;  4GGQ A;  5EE0 A;  4N59 A;  3DHI C;  2CS4 A;  4DXF A;  1EO6 A;  1WFY A;  4IWQ A;  3Q2A C;  3UF8 A;  4B95 A;  1L6U A;  2W3R A;  3P1M A;  2J53 A;  2IGD A;  5JHB A;  4OZC A;  4MH8 A;  3HK0 A;  3O65 B;  4RFB A;  1TKG A;  1I4X A;  4GDK B;  3JVZ X;  1TZ1 A;  2INN E;  3U30 A;  1WJ4 A;  3MHZ A;  2PVO D;  4S0R A;  2NVU I;  4MJS B;  1UWX A;  1WRD B;  1E7P B;  2I1J A;  2K9X A;  2KC1 A;  4FJZ A;  1C4A A;  3RFZ B;  3LB8 C;  2KJH B;  1HZ5 A;  2G9H D;  2CU1 A;  2BYF A;  2FCQ A;  3QX1 A;  2WDV B;  2BT6 A;  3QCA A;  3A9K B;  3AEE B;  1FPY A;  1PQS A;  4N9F 4;  4HDQ A;  2HTH A;  4FHK A;  4JWU C;  5J18 A;  1QT9 A;  4P16 A;  5D6J B;  4JX1 C;  1GJZ A;  3ZTC A;  4QAY A;  4J3O D;  2NS5 A;  2VZK B;  1OQY A;  4GU2 A;  3QK0 A;  4RGT A;  2NPT B;  1X1M A;  4MGK E;  2LXA A;  4WUR A;  1B9R A;  2CHZ A;  2MJE A;  4ANV A;  1WYG A;  1ZW7 A;  2EMS A;  4YT0 B;  1FIQ A;  4W9L A;  4M8M A;  4DDG D;  2WNM A;  2KX0 A;  1T0Y A;  2AL6 A;  4AWJ A;  5D7G A;  2BS3 B;  2MP2 A;  1WX7 A;  1XXG A;  2WXR A;  4W9E A;  1C77 A;  5J17 A;  3KUD B;  1STE A;  4IM3 A;  2BQQ A;  1ACC A;  3WAL A;  4XDD A;  4TUU A;  2RDG A;  2N4F A;  1FCL A;  2OJR A;  2FCN A;  4EZL A;  1ZXI A;  4A8X C; 
#chains in the Genus database with same CATH homology
 2WXG A;  3AEF B;  3ZQ4 A;  1UUP A;  4ZHP A;  4TQ0 A;  2AQ2 B;  1TZO A;  2KQ4 X;  2ICI A;  3RPF C;  2VZK D;  4OZB A;  4WH4 A;  4P6V F;  2AQ3 B;  1SF0 A;  1JAL A;  3HVD A;  1DOX A;  2R61 A;  1I4G A;  5G5H A;  3FAH A;  3WCQ A;  3DWG C;  2JYT A;  5BMG A;  2JSV X;  1V1P B;  2MH7 A;  3SEB A;  3ZJU A;  1QOF A;  1VJK A;  1VZ8 A;  1VZ6 A;  1DOY A;  3O13 A;  1XLO A;  2NTS A;  1Q10 A;  3V05 A;  1SJE D;  1JW9 D;  1MVK A;  3P63 A;  1L0X B;  1BUI C;  1ESF A;  3ETR A;  3TSS A;  1AWD A;  2Z8L A;  3AB5 A;  4YSY B;  2QMT A;  2HTM E;  3R2T A;  1JRO A;  3T3N A;  2LMC A;  1K51 A;  4LTU A;  4PT5 A;  1I4H A;  1NYR A;  1ET6 A;  2M0A A;  2I2Y A;  2JZP A;  4A90 A;  3NS1 A;  4ZYS A;  3AEC B;  3AEA B;  2IJ0 A;  3N9Y C;  2BB5 A;  2YEP B;  3KLS X;  1QIL A;  4XDC A;  4AQ7 A;  2PW9 A;  1GOZ A;  1CJE A;  4RGN A;  4RH6 A;  2PIA A;  3BK2 A;  2JWU A;  1ZP0 B;  3BVM A;  3I9V 1;  4HKZ E;  4OVZ A;  1JRP A;  1PGB A;  2J52 A;  5BMI A;  1TS3 A;  2PKO A;  1I4Q A;  4FXC A;  1P7E A;  3BII D;  2ACZ B;  2ONQ A;  2LEK A;  4WIP A;  2WXL A;  5H8Y E;  4ZRQ A;  2MJ3 A;  3NUH B;  2PMV A;  1N63 A;  3ABV B;  4YTM B;  2MJD A;  4UDU C;  1N5W A;  1EWC A;  3AV8 A;  4USA A;  2WXI A;  3BVZ A;  2LHE A;  3AE2 B;  3BK1 A;  1YQ4 B;  3HRD D;  3AEB B;  1IUE A;  1CZP A;  2IGH A;  1EWY C;  4MT5 A;  3ZJT A;  4CQN A;  1UNS A;  2D5G A;  1AW7 A;  3OWE B;  1JML A;  1TS2 A;  1F0Z A;  1CQV A;  1YJJ A;  3TEZ A;  1KRH A;  4AS1 A;  1FNU A;  3UI3 A;  3E56 A;  1L6V A;  3P42 A;  4LK0 M;  2K22 A;  1E10 A;  4C80 A;  2FBW B;  2K5P A;  1JWA D;  1FNV A;  4RF0 A;  4WAF A;  1RFK A;  2EEL A;  3GS2 A;  3L4P A;  1K52 A;  2ON8 A;  1J7A A;  1XCT L;  1SB3 C;  1T3Q A;  2G1E A;  1N5X A;  1MHH E;  2W3S A;  2BW2 A;  1ZDV A;  1MPE A;  1FRD A;  2SEB D;  2M19 A;  1XCQ L;  1M4V A;  4D2K A;  4YWG G;  4JWS C;  4H2A A;  1HXY D;  3Q8F A;  2KAC A;  4REZ A;  2QIL A;  1IBX B;  1FRR A;  2WXN A;  2WDQ B;  2PLP A;  1GAQ B;  2W55 A;  2ZW0 A;  1V8C A;  3BWU D;  1N61 A;  3AEG B;  4DXG A;  2E3T A;  4NAM A;  1K53 A;  1RWS A;  4NZL B;  2EKI A;  4HJG E;  4KGT A;  2BB6 A;  1FO4 A;  1TKY A;  1HQR D;  2GRI A;  3IAM 1;  2WDR B;  4KGS A;  3GB1 A;  1BXT A;  1QLB B;  2DYO A;  2WXK A;  5HG2 A;  1HZ6 A;  1P7F A;  2WXH A;  1Y56 A;  4R3D A;  1PUT A;  3NVW A;  2H89 B;  1B1Z A;  1ZUD 2;  4TQ1 A;  1TY2 A;  1EU4 A;  1DOI A;  1FCC C;  1QOA A;  2PTL A;  1IGD A;  4RCO A;  3IXS A;  1SBB B;  3U2S C;  3B2G A;  3VQI A;  3TEX A;  1VR9 A;  2RMM A;  1KLU D;  1KLG D;  1I4P A;  1QOB A;  1J7B A;  2M56 B;  2PVG C;  2RPV A;  4YTN B;  1I7H A;  4N58 A;  1VLB A;  1JWU D;  1ZDX A;  1QOG A;  1L4Z B;  3BYT B;  2FUG 1;  1SE3 A;  2OED A;  5AUI A;  4YSZ B;  4KKJ A;  1T5X D;  4KX6 B;  3DWM A;  2OHF A;  3KQ4 A;  3PZ7 A;  3J9C A;  1T6B X;  3EA6 A;  1A70 A;  3BVG A;  3PZ8 A;  1UGJ A;  3IAS 1;  3IT6 B;  1PGX A;  3P4S B;  1K50 A;  2DLB A;  3U4E G;  3NZ3 A;  4L1B A;  4DQO C;  3ZYY X;  2QEJ C;  4US9 A;  1XEE A;  1SE2 A;  3NVZ A;  3Q8A A;  1WXQ A;  3EUB 2;  1C4C A;  5C3J B;  4MM3 B;  2LUM A;  1C76 A;  2BBC A;  1C9F A;  1IGC A;  1ZXH A;  1TS4 A;  1D5X C;  1EM7 A;  3AE8 B;  1JWS D;  5GXG B;  3VRA B;  5AUK A;  1AYF A;  2DBY A;  3W5V B;  2LHD A;  4OHJ A;  1XLP A;  2WQY B;  1XF5 L;  1ZE3 D;  2V3N A;  4ARC A;  1L5P A;  1FMA D;  1OQR A;  1HA5 A;  3KWV A;  5D3I B;  1N62 A;  4L2Y A;  3VR8 B;  4WQM A;  1KH0 A;  2QSD A;  4B0M A;  1MHX A;  3AE6 B;  2QIE B;  1FEH A;  1VRA B;  1YNT E;  1NEK B;  1TYG B;  3AMZ A;  1ENF A;  3TEY A;  2V0G A;  4KGR A;  1FXI A;  4ZOH C;  1PGA A;  3NRZ A;  1JQ4 A;  4EE2 A;  1OQQ A;  3PO0 A;  2WXM A;  2WXO A;  2INP E;  2Y5P A;  5BYS A;  1KF6 B;  3AE3 B;  5I4D A;  3EGR A;  1PFD A;  2GB1 A;  3Q8C A;  1VZ7 A;  4HKQ A;  4ITK A;  5EE1 A;  4XWT A;  1N60 A;  1MI0 A;  1SEB D;  4YSX B;  1WGK A;  5T8I A;  2WU2 B;  1NI3 A;  1ET9 A;  5HI1 A;  2W82 A;  4MAC A;  1JWM D;  1R7S A;  1XLQ A;  2V3P A;  3TUO A;  2Q5W D;  3AE1 B;  4JE3 B;  4KKI A;  5HFY A;  2BYT A;  4WWM A;  5FKA C;  1TS5 A;  1L4D B;  2TSS A;  1SIJ A;  5EE9 A;  5BYR A;  5TSS A;  4US8 A;  4RNA A;  4B0E A;  2GI9 A;  1YMH E;  1SSN A;  2L32 A;  3C8Y A;  1C78 A;  3AED B;  2ZW1 A;  3FIL A;  3U52 E;  2CJN A;  4NJC A;  4YXD B;  3AE9 B;  1YN5 A;  1E0Z A;  4A55 A;  3ZGZ A;  5C2T B;  4TMA B;  2IDY A;  3V3X A;  2WS3 B;  3FC4 A;  4A6Q A;  4N6E B;  2Y5C A;  2AQ1 B;  2K0P A;  3MP9 A;  1L0Y B;  1UWM A;  1FFV A;  1GPX A;  2Y3A A;  4Q2J A;  4M0W A;  3LYY A;  1HEZ E;  1YN3 A;  2DWQ A;  2WU5 B;  3B2F A;  1PYW D;  2H88 B;  3B9J A;  3AE5 B;  4IDI A;  5BYQ A;  2FE8 A;  4ZRP A;  2J42 A;  4HRO A;  3GP7 A;  2IGG A;  5FK9 C;  2WXP A;  4LLG M;  1EU3 A;  2KN4 A;  1YJI A;  1C4P A;  2X38 A;  2YEP F;  1XO3 A;  2JYE A;  5LNK 1;  3VRB B;  1FM0 D;  1V97 A;  4O1N A;  3SFD B;  1YN4 A;  2N9K A;  2B76 B;  2XN9 C;  2LJI A;  3MC0 B;  1YQ3 B;  1V1P A;  2KDM A;  4C7Z A;  1FD6 A;  2KWD A;  4OW0 A;  1NEN B;  4HEA 1;  1TJE A;  1PDX A;  3SR6 A;  5MPO A;  2KMM A;  3NVY A;  3W1S A;  5E6J A;  2BS4 B;  2NMQ A;  1J7C A;  2JXT A;  4ZHO A;  1FXA A;  2V4I B;  1JWB D;  1D5M C;  4HRS A;  4N59 A;  5EE0 A;  4DXF A;  1KFY B;  3NVV A;  1D5Z C;  5BMH A;  2LGI A;  2JU6 X;  3LXF A;  1L6U A;  1XLN A;  2W3R A;  3HUI A;  3P1M A;  2J53 A;  2IGD A;  1TY0 A;  1DYQ A;  1F2R I;  1WSP A;  4OZC A;  1SJH D;  1ZOY B;  4OZA A;  4MH8 A;  2N9L A;  3Q8B A;  2LFI A;  4RFB A;  1E9M A;  1TKG A;  1I4X A;  2QJL A;  4GDK B;  3URY A;  4RGO S;  1C79 A;  2INN E;  3Q8E A;  2L83 A;  3MHZ A;  4NAW B;  1VDV A;  1KTK A;  3BYY B;  3H8H A;  3P4P B;  3T3O A;  2L1A A;  2PVO D;  3AH7 A;  1UWX A;  1CK1 A;  1E7P B;  3TEW A;  3W2D A;  2K9X A;  2DYM A;  3HVZ A;  1C4A A;  2J4X A;  1RYJ A;  1LO5 D;  1GB1 A;  3RFZ B;  2RDH A;  3LB8 C;  4RGM A;  2AX5 A;  1HZ5 A;  1TKE A;  1ZPS A;  2G9H D;  2WP9 B;  1QF6 A;  4YTP B;  2N0S B;  4C56 C;  2BS2 B;  3P4R B;  3AN1 A;  2CJO A;  1OFF A;  2WDV B;  1SXT A;  5FR3 A;  1DGJ A;  5JXV A;  2BT6 A;  2MEK A;  2BTE A;  3AEE B;  1QKZ A;  1V1O A;  3AM9 A;  3Q69 A;  4JWU C;  2JQR B;  1F77 A;  1I4R A;  1WWT A;  3MFG A;  2WXQ A;  1QT9 A;  4P16 A;  4IKG A;  4JX1 C;  2I38 A;  2K3U A;  4J3O D;  2CU3 A;  3ZJV A;  2XNA C;  5HHD G;  1GB4 A;  4C7Y A;  2VZK B;  3CIR B;  4RF1 A;  3E9S A;  2E6X A;  2HDE A;  4RGT A;  3W5U B;  4WUR A;  1RM6 C;  1B9R A;  2MJE A;  4IOI E;  1QQR A;  2W54 A;  1WYG A;  4L23 A;  1D4B A;  3SFE B;  4GDL B;  4JPS A;  2WXF A;  4XWW A;  4YT0 B;  1FIQ A;  1NVI D;  2WXJ A;  3FIL B;  1E6E B;  1NYQ A;  3AE7 B;  2WNM A;  1FNW A;  3P4Q B;  3VR9 B;  1FFU A;  3R8B A;  4A9A A;  1L0V B;  1IBX A;  1SE4 A;  3KWL A;  1ROE A;  3IT4 B;  5D7G A;  2BS3 B;  3I57 A;  1XXG A;  2WXR A;  5EE3 A;  4TSS A;  1C77 A;  2N7J A;  2KAJ A;  4GLS C;  2JX5 A;  2IPK D;  1JCK B;  1STE A;  2L52 A;  3R2I A;  1F2R C;  5D3D A;  4ARI A;  1ACC A;  4XDD A;  2RDG A;  3MJ5 A;  2SAK A;  1FCL A;  3W9C B;  1BML C;  3BZD B;  1D6E C;  3U7Z A;  1WRI A;  1AN8 A;  1ZXI A;  4A8X C;  2NTT A;  2WLB A;  4XE0 A;  5H92 C;  3CWI A;  5G5G A;  3AE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...