1RYMA

Structure of the group ii intron splicing factor crs2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
YTPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTEQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLVLKGFSGSTERFNLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the group II intron splicing factor CRS2 yields insights into its protein and RNA interaction surfaces
pubmed doi rcsb
source organism Zea mays
molecule tags Translation
molecule keywords protein CRS2
total genus 58
structure length 185
sequence length 191
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 1rymA00
4YLYA 1RYMA 4P7BA 3OFVA 3KK0A 2JRCA 2Z2JA 4FNOA 4QAJA 5IMBA 2PTHA 3TD2A 4OLJA 4QT4A 2LGJA 3NEAA 5EKTA 1RYNA 4QBKA 2NAFA 4QD3A 5IKEA 2Z2KA 4FOPA 4Z86A 2MJLA 5B6JA 4JY7A 4ZXPA 3TD6A 3TCKA 3VJRA 4JC4A 3KJZA 3P2JA 4IKOA 4FYJA 4DJJA 5IVPA 4ERXA 4LWQA 4JX9A 2Z2IA 4HOYA 1RYBA 4FOTA 3TCNA 3V2IA 4JWKA 4DHWA
chains in the Genus database with same CATH superfamily
5CMLA 1KMHA 1Y5RA 3CB2A 3ZE1B 3ZDDA 4X3PA 1MG0A 4HEQA 1R8JA 1X19A 4J7UA 5C80A 4YV1A 4PPNA 3LPNA 2A67A 2EQ5A 4CM7A 3D7NA 2ZOSA 4XOUA 3LCUA 4HG2A 3WB0A 4KPUB 1NVFA 3DBVO 3NIBA 1N7HA 1RYNA 4Y2UA 4NV3A 1B43A 1QGYA 1IWOA 3T0FA 4R0MA 2B7CA 2ZT8A 3UFBA 3R24A 3CSDA 5E2IA 5IDVA 3M6VA 4G65A 3ILXA 4L6AA 3T95A 1SQGA 13PKA 4DY4A 4CI9A 2LKCA 3H1BA 3KUKA 4JB3A 4OK5A 4EHNA 4YRRA 4YHHB 3GFRA 1GGEA 1XTRA 4IGAA 4MJ3A 5ALPA 4TVBA 3VJMA 5C46F 2IY8A 3B6JA 2VWPA 3IBTA 3KJNA 3EZ7A 2G82A 4IGIA 3UJAA 1UMBA 1P9LA 5HVNA 4W82A 2RBGA 3JQPA 4QPPA 2JIZD 2O2ZA 2W0MA 4XYGA 5KYVA 2Y93A 4F3NA 3L7CA 4B3SB 5HK9A 5HZGA 4O2BB 1ZCFA 1C81A 2FEXA 3MJEA 4FSDA 5A3SA 1KI9A 3WKBA 1YTUA 2I9PA 4WACA 2IYSA 1B1CA 2N75A 1T2AA 3C8UA 1U1DA 5ICFA 1UZMA 3PXXA 5AUQA 4XGQA 1QHHB 4YJ3B 4UQPA 5AK4A 5FBHA 2EX0A 3NT5A 3RVMA 4Z4FA 2R6R1 5CH5A 4JC0A 2AT1A 2WIFA 5DHQA 3TRJA 4LOHA 4CVNA 2D74A 1M7HA 5I01A 3PP8A 4BKMA 2D1TA 3EJWA 2OYRA 1PJLA 2Z4RA 2BFDB 4DN6A 1T43A 4DMLA 2W6NA 3E9ZA 1SU8A 1VB3A 4ZOBA 5EWJA 2XUAA 2EW2A 2IYVA 1UDAA 5CVDA 2ZUTA 4V1CA 2VOEA 1DO0A 3U62A 3WTBA 3ESDA 2IXTA 2DHRA 3X2FA 1M8KA 4BLPA 3IUYA 4PX5A 1ZGGA 3IKVA 5HTKA 3VDQA 5C1PA 2IVZA 5HWSA 1EGQA 1I0ZA 4MQFA 2HZ7A 3AHCA 1KQOA 2FMUA 1KAQA 4H3VA 5CB8A 1ZH8A 5A0TA 4YUAA 3OJLA 1L5YA 2PX3A 1K75A 2O6HA 4QYIB 5PNTA 5ABPA 2CLCX 2D8MA 4TTSA 1G3QA 3IP6A 2ECKA 3A37A 4LPKA 1IPHA 4ZOQI 4N49A 4URUR 3HVHA 1HDRA 1CTQA 1QTRA 1DS6A 1V41E 2PX4A 3OLVA 1RMTA 3E5MA 1Q14A 3OTQA 4CV2A 1AOXA 1OYWA 4RELA 4EAAA 1RE0A 3WMXA 2YN0A 2ZBRA 4LYGA 2Q3FA 4JY7A 2GHQA 3PXAA 5KWIA 1DRUA 3TIFA 4AJLA 1S7CA 1E1QD 2FN7A 4ZRNA 4FFOA 4NE2A 4C4SA 3CLSC 3BMNB 3ESQA 3UMJA 2C0CA 2ZRLA 5AVKA 4DKJA 4BNVA 3ACCA 4ZPXA 3MIZA 3PHIA 4IFBA 3BEDA 4M0EA 3A10A 3KSDO 1KK0A 5H02A 2GJ9A 5K1ZA 3VZDA 3GGCA 3SPXA 1HG0A 3SQDA 1USIA 4M53A 2HV9A 1KI7A 2MU1A 1KBQA 3MOGA 1ZGBA 1D2EA 1Y3CE 2BSAA 3O1LA 3P4UA 4IHAA 2BGJA 3TI9A 1IQ0A 3ZCSA 4DSNA 5JVDF 1Q20A 2J07A 1B16A 1GLNA 1QYCA 4KC0A 2FRXA 2O8BB 1B26A 5K3BA 3S70A 1I3KA 3DMYA 3W2EA 1OMOA 3Q9LA 5LZ2A 1XZMA 3K0BA 1HT0A 2QTAA 3OC0A 2O4CA 2P3QA 3N87A 5DX8A 2W83A 1OFUX 1RWNA 2YXNA 1P62B 4E6PA 1S3GA 3ED1A 5AK6A 3NCTA 2GD1O 2VPYA 1BXRB 4KYIB 4DB4A 1N77A 4X44A 5BNTA 1RAFA 2ZTVA 4Q3DA 3WGOA 1PZFA 1M2OA 3MMSA 4RLSA 2IYFA 1NONA 1KFJB 2XWQA 3MZ0A 1OZHA 2C1EA 4RH0A 1ODFA 1W94A 3FPAA 2I76A 3ENWA 3HLKA 5KVVA 4ARIA 1M1NB 2DZDA 3QI7A 4L3WA 1DXYA 1THGA 2XBLA 3PS9A 4XH9B 1G9XA 3GZTB 3JD0A 3RYFA 4BFLA 4G0WA 4TYYA 2FKNA 4BO1A 1YKFA 3WGTA 3ZE7A 2JGEA 1U9IC 1Y8ZA 2XMRA 4YI3A 4FYYA 5F51A 2G1KA 4YIHA 5IJ0A 3IRUA 3PUVA 1XOIA 1TRHA 3AZPA 3VNRA 3EBLA 1SUFA 1AD2A 1X1CA 1H8ED 5CLLA 4AT1A 1R0ZA 1P1HA 2OFWA 2OXEA 5DSXA 2HQRA 1GZSA 1SG6A 3R7WB 1MB2A 1KF0A 2P9YA 4F9EA 1NC3A 1WTAA 5TPWB 1GPBA 3Q5EA 4D8XA 1WUTA 1ZD5A 4GW3A 3HMKA 3Q3EA 4MW4A 3AXTA 3HYRA 4OQDA 3ZV6A 2HHJA 3QE3A 4US0R 3ZQ6A 5DASA 1IAQA 3SHWA 1W4CA 4ES6A 1XQ9A 2VF4X 2PRKA 4CM8A 1JXQA 2V54A 2YVUA 4RZQA 2FUEA 2X41A 3NHRA 1DEAA 1ECBA 3OG9A 2FG6C 5AK3A 5FPHA 3HVJA 2L82A 5EZYF 2CVQA 3FR8A 2J0VA 2WZCA 4ID9A 4K6GA 5EERA 1G21B 2MOKA 1DFGA 1SZCA 3I76A 1JNYA 4P7JA 4LOKA 3UJ9A 4BKRA 4LS3A 1C4OA 2A0YA 3CQ9A 3IH5A 4MW0A 4QJ4A 4QOGA 1DG9A 4RESA 1WCIB 2DWUA 2I29A 2P6NA 4L5CA 5ITWA 1C7JA 2WR8A 1JEJA 2ORED 4MWGA 3WRVA 3G5AA 4JIMA 1CQIA 1DC6A 4BWGA 2ISQA 3ZWKA 2SNIE 1KJ9A 3HB5X 4PV7A 4RIGA 1F2DA 1EWTA 4U7PB 4DRYA 1TJ4A 5BT8A 1ENOA 1TF2A 2V74B 3MWGA 5IMBA 5JV5A 1JKFA 2JCYA 4U9IS 1TF7A 3RFCA 4AY5A 5D3KA 3RLIA 1N1DA 2YWHA 4WIAA 2VDUE 2AUMA 5HRCA 1T5OA 4TV8A 4A8JB 2HNKA 4N76A 1GKIA 1KEUA 4RZXA 2J3DA 4ZXPA 5TQ0A 1RKXA 3LU1A 2OG1A 3OICA 3RS2A 2YHUA 3LZCA 3WMFA 4BX8A 3GOHA 4HVLA 1E5LA 2JIZA 4KXFB 4NR0A 5EMNA 2Z2XA 1UMBB 3OQIA 2V7EA 5DULA 4QVIA 1UZAA 1TZBA 1T4CA 3P5SA 4L3OA 3VPFA 4X92A 3OUZA 3QSGA 3BHMA 3HJRA 2KYRA 2MYTA 3J81A 3NONA 3E5RA 1ORWA 5TY0A 3ROZA 4XDGA 3A1CA 4N7MA 1JJVA 3VO2A 5EESA 1HNWB 4RANA 4Z0HO 4DJAA 3WWCA 1O08A 2WD7A 2ZYWX 4DNXA 4P4SB 4D9MA 2XD9A 4WINA 5C37A 2Y6UA 2GJ4A 2LGJA 2P5TB 1A9OA 1SVUA 3CLUC 5K09A 2D7JA 1WZ2A 1TQ4A 3GROA 4UHEA 1B3BA 2R6DA 4YQZA 2HU2A 3BD7A 4QXRA 4PLFA 1A7KA 1PFUA 2WYWA 1NVUQ 3O95A 3D6VA 4J4HA 1NUTA 2ID9A 5B1SA 4F5DA 4J03A 2GBFA 2X0FA 1SVOA 1G5HA 2BBWA 3PQFA 4N39A 4EAQA 3EVFA 1YBHA 2GCOA 3ANSA 1ZIOA 3NBFA 3SGLA 3SICE 4Z8YA 5JXIA 1EFHA 5KYWA 3FTEA 2MSWA 3UHAA 1D8TA 2QE6A 3WK6A 4BGUA 1VCHA 4CTNA 4KXMA 4E2ZA 4RF4A 5AVTA 3L02A 4MPTA 3ONNA 4B80A 4TS4A 4C89A 3RJTA 3UK7A 3DKIA 3DOHA 3WLNA 3PITA 2KBEA 2X1LA 5PGMA 4XQEA 4XUDA 4D1YA 5JRDS 5AKJA 3F6RA 5BV7A 5B4TA 4RH3A 5TT1A 3OIUA 2WF6A 1GAJA 1ZSNA 3MRSA 2O50A 2FMHA 3B78A 4I5EA 4A0FA 1TQ2A 2VR1A 3PNSA 4EG6A 4UTRA 4FW8A 2XOKA 4TYQA 4PANA 1DAKA 4XGIA 3AOGA 4D0GA 1X1AA 4P35A 3JQEA 4EHAA 1JYEA 4KN9S 4A8PA 3ECAA 2IIQA 2PH5A 3HLYA 1OH7A 2WOOA 1D03A 2FX3A 2DHQA 5KU1A 3LVFO 4YRMA 3F4BA 2DT8A 4CCSA 2H4WA 4EMUA 3PDIA 3K16A 1DJLA 4MQUA 2IYQA 3WOHA 4LJ9A 3EMDA 3BK1A 3ROEA 3ZLTA 1U3WA 3CVXA 3X43A 1CVRA 2O57A 2PRSA 3O47A 4GQBA 2JEYA 1C9JA 4RK0A 5ALLA 2QS9A 4NZOA 4OSEA 4Q7QA 1MUUA 4PCLA 1OVGA 3D6MA 2GAFA 3IVCA 5E7QA 4LRSB 3H8VA 4QUDA 4L4XA 2EQAA 1RRVA 3FJYA 5AR1A 4UUNA 4AZ3A 2WVAA 4HDRB 1N2OA 2AA3A 3A6GA 4AUMA 5FUQA 2O3QA 1Y1PA 3EC2A 1CY8A 1P4HA 1YQ9A 1IBCA 2WINI 2Q45A 2X9LA 3CU5A 1X9IA 2VHQA 1I9GA 5ECDA 3ZWQA 3TTSA 1FTSA 4NESA 1JKIA 1I8TA 1OXMA 4OQEA 3WKAA 2PE5A 4DJEC 3C6ZA 1L5SA 1XNJA 2JF0A 3PC3A 3SJUA 5EGNA 1IQRA 3HL0A 3BQMB 3H5LA 1CJUC 1WXHA 2BGRA 1WCXA 4K6KA 3RF6A 3GAAA 3WKCA 3SSMA 4KFCA 4L27A 4DWVA 4CL2A 3MM4A 3L4BA 1MR3F 2PVPA 1OQAA 3I05A 2HCBA 1WDLA 4UU8A 1YS7A 1QDUA 3BOSA 3KKMA 3OT1B 1LRLA 1E4EB 3DKRA 1NP6A 3F4LA 3T3HA 4EA6A 1EIWA 4PTYA 5GVRA 4DL9A 4E70A 5FWXB 1QYRA 1MJ5A 1DIGA 5EIEA 4D4IA 2B92A 4XCXA 1AQ6A 1GN9A 1OASA 4NZYA 1Y6FA 2GXAA 1CF4A 3CZPA 3LQKA 5EPEA 2PFKA 2MHCA 4HYEA 1MOQA 3UJHA 4DEYA 5B6IA 1U8CB 1YL6A 2RGRA 2B7LA 1GRQA 4L0MA 4NXNB 3FRIA 2GXQA 3ICVA 1XKXA 5AKXA 3AINA 1P0MA 1GZ4A 5IKEA 1IOVA 3OQVA 4ZQIA 2BMEA 1J07A 5K3FA 2VC2B 1I6MA 2IEIA 3ONDA 3ISTA 4DR1B 1JG3A 1CRWG 4CYMA 4GGMX 1WETA 2RAUA 3TS1A 1CY1A 1U2DC 3VSCA 4IQFA 4QEKA 4H6PA 2HLDD 4MARA 4YRPA 1AH2A 1UIMA 2X0RA 2XCLA 4NWIA 3I1YA 2LE0A 4E30A 2QMHA 2FNAA 2EIHA 2WTMA 4YTEA 2CBZA 3UAVA 4LCJA 4CM8B 2C7OA 1LSSA 1V7QA 2HRRA 2EW8A 4U63A 1LKZA 2YXPX 4MQ6A 1KPHA 1ZH6A 3CH4B 3ZW7A 2ZUFA 2ZYRA 2PJDA 3COVA 3T5MA 4ZZ2A 3T99A 1K68A 3DWGA 1IEQA 2PKYX 3HBNA 3WQBA 3GLFA 2YMQA 3K94A 4DA0A 5TT0A 1G21A 4RSMA 4R16A 4I9FA 2O1XA 4N5NA 1DLIA 2YXBA 4ER6A 3EEYA 5C3UA 2NADA 3C3WA 3K5PA 3BQ9A 1IY8A 3FYUA 1SHJA 3ANTA 4JC4A 1IY9A 5D3MB 1Y4SA 2W37A 3S2UA 1W25A 1N3YA 3S1SA 2MSDB 4MUHA 4CR6A 2ZGVA 4YUWA 1U8FO 4DIFA 4BFXA 4Y1RA 1T2NA 1FUEA 1QX4A 2JCBA 3U6BA 2B1IA 4B4VA 1DKRA 1ZD8A 4S1OA 5TNXA 2Q4DA 4YJDA 1G5TA 2F3UA 1E6CA 1B73A 1B7GO 1P6QA 1QZ3A 3MT8A 4IDDA 4WZAB 5FYQA 3U0BA 1VIYA 3WB2A 3HCCA 5A4IS 2DBYA 3FPBA 1A2OA 4RY2A 5CNKA 4EY4A 1ACJA 2ON6A 4K1LA 3QQPA 3X1ZA 2PMCA 1SN7A 5E38A 3H65A 1T9CA 2QU7A 3KCQA 2CNKA 3OQIB 4RLHA 4Q9IA 4EBFA 3DMNA 4M37A 3N5KA 5DM60 1IB6A 4UQLA 3T35A 1E20A 1Y82A 1CERA 2GN8A 2FPGA 1KP2A 4IDQA 1BXZA 2YZKA 2FWRA 2G6BA 4DG5A 1IONA 3PHBE 3I53A 1MA3A 4FMCF 1GUAA 3OUUA 1DOHA 2O8NA 2RC5A 1K98A 4FYKA 5TPZD 1GQOA 3H84A 1E2FA 3A14A 4LWOA 5EYPB 2OPHA 4RY8A 1VGRA 5DM1A 2FJPA 1XI2A 2B5OA 3IURA 4JQOA 1ZI9A 3X1JA 4BVHA 4CF7A 4P38A 4QUEA 3LUAA 1P4SA 4Q0MA 4LRXA 1TU4A 3HFSA 4TX1A 1BEUB 4TLEA 5ULLA 3S1AA 4L4RA 1YZUA 1KMMA 1SCQA 3NKVA 4Z0TA 3ZH2A 3TLCA 5F7OA 3VTKA 3N8DA 4UHDA 1ZSVA 1H1DA 3O8DA 1MBZA 3P2MA 5I7WA 5CLIA 8ABPA 1VCNA 2QVYX 1EVQA 4NF2A 1D07A 3BFVA 5ADUS 1YDHA 5CVUA 1T6ZA 2BKUA 1V39A 1Y8RA 1ZD1A 3LT5A 3TZLA 1QHXA 2IYXA 2Y92A 5KYWB 3ZY2A 2J6HA 4WOKA 4FFSA 2CKDA 5JANA 1IDOA 2C9OA 1B74A 1GG9A 1VHDA 3RHSA 4YMTA 4ZGGA 1V48A 1LEHA 5AVJA 3O8RA 2ZM6B 3HM9A 3GN2A 1KMIY 4BZQA 1OJLA 5M5BA 4DR3B 1N2BA 4R1NA 3O4IA 3EVZA 3WJ2A 1AHPA 2O7VA 1PDOA 4H0FA 5EKTA 1FMTA 4XE5A 1GG2A 3U7RA 4E46A 4L8GA 4DV7B 3FBTA 3QE9Y 3DT9A 2I65A 4QVKA 9ABPA 3NXSA 1HNNA 4E13A 3NAZA 2CSUA 2BD0A 1ZI8A 4OA5A 1M2OB 2QJFA 5FL7A 3BCHA 3TNDA 3UYLA 1XWFA 4F2WA 3ZGZA 3L1VA 5JJ5A 1YB1A 2XE7A 2OLJA 2FU5C 2H29A 3EULA 3PDHA 1U8ZA 3L41A 3MWEA 3WAGA 1O0CA 5JALA 1AKVA 3DMTC 1P4GA 5BWMA 1MMFB 4DQXA 3AC0A 3KQUA 4RDCA 1E0KA 2PVSA 1D04A 3BJRA 3P2YA 4FR0A 2IOFK 4PHFA 3VSEA 4R8LA 3F6EX 4GL4A 2PD4A 4WY5A 3MERA 3MJFA 5FAXA 3CRQA 1I5OA 3A1SA 3M5DA 3IBCA 3HXQA 4TT3A 3TO5A 4DMKA 2Y77A 3R3YA 4XVRA 3U60B 4A36A 2ZXUA 2GBPA 5G53C 3IMFA 2QLLA 2XWBF 1K7YA 3HUFA 4WL0A 3EEQA 3ICCA 5DMHA 2EX1A 3KEQA 4FK8A 3KV3O 2P9ZA 2VCYA 4N12A 4F7DA 5LXTA 2DOKA 4FFMA 2M6LA 1AHIA 4NJEA 4RM2A 3Q7SA 4GI3A 4I1VA 5JQGF 1TZKA 5DXJA 1F0NA 4B6QA 4Z9XA 4C04A 3RAFC 4KR2A 2HF2A 3OJEA 1XKLA 2ATXA 4JU9A 3DKPA 4IFTA 1GHTA 2FRDA 3CX7A 4L5JA 4XDZA 2QRVB 1JP7A 3MK31 4QWWA 1LDGA 2RCYA 2FN8A 4R9SA 4WZZA 1DKOA 5F33A 3WADA 2R0QC 4E5UA 2V97A 2XMPA 2GXUA 2FG5A 7GPBA 4DB2A 1BVHA 3RABA 2R4TA 1TCAA 4XLZA 1MNQA 3PSAA 3WMRA 1L7MA 1X0XA 2ZVPX 3UBMA 5IPFA 1B6TA 1I4TD 1LBTA 2IX9A 4DTIA 4FLEA 1IE3A 1P3JA 3N2IA 3EGDB 2H92A 4U0KA 3VPSA 2ODAA 3CA8A 2OV4A 4FNAA 5K0NA 4Z0PA 5JZ9A 1SUIA 3SYTA 2AEEA 1O7JA 1XTKA 2HMSA 3SD7A 5A2GA 1OXXK 5LUAA 4PW0A 3H42B 2Y2UA 1R66A 5MFPA 1BZYA 1CQIB 1WJGA 2H1LA 1PL7A 1PU2A 1A72A 1RT9A 2WMYA 4NATA 5FUYA 4E5DA 4MRVA 2Q3HA 5IT0A 1DT5A 4X6YA 3BK2A 3BL8A 3RTCA 3DGFC 2N46A 3CG0A 3H2YA 4KQ6A 4Q37A 4QQKA 5ERXA 1E1RA 2F9FA 3ETCA 1LUAA 5K0EA 2XHEA 2V55B 4G1FA 3QMPA 4NCKA 3FMGA 4ZEWA 4B9AA 3NTRA 4BBAA 2L0XA 2CXOA 5TRTA 3WC4A 1KRXA 2HM7A 3DBOB 3KOWA 3PUZA 4HJRA 2EKBA 5IK2A 3SBDA 1KO1A 3LC7O 5JXGA 1RZVA 2CHGA 1N57A 3Q72A 1O03A 1ZUD1 5BV2P 1ZGAA 3CX3A 3KLPX 3T61A 4I66A 1M3SA 2MYPA 2QUAA 4RWEA 1G8MA 2XZDA 4D02A 1PEYA 2PWZA 1UPCA 1ZMTA 4HDMA 5IT5A 2WTUA 3ER8A 1U6JA 5J4HA 4BE7B 1Z2EA 4I8XA 1UBFA 3L0DA 3T4UA 4ZOCA 5LB2A 5ELLA 3DEZA 2JAWA 3D6FA 1PWEA 5DXAA 1PP4A 2X6TA 4LMAA 4UDYX 4DA9A 5L45A 3PWKA 4TUYF 1UWVA 3C1TA 3M1LA 2QVLA 3LRPA 3ONWA 4FX2A 3REOA 3SSOA 4CG0A 2X4DA 2R5WA 3GV0A 1C0KA 3DWIA 4NABA 4IVNA 5IVDA 4ZJZA 3GJRA 3PFFA 1VGQA 1NU6A 2EFGA 2PWAA 4FONA 1ST2A 1TKBA 4DDMA 3DR3A 3TUZC 1K08A 4MJLA 1F4LA 1OAOA 3M6AA 3PCXA 4BV8A 1Q1QA 1XP8A 2FMFA 5LQMA 1R0WA 2G4VA 4BFWA 1TYBE 2JLSA 3KYDB 1DHTA 2AJCA 1G2IA 3KP1A 4CMCA 1W0CA 1ZESA 1XKQA 2FHPA 3FJOA 1IM5A 1N7GA 2VRNA 1OVMA 4GZLA 3C7AA 5EMKA 1DIOB 2HWXA 2HIAA 4D5EA 1ZJ4A 1D5WA 3F49S 3OZCA 3MSXA 3KSAC 3MAJA 1DWQA 2YC2C 1J7KA 5E6UA 3L7NA 4PWYA 3USCS 4CDNA 5FULA 1FDRA 3OCCA 3GMSA 4G5OA 4ME6A 1QB8A 1XO1A 3I23A 3KR2A 2DQSA 3K35A 4KZKA 4O4LB 4R1MA 2Z5GA 4CNQA 4PFSA 1GNPA 1Z62A 1WKBA 2I62A 3FF4A 3G9XA 4O0LA 1A9RA 4TKUB 1QGED 4WVLA 5COBA 2O8FB 4ZC8A 1GPWB 1GL9B 2L2QA 2QYSA 2EZ8A 3AESA 4R1QA 4EJSC 4G01B 3MMZA 4HNUA 4QZVA 4FJ0A 1RE1A 2BSQA 5KOYA 4KSYA 2QW8A 4QJ5A 2BL4A 3UN1A 1M2KA 3L0SA 1KSHA 1RQRA 2C04A 3NHLA 3G2QA 3QI2A 1DKPA 5K0CA 3O74A 5T5QA 2QI9F 3S27A 2DX7A 4HOYA 1Z5UA 2QTMA 4RD0A 4RIHA 1QKKA 2NNWB 1E1KA 1M34A 2LKDA 2Q9BA 4D8TA 3AR3A 4JI4B 4DCSA 2XW6A 2QRMA 3BD9A 1N2CB 1XD2B 3EUAA 3L8HA 4IOLA 4AZ3B 4V1CI 4GBGA 2FQXA 4YLGA 3EISA 3TQFA 1MO5A 1QZUA 4HAOA 5FL7D 2PZFA 1NOJA 4KE7A 1E1NA 3KEOA 5E4YA 5H9WA 4RPGA 4D6XA 1UBUS 5DCYA 4JJ6A 3U9TA 2FEMA 3AEXA 1E58A 3RWBA 2N1MA 2ZRCA 1PJBA 4US2R 1X3SA 1BVUA 5THKA 3CLVA 5FB3A 5U1PA 5D7BA 3NHSA 4E15A 3UC9A 1UBRS 2VBGA 4DR4B 4RL4A 3PEUA 3HP7A 1BO6A 4H3SA 1SXJA 3AUKA 3H0EA 5LD2B 4WX2B 1POWA 2XJ4A 2R00A 3D5TA 1M74A 1PWYE 4KSBA 4CQMD 2NQTA 1JMYA 3CWCA 4I55F 3CRRA 1E3WB 1OT3A 1WOYA 1SXPA 5HKLA 5CJJA 2VJMA 2YVQA 4N0MA 3G5UA 4R71A 2H3HA 4QNNA 2ZAIA 1VP3A 1XDSA 4RJJA 1H8EA 4MWTA 2GHIA 1NJGA 1JE1A 4PLTA 4Q05A 4TT8A 5A4DA 1QFXA 4LQCA 1K4KA 2KSQA 1QLHA 2P2SA 5KTTA 5CD1A 3QWBA 2BJVA 4AY6A 2REOA 3ELBA 3QU7A 4OYLA 3AILA 1ZNWA 2YFKA 2Q7DA 3ZDFA 4EZIA 3HXTA 5CYGA 3V1TC 2FUKA 5I9SA 3CNLA 2ZE6A 3MJSA 4XLLA 3RREA 4P0QB 4TWIA 1FU7A 1S3IA 2XD4A 4V0NA 2X14A 2A5GA 1QHYA 4GPZA 1GNQA 2ZBPA 3DNFA 4DC9A 3N2ZB 1RXWA 3EQ6A 1EX6A 4C05A 1I1QB 5JY1A 3VR2D 2ONCA 2PZMA 3LCCA 1PZHA 5HYVA 3W6ZA 1UQUA 3QPAA 1DJMA 3EOZA 1ZAYA 2QTTA 1BCSB 2O8CA 2CK3D 2ACKA 3C5VA 2QX7A 2JVJA 5JDIC 2JKVA 3ZDAA 4KR9A 1PDVA 2PD6A 4BO9A 3ISJA 4Q4HB 1VJ1A 3I9V6 4GPAA 4Z9AA 1YK0A 3SC2A 4RIFA 3TRHA 5M29A 2E37A 3MWDA 3FPEA 3EGDA 1P8AA 2YASA 4ZO8A 3LYUA 2H2HA 3KOMA 2AFHB 3V8EA 3DZIA 1G8JA 1Z22A 5AYVA 3MINB 1ATZA 1DPGA 3H8WA 3K0FB 3KWMA 1GCOA 3L05A 4O4JA 1Y8QA 4EL5A 5KQPA 1NFRA 3RK0A 4UAVA 2F3RA 3BSWA 1V8FA 1J8VA 3A06A 3A6ZA 5EOVA 1N92A 1Y9EA 3EODA 2FN3A 4QJBA 1CIJA 5LOVB 1O6GA 2EL9A 1J0BA 2ZIUB 1T0JB 4OHFA 5DOVA 1YZQA 2FEAA 3EA4A 2R7LA 4O33A 1DIBA 2Q7XA 3BXZA 1CYEA 2FKAA 2V1UA 3EXEA 3KE9A 4C22A 1F51E 1YQQA 1BH2A 1ES9A 3P9SA 1R6BX 4KQFA 2XVMA 621PA 4QGAA 3ZWWA 1ND6A 4ENWA 4QHYA 4EY6A 2XVAA 6YASA 2QRLA 3QV2A 2XE6A 2PCLA 1YULA 3E53A 3VZRA 5AXBA 4Q02A 3KEGA 2J7KA 5BRAA 2J6IA 4J9VA 2P8JA 4J6EA 7ABPA 3K31A 1VHLA 3VVBA 3R5KA 4HZGA 3A0UA 4RQBA 2P6MA 2Y9MB 4MHSA 1UJNA 1MZPA 2C5GA 2NT4A 3O8NA 4YP0A 5ENDA 3OFJA 7REQB 2VP3A 4LHSA 4BCBA 3ELYA 1GDTA 2QOEA 1ZFNA 2LWIA 3ZZ1A 3UUWA 1QH8A 2W4QA 1QGDA 3D0KA 2E21A 1NKSA 5JZBA 2AWOA 1JAIA 3WZ2A 1T8YA 1NLFA 1QCCA 2C8LA 2FQQA 2UZ0A 3W3AA 4BNWA 3CEJA 1NY5A 4K9RA 2I3BA 5SV2A 1XTSA 4TUYB 2PLNA 1T25A 1AUOA 2A9JA 2BFEA 3DA8A 3Q8XB 3B7PA 1G1AA 2QVBA 1GPDG 1Y3BE 2ZVJA 2OCLA 3EQZA 4PSDA 4S1PA 4DNQA 1N2GA 3GEDA 3I92A 5C35A 1CBUA 3QBEA 3TRKA 4F46A 5NULA 1HF3A 3BMQA 3IHTA 5AI9A 2I3DA 4EJMA 2AOTB 2Y4OA 2VHJA 3IMEA 4XDHA 4QGGA 3K15A 1F9AA 1G3MA 1LPPA 1W4ZA 3SQLA 3NAQA 1P75A 1G2PA 1U8AA 5CFZA 2Q07A 2IHZA 4UEJA 1YV9A 2VNIA 5ALRA 2O5CA 1OXSC 3RS3A 2ATIA 1HLPA 3AVUA 4N48A 3H4MA 1VI2A 4XD7D 5IW8A 4XIGS 1RW4A 1B42A 5FWXA 2WF9A 3MWEB 4TLCA 3TGWA 2O3SA 3EZGA 3N0TA 4OUDA 2DCMA 3N0WA 1VRWA 4FFLA 5H4HA 4QOEA 3KYBA 3Q9NA 4OQNA 4JGIA 4O4LF 2QE7D 2XR1A 5G02A 5CBPA 1QMPA 3IPAA 2B36A 3CZ4A 4MA5A 3DNMA 5BSEA 4OVKA 1CUEA 3HH8A 4TL7A 4YCSA 1IOZA 3THWA 1X8LA 2PSEA 1O8BA 2CNWD 2YC4C 1MPTA 4D2IA 4CMEC 4M86A 1RFLA 3HKBB 5JO9A 4CGYA 5KEIA 1U0JA 2RMKA 1A2KC 3BH7A 4G07A 1YR8A 3PQDA 3ZIDA 2XB2A 5IKMA 3BJIC 4ALLA 3QTBA 4HN2A 2WWTA 5J47A 5D7NA 4B4WA 1AMNA 1BA3A 2I2CA 7MHTA 4F2HA 3NGMA 1DEKA 1XXHA 1BHQ1 4YRCA 3NC4A 3V8BA 1LY1A 3FOCA 1XK6A 1UKBA 2OORC 5IHPA 2AD1A 3JR3A 3QE4A 3LOUA 1H4QA 4RV9A 1TB4A 5DTJA 1HY3A 3T7SA 3I61A 1QNLA 3VAYA 3K4QA 3A9SA 2F48A 1AXEA 1DBVO 3MB5A 3PKZA 1ZP6A 3H1AA 3SFVA 3E9EA 4ZI7A 1C9EA 2ORYA 2HIGA 2IELA 2Q9CA 2Y1XA 3R5HA 2XZOA 5DISB 2I4TA 1QPBA 2EYUA 4N9WA 1TC2A 4O4IF 3ER9A 2PMDA 1UT6A 5GGXA 4TMFA 2ZZNA 1Q0PA 3FB1A 5HM6A 1RVV1 4C29A 5KSPA 2VDQB 2XZPA 3RUIA 1FFSA 2OBBA 1U2QA 1XYVA 2C31A 1HH4A 2AUNA 2J59A 3ADPA 1WXGA 3GJ4A 4NZZA 4PAWA 1EMDA 2HHLA 2GILA 1ODKA 2BGMA 2IDZA 1UK6A 2OEPA 2ZYUX 3H75A 4LCBA 4MUMA 2JDID 1QIFA 1SOAA 1KEVA 3H11A 3O0TA 2R8BA 3CIOA 4G8DA 4DV4B 3WIUA 5CG2A 2VH1A 3D0RA 5EEHA 2WAMA 3L93A 2EAUA 2BZ1A 3WL3A 5BW8A 4C76A 1UDXA 2VRCA 3AGPA 5TIIA 2CNDA 2P2LA 3I2YX 3OKFA 1O94C 1SNYA 3LUCA 4EVRA 1CV2A 2AN1A 3NJ8A 4WNIA 1MQAA 1CHDA 1E2LA 1XQXA 2Q3CA 1GT6A 3C3KA 3CCCA 4BC0A 3HJFA 1GEGA 4F1KA 1C0LA 2P3SA 3PD7A 5EKSA 2GCIA 5FWNA 5IANA 4HDKA 3CZQA 2WBLC 5TMBA 1QHSA 2Z9DA 4CG3A 4BFUA 1Z4IA 2KX7A 4KAJA 2GX6A 3PRKE 5B53A 4TLBA 3U0VA 5JMOA 2C7QA 2FPGB 2QENA 5FWAA 3STXA 4JODA 3V32A 1BE6A 3B12A 3RK1A 1U6IA 5CDGA 2NVUB 3R7SA 3UK1A 5CM9C 4XWWA 4EFNA 2PQ2A 2WMDA 3IPCA 1I33A 3IQXA 1ILWA 3N53A 3W4IA 4URYR 3RSOA 2ISSD 2RGCA 4YJ2A 2UXCB 1MVNA 1C29B 2CXUA 2NAFA 4L28A 4QTUB 3WLJA 2BH2A 1TD9A 4J1QA 3O2JA 2YZGA 2BLLA 4C30A 3VJLA 3LSYA 4MOWA 3GIWA 1RC8A 1LSUA 4BDTA 2V6IA 2CJWA 2WK1A 2ZUEA 4EIWA 4IZIA 4PSUA 4MLCA 2PKCA 3B85A 2DC1A 4MV8A 1V1JA 2NZVG 3F6SA 4FS8A 3SHFA 2OGZA 1CDOA 4JLNA 4NL4H 1R1DA 3L1KA 4H1WA 2FDCA 1UKAA 3JQFC 1VSBA 3JYOA 1SG0A 4FMDF 3QVMA 4M98A 4TMXA 2H4ZA 3PFCA 2QUBA 2ZIFA 1SQSA 1TEXA 2V0CA 2YZ2A 4I3GA 3RS7A 1ID8A 1NX9A 1EQ2A 4J2TA 4YCJA 2IXEA 4FFPA 1NNEA 4X20B 2CYCA 2JI8A 1C50A 1J49A 1TTPB 3N86A 4JL6A 4KYVA 2WHRA 1J70A 3M1YA 2P69A 1MOSA 4JSTA 5IULC 1BW9A 2F62A 2J5XA 1MVOA 1FUKA 2VJKA 3BDVA 2XB4A 3GJ5A 2ZU6A 3JYQA 1M1YB 3EFOB 1JEOA 3F8SA 3GJTA 3KFVA 3KVYA 4MROA 2QX4A 3LHDA 4QWMA 3T8YA 3TMKA 4DJ5X 2Q41A 5FNVA 1LFDB 2R6FA 2FPXA 2FV8A 4NG4A 1FXWF 2G9RA 1OU0A 2ZTUA 3P1JA 5LQUA 4MEAA 2XGOA 5DLDA 4A5OA 5C7YA 2JBWA 3WWDA 1CS4C 4MCHA 2NXEA 6LDHA 3J7AC 4PFKA 1ZD2P 1ONPA 2P67A 2ZDHA 4BQRA 1E7YA 1QH8B 2CNBA 5EIOA 1FQJA 3EC7A 4HSEA 3Q87B 4D56A 1Z6AA 4D81A 3K92A 3NM4A 4ZK2A 4ZVNA 4MAFA 4BUZA 3UQYS 4KU4A 1R0SA 1U2TA 4AKTA 3EG9B 2X0EA 3IBYA 4IOMA 1SZJG 5IAKA 2XXAA 5CK4A 1LS1A 2B1GA 5AI8A 3BE5A 2JGIA 3DFIA 2OGSA 1PSZA 1MIHA 1QNFA 3TRIA 1O89A 2QLMA 2PA0A 3CG4A 4WTOA 3AVYA 1EK0A 3T1TA 1FNCA 1H4TA 4J3JA 2XVZA 3ANMA 3S2IA 3HKDB 2E1RA 2I22A 3SQWA 5LMUB 4ZYUA 1WTCA 3FVQA 3AVQA 3QYPA 3T4XA 4D9IA 2HMUA 2WIGA 4ZT6A 2TS1A 4N41A 1CJTC 5ICCA 2BMWA 2P27A 2X7XA 3AWIA 3KIPA 1JF8A 3QH4A 1XGKA 1QCYA 1XT6A 2HA4A 5EY5B 3AF6A 2PV7A 3INYA 5DZSA 1F60A 1UAYA 4WCFC 1AS3A 4BYMA 2OFPA 4QYTA 1V3QE 3R9KA 1FP1D 2E9SA 3LBYA 4H16A 2HRBA 1ECFA 4M8NE 5GV8A 2RBEA 2VBCA 5CBPB 4FLFA 4WPGA 1X2EA 2O8VA 2PX0A 4ND6A 4IMJB 3QYFA 1KI2A 5JXJA 4PG5A 2C4VA 3KVRA 1JHZA 3R0IA 5AHRA 5KSYA 4GVXA 3QKSA 1YKGA 4M0UA 1H2HA 5J5CA 1G63A 3UT6A 1RPZA 1N8KA 1DC7A 3UWSA 4GXTA 4EJFA 2JIMA 4NBSA 1U1GA 1PJTA 1XU7A 2PGIA 1N1EA 3BWDD 3WGIA 4FOLA 3PLNA 4K03A 3DLCA 3TEJA 3LK6A 3HY6A 5LKAA 3K05A 3DLAA 1Z74A 3QVLA 4IRXA 4LJSA 4X61A 3V48A 1ZXXA 1GA6A 4FFBB 4N8SA 2WIBA 4HSGA 4C4TA 4N4AA 4A73A 5JPCA 3IHKA 2HBQA 2Z2ZA 1KJJA 3O9VA 1S2OA 1XHEA 2J9XB 3FTNA 1V7CA 3JWEA 3O92A 5IBQA 3VVCA 1RQ2A 3QSYA 3TBFA 3UHOA 1IVNA 1Y1TA 1DFHA 2JFWA 1Z2OX 2B7BA 2P0YA 4CLXA 3MINA 3QMVA 1FVXA 5F5XA 3EXAA 1YD7A 4L22A 1MO4A 3I45A 4BLQA 5L7WA 3OZWA 3GA7A 3O8OB 2VFAA 4M8SA 3REGA 3H7AA 2Q4BA 1SXHA 1UC8A 1GTVA 2SKDA 3HDTA 5EP3A 4U4AA 4I50B 2C77A 3O8QB 4FM9A 2UZ3A 1NASA 4NFLA 1NPTO 2YTZA 2Q2NA 4PYJA 4GEGA 4LZWA 1Z4MA 2Z83A 4UFOA 3M3DA 1ZR4A 2VUHB 1X7YA 3SBOA 2VDJA 1ISRA 1J2JA 8OHMA 5C1DA 4R84A 3K53A 2R6GA 1CD5A 4E33A 4JNCA 1HYBA 2WB4A 3WL4A 5L3QB 3OE1A 4H1UA 2H48A 2O7SA 2VHUA 4RWZA 4MQFB 3CJQA 4P84A 2REXB 4BU1A 5JAPA 2JFBA 1SCKA 1CEYA 4WK2B 3LDFA 2OK8A 5BURA 3BB1A 1ETHA 3NBQA 4MVJD 3QTTA 2EFEB 4Q9LA 1LBSA 1UMDA 3KXIA 3HRHA 1K5HA 3KYIB 4YC7A 2BFWA 1K0UA 3FNIA 3CJTA 4RNDB 5CUQA 1V71A 4ZZ0A 2OYSA 2W8BA 1XMVA 3LGSA 4CKEA 1T2EA 2DCUA 1CRLA 1DAPA 1PX2A 2XIJA 1URPA 3K9WA 4IV8A 4E1VA 5CB6A 2JAPA 2H3EA 1DAMA 2PGXA 2VF2A 1V1RA 4K9PA 3DV2A 3KK0A 4CMJA 4NEHB 4OA8A 2BKVA 3DV9A 3U19A 1F2UA 2MYUA 3EHDA 3GPCA 4CDRA 2EV9A 5DTRA 1YU9A 2RJOA 3I83A 4UOZA 1Z82A 3SP1A 4AXXA 4G0QA 5EN4A 1J5PA 4HNAA 3VHLB 1LWNA 2G9ZA 1VE1A 5FI0B 4C0LA 5BMOA 4TKUA 2CMFA 4N7RA 3TIXB 2Q3DA 2QN8A 3GCZA 3KJZA 3I2HA 3PIIA 4L8YA 2PT6A 1OFHA 1B8VA 4YROA 1DU4A 4ZQBA 2JZNA 3ZYZA 2O5VA 2HJRA 3AEKB 2O2IA 1ZBQA 2APJA 3OIWA 2NU7B 2NXJA 1XU9A 1E3SA 1NU8A 4GF5A 5IWCA 1P5JA 1ZRMA 3HRIA 3PXCX 2GK4A 2IEDA 3QRWA 5JCOA 1N5KA 2VDRB 1K5GA 4TQGA 3MFYA 4MS3B 5SZJA 3LC0A 4MYDA 4R54A 3B6KA 1GFZA 4M55A 2IWHA 3UYKA 4QYSA 1EA7A 2RHWA 2XNHA 2L18A 3VPGA 3C1OA 1TCBA 1RWKA 5AMXA 1YVPA 4WNAA 1IQUA 5JD4A 8ATCA 5CVVA 3E5NA 3P9RA 4FSHA 2WY2D 4DMGA 4BEWA 1PK8A 3UGKA 3HCRA 1S9DA 2C42A 3WWYA 2HA7A 1ZZGA 1T0HB 3CLTD 4A2QA 1VLMA 1KETA 3LBHA 1MENA 1VBKA 2DYKA 3OA2A 4OMCA 5CPFA 1JYFA 4CBVA 3A7DA 3JZFA 3W5DA 1I13A 3GZNB 3SR3A 3HDGA 1AKWA 2QL7A 5CX1B 4LY0A 3WBJA 1M1NA 1ORIA 1DI0A 2JK0A 2MIIA 3B9RA 4JI6B 4CDMA 5JYBA 4DUGD 4M9SA 2QGZA 1NUAA 1JXOA 1EFKA 4JLSA 2X9GA 2VLBA 3CVYA 2AJLI 3T9AA 1F7VA 1Y0BA 1JQKA 2ZJ1A 1CUFA 1SHKA 4XSHA 1Y3DE 4IF6A 2J09A 1K5DA 4UFNA 2X0JA 1E2UA 3IPRA 5CW1A 3PEEA 1MD9A 3NHZA 1XNGA 1CB0A 1CDZA 3G2JA 1M75A 4P82A 5H3LA 1W36C 2OM6A 4HBGA 4U2CA 3VU9B 1KFKB 3VKVA 4IWXA 1DC4A 4X41A 3SQMA 3VSDA 5K3CA 3MT9A 4KUGA 2WWVD 1CUIA 3LOPA 4NYJR 4BNYA 2UZAA 2B1QA 2PBRA 1EZ1A 4FR5A 2Q9AA 4BNZA 3KPYA 4D82A 3FROA 1EDDA 1PT9A 1W48A 4LE0A 4WUVA 2H57A 4I6EA 3IUBA 2NO9A 5EXDA 4BVLA 3S8YA 3ESXA 1E9EA 2E7ZA 3QUSA 4IHKA 3DFMA 1PR5A 1OUMA 3QG5A 1S2DA 3A4TA 2A1UB 3DVAB 6Q21A 2FJUA 1YQWA 1R4NB 3O9ZA 1EM6A 1JI0A 4RVDA 2OWDA 4UZEA 4O3MA 3ROGA 2OAEA 4DXAA 4DOMA 1HRDA 1Y3AA 3THWB 1F0KA 2XLCA 3KVNA 1RYYA 2VQ6A 4ARZB 3WYGA 1JKXA 2G0TA 4I19A 2NV0A 1ECPA 1QHEA 4XB6B 2H5LA 1DSSG 4TTPA 1A9TA 4NDZA 2VKQA 1LZLA 3TW8A 1EI9A 1ZM2A 2FW7A 5JT1A 4UULA 1DX4A 3R3UA 3FPGA 5AJXA 4Z49A 1ZVMA 2FUG6 5EZ6B 2E82A 4XPZA 5GQSA 3RH0A 2YFHA 1F8UA 1H0HA 1L8AA 4N5HX 1M2EA 1L4HA 3MUOA 5ITVA 1JLLA 2RHLA 3WLAA 2ESRA 1JDSA 4XIFA 4E7PA 1FP6A 1FRFS 2V59A 2O0JA 2IHVA 2VH2A 2ZIXB 3MTAA 4DTCA 1SEPA 4EB6A 2O4UX 4B7AA 4FE3A 2O0LA 4QX6A 2Y67A 2P9GA 5EWJB 4R2WA 4C0JA 3W5AA 2YWDA 3QA3E 4H7DA 4AJJA 4B79A 1A9XA 3PU6A 2G77B 2XWSA 5BW4A 1U7HA 1F8GA 1YRWA 3TM4A 3E84A 5AKYA 2NZUG 1X7ZA 4LZAA 4HB0A 3BIXA 4WVFA 1IBMB 2F9LA 1ZM9A 5C1BA 3I5YA 1W44A 1PO7A 2I4RA 3C8MA 2QIOA 2A1IA 4UHBA 4COOA 4WCFA 4DWOA 4K7JA 4D4LA 5GINE 3ILVA 4OFWA 4DV3B 2DTEA 3VDXA 1LNZA 4PY2A 2OFOA 2ZUWA 4D26A 4JOBA 4KODA 1JBKA 4INAA 4WEQA 1SU6A 3NM5A 3ZC3A 5FEMA 4HUQA 1C30B 2HFJA 5JVDB 3ZHQA 4X93A 3HYLA 1E98A 4R68A 4V0RA 1T91A 5EE9A 3ND7A 2R1TA 3FVWA 1N7JA 1SG9A 1HZZA 1QCDA 3U56A 1NHWA 4EP1A 3N74A 3AEZA 2H5JA 2ZSUA 5L8VA 2QP4A 2V9PA 5E7IA 2WRZA 5C4MA 3IULA 3KZCA 1W5TA 3N2GA 4DLVA 1XZCA 3S7TA 4U7TB 3OFNA 3DHWC 2R2GA 1BOOA 3A9TA 5HGJA 3TSZA 1NF8A 1X2BA 3U7JA 1WPXA 4O8CA 4Z1MD 1NF3A 4PU0A 2XQFA 3EZ6A 3JQBA 4QC2A 5HMLA 3W05A 4R0NA 2GMWA 2JJYA 1N6KA 3TAXA 3E1GA 1VBFA 2UZ1B 4AMYA 3D7SA 3QFHA 2B78A 2JI6A 1CZNA 2IHTA 4PO9A 2XUGA 4W5NA 3KJFA 4F12A 4IVRA 4M1WA 1GYQA 1OZ0A 3NHUA 4K40A 5EXXA 2RGBA 2GZ1A 2AOTA 2QV0A 3LGXA 3PRYA 1YI1A 4QNMA 4YASA 1BEEA 2DQYA 2QTVA 3E4DA 2PXHA 4IDHA 5IXJA 3M4ZA 3CRW1 4HJXA 1IVSA 1I4WA 2VEOA 3BFKA 3A58B 3K7EA 3ZJYA 2AZXA 2X2OA 2B8JA 3QPVA 2AN5A 4HAXA 4MGKR 4XJVA 4JJIA 1V5WA 2BMAA 2ASEA 1OLSA 2J3QA 1SCUA 3D3NA 3LDGA 1YCFA 4OV6B 3BE6A 4GLOA 1EX7A 1WLYA 3QX9A 1P7PA 4H77A 1YU6A 1L5NA 2QQ5A 4HS9A 3RV3A 3HBMA 2CNLA 4NKRA 3AR7A 5AW3A 2GEFA 4LZLA 3G59A 1V9SA 4V0KA 1FW8A 2SHKA 3OF3A 3KEFA 2NIPA 2YRWA 4XX0A 2YYZA 4Q1EA 1JWAB 1XZPA 2YNMD 5CYFA 1VECA 1L7AA 1TKRA 1ONBA 2PU7A 3AETB 3FDZA 4QARA 5D2CA 3ND6A 4D4GA 1O0BA 1PSDA 3BREA 4I55A 1SVIA 3IAHA 4GOXA 3ULKA 4UM7A 4F6RB 3F78A 1Q22A 2NUBA 5LYYA 4H7HA 2O8EA 3D4PA 1QE0A 1T8RA 2FRVA 2EWWA 4RHFA 4BQPA 4LSMA 5DWDA 1HDIA 2Q0QA 3OY2A 3MJHA 3PC4A 2PNFA 4CFSA 4FWTA 4U2BA 1G8SA 3DBHB 1UK8A 4S3MA 4CEIB 1RCFA 4FC7A 4W6ZA 4JYCA 4FHDA 4J76A 4YDQA 3DPSA 5JNTA 1EXVA 2W70A 4WMLA 5LLSA 3ZLVA 4M60A 1Z45A 3N8IA 4FJ2A 1UZUA 4ZMSA 1OPXA 1UOEA 4D3DA 4BX9A 2PL9A 3QBVA 1XP5A 4NYMQ 4OBEA 1NL3A 1YMQA 2D1RA 4U02A 1H5QA 3OC6A 3RAJA 5HF8A 3ZV5A 1NQXA 2FP3A 2G9UA 1JALA 2FSVA 4LJ7A 4BNIA 2FGKA 3D3JA 1LTQA 3DL2A 3FUUA 3ZBQA 4D41A 3PXEA 1EFVB 1K7EB 1AKRA 4L5IA 4LNAA 2QLJA 4A92A 5KQGA 3A70A 1OFIA 2X8JA 5HKOA 2Q50A 3EYWA 3EAGA 5DHTA 5IAAA 2R3SA 4JEUA 5DOZA 5G0TA 1RKQA 1VCOA 5LL6P 3F96A 1GFIA 4Y9RA 3HN7A 2FPOA 1JFFA 5WRFA 1B93A 1CUWA 1U8UA 1KYWA 2LBPA 2O2GA 3LOQA 4HK4A 3V33A 3OAAA 4FKMA 1IN1A 4I5IA 1BDIA 5IZCC 3PUWA 6NULA 4G8BA 3NWBA 1N2ZA 4I1PA 2BMJA 2IT1A 1HI9A 5AI0A 5ESXA 1I4EB 3SVLA 3OX3A 1R4NA 3AI7A 3G8CA 2PXAA 5D51S 4U6QA 2FR1A 3TTUA 1FFXB 2JIOA 2ZEJA 4P5DA 3C2QA 5HF6A 1S8AA 2C7GA 3D7LA 4DIMA 4E1BA 1HE2A 4DNFA 3L7OA 3T3PB 3GRVA 1PK9A 1F2VA 3LV8A 4HHEA 4L2IA 2XAUA 3H97A 4OG2A 1JLRA 1OREA 1OI4A 2XUDA 4RZ2A 4UREA 5C34B 3W1EA 4AWAA 4N54A 3MPOA 3RTGA 4H7KA 1TKAA 4KWEA 1SD1A 3I09A 2O2XA 4R1UA 3F74A 4TZ6A 2I6UA 5KQMA 1ZW6A 1X7YB 2Y0PA 3LQFA 4EGQA 1T0IA 5K03A 4DR6B 1WA5A 2VJAA 3DE5X 1FP7A 1P7CA 2AGVA 1A04A 2GM3A 3JQ7A 4PVCA 3U4GA 5FOQA 3IT1A 4HKTA 1T8TA 5DHRA 4RETA 1N5JA 3L77A 4GRDA 3C7KA 4CMIA 3TZHA 2YMLA 2PGOA 1XZIA 2NTEA 3H9BA 3N0VA 1N7IA 3KAJA 1MB4A 3QUBA 2NZXA 3NFYA 3TSWA 3BMOB 4G9BA 1LCIA 1Z2AA 2OD9A 4ZEXA 5F2NA 3D43A 1CXZA 3RRNA 4QPCA 4NBVA 4DQLA 3TE6A 4KE8A 3BE4A 1SKMA 1JDNA 2O7NA 4P4GA 1GTSA 1FSGA 3VH3A 5JNRA 1DE0A 1JFTA 1RZUA 2X3UA 3N1UA 1D6JA 2E48A 1FF9A 2Z6UA 5DXFA 1G6HA 1K2VN 4GGPA 3AIOA 4MUGA 1CCWA 2ZSAA 3OLCX 1XVLA 4KJXA 4K87A 3FOBA 3JWPA 1C7EA 4JLUA 3A4VA 1HG1A 2DWPA 5C1OA 4ALIA 4M88A 1USWA 4G0OA 2XNDA 3WK7A 3BJMA 4YUVA 4P9NA 3ZCQA 1Z34A 1G5FA 2H06A 1JE0A 1DV1A 3O84A 1T5HX 4RTLA 4R1LA 3GPIA 1ZI6A 2H65A 2CUNA 5FNVB 2XOEA 3OE7D 2CL5A 4AJPA 2WLTA 2PXXA 4WXPA 2QD5A 5ALSA 3I6ZA 2RIRA 4MR7B 4DDTA 2C61A 5K7SA 4DXHA 3EPLA 3NBZC 4KX3A 2W2KA 2OFFA 3WGLA 2QTBA 4NH0A 3VGJA 1WZCA 2Y99A 4CCYA 4LSGA 4M9RA 2IYLD 5EVJA 1FS6A 1KDYA 5CJ2A 4NMXB 3ETLA 3M6WA 1O95D 4I4IA 3UCFA 4WESA 3B60A 2P0EA 2NUTB 2ZUCA 1V7ZA 3D4NA 4M0PA 4AKSA 4EG3A 1AF4A 1G8HA 2D1YA 5ANRB 2HSWA 2NV6A 4XWTA 4EO4A 4IKEA 5JHGB 1T3ZA 2HA6A 1EDZA 5IU6A 4RMNA 1Z5PA 2GPNA 1XLWA 4J0GA 3THOA 5DNVA 4NFHA 2VK8A 3D81A 1YGYA 3IVRA 1CY0A 5EHZA 5E6UB 1H9BA 1QHFA 2O2HA 2Q27A 2DAPA 4UPDA 4YWJA 1ZRHA 4COKA 5KYNA 1P0CA 1T10A 3I58A 3N3AC 5BUZA 3IUJA 2XBMA 2Z58A 1QTIA 4ALJA 4C7OB 2NN3C 5K6RA 1Z4NA 4HXFB 5F7XA 1G6KA 1IXKA 3ZWYA 2FXVA 4AJKA 4B6JA 4KMRA 1L4KA 4LFBB 3KXDA 1KRWA 4KDEA 2HA3A 2QY6A 1P1FA 4YIKA 1POXA 4UVDA 3FLBA 1DUVG 4N82A 3RO7A 3TLGA 4C4YA 5AUPB 5EIHA 3RSSA 3TSYA 1IN4A 4ENRA 2J30A 5HA5A 2ZPAA 3FNGA 3H3JA 3C1AA 2YNMA 1SB8A 2VDVE 3IUPA 3NIWA 2DBRA 2VYND 3L79A 3OOSA 5T6MA 5FWYA 4ZO6A 3PPVA 5KNLA 4IUDS 4IILA 4ZV7A 1L5HA 4EM6A 5FBKA 4P36A 4NZPA 4BKUA 5JSKA 1TU0A 1HDZA 1FRVA 1VIVA 3KAQA 4ZT5A 4U8HA 1GG5A 3L1JA 1RXCA 2WVJA 1PVVA 5ES4B 1FC0A 3HDJA 4N18A 3T5TA 1DC5A 1VHQA 1GG8A 2QZJA 1LWOA 1JLHA 5CA0A 5CA1A 5LU9A 3W5VA 3NIFB 3RSZA 3QWIA 1S8FA 2WWGA 4R31A 1QO0D 5JTUA 2QUZA 5HX7A 3DOFA 5KMGB 5F12A 1QR6A 3BIJA 2A4MA 2P4QA 3LUDA 3LY8A 4EYSA 1SCNE 3N8NA 2P0AA 4V02A 1ZVQA 3GLSA 2H4FA 3HGTA 3TR6A 3HR8A 3MOIA 4CEJB 5BMVB 3QJ5A 4DM4A 2XJ9A 4G36A 5C1IA 4ZKEA 2WMOB 3HE3A 2JJ1D 3ZTYA 4C2AA 4C3UA 1U3FA 4Z51A 3SMVA 4LXGA 4QDZA 3IR5A 2NZ8A 2EWVA 2GQ0A 2ZTMA 2BEKA 2D2VA 3DWEX 3MVEA 3KB1A 3CISA 2PT7A 2X15A 3NYWA 4KEAA 2VJMB 5YASA 2ETVA 3ZD6A 5KOJB 5ECGC 4QBIA 4IIJB 4JWKA 3SE0A 2QG4A 1SCIA 3V1MA 1U94A 1G5IA 5EHGA 5SY6A 2B5WA 4MWBA 1I2CA 1NVAA 4UUPA 5JYCA 1ONSA 1K8ZB 1VP9A 3G6KA 3BGIA 2NX2A 2YIVX 2EVWX 3JQDA 5LZ8A 1P9OA 2DVMA 1QUEA 2OBXA 1UAGA 1A9XB 2GHRA 4P3OA 3PIRA 2XQIA 2RI0A 3BD6A 4S12A 2O5EA 1WVGA 1US8B 3B70A 3UANA 2ATVA 1XBTA 4DSUA 4EB6B 2XF8A 2ZI9A 4JT4A 2G1AA 4XUGB 3U7HB 1MHPA 1C0EA 4C7BA 2G28A 2FJ0A 3A9UA 3DEFA 4L4YA 3KQPA 5CVEA 3ELUA 3L0ZA 3WR5A 5TDHA 4MI3A 1C1XA 3FZGA 4QRIA 1DCMA 4IRMA 5KI6A 2BAGA 4HL6A 1UQTA 3HUEA 1FTNA 1LPOA 1KJQA 1WM1A 4BO2A 4LRTB 5J43A 3R8CA 2WJVA 2A9QA 1VE3A 2AW3A 2VPXA 4L5BA 2FR0A 3X2SA 1DCFA 2GRUA 3E2IA 5H70A 5IH7A 1BE1A 2JAUA 1KJ8A 2H85A 4UU0A 2FHSA 3FB4A 2OBYA 1DRKA 3FF1A 3PUYA 5F35A 2I2WA 2VJCA 1XELA 1WY5A 2IC5A 4WA7A 1KPGA 1YACA 2EG5A 1VE6A 2WAAA 2BKEA 4ZDJA 4ESVA 1U0HC 1L5RA 2HMVA 5EJ6A 3G5LA 3HEBA 1CX9B 3IGFA 4GRIA 4YCCA 2QA5A 2Y1DA 4CMHA 1M2GA 4D74A 2HU7A 1HYQA 1RQNA 3SBXA 2GGSA 1UZLA 3M33A 3TCXB 3BXXA 3QFCA 1L3CA 1SKAA 2OV8A 4GM0A 4OFXA 1IJKA 3EXEB 3R5TA 5DEOA 5J58A 3FHLA 3PDWA 3WAJA 5JDIA 3IBGA 1FJHA 3VR5A 2FK8A 4WLUA 3LUPA 2HGZA 1VGVA 4FEYA 1RHQA 3KUUA 3DV0B 1AQLA 3GNQA 3WHIA 4YXFA 2XWPA 5BSKA 1PFWA 1KZ4A 1P81A 3DD5A 2QKYA 4LXQA 5G1NA 4JXJA 3V4FA 4KQ9A 3WP0A 2N42A 3D8RA 3PXUA 4LI3X 2A4KA 3VNUA 1RRPA 4RKWA 2H54A 4GM1A 3PGMA 2AXNA 4YH1A 3AERB 4KDRA 5I8ZA 5T4EA 1LPNA 1EXWA 1W0KA 3QFRA 4TVKA 3A3KA 1NNI1 5I8WA 3KCNA 2JFHA 4Z53A 1RJWA 4MS4A 2WOJA 2M1ZA 2XUOA 3H17A 1Q11A 4BLTA 1BJTA 1FDUA 1YQDA 1LK7A 2HA5A 3GAMA 2IU0A 1P5RA 4ROTA 3KUXA 5T4FA 2J08A 1G38A 2E18A 2BUAA 2FOLA 3IOMA 3OM0A 2EEPA 1UJMA 4LQ4A 2GM4A 4QLAA 1C4WA 4CQNA 1KQNA 2G9QA 3GMTA 4HCJA 4RPCA 4ZT3A 3KTFA 3B1XA 5A5FA 3DLIA 4WLOA 1BCRB 3FGZA 3C3CA 4Y1EA 1F4PA 3MWKA 4RF5A 3S3TA 2D59A 2JI4A 5A71A 1VCMA 2C57A 5E8RA 2ZWVA 4RHXA 1CR2A 3B38A 3QLUC 4J3FA 1AG9A 2IXFA 4G5XA 4KPEC 3BWMA 5LQKA 2SBTA 2HXSA 4X6LA 2CB0A 2IVFA 4LUCA 4YFVA 3NBUA 3SZUA 1JHXA 4D8WA 1WXFA 1SIUA 3P0IA 4DS3A 1IIBA 1UKEA 2QGNA 1BMFA 3P5BA 2EP8A 1XZGA 4UFPA 2CDRA 2Q0XA 4O2AA 4BNUA 5I7EA 2ZYHA 3TQCA 2PKQP 3FWYA 2O8EB 5E1DA 4B3DA 1IHYA 1XZQA 4BU0A 4JFRA 2NPIA 5FV7A 2BR3A 4YQEA 1Z17A 4BP9A 4B6SA 2YZMA 1DTEA 1J33A 1FXSA 4HGOA 4JLWA 2J85A 1M2NA 2REQA 3U6KA 1GGVA 2XQVA 5BSTA 3NNDA 1K5PA 2FUCA 1AZTA 4E2FA 3K0SA 1WZEA 1XEAA 3LY5A 3GHYA 1IY1A 3V2HA 2ZJZA 4PXYA 4YMWA 5E0OA 2YWJA 3QW4B 4BO5A 2OBNA 3K32A 5CDFA 3SU8A 2F64A 4DA7A 1GZHB 1U9YA 2HQ1A 1CDEA 2J0UB 3KT0A 2I4MA 3RVKA 3SZGA 2IH2A 3ADKA 1JB9A 4NECA 5LQJA 3N07A 2C07A 3OD1A 1TAUA 4WZ6A 4Q19A 3WLTA 4RD6A 4MSUA 4KUHA 2Z2YA 3ABSB 4XTCS 4Y2TA 1I0LA 2X0DA 1QBKC 5JBQA 3AL0C 3K1YA 5BWNA 3UV3A 4PPQA 1OLOA 4X8HA 1D2RA 1NXTA 4GP6A 2XYHA 3AJAA 5HQJA 5F4BA 3QLEA 2A2ZA 3GJQA 5I7AA 1UWCA 2VTVA 5ALIA 3U31A 3N7TA 4MHTA 1AK2A 1EE9A 3JQFA 4ZXFA 2VHYA 1FFXA 1ML4A 4ZO7A 3TQTA 2CEAA 3S2FA 3H16A 2C9DA 2FWPA 3OZAA 3SHVA 5HNKA 5KC9A 5CCEA 4BNGA 4QO7A 4G4SO 1W8DA 2GEVA 2MR6A 1GL6A 2PGAA 4C0HA 4TYWA 2VAMA 3KWFA 4XGKA 2CXXA 3M81A 4YYZA 1KAOA 4J8PA 2PX6A 2D4HA 3SEFA 4ZYTA 2IUFA 3MMPA 4WXHA 1UADA 3BE8A 1DL5A 1RXIA 3A4NA 5IJAA 3M6MD 3M2PA 3U3ZA 1AUXA 2VT6A 2JDIA 1DEOA 3ILSA 4FVTA 4YB8A 4ZANA 1P1JA 3OQNA 4L75A 2DXIA 1QU3A 1BS9A 3FX2A 2Y76A 1KDVA 2GK6A 5JSFA 2YQ4A 2DKOA 1DVRA 1KJYA 1NQ5A 2AUTA 2PX2A 3OZ7A 4ENVA 5BR4A 5DNCA 1DKLA 4MUJA 1TUGA 4ALMA 4JBLA 5SZIA 3KXPA 1W2WB 4BC1A 4X9XA 1I3MA 2CDNA 4HH1A 3RC1A 4D4KA 2QRGA 3ZTWA 2X2FA 4YMGA 5F1KA 3P0FA 1BQ4A 2OR3A 5JAIA 3DZKA 3EE6A 3NDRA 3GH3A 3C87A 1JNXX 2VAPA 4P08A 4QT4A 4I9UA 1AIPA 1TJNA 2O9JA 3L18A 1ML3A 2XMSA 1IJFA 2PSDA 3LKDA 1KYQA 4WFKA 2DJIA 1YFZA 4IDNA 4R0VA 4YMHA 4XAQA 3UO8B 3VZPA 2J4FA 3U81A 3OD5A 4TN1A 2IX3A 4LXHA 3TOVA 4E5PA 5L4LA 1UANA 1HT2E 5JRZA 5DHPA 5CDSA 5AVRA 2DBVO 4FB5A 5EP4A 2DPLA 4W63A 4UTXA 2W8ZA 4KNYA 3TLZA 3KC2A 3CXUA 1Q5PA 1QVAA 3H3FA 3H87A 3QUTA 3VQTA 1KRHA 4MH0R 1B14A 2WD8A 3KB2A 5K0GA 2DHCA 2P77A 4OGGA 4DQ0A 5FRDA 4CCYB 1GU7A 3PWSA 5DYIA 1FPQA 5J59A 1NN1A 1SZDA 4R7GA 4BMZA 4YAJA 1KWKA 2OZEA 1RHUA 3T4PA 2R44A 4F9GA 1UIRA 3ZVMA 5IYZF 1R0KA 1XTTA 3T54A 1S4MA 2EDAA 4WBSA 1FYDA 4LOJA 1XK7A 3DBLA 5HUQA 1QV9A 1KZYC 3VC7A 2ZSFA 2OORA 3HZRA 2JG3A 3NUGA 2FH5B 4PEVA 3FA2A 1Z47A 4IINA 1UPFA 2JIQA 1FW6A 4LE1A 1VCIA 1M6VB 3L0IB 3RARA 5CB4F 5FA6A 1QO9A 3EDMA 3HKCA 9LDTA 3R5JA 3IAS6 4D4JA 1EGAA 3KTDA 4C2UA 2G0NA 2O52A 5ENVA 1MO6A 2NSJA 3JQ9C 3JCZA 4OXYA 4PLZA 5AK0A 5AW5A 5AW7A 5HKKA 5JFOA 1A50B 5KSZA 5KNBH 3B6MA 1P1BA 5FUXA 1RI2A 3UMBA 2QAJA 2E1PA 1PAUA 4XD7A 4UNRA 2KPOA 3STUA 1SD5A 3DZGA 3ER6A 3UJ6A 3W7AA 8GPBA 1OZAA 3AF3A 5IRCD 4AUKA 3K9FC 1U8TA 2J3KA 4KQJA 1QP7A 3I0ZA 1JBEA 1IPFA 3I04M 4P6VF 5CIWA 5IXSA 1VI6A 5EUMA 5IDXA 4QOSA 1P39A 5FBRB 2A14A 4Z9YA 3L7IA 3I9KA 3QA9A 4PR3A 1EB8A 4EITA 1HQDA 3JQCA 3UVEA 2DP4E 2NTVA 3GVXA 1OH5A 2I54A 4C4RA 1O6BA 5TS3A 4WNYA 4CCWA 1G2QA 4K6FA 3TKAA 2E3JA 3ENNA 4B9EA 5LM3A 5COQA 2ZDQA 3H2HA 3HV0A 4KH0A 3I8OA 1X87A 4N65A 3EG9A 2JGRA 3VX3A 1XAHA 2VWHA 3CCBA 3DUFA 4YV0A 2VCHA 1TU3A 3OU7A 2O48X 2PR2A 3AFIA 4WFJA 5HF9A 2PRYA 4RNCA 1MGPA 1OIWA 2K5UA 4XQ9A 5DCUA 2G76A 3AF0A 1DRWA 3WXBA 1XD9A 1SXIA 1AO0A 4JEMA 1W52X 2UVPA 3G8DA 2OXRA 3WGYA 4F2DA 1R6DA 2QXTA 2WG0A 3LNTA 2Q5EA 3CVOA 3K4PA 4R5HA 1SXJC 2C78A 4LISA 5T8KA 4AJ1A 4ZCLA 1NBEA 2OENG 3GP3A 5DHSA 3DZDA 4G1UC 3UKJA 1K8YB 1DPFA 1OIVA 1QGUB 1TM2A 1AKQA 3Q3IA 1LC3A 2WUDA 3EXHB 1XLTC 3GFTA 4ZD6A 1P3DA 3W5HA 4F84A 3H8JA 4UVHA 3TLBA 1VDZA 3BKXA 1BCSA 1EJ0A 1G3RA 5LXTF 3I72A 4MA4A 4EHIA 3CHYA 4OQFA 5UKDA 1NXXA 4QYXA 3K0AB 1CE8A 3B3FA 3OH8A 1J5EB 3G2IA 1QIMA 1JHVA 1FVHA 4LW8A 1L4YA 4G24A 1XCOA 4TL8A 1GGNA 2A9PA 3RC2A 4NEGA 1SR8A 1R3UA 3L01A 4KFSA 1QTQA 5A62A 3P45A 1H4VB 3MQ4A 3U48A 3A6KA 2VO1A 1BWQA 1R8SA 3H86A 2CXQA 4B40A 1SIWA 2QGFA 2AHOA 2YHSA 4PQGA 1E4VA 1PGQA 1U2DA 2H07A 4RK6A 5E9WA 2OOSA 4NFSA 1DJQA 5U4XA 3V3TA 1AC5A 1GTG1 2GEUA 1MO2A 2GF2A 4NBRA 4B09A 5L53A 5LOVA 3FTFA 4WNCA 1VPVA 2GZSA 1NI4A 1M8FA 2BFNA 3UOGA 2O7QA 3INNA 5D85A 3QEKA 4MAMA 3QFSA 1Q77A 2QTRA 4IV5A 4NNJA 4ENPA 4C3VA 2VHZA 1RAIA 2A1TS 4JJFA 4LY6A 2HK6A 4Q7JB 4DCJA 3FETA 1PRYA 2PTGA 1E9DA 1COZA 5CEFA 1DARA 1TUEA 4AW9A 2BHNA 2GTHA 3CJRA 4TTIA 2DEUA 2AG6A 4IMIB 4PQFA 2B5VA 2ZTLA 4EATA 3O6VA 2X8BA 2EG9A 3LO8A 1O1YA 3INRA 3ADDA 3TZBA 2L69A 1NBMD 4E09A 1V3UA 4ENUA 1PV4A 2O5RA 3HSSA 5A3VA 5BYJA 1KDOA 2LIPA 3AHDA 3NTLA 4RY0A 5KYYA 2A58A 4NXMB 2A5FA 3AZOA 2QR2A 2GA8A 2YL2A 4QIHA 3F8WA 2XUHA 4IDGA 5E3HA 3X1XA 4EVSA 8MHTA 4IQ8A 2HBZA 3NAMA 3QKWA 1GUBA 3MWFA 1ZA1A 4OJTA 1D6NA 2QYHA 4YP9A 1U5BB 1Y1QA 3L04A 4GQIA 5L3QA 1Z7EA 3WRXC 4FGZA 1Z15A 4FBMA 1HNXB 5CFNA 1C1DA 2OCYC 2PT5A 3JZDA 5GP1A 5B4UA 1RJGA 1YQEA 1CS0B 2RJNA 3NEJA 4KLAA 4R9UC 4ZVLA 3DP7A 3CURA 4CN8A 1NKVA 4WESB 4CL8A 4GH5A 3OX4A 3FTPA 3QEMA 2VK4A 1Z2CA 3LF1A 4OMFG 1FY2A 4PHHA 3CO0S 4E51A 1N75A 2IIPA 5I5EA 4BNDB 1V3VA 3GNSA 3IXQA 4JSRA 4II2A 2WE8A 4LXXA 5EZYB 1AY0A 2X77A 1C5KA 2QLFA 3OX1A 4UM9D 5BO5A 1BU8A 2IHBA 3AUXA 1WV0A 3IC5A 1M1YA 1XEWY 1YB5A 2RHTA 3EFOA 3OQ1A 4RTQA 2PUWA 4G0MA 1T5TA 1Z6TA 3PNVA 3TPZA 4FGLA 4JX9A 2QN6A 3KM0A 5BOSA 2YY5A 2Y66A 3O91A 4IHQA 1QS0B 2Q4OA 4MNTA 4XSGA 4MW1A 2BMFA 1NN3A 4GYWA 3LQ1A 2BFAA 5CT5A 5AWFC 1JUDA 3NV9A 5FOUA 1N1GA 3L8GA 5AJTA 3RCBA 3RLFA 3WGHA 3FYHA 1AQJA 2QTWB 1Z6PA 5AJHA 2VHTA 4BIIA 5GVSA 2ZM5A 1DADA 3QVJA 4ZJUA 3UATA 2G04A 4XQGA 1I2AA 4AG3A 4ZZ1A 5CLJA 3LQQA 1E2KA 4L0CA 4B83A 2GT1A 1PR3A 2Y1GA 2RH4A 2YW9A 4QBKA 4GBJA 3OPXA 4IIVA 5FBZA 2SECE 3BH6A 1U3DA 5BSHA 2PS9A 4P0PB 1R27A 3TDNA 2IPLA 3B8HA 4HWRA 3LX8A 4Q3EA 4EEKA 1D4AA 1CK4A 1JILA 3F7NA 1FRZA 3ISVA 3O4JA 3WIDA 4M89A 2ZBUA 1YNOA 4QE3A 3ZDCA 4RTNA 4B17A 1UKVY 4I1UA 3HWWA 4JGGA 1OHHD 5TJHA 3IEIA 3A2LA 1I5EA 4N0QA 4O63O 3SHQA 4QPNA 2FWIA 3WGMA 1P1RA 3JAWB 1CUVA 2COEA 1KKLA 2PWYA 4Y2QA 3RDPA 3K96A 4KW7A 3QMMA 1V8OA 3B7GA 2QR5A 1OGJA 2NV2B 2W43A 4HS4A 4ZOLF 1L8LA 4Y6SA 2XOXA 5B55A 1IHPA 2ECOA 4KOAA 1TRKA 4C5BA 4ZVPA 3VKHA 5ECWA 5DLPA 4L51A 3GZNA 1FNNA 1FYWA 2LCIA 3RJ5A 4G6ZA 3BHJA 1YR9A 2J9RA 1FP4A 3UV7A 5B4VA 1ZW1A 4RVSA 3QNUA 5ILOA 3VA7A 1AKTA 2VUTA 1VZ2A 2PUJA 4BN0A 3T1YB 4EHFA 1A8HA 2WMNB 3HCWA 1QIEA 3KPWA 3NDJA 4FMPA 3KDAA 3UAZA 3KT3A 1YC2A 3P9QA 1HEIA 1LVGA 3A6EA 3H2BA 4HAIA 4RGQA 4FYVA 2ZJ5A 3CY6A 1Q2UA 4S24A 5G0SA 1EWRA 3E23A 2VHEA 5KTMA 4XWAA 3GBPA 2EJBA 2CXNA 1RTKA 4UASA 4LJKA 4YGYA 1JSXA 2JARA 2P3LA 2PS3A 1PSWA 1X1EA 2WAYA 3DHNA 3EH2A 3KKZA 4CIWA 4UJ5A 4UOQA 4LK2A 5KJFA 3KQLA 2NUPB 4XYEA 1DDOA 2RGWA 1QVRA 3OAAD 4B3MB 2QJOA 1FIUA 1Y63A 3CZ5A 2C3OA 3GT0A 4RHUA 5CNJA 1PEAA 3LSTA 4FHZA 3KQKA 5CFRA 4JVSB 1RS0A 1XDGA 2OP1A 4D4HA 3ZDZB 3QNWA 3IEMA 1HDYA 5GJWC 4B3HA 4RJTA 1SMKA 1ICEA 2QDKA 1E7QA 3AHHA 3EOAI 1EP9A 1JDUA 1UUFA 2C9ZA 3DMTA 1HOTA 3CPEA 3VBEA 4JBHA 5B3LA 4LYAA 4WKGA 4G4SP 1SU4A 4MI1A 4UARA 4YJHA 3H9QA 3UKDA 2Z5VA 3U4CA 3WKDA 2ZJAA 2QSYA 2ZE5A 5EHIA 3L8EA 4FXPA 3G9ZA 1H2BA 2IODA 2VCEA 2VYVD 1DZ3A 4E3ZA 3KETA 1ZH2A 1IN7A 2WJGA 2IP1A 3O3NB 5DGXA 1TPYA 2IXBA 4AVYA 4EG0A 4YCDA 4UD6A 3QYAA 4EHJA 3JD1A 1R0RE 5CR9A 2MDTA 1N6PA 5EFOA 4YJ2B 1MU0A 1T1RA 2W2OA 4HNHA 1ELOA 3EQ9A 1U6KA 1VYVA 4G67A 5E3IA 3U40A 2XNKA 4Z6KA 2AH5A 3ZZ0A 4YRKA 1P31A 1YS1X 2YYYA 5AUOB 4K8OA 2QN7A 5A5VA 2C5SA 3ZHOA 4B75A 2B4AA 1EVLA 1J1ZA 2D1QA 2FEPA 4KR3A 4DBZA 2AFVA 3HWSA 2XA9A 3IR7A 4OY3A 4LYYA 3OMLA 3P26A 2Z98A 4MQBA 1NI4B 3P7MA 4DDKA 2WG1A 2C8VA 1SBZA 3FUCA 4KG7A 1SBTA 4PG6A 2XYRA 2CCGA 5J5VA 5CA0F 3QTLA 4MB6A 3JYLA 3S8EA 3IUNA 1K06A 1RWWA 3JVUA 2GN6A 3L46A 1XZDA 3THXB 4P8RA 2GKOA 3FAZA 5AICA 3SK0A 5JAUA 1JJAA 1FX1A 1WQ3A 1Y5IA 3PJGA 2H8KA 6GPBA 4I1YA 2IYZA 3DV0A 2RHJA 3ITKA 3KQYA 2C2YA 3W5IA 1HZZC 3V4PB 3H5NA 4BO7A 5MHTA 2Z8XA 2QD4A 5KQRA 2HQOA 3I9OA 4JROA 5EMLA 4DUZB 1ZMRA 4FXOA 1JJBA 2GDZA 5JVDA 3F3SA 1J1UA 1A9PA 1RJ9A 1GGKA 1U2PA 4WK0B 3RIGA 1VE9A 3NC0C 1K9SA 3C6XA 1K3FA 1WRBA 2QVXX 2JA2A 3ND5A 3Q2IA 4I5GA 4IIGA 2X42A 3W6UA 4UJ3A 1U7ZA 1TMOA 2CLOB 3H5VA 1WHSA 4TZKA 1CW2B 1ZOLA 4U8GA 4B45A 3FG9A 3R9XB 1ISPA 1J0CA 3UAGA 5K8JB 3OTWA 2AS0A 3UT0A 4FCCA 1NVVR 5ESDA 1L9XA 3K6RA 3G1WA 3UY4A 1KY2A 3K0CA 5DCLA 4JEHA 1Q1EA 1KI4A 4K88A 2C3MA 3ZHUA 4CQLB 2CZGA 1TJYA 2FUG1 4Q1CA 3O26A 2PMBA 5T8KC 2X58A 3VTZA 3TUJC 1CJCA 1I01A 3M4JA 4YP5A 2NP6A 1FFWA 4U9UA 2QP3A 2XXJA 4RFSB 3D8BA 3IE2A 3FXAA 3BXEA 4UMFA 2WSSD 4WBXC 2BTQB 3IDOA 3WQRA 3ZY6A 1YIDA 4AN0A 2AR0A 3R40A 1OBOA 1BGWA 1OGIA 1Z7GA 2B20A 4RGVA 1P9NA 2SKEA 5BYKA 5HKAA 1PR6A 1JR6A 1XMQB 2WSMA 1KAEA 4Q03A 5JSYA 4DLPA 5AW2A 3SNHA 2QMEA 2VT7A 3EK2A 4RULA 2AKYA 4JP2A 2AZDA 2XRMA 3NGLA 2QJWA 3U26A 4CF3A 5HP4A 1UK9A 2WD9A 5ESWA 2WC1A 4JXZA 2YXLA 4H7PA 5FBVB 5TMPA 1TZJA 5KIAA 1DNPA 1TD1A 2YX1A 4JB8A 1HK7A 3SI7A 5TGDA 2BFMA 3F7OA 3TXXA 3GLIA 3CCFA 3L6CA 2QE7A 3OZUA 4HLCA 1F8YA 4OLHA 5U4QA 3SG0A 3UJ7A 4ZHQA 2X5OA 2Z3ZA 3B6ZA 2JKZA 2NM0A 4X0EA 1H3EA 1KPIA 4ZREA 2OKGA 3H3XA 1DEHA 2NT3A 4YY3B 3GUZA 3R3HA 1SVNA 3EDYA 3AW9A 4O3FA 3JR7A 3H0CA 1E2EA 4H2DA 1H2AS 5DPMA 2G07A 2D5BA 2PX5A 4YJ3F 4G1EB 4CI0B 1MO3A 2XGMA 3P27A 4RMHA 2WNIA 5F1OA 3GRZA 1DKUA 1I0IA 3SKXA 4B32A 4DMHA 2XCSB 3IHLA 5F7JA 5CK5A 2CBGA 2PRIA 3CR3C 3ORYA 4TYMA 2JFZA 5K4GA 1BMFD 4F6RA 4PE5B 2YHAA 2C4KA 1QPZA 2V58A 3EIWA 2NU8A 1GA1A 3H1GA 1T5LA 2YR0A 4RSHA 5D6OA 3WMWA 3GLGE 1G7CA 2QRVA 4UW9A 3UJ8A 2G8NA 3WV4A 4JI0B 1CYDA 4DBLE 3MXTA 3QVUA 2GCEA 2D2FA 3RVBA 3KQOA 4M4SA 4MQEA 4AYTA 4YCLA 1GNLA 3N2LA 3AKYA 3NH6A 1IMOA 4ZFNA 3L8FA 1HE8B 3NEAA 3AUAA 4RHTA 4F9FA 4YAEA 1ISJA 2W2VA 4IWNA 4RAQA 4B7CA 5JROA 3JZMA 1C3XA 5CG1A 4EUSA 3CLRD 1NMYA 1QRUA 2IK8A 4QICA 1RM5A 1ZQ1A 2CLLB 1E1CB 1G8FA 1X7WB 3WLMA 1JIIA 1V5GA 4M1QA 4CDGA 5IJXA 4X00A 3HVKA 4KI0A 5IF3A 4G25A 1EFVA 3RGWS 1E7MA 4AQ7A 1Q7GA 1XRQA 2VK1A 3L4EA 4LJ8A 1V2HE 4G5YA 4C2BA 4DSTA 2FXIA 4BPRA 4JP5A 2A1TR 3IEXA 4S1WA 4PHGA 2FPKA 2RGGA 5FHRA 1NBWB 1XCJA 2H1FA 1N5IA 3TGPA 1RACA 3K2BA 2I91A 1II0A 1NQWA 1JSZA 3F7TA 1XQVA 4KN8A 1I36A 1U7OA 1JFFB 4I2VA 5JJBA 4JCCA 1LRKA 3EDOA 3N0RA 1CC1S 3A4YA 4MUIA 2OLKA 4IFIA 2HY7A 2MINA 2WTEA 3VHRA 3LY9A 1OZFA 3MAAC 3O4GA 4ZU6X 2Z1NA 1THMA 5IF9A 4LXUA 3ZCTA 2VZ8A 3N8GA 2GD6A 4N5MA 5K3AA 2GS9A 1PT7A 5AOVA 3SYMA 2QNIA 3CMCO 2GRJA 3H7IA 4RBNA 5AKIA 3HCFA 3A25A 5GM1A 2CBXA 3EQ2A 4FDLA 2HEIA 1OAOC 3SBEA 1HURA 1ZCBA 3DS8A 4BHTA 1VL2A 3VH4A 3RBZA 4MUKA 2BEVA 3GJ3A 2XTNA 3QG1A 2AJTA 3LPCA 2WU1A 5CT9A 2GJSA 2Q99A 3QVXA 4G4JA 2ADMA 4MB0A 3U2QA 1M0TA 3OZBA 3ACBA 2XMDA 2EARA 3T5CA 1YONA 3JV7A 1CFJA 1R7RA 2ZS7A 3RRYA 2Z08A 5THXA 1MX1A 1YRBA 5K6AA 1ZIYA 1QJCA 4GYKA 1GU0A 4JJAA 4TWAA 3PHHA 4L5YA 4Q82A 4CR7A 1R4MA 4QM7A 4CLEA 4RS4A 1GZVA 4AP9A 4GLJA 4HGZA 1SBNE 2PS0A 2Z0MA 4D46A 4GMXA 5K0BA 1E2DA 4PYQA 1RWMA 4MV5A 1IM8A 1WB4A 2BWJA 4YN3A 3EA5A 2ZRJA 3IIJA 4BNFA 5LDHA 4ARCA 2M1XA 4EEXA 1ZDMA 2CFSA 3WGQA 4HWKA 3B3GA 4C21A 5E6RA 5CU7A 3WIVA 5FBLB 1CUAA 3CF2A 3VO8A 4J2OA 5CNIA 3U9SA 5TE9A 5H7XA 1F9EA 3IFSA 1JR3A 2AFIB 2BM0A 3OVMA 3ECCA 5IXYA 1V8DA 4U00A 3GG2A 1WLSA 4G84A 4BECA 1LX7A 4B3BA 3HKCB 1PJ3A 3R44A 4IY1A 1ACMA 3PA6A 5CTAA 1FLNA 4BMDA 4HGNA 3RIMA 1W4RA 3GEHA 1R3DA 2A8YA 2J5RA 2VUIB 4JUFA 4CKWA 1GPMA 1P9RA 1NFFA 1MAAA 1RLUA 3R7DA 4DIBA 4WOBA 3A1DA 1B41A 3OE7A 4H3KB 3UJBA 3ABRB 1Z6QA 3ELDA 5JNSA 4Q16A 1WG8A 3DULA 3LUKA 4MZXA 4TVOA 5DVZA 5CX1A 1WHSB 2AG0A 5CHYA 4ZO4A 4ZRMA 3V9PA 2DFPA 5IVKA 3WICA 4BUJA 3RTDA 3DBIA 3DOJA 1G4AE 4NU5A 4UPVA 3DC2A 2J48A 2FMTA 3RRBA 1S1CA 1JZQA 4BGEA 2CVFA 5JBNA 1QM5A 3PUIA 4J1SA 1V95A 4BATA 3KJIA 3D9QX 2DUWA 4WLVA 1NI5A 4B3IA 4LOLA 4L76A 1P2TA 2D0IA 3W79A 4DZRA 1F20A 5B36A 5JDCA 1ZJJA 5AM5A 4NLLA 1DBWA 1XA3A 3ASUA 3IEUA 2AX4A 4JT2A 4L07A 3AJ9A 4GZ6A 3PC2A 2FETA 2D0OB 4QUGA 2IHKA 3CN9A 3C74A 4JA2A 5F78A 3V4LA 3R74A 4CTMA 1UH5A 2QM3A 5DK4A 1O77A 3WTCA 6ABPA 1QU2A 2Q21A 4AJNA 2O2JA 4BUCA 4CUKA 2PDAA 4MVJP 4AZTA 4NS1A 3DEAA 1Y98A 1Z28A 4I0WB 4LXIA 2HZBA 3IVGA 4KDFA 4OLFA 3UUGA 4HN9A 3EMKA 1A5AB 1BKYA 1P8JA 3RVQA 4FHEA 5BXQC 3EYAA 1U2GA 4KK3A 1L6RA 1YHNA 2G72A 4IJUA 4ZN6A 2UVDA 3NZEA 1PW7A 4KMSA 2A1UA 3DVAA 3R09A 1XG5A 1WABA 1A2BA 2MR5A 4M1YA 4QLOA 5KWEA 4F4HA 4JKYA 2JH9A 4URZR 4Q7KA 1ZK1A 3ZWAA 1UP6A 4JT8A 1QH9A 1W4BA 3AWDA 4R8VA 3T9CA 3LW8A 1V26A 1L5KA 3ET5A 2CLHB 3T12A 3PTAA 1VE7A 4DQDA 4J49A 5FFFA 3NPAA 1HFEL 3V2GA 2I3GA 3OF5A 4N3AA 2H8GA 3EUEA 1WU8A 3W1WA 3WLKX 2YICA 5CX4A 3M6XA 2WPDD 1EP2B 1KKUA 1VLLA 5L95A