1RYOA

Human serum transferrin, n-lobe bound with oxalate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oxalate effect on release of iron from human serum transferrin explained.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Serotransferrin
total genus 103
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2003-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ryoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ryoA02
3QXMA 2CZLA 1USYE 2YLNA 3MC2A 1MRPA 2HAUA 4QFNA 2A5TB 1O63A 1WODA 2F97A 4BDOA 2Y84A 4QSEA 1R9QA 3DM0A 1B05A 1B3FA 3FXRA 4KHZE 2NVUB 3JV9A 5CMMA 1ZIUA 2Q89A 4RNSA 4GXSB 2ZNTA 2PT1A 1B7HA 3T66A 3VLVA 4H0WA 5EHSA 4JSOA 2I0BA 3PGFA 3KBRA 4X1DA 4Z0IA 5FTIA 5H8SA 3SEYA 3MP8A 4QSCA 4H8IA 4X9TA 2V84A 3K4UA 1B3GA 2HEUA 3MPLA 2HQ0A 3FVOA 3B6QA 3CIJA 4WEDA 4NF8B 3VXBA 1ANFA 4IY6A 1LBBA 2X7QA 2Q8JA 1MXZA 4NMYA 3IB0A 1SYIA 1I6QA 1LAXA 2PBWA 3PU5A 3PMVA 4Q8RA 3EF7A 1B0LA 1IEJA 1US4A 2AIXA 2V93A 3OEKA 4GLIA 2DVCA 4IO6A 4DIGA 4DXCA 5AE4A 4C0RA 1ZJLA 1UTHB 1N7XA 1Y20A 2XXIA 1OQHA 2F6GA 2UXAA 3IB1A 4ZZAA 5I57A 3LC8A 3Q28A 2Y7RA 1WDNA 3KG2A 4H1XA 2PMSA 4MLVA 3O9PA 2R71A 2XXXA 5I58B 2ONSA 5DVIA 5H8QA 1MQHA 2HZLA 3G3JA 1LFIA 1BP5A 3MVXA 4H67A 4EUOA 1B6HA 2FYIA 1JNFA 3TTKA 3MP1A 1MM7A 1UQWA 2O84X 3TZAA 3ZS6A 2BJJX 2OLBA 3C34A 2OCUA 3SDFA 1RYOA 2I4CA 3OO6A 4WEPA 4ZEIA 2XXRA 2O1LA 5ELVA 2OWTA 3FJ7A 5KDTA 3VFJA 2D21A 5I56B 1RKMA 3FGSA 4RPOA 3H6UA 3RTFB 3O28A 4LVQA 1DMBA 1FTLA 3LSWA 3Q26A 1VSOA 2I4BA 1N3XA 4NTLA 1Q1KA 3VE1B 2YPNA 4JB7A 3OELA 4YU0A 4OETA 2XXUA 5FHNA 2ZNUA 3C35A 4ISUA 4L17A 5M2VA 1B3HA 2I48A 1N04A 2VHAA 3QUFA 4OHNA 3MBPA 3E4RA 4NWDA 5H8FB 1WVJA 5I59B 2NOOA 1XT8A 3H6TA 3TDJA 4LQ5A 3AXFA 4PFTA 3K1NA 2DE3A 4KFQA 5HBCA 3D4GA 1BKAA 2VOZA 4FJPA 1LCFA 1LLSA 5DVFA 3SEVA 1QW0A 3MUQA 4TLLB 5H8FA 2HAVA 3WAFA 3MP6A 5I84A 1PB8A 1PBQA 4GRKA 1NL5A 3A3UA 3TKDA 4E0XA 3JYRA 1QJMA 4YKJA 2DE4A 1SYHA 2DWIA 3K01A 4QSDA 1ZMGA 3TCFA 3FV1A 1LAGE 3KOSA 4HCYA 3V8XB 3RTWB 1Y1ZA 4G77A 1JVXA 4GFRA 4F22A 1LCTA 3C31A 4ELPA 5I56A 1POY1 3OEMA 4IO7A 3KN7A 2I49A 3PUZE 4ND9A 3RT8A 2Q9TA 1LAHE 3F11A 4GQOA 3ECRA 4IO2A 4BDNA 4E0WA 4N07A 4KYDA 2YJPA 3TCGA 3U94A 1I6BA 3DP4A 4ZEDA 3TTRA 3CRBA 4EF2A 1N84A 3HHFA 1JW5A 3PMWA 4R2BA 1MXXA 1OLCA 2GHBA 4R9FA 2P1SA 1NFTA 4GIZA 4IO4A 3V5AA 5I2KA 1B2HA 1P1OA 3IX1A 1QUJA 2CMOA 2HZKA 3ONMA 2RKMA 4JBZA 1AIVA 3S9MC 4MFIA 3ZSFA 5F7VA 4LZ7A 4H5FA 2QS1A 4GL8A 1UTHA 1SVXB 2PX1A 2XXHA 2RF1A 3PPQA 4U4SA 3OSQA 4RK2A 5H8HB 1D9YA 3BFUA 3S9NC 1NNKA 3DP6A 2XD2A 1JETA 1MG1A 1M5DA 2F78A 4YKIA 5DYHA 3SEXA 1Y9UA 1QKBA 1J1NA 1TWYA 3FJMA 4DLDA 4YKPA 3TELA 2R6GE 5I2KB 2GHAA 2XX7A 5CI5A 4ZS9A 4XKQA 3K6VA 2O6AA 4FEDA 4NF8A 3C4MA 3TEPA 1LGBC 1N76A 1FTJA 2F8DA 2REJA 3PUXE 3H6VA 3PUYE 3B7DA 4ESWA 4F2OA 1A55A 1YCJA 2B65A 4C1TA 1DSNA 2D5WA 1B3EA 4U1OA 2R9JA 1IXCA 4XKRA 4OTEA 4OYVA 5EYFA 1SW1A 2ANJA 2QPQA 1PB7A 3LBSA 5DVJA 4GOTA 1B5IA 3KFMA 3QSLA 2VP1A 1OLAA 5CMBA 3OXNA 1TFDA 2DWAA 3RY3A 4ESXA 4RYAA 3PPRA 3G3HA 4YZZA 5L9SA 3FXQA 1FTKA 1D3KA 3OO9A 1MQDA 3TTLA 1CE2A 4U4XA 3RT6B 3G3IA 4KD5A 4U22A 3R7XA 4U21A 1JQFA 1OVTA 4PQJA 4DXUA 2ESNA 4OVJA 3PPPA 2XD3A 1B4HA 1FTMA 1JW4A 4TLMB 1ZTYA 5F1QA 1I6AA 3N6TA 1SD3A 1EU8A 3CFLA 3CI8A 1O64A 3MZ9A 2Y7PA 1M5CA 3FD3A 4NEDA 4QF9A 3VLUA 2XX9A 4JXIA 2B3BA 5L8DA 4AQ4A 3IK6B 4ONYA 4HS7A 1NKXA 2Y7KA 1US5A 1A7LA 3FVNA 2HFBA 3HHGA 4GL0A 4X1BA 2DYXA 4OEUA 4QFPA 4YMBA 1DTZA 3KJTA 3Q25A 1AMFA 2V25A 4R72A 4R75A 1URSA 2B3FA 4OESA 1UTBB 3U92A 2F5XA 4F3SA 1II5A 4KI0E 4NF5B 4QHQA 3QK6A 1IQ7A 4R6HA 4I1DA 4JWYA 3C9HA 1VR5A 2DWHA 4PE5B 1SI0A 1UIVA 5CM6A 1B40A 1A54A 1HSLA 3H06B 1JEUA 1A8EA 3GZGA 1PB9A 3ILUB 4FEBA 3MZ1A 4ZEBA 3TYHA 1IXIA 2Q2AA 2AL4A 4FAJA 3MAMA 3IJXB 3EN3A 2UVGA 1ZKBA 3GLBA 3A3CA 4ZEFA 3IO4A 5FHMA 3VVEA 4MF3A 4FORA 4I8CA 4THIA 4YMAA 1YTVA 3IAZA 3N5LA 4F18A 2WKYA 1P1NA 5CMKA 3UA8A 5ICTA 4LATA 5CMCA 5DT6A 4EDPA 1MQJA 1LB8A 3N94A 3OO8A 1B5HA 2QJEA 5AA1A 4Q5TA 1LB9A 3O6IA 1D4NA 2DS9A 1HSEA 3PUWE 1B46A 4LZ8A 1B5JA 3V89B 3K6XA 1VFDA 2F7AA 4ZEKA 1IUDA 1LBCA 1S9TA 1MY1A 2UYFA 2ZYNA 4I9DA 2O1MA 4OWDA 5EHMA 1MY0A 1UIUA 3HV1A 3IJOB 2DSFA 3ZKLA 2I6EA 3T9HB 3MVWA 2ZXTA 5DEXB 4NF6B 2QRYA 4MLQA 1L5TA 3FASA 4EQ9A 4FECA 4HCWA 1GGGA 3S4UA 4ZECA 3T9UA 1Y4TA 5J1DA 1B1HA 1NNPA 1P1QA 2F7CA 5CC2A 5ITPA 1PDAA 3HSTA 3MVZA 1IXGA 4AB6A 1SW4A 4NF4B 4BDQA 3O97A 4YB6A 3Q27A 3QAXA 4R6KA 4ELRA 2G29A 1M5EA 4DZ1A 4F1VA 1MDP1 1YAEA 4PFYA 3T96B 1P1WA 2OJTA 5DTBA 1ZLQA 3RQTA 2OK2A 4NF6A 3CSGA 2RC9A 3KOTA 1SW2A 4KPTA 1H44A 3IOVA 1ELJA 2O68A 2P2AA 4IO3A 3TAJA 1Y3NA 4ZE8A 2NWJA 4DDDA 4U1ZA 4NF5A 3O6HA 3MVYA 1OVBA 2A5TA 2NUVA 3KN3A 2RC8A 5H8HA 1AL3A 2Z8FA 4R6YA 1MQGA 1KWHA 1B51A 2QMWA 2Y7IA 4RPNA 5H8NB 4N6PA 5A5XA 4O3CA 4F31B 4KYEA 3D4CA 4Q0CA 4R73A 5CBSA 5HPQA 3HCQA 3UGWA 5AA4A 1R6ZA 3CG1A 4BDMA 2ABHA 3OD7A 3PD9A 1EZPA 4U23A 4XKPA 3K0VA 1LSTA 4FIMA 4ECFA 3K6WA 3K1MA 4ZDMA 1GTKA 1SDXA 4KCDA 4EQ7A 3LUYA 3DELB 3C33A 1S50A 2Q88A 3FUZA 3IR1A 2QS3A 4H6DA 3H7MA 2V3UA 4OEVA 3UP9A 1MH4A 3LSLA 5FTHA 1MXVA 4Q30B 1FQDA 2P0SA 2AYSA 2QSXA 2RCBA 4JSDA 3SERA 4AB5A 1MY4A 4OQOA 2O69A 1UTBA 3SESA 3CR9A 3TMGA 2F36A 3EQ1A 3K6UA 3SEWA 1XS5A 2ZYOA 3KZGA 4PETA 3I5OA 2Z22A 2H4IA 3N26A 4LONB 3MWBA 3TUSA 1EH3A 1OMPA 1XC1A 4YAHX 3M3LA 1XVXA 3M8UA 1I69A 2DP8A 2GH9A 2HCAA 1XOCA 2XXPA 3OOAA 4GD5A 3VV5A 3M3FA 2FA7A 1B4ZA 1BIYA 2IA4A 2ONKE 3HO7A 4G2ZA 4G68B 4HW8A 1JVYA 2XXQA 1POTA 3UORA 3P7IA 5LOMA 1N7WA 4UA8A 2F6PA 2UVHA 3KJ7A 3O66A 4PFUA 5KCJB 1XHYA 1OIBA 2QS2A 3O29A 4OMBA 1QUKA 3RGYA 1MPBA 3RNNA 3UN6A 2H98A 2UVJA 3PUVE 4WXJA 3TQWA 1MS7A 3IOTA 4XXUA 2DQVA 3CSBA 3FATA 3QIMA 3WAEA 4TOZA 3CFXA 5CBRA 1IXHA 1IIWA 2F35A 2Z23A 3H03A 5I2NA 5I59A 3BKIB 3B6WA 4GWOA 3H3GA 1BLFA 2REGA 3JZJA 3IO6A 1PC3A 1AH5A 2GFEA 2ZMBA 3MZBA 3R26A 4XTCQ 5AA2B 5AA2D 1ATGA 1Z7NE 2NXOA 2RINA 1TXFA 1Y4CA 4POXA 3HPIA 4LQ2A 4LUBA 1EZ9A 4F3PA 1FQEA 1BTJA 5ISUA 3SEUA 3U8QA 2XXVA 2Q2CA 4O3AA 3H4ZA 1FQBA 3FZVA 1MDQA 2PT2A 2XXTA 3FIRA 1A8FA 1SBPA 2FNCA 3PPOA 3OO7A 2H99A 2Y7WA 4FE8A 1TT1A 4YB7A 2V3TA 3W9VA 1SI1A 1ZBMA 3VVDA 3DP8A 3O6GA 4EQBA 4Z7EA 1EZOA 4GXAA 3G3KA 1CB6A 1USYH 5I57B 5AA2A 2AL5A 3UIFA 2H9BA 5JTYB 1LFHA 5ITOA 1M5BA 4XIGQ 3S2VA 1M5FA 4GVOA 1MH3A 3CVGA 1B58A 3EPEA 1P1UA 1N3WA 4M4GA 1D9VA 3GXAA 3S9LC 4HTGA 3EHUA 4JDFA 4DCYA 1FCKA 1MPCA 4BLAA 1MXUA 5HM4B 3Q29A 3THIA 3USDA 3IOWA 3K2DA 4LA9A 3UK4A 1JW1A 3U1OA 4POWA 1DPEA 5JK4A 1MY3A 4P11A 4IO5A 4F3GA 1H43A 3T9XB 4H8JA 4NE4A 4OXVA 1URGA 1NH7A 3RUMA 2A5SA 3SKPA 2OZZA 4F29A 1F9BA 3MQ9A 1AOVA 1QVSA 4RK9A 4F39A 2QL3A 2OWSA 4G8NA 4MH5A 4BDRA 1XVYA 3HN0A 2XHDA 3M3KA 1OQGA 2I3WA 4QFKA 1IITA 4G8MA 2E1SA 1SQYA 3LSFB 3U72A 3TODA 1B0HA 4RA1A 2DXYA 4RJZA 4DXBA 5TPAB 5IKBA 3G3GA 3TTMA 4OZ9A 1MXWA 1B32A 3BBRA 3PD8A 2DOJA 4F1YA 3GBBA 3PPNA 2THIA 3OSRA 3DLNA 4F1UA 3T9VA 1NNTA 1LFGA 2LAOA 2ZNSA 1H45A 3FV2A 4QRZA 2X26A 1GR2A 3G3FA 4YB5A 5JEIA 1RYXA 3FVKA 5H8QB 3RN8A 3FXUA 2DXRA 4K3FA 3IOUA 4KYSA 2QS4A 5AA4B 5TP9B 4M1VA 3SETA 2HXWA 2OBGA 4G68A 4I62A 1TFAA 5CRYA 3KSJA 2ZYKA 3FVGA 1FW0A 4PFWA 5K2YA 5JTYA 2XXYA 5TU0A 3L6GA 4U2RA 5L9OA 4GF8A 2IEEA 2QMXA 5A5XB 5TPAA 1H76A 2PYYA 3C36A 3QUJA 4FATA 1B7UA 1NMUA 5H8NA 1R9LA 2E0SA 4IB2A 1T0KA 3FJGA 3KSXA 2F7BA 2DWJA 3LR1A 4F2QA 4JWXA 4ELQA 5KDTB 3RPWA 2M8CA 1MM6A 1NNFA 4IY5A 1B9JA 2UYEA 4TQUQ 4X48A 1ZU0A 4EXKA 5B7DA 1A99A 3MW0A 1FTOA 3ILTB 3OENA 4IGRA 3A09A 4YKKA 4P0IA 3EHSA 3OMBA 2Z8DA 3MPKA 3N6UA 4IGTA 4OFJA 1A40A 2D3IA 1QUIA 3K1PA 4N13A 4P0GA 3TQLA 5AA3A 5ICQA 3IB2A 3PMXA 4R2FA 5K2XA 4C1UA 4QFOA 4F3BA 1JEVA 5I58A 4H65A 1B52A 1Q35A 4NF4A 1S7YA 5BUUA 1DTGA 3CG3A 3LSXA 4G4PA 3KN8A 3CFZA 3C32A 2ALUA 2V3QA 1LAFE 2O7IA 3ODBA 4LZ5A 1QKAA 2XXWA 2ZYMA 3GBAA 3BFTA 3MJNA 4WKMA 2GRVA 4F19A 3H6WA 3E9XA 4BDLA 1YPNA 3T22A 4OENA 3I6VA 3VLWA 3E3KA 1B1XA 2I58A 1NH8A 1VFEA 2F34A 4OFOA 1VE4A 3E13X 4RXLA 4YICA 3TFLA 3VVFA 4ZE9A 1B3LA 1DOTA 4JWOA 4RY1A 2RC7A 4OERA 2I3VA 2VGQA 1URDA 3TCHA 5KCJA 4R9GA 4H5GA 3EHTA 4QFLA 5B70A 4G8HA 5KZTA 3G7WA 2Z8EA 4KR5A 4DE8A 4EXLA 3I3VA 2XX8A 3R6UA 4XKNA 1MPDA 1Y1MA 2DVZA 5FHOA 1PEBA 1MXYA 4UACA 3VDFA 1MY2A 4LP2B 2W7YA 4ZZEA 4EF1A 1Y3QA 3U93A 1O7TA 4O3BA 2I0CA 5L9MA 3K00A 1MQIA 2ONRA 2DE2A 5DEXA 1P99A 3L6HA 1N0TA 1B7ZA 1HSJA 3O2AA 4KQPA 3RLFE 1SW5A 4OFLA 4PP0A 2H25A 3B6TA 3W9WA 2VD3A 2KLFA 4R74A 1IZ1A 1DPPA 1GV8A 3IL1B 1GVCA 2G93A 3KEIA 3ZKKA 1FQCA 1PBPA 2H5YA 3T93B 1Y3PA 2X7PA 4NWCA 5I2NB 3TPAA 5IAIA 1R1NA 3S9EA 4DCXA 2PVUA 1FQAA 3TTNA 5TP9A 1Z7ME 3VXCA 1FQFA 3QYTA 3K02A 4MBPA 4ELOA 2O7UA 2VD2A 2O51A 1QULA 2RCAA 4KCCA 3W15C 3IORA 5BWJA 3PV0E 4G68C 1H3DA 3KGCA 3V83A 2UVIA
chains in the Genus database with same CATH superfamily
1USYE 1MRPA 5A5LA 4QFNA 2F97A 1R9QA 5CMMA 2KQZA 4GXSB 4OVTA 3T66A 3MP8A 4X9TA 4WEDA 4NF8B 4IY6A 1LBBA 4P3LA 3EKIA 1IEJA 2AIXA 5AE4A 4NGUA 1ZJLA 5I57A 3IB1A 2Y7RA 2PMSA 4MLVA 1MQHA 2PFZA 3MVXA 1B6HA 3MP1A 4NX1A 2BJJX 3C34A 3OO6A 2O1LA 3VFJA 2D21A 1FTAA 3RTFB 2I4BA 1N3XA 3VE1B 2ZNUA 1N04A 3QUFA 1XT8A 4KFQA 3SEVA 1FBPA 4GWYA 2HAVA 5I84A 1PB8A 2GQ1A 3JYRA 3K01A 4QSDA 3KOSA 4HCYA 3RTWB 1Y1ZA 3T0JA 1LCTA 5I56A 2QVUA 3RT8A 2Q9TA 4E0WA 4N07A 4KYDA 3TCGA 4EF2A 1MXXA 2P1SA 4GIZA 4UABA 4HXVA 2QS1A 1UTHA 4U4SA 3BFUA 3CHGA 4NHBA 3SEXA 1Y9UA 4MAGA 4IR8A 5I2KB 2GHAA 5CI5A 1LGBC 3PUXE 4F2OA 3H6VA 3B7DA 1A55A 2B65A 1B3EA 4GOTA 1TFDA 1K9YA 4YZZA 1YYZA 1CE2A 4KD5A 4NN3A 4U21A 2ESNA 4P1EA 1B4HA 4GX6A 3N6TA 1SD3A 1EU8A 3VLUA 4AQ4A 1NKXA 2DYXA 1DTZA 2FVZA 4R75A 4OESA 3U92A 4O8MA 4JWYA 1VR5A 1B40A 1A54A 3MZ1A 4FAJA 3EN3A 5FHMA 3VVEA 1YTVA 3U65A 5CMKA 5ICTA 4LATA 5CMCA 3N94A 1LB8A 5T3JA 1D4NA 1HSEA 1B5JA 3V89B 2F7AA 5I59B 1IUDA 1UIUA 3HV1A 3IJOB 3ZKLA 4NF6B 2QRYA 4MLQA 1L5TA 4EQ9A 5J1DA 5CC2A 5ITPA 3Q27A 4R6KA 4DZ1A 3MYUA 4F1VA 3T96B 4DI3D 1P1WA 2OK2A 3CSGA 3KOTA 1ELJA 4ZE8A 4OA4A 4U1ZA 4MNIA 3MVYA 2Q8MA 5H8HA 5H8NB 5CBSA 3RYDA 3D4CA 4AS5A 3UGWA 1R6ZA 3CG1A 1EZPA 2FBPA 4XKPA 4ZDMA 3A29A 3DELB 3C33A 3IFAA 2V3UA 3FXBA 1MXVA 1UTBA 3CR9A 3SEWA 3NOHA 2Z22A 3MWBA 1EH3A 1XC1A 2P3VA 1XVXA 1I69A 3VV5A 3B50A 4G68B 2ONKE 1POTA 3P7IA 3O66A 5KCJB 1XHYA 1OIBA 1QUKA 3RGYA 4N8YA 1MPBA 4WXJA 1MS7A 3CSBA 3QIMA 3WAEA 4XF5A 3CFXA 5CBRA 3H3GA 3IO6A 1PC3A 1AH5A 2ZMBA 2RINA 4PF6A 3HPIA 4LQ2A 1FQEA 5ISUA 3U8QA 4O3AA 3IR1A 3FZVA 1MDQA 1A8FA 1SBPA 3OO7A 5I2NB 4YB7A 3G3KA 5ITOA 1M5BA 3CVGA 4AS4A 1P1UA 1FBDA 1N3WA 4M4GA 1FCKA 1JW1A 4P11A 4PF8A 1FPJA 1NH7A 4PAIA 3RUMA 4P1LA 4F39A 2QL3A 1IITA 1LBWA 3G3GA 3TTMA 3PPNA 1RDXA 1H45A 1RYXA 3FVKA 3SETA 2HXWA 2OBGA 4I62A 1TFAA 1FW0A 4PFWA 3L6GA 4GF8A 2QMXA 2FIXA 5A5XB 3C36A 1FRPA 1R9LA 4F2QA 1G0HA 4JWXA 4TQUQ 4IY5A 4X48A 1NV3A 1NUYA 4PBQA 4P0IA 3MPKA 4IGTA 1QUIA 3K1PA 4R2FA 4QFOA 4F3BA 1JEVA 4H65A 4PDDA 3ODBA 3BFTA 4F19A 4BDLA 3T22A 3VLWA 3E3KA 2I58A 1NH8A 4OFOA 3TFLA 4ZE9A 2RC7A 4OERA 1RDYA 2B4LA 5IZ1A 4XKNA 2ZZXA 2XWOA 1LEVA 3K00A 1MQIA 1KA1A 2XA5A 3SZPA 3O2AA 1HSJA 3RLFE 2H25A 1DPPA 1GVCA 4N8GA 1PBPA 3T93B 2H5YA 3TPAA 4DCXA 3E78A 1FQFA 4KCCA 4P8BA 3IORA 4PC9A 4G68C 4YICA 2R8TA 2Y84A 4QSEA 4KHZE 1B05A 1B3FA 1ZIUA 1B7HA 4H0WA 4JSOA 2I0BA 4OVSA 4QSCA 2V84A 2WBBA 3K4UA 2HQ0A 3FVOA 3B6QA 3CIJA 5IM2A 4P56A 1ANFA 1AWBA 2Q8JA 1MXZA 5LDZA 2QFLA 1G0IA 1I6QA 2OWZA 3OEKA 4IO6A 2XXIA 1N7XA 1OQHA 2F6GA 5EQ9A 5LTCA 2HZLA 1LFIA 3ZS6A 5FBPA 2O84X 2OLBA 1QGXA 1RKMA 3FGSA 3H6UA 4KXPA 4O7MA 1VSOA 2YPNA 4JVIA 3OELA 4OETA 2XWIA 3C35A 2VPNA 5M2VA 1B3HA 2VHAA 3E4RA 2NOOA 3TDJA 1Q9DA 4LQ5A 5HBCA 2DE3A 3D4GA 1BKAA 2VOZA 1LLSA 5DVFA 4TLLB 1NL5A 4YKJA 1ZMGA 3FV1A 4MIJA 1JVXA 3OEMA 4IO7A 3KN7A 3LUZA 4BDNA 1LAHE 3KC1A 1NV5A 4HE0A 3DP4A 3HHFA 3PMWA 4R2BA 4P47A 2GHBA 5I2KA 1NFTA 3ISPA 4IO4A 3IX1A 2CMOA 2HZKA 1AIVA 1SVXB 5H8HB 3OSQA 2XD2A 1JETA 2F78A 5DYHA 2R6GE 2XX7A 4MEVA 1LBZA 2O6AA 4FEDA 4NF8A 1FTJA 2REJA 4ESWA 1YCJA 4C1TA 1DSNA 4XKRA 4GX3A 2L5VA 1IXCA 4OTEA 3LBSA 3QSLA 3RY3A 2DWAA 3G3HA 4DI4B 5L9SA 3FXQA 1BK4A 1FTKA 3TTLA 1MQDA 4U4XA 4U22A 1OVTA 4OVJA 3PPPA 4TLMB 1JW4A 5F1QA 1I6AA 4NEDA 1A7LA 3KJTA 3Q25A 2V25A 4R72A 2B3FA 1UTBB 2F5XA 1II5A 4R6HA 3C9HA 2PCRA 4PE5B 5CM6A 3H06B 1JEUA 3ILUB 3TYHA 1IXIA 1EYJA 2AL4A 3MAMA 5IZ3A 1ZKBA 1LBYA 3IO4A 4YMAA 3IAZA 3UA8A 4EDPA 5DT6A 1MQJA 5AA1A 3OO8A 2QJEA 4NQ8A 2Y5LA 4MNPA 4ZEKA 1NUWA 4OWDA 5EHMA 2DSFA 2I6EA 2WYKA 3T9UA 1Y4TA 2XWVA 3HSTA 3MVZA 4BDQA 4ELRA 4PE3A 4PFYA 3RQTA 2RC9A 2P2AA 4IO3A 1Y3NA 4DDDA 2A5TA 2RC8A 1MQGA 2QMWA 1B51A 4N6PA 5JK4A 4O3CA 4F31B 5AA4A 2WEFA 1LSTA 3K6WA 3K1MA 4KCDA 4FBPA 4OEVA 5FTHA 3LSLA 2P0SA 2AYSA 4JSDA 1NUXA 4OQOA 2F36A 4LONB 3TUSA 2DP8A 2F3BA 2XXPA 3OOAA 4MMPA 4PAFA 1BIYA 3HO7A 2XXQA 2UVHA 4PFUA 1NV4A 3O29A 4OMBA 1NV0A 3RNNA 2VT5A 2DQVA 3H03A 1IIWA 5I2NA 2CZIA 3BKIB 4GWOA 1BLFA 3JZJA 4XTCQ 5AA2D 4PBHA 1TXFA 1Y4CA 4MNCA 4X8RA 2XXVA 2Q2CA 3H4ZA 2PT2A 2Y7WA 3W9VA 1SI1A 4PGNA 4GXAA 1EZOA 5ET6A 5I57B 5AA2A 2AL5A 4XIGQ 3S2VA 4GVOA 4XFEA 3EPEA 1FJ6A 1D9VA 3S9LC 3EHUA 4JDFA 4DCYA 1MXUA 3Q29A 3THIA 3IOWA 3UK4A 4POWA 4PCDA 1MY3A 4F3GA 1H43A 3T9XB 4H8JA 4F29A 2OZZA 1AOVA 1QVSA 4BDRA 4QFKA 4H46A 1SQYA 4RA1A 1CNQA 1B32A 3GBBA 2THIA 4F1UA 3FV2A 4QRZA 2QVVA 4YB5A 3RN8A 2DXRA 4K3FA 3IOUA 5AA4B 5TP9B 4N6KA 4G68A 3KSJA 3FVGA 1NI9A 4X04A 5JTYA 5L9OA 1B7UA 1NMUA 1T0KA 4GX4A 3KSXA 2F7BA 2M8CA 5B7DA 4H45A 5I7IA 4YKKA 3A09A 3V83A 2Z8DA 4P0GA 4OFJA 3TQLA 3IB2A 3PMXA 1S7YA 5BUUA 3CG3A 3KN8A 3C32A 1QKAA 4WKMA 2GRVA 3H6WA 3E9XA 1YPNA 3I6VA 1VFEA 2F34A 4GWSA 3VVFA 1B3LA 1DOTA 4JWOA 2I3VA 2VGQA 3TCHA 5KCJA 1IMBA 4H5GA 5B70A 5KZTA 4EXLA 2XX8A 1Y1MA 2DVZA 1PEBA 4UACA 3VDFA 5DW8A 2W7YA 1O7TA 4O3BA 5ET7A 2ONRA 2DE2A 1SW5A 4PP0A 4R74A 3IL1B 3KEIA 3ZKKA 2X7PA 3S9EA 3TTNA 1FQAA 4ELOA 2VD2A 5BWJA 1LBXA 3PV0E 4KYEA 3KGCA 1FSAA 3QXMA 2CZLA 2YLNA 1NV6A 2A5TB 1O63A 4BDOA 3FXRA 3JV9A 2Q89A 2ZZVA 2PT1A 4Z0IA 5FTIA 4X1DA 5H8SA 2HEUA 3MPLA 4I3YA 4G61A 5ESYA 4NMYA 3IB0A 1SYIA 2PBWA 3PU5A 4P9KA 3PMVA 3EF7A 1B0LA 4DIGA 4GLIA 4C0RA 1Y20A 1IMEA 4ZZAA 3KG2A 4H1XA 2R71A 2XXXA 5H8QA 1BP5A 2DDKA 3TZAA 2WBDA 3TTKA 1UQWA 4WEPA 2OWTA 5KDTA 5I56B 3LSWA 3Q26A 4NTLA 1Q1KA 4JB7A 2XXUA 1EYIA 3MBPA 4I3EA 3AXFA 3K1NA 1IMDA 1LCFA 1QW0A 1PBQA 3TKDA 4E0XA 1QJMA 2DE4A 1SYHA 2DWIA 3TCFA 2B4MA 4GWZA 4G77A 4ELPA 1POY1 3PUZE 3F11A 4GQOA 4ECFA 4IO2A 3ECRA 2YJPA 3U94A 4N81A 1I6BA 3CRBA 1JW5A 4R9FA 3V5AA 2PFYA 1B2HA 3ONMA 2RKMA 4JBZA 3S9MC 1VDWA 3ZSFA 4LZ7A 4H5FA 2XXHA 1FBEA 2RF1A 3PPQA 1NNKA 3DP6A 4QXDA 1M5DA 4YKIA 5ET8A 4DLDA 1J1NA 1IMAA 4YKPA 1NV1A 3TELA 4XKQA 3K6VA 3C4MA 1N76A 2F8DA 2D5WA 4U1OA 2R9JA 4OYVA 1OLAA 4ESXA 4RYAA 1FBCA 1D3KA 3OO9A 5I59A 3R7XA 2XD3A 1FTMA 3CI8A 3CFLA 4QF9A 2Y7PA 1M5CA 3FD3A 4JXIA 3IK6B 1K9ZA 4HS7A 1US5A 4PFBA 3HHGA 4X1BA 3T1BA 4QFPA 4NF0A 1AMFA 1URSA 4KI0E 4NF5B 4QHQA 1IQ7A 4I1DA 1SI0A 1UIVA 4N15A 1A8EA 3GZGA 4FEBA 2Q2AA 3IJXB 4QBAA 4ZEFA 4FORA 4THIA 3N5LA 4F18A 3GYYA 2WKYA 1FPDA 5EYGA 3O6IA 1B46A 3K6XA 2UYFA 2O1MA 1MY0A 3E79A 4OVPA 3MVWA 3T9HB 5DEXB 3FASA 2CZHA 1GGGA 3S4UA 1PDAA 1IXGA 1NUZA 1SW4A 2XXKA 4NF4B 3O97A 4YB6A 3QAXA 1M5EA 1MDP1 1YAEA 5DTBA 1ZLQA 4NF6A 4I40A 4KPTA 1H44A 2XWKA 2O68A 3TAJA 2NWJA 1OVBA 3KN3A 1AL3A 2Y7IA 1XI6A 5HPQA 4Q0CA 4R73A 2ABHA 3OD7A 3PD9A 2HHMA 4LN5A 4FIMA 1GTKA 1SDXA 3LUYA 1S50A 4Q30B 4Z7EA 1DK4A 3SESA 3TMGA 3EQ1A 3K6UA 1XS5A 2ZYOA 3I5OA 1OMPA 4YAHX 3M8UA 4GD5A 1XOCA 3M3FA 4NAPA 2FA7A 1B4ZA 4G2ZA 5LOMA 3UORA 4UA8A 2F6PA 5I3SA 2H98A 3PUVE 3IOTA 4XXUA 3MZBA 1ATGA 1Z7NE 3KBZA 2Y5KA 4LUBA 4F3PA 1BTJA 3ROJA 4POXA 1FQBA 3PPOA 4MH5A 1IMFA 2H99A 2V3TA 3O6GA 4PDHA 5IZZA 3UIFA 2H9BA 1LFHA 2BJIA 4BLAA 5HM4B 4LA9A 3U1OA 1EYKA 1KZ8A 4O94A 4IO5A 2A5SA 5EYHA 3SKPA 1F9BA 3MQ9A 3MSTA 3HN0A 2E1SA 2CEXA 3LSFB 3U72A 4DXBA 1B0HA 4RJZA 2DXYA 5TPAB 1MXWA 4F1YA 2P3NA 3OSRA 3DLNA 3T9VA 1FPFA 1LFGA 2ZNSA 2X26A 1GR2A 5JEIA 5H8QB 3FXUA 4KYSA 4M1VA 4PAKA 4XEQA 5F24A 1DBZA 5TPAA 1H76A 2PYYA 3QUJA 2E0SA 1NV2A 3FJGA 5ET5A 4ELQA 1NNFA 2UYEA 1A99A 1FTOA 3EHSA 3OMBA 5ICQA 4C1UA 1B52A 4NF4A 3LSXA 4G4PA 3CFZA 2V3QA 4LZ5A 2XXWA 3GBAA 3MJNA 4JVDA 1B1XA 4RXLA 1VE4A 3E13X 3QMFA 1YXIA 4RY1A 4G8HA 3G7WA 2Z8EA 3R6UA 1MPDA 4OANA 5FHOA 1MY2A 3U93A 5L9MA 2F3DA 1P99A 1B7ZA 3W9WA 2VD3A 2KLFA 1GV8A 2G93A 1Y3PA 4NWCA 1FPBA 2PVUA 5TP9A 1Z7ME 3VXCA 3QYTA 2O7UA 3W15C 4U2RA 3B6TA 1D9QA 2KR0A 5EQ8A 3MC2A 2HAUA 1WODA 3DM0A 2NVUB 2WX9A 2JJKA 4RNSA 2ZNTA 1FPLA 3VLVA 3PGFA 3KBRA 3SEYA 4H8IA 1B3GA 3RPLB 1FPKA 4HE2A 3VXBA 2X7QA 4O7IA 1LAXA 4Q8RA 1US4A 2V93A 4DXCA 2DVCA 4OVRA 5J16A 1UTHB 2UXAA 2V4CA 3LC8A 3Q28A 1WDNA 3O9PA 3RPLA 5I58B 2ONSA 5DVIA 3G3JA 4EUOA 4H67A 4GWWA 2FYIA 1JNFA 1MM7A 2OCUA 3SDFA 1RYOA 2I4CA 5IZ3B 4ZEIA 2XXRA 5ELVA 3FJ7A 4RPOA 3O28A 4LVQA 1DMBA 1FTLA 4YU0A 5FHNA 4ISUA 4L17A 2I48A 4OHNA 4NWDA 5H8FB 1WVJA 1KA0A 3H6TA 4PFTA 4FJPA 3MUQA 5H8FA 3WAFA 3MP6A 4GRKA 3A3UA 2HPGA 3PTYA 1LAGE 3V8XB 4GFRA 4F22A 3C31A 2I49A 4ND9A 1FPGA 2FHYA 3BIGA 4ZEDA 3TTRA 5IGAA 1N84A 4N91A 1OLCA 1P1OA 1QUJA 4MFIA 5F7VA 4N6DA 4GL8A 2PX1A 4RK2A 1FPIA 1D9YA 3S9NC 1MG1A 1INPA 1QKBA 1TWYA 2WYPA 3FJMA 3D1RA 2OX3A 4ZS9A 2HXRA 3PUYE 1SW1A 2ANJA 2QPQA 1PB7A 5DVJA 1B5IA 3KFMA 2VP1A 5CMBA 3OXNA 3PPRA 3RT6B 3G3IA 1JQFA 4PQJA 1SPIA 5EQ7A 4DXUA 1YZ0A 1ZTYA 1O64A 3MZ9A 4NG7A 1FBHA 2XX9A 2B3BA 5L8DA 4ONYA 2Y7KA 3FVNA 2HFBA 4GL0A 4OEUA 4YMBA 2CZKA 4F3SA 3QK6A 2DWHA 1HSLA 1PB9A 4ZEBA 2Q74A 4PTKA 2UVGA 3GLBA 3A3CA 4N4UA 4MF3A 4I8CA 1P1NA 4MCOA 1B5HA 4HE1A 4Q5TA 1LB9A 4GWXA 2DS9A 3PUWE 4LZ8A 1FBGA 1VFDA 1LBCA 1S9TA 1MY1A 4I9DA 2ZYNA 3TODA 2ZXTA 5EQAA 4FECA 4HCWA 4ZECA 1IMCA 1B1HA 1NNPA 1P1QA 2F7CA 4AB6A 2G29A 2OJTA 1SW2A 3IOVA 5I5PA 4NF5A 3O6HA 2NUVA 2Z8FA 4R6YA 1DCUA 1KWHA 4RPNA 5A5XA 3HCQA 4GBWA 4BDMA 1JP4A 4U23A 3K0VA 4EQ7A 3FUZA 2Q88A 2QS3A 4H6DA 3H7MA 3UP9A 1MH4A 1FJ9A 4AB5A 1FQDA 2QSXA 2RCBA 3SERA 1MY4A 2O69A 3LV0A 3KZGA 4PETA 2H4IA 3N26A 3M3LA 2GH9A 2HCAA 2IA4A 3IFCA 4HW8A 1JVYA 1N7WA 3KJ7A 2QS2A 2QVRA 1FBFA 3UN6A 2UVJA 3TQWA 4PFRA 3FATA 4TOZA 1IXHA 2F35A 2Z23A 2ZZWA 3B6WA 2REGA 3R26A 2GFEA 3KC0A 5AA2B 2NXOA 1EZ9A 3SEUA 3FIRA 4FE8A 2XXTA 3FBPA 2FNCA 4MX6A 1TT1A 4MJOA 4EQBA 1ZBMA 3VVDA 3DP8A 1CB6A 1USYH 4N17A 3HFUA 5JTYB 4MHFA 1M5FA 4PFIA 1MH3A 1B58A 3GXAA 4GWUA 4HTGA 1MPCA 3USDA 3K2DA 1DPEA 1RDZA 4OXVA 4NE4A 1URGA 1FPEA 4RK9A 2FIEA 2OWSA 4G8NA 1XVYA 2XHDA 3M3KA 1OQGA 2I3WA 4G8MA 5IKBA 4OZ9A 3BBRA 3PD8A 2DOJA 1NNTA 2LAOA 3G3FA 3B8BA 3BIHA 2QS4A 4GBVA 5CRYA 2ZYKA 5K2YA 2XXYA 5TU0A 2IEEA 1LBVA 4FATA 5H8NA 4IB2A 2DWJA 3LR1A 5KDTB 3RPWA 1MM6A 4EXKA 1B9JA 1ZU0A 2CEYA 3MW0A 3ILTB 3OENA 4IGRA 3TEPA 3N6UA 5EYFA 5AA3A 1A40A 2D3IA 4N13A 5K2XA 5I58A 1Q35A 1DTGA 4JVCA 5EHSA 2ALUA 1LAFE 2O7IA 2ZYMA 4OENA 4OVQA 1URDA 2MKZA 4R9GA 3EHTA 4QFLA 4KR5A 4DE8A 3I3VA 1MXYA 4LP2B 4ZZEA 4EF1A 1Y3QA 2I0CA 5DEXA 3L6HA 1N0TA 4KQPA 4OFLA 1IZ1A 1FQCA 5IAIA 1R1NA 1NV7A 3K02A 4MBPA 2O51A 1QULA 2RCAA 2VPOA 2UVIA 1H3DA 4PGPA
chains in the Genus database with same CATH topology
3QXMA 2CZLA 1USYE 2YLNA 3MC2A 1MRPA 2HAUA 4QFNA 2A5TB 1O63A 1WODA 2F97A 4BDOA 2Y84A 4QSEA 1R9QA 3DM0A 1B05A 1B3FA 3FXRA 4KHZE 2NVUB 3JV9A 5CMMA 1ZIUA 2Q89A 4RNSA 4GXSB 2ZNTA 2PT1A 1B7HA 3T66A 3VLVA 4H0WA 5EHSA 4JSOA 2I0BA 3PGFA 3KBRA 4X1DA 4Z0IA 5FTIA 5H8SA 3SEYA 3MP8A 4QSCA 4H8IA 4X9TA 2V84A 3K4UA 1B3GA 2HEUA 3MPLA 2HQ0A 3FVOA 3B6QA 3CIJA 4WEDA 4NF8B 3VXBA 1ANFA 4IY6A 1LBBA 2X7QA 2Q8JA 1MXZA 4NMYA 3IB0A 1SYIA 1I6QA 1LAXA 2PBWA 3PU5A 3PMVA 4Q8RA 3EF7A 1B0LA 1IEJA 1US4A 2AIXA 2V93A 3OEKA 4GLIA 2DVCA 4IO6A 4DIGA 4DXCA 5AE4A 4C0RA 1ZJLA 1UTHB 1N7XA 1Y20A 2XXIA 1OQHA 2F6GA 2UXAA 3IB1A 4ZZAA 5I57A 3LC8A 3Q28A 2Y7RA 1WDNA 3KG2A 4H1XA 2PMSA 4MLVA 3O9PA 2R71A 2XXXA 5I58B 2ONSA 5DVIA 5H8QA 1MQHA 2HZLA 3G3JA 1LFIA 1BP5A 3MVXA 4H67A 4EUOA 1B6HA 2FYIA 1JNFA 3TTKA 3MP1A 1MM7A 1UQWA 2O84X 3TZAA 3ZS6A 2BJJX 2OLBA 3C34A 2OCUA 3SDFA 1RYOA 2I4CA 3OO6A 4WEPA 4ZEIA 2XXRA 2O1LA 5ELVA 2OWTA 3FJ7A 5KDTA 3VFJA 2D21A 5I56B 1RKMA 3FGSA 4RPOA 3H6UA 3RTFB 3O28A 4LVQA 1DMBA 1FTLA 3LSWA 3Q26A 1VSOA 2I4BA 1N3XA 4NTLA 1Q1KA 3VE1B 2YPNA 4JB7A 3OELA 4YU0A 4OETA 2XXUA 5FHNA 2ZNUA 3C35A 4ISUA 4L17A 5M2VA 1B3HA 2I48A 1N04A 2VHAA 3QUFA 4OHNA 3MBPA 3E4RA 4NWDA 5H8FB 1WVJA 5I59B 2NOOA 1XT8A 3H6TA 3TDJA 4LQ5A 3AXFA 4PFTA 3K1NA 2DE3A 4KFQA 5HBCA 3D4GA 1BKAA 2VOZA 4FJPA 1LCFA 1LLSA 5DVFA 3SEVA 1QW0A 3MUQA 4TLLB 5H8FA 2HAVA 3WAFA 3MP6A 5I84A 1PB8A 1PBQA 4GRKA 1NL5A 3A3UA 3TKDA 4E0XA 3JYRA 1QJMA 4YKJA 2DE4A 1SYHA 2DWIA 3K01A 4QSDA 1ZMGA 3TCFA 3FV1A 1LAGE 3KOSA 4HCYA 3V8XB 3RTWB 1Y1ZA 4G77A 1JVXA 4GFRA 4F22A 1LCTA 3C31A 4ELPA 5I56A 1POY1 3OEMA 4IO7A 3KN7A 2I49A 3PUZE 4ND9A 3RT8A 2Q9TA 1LAHE 3F11A 4GQOA 3ECRA 4IO2A 4BDNA 4E0WA 4N07A 4KYDA 2YJPA 3TCGA 3U94A 1I6BA 3DP4A 4ZEDA 3TTRA 3CRBA 4EF2A 1N84A 3HHFA 1JW5A 3PMWA 4R2BA 1MXXA 1OLCA 2GHBA 4R9FA 2P1SA 1NFTA 4GIZA 4IO4A 3V5AA 5I2KA 1B2HA 1P1OA 3IX1A 1QUJA 2CMOA 2HZKA 3ONMA 2RKMA 4JBZA 1AIVA 3S9MC 4MFIA 3ZSFA 5F7VA 4LZ7A 4H5FA 2QS1A 4GL8A 1UTHA 1SVXB 2PX1A 2XXHA 2RF1A 3PPQA 4U4SA 3OSQA 4RK2A 5H8HB 1D9YA 3BFUA 3S9NC 1NNKA 3DP6A 2XD2A 1JETA 1MG1A 1M5DA 2F78A 4YKIA 5DYHA 3SEXA 1Y9UA 1QKBA 1J1NA 1TWYA 3FJMA 4DLDA 4YKPA 3TELA 2R6GE 5I2KB 2GHAA 2XX7A 5CI5A 4ZS9A 4XKQA 3K6VA 2O6AA 4FEDA 4NF8A 3C4MA 3TEPA 1LGBC 1N76A 1FTJA 2F8DA 2REJA 3PUXE 3H6VA 3PUYE 3B7DA 4ESWA 4F2OA 1A55A 1YCJA 2B65A 4C1TA 1DSNA 2D5WA 1B3EA 4U1OA 2R9JA 1IXCA 4XKRA 4OTEA 4OYVA 5EYFA 1SW1A 2ANJA 2QPQA 1PB7A 3LBSA 5DVJA 4GOTA 1B5IA 3KFMA 3QSLA 2VP1A 1OLAA 5CMBA 3OXNA 1TFDA 2DWAA 3RY3A 4ESXA 4RYAA 3PPRA 3G3HA 4YZZA 5L9SA 3FXQA 1FTKA 1D3KA 3OO9A 1MQDA 3TTLA 1CE2A 4U4XA 3RT6B 3G3IA 4KD5A 4U22A 3R7XA 4U21A 1JQFA 1OVTA 4PQJA 4DXUA 2ESNA 4OVJA 3PPPA 2XD3A 1B4HA 1FTMA 1JW4A 4TLMB 1ZTYA 5F1QA 1I6AA 3N6TA 1SD3A 1EU8A 3CFLA 3CI8A 1O64A 3MZ9A 2Y7PA 1M5CA 3FD3A 4NEDA 4QF9A 3VLUA 2XX9A 4JXIA 2B3BA 5L8DA 4AQ4A 3IK6B 4ONYA 4HS7A 1NKXA 2Y7KA 1US5A 1A7LA 3FVNA 2HFBA 3HHGA 4GL0A 4X1BA 2DYXA 4OEUA 4QFPA 4YMBA 1DTZA 3KJTA 3Q25A 1AMFA 2V25A 4R72A 4R75A 1URSA 2B3FA 4OESA 1UTBB 3U92A 2F5XA 4F3SA 1II5A 4KI0E 4NF5B 4QHQA 3QK6A 1IQ7A 4R6HA 4I1DA 4JWYA 3C9HA 1VR5A 2DWHA 4PE5B 1SI0A 1UIVA 5CM6A 1B40A 1A54A 1HSLA 3H06B 1JEUA 1A8EA 3GZGA 1PB9A 3ILUB 4FEBA 3MZ1A 4ZEBA 3TYHA 1IXIA 2Q2AA 2AL4A 4FAJA 3MAMA 3IJXB 3EN3A 2UVGA 1ZKBA 3GLBA 3A3CA 4ZEFA 3IO4A 5FHMA 3VVEA 4MF3A 4FORA 4I8CA 4THIA 4YMAA 1YTVA 3IAZA 3N5LA 4F18A 2WKYA 1P1NA 5CMKA 3UA8A 5ICTA 4LATA 5CMCA 5DT6A 4EDPA 1MQJA 1LB8A 3N94A 3OO8A 1B5HA 2QJEA 5AA1A 4Q5TA 1LB9A 3O6IA 1D4NA 2DS9A 1HSEA 3PUWE 1B46A 4LZ8A 1B5JA 3V89B 3K6XA 1VFDA 2F7AA 4ZEKA 1IUDA 1LBCA 1S9TA 1MY1A 2UYFA 2ZYNA 4I9DA 2O1MA 4OWDA 5EHMA 1MY0A 1UIUA 3HV1A 3IJOB 2DSFA 3ZKLA 2I6EA 3T9HB 3MVWA 2ZXTA 5DEXB 4NF6B 2QRYA 4MLQA 1L5TA 3FASA 4EQ9A 4FECA 4HCWA 1GGGA 3S4UA 4ZECA 3T9UA 1Y4TA 5J1DA 1B1HA 1NNPA 1P1QA 2F7CA 5CC2A 5ITPA 1PDAA 3HSTA 3MVZA 1IXGA 4AB6A 1SW4A 4NF4B 4BDQA 3O97A 4YB6A 3Q27A 3QAXA 4R6KA 4ELRA 2G29A 1M5EA 4DZ1A 4F1VA 1MDP1 1YAEA 4PFYA 3T96B 1P1WA 2OJTA 5DTBA 1ZLQA 3RQTA 2OK2A 4NF6A 3CSGA 2RC9A 3KOTA 1SW2A 4KPTA 1H44A 3IOVA 1ELJA 2O68A 2P2AA 4IO3A 3TAJA 1Y3NA 4ZE8A 2NWJA 4DDDA 4U1ZA 4NF5A 3O6HA 3MVYA 1OVBA 2A5TA 2NUVA 3KN3A 2RC8A 5H8HA 1AL3A 2Z8FA 4R6YA 1MQGA 1KWHA 1B51A 2QMWA 2Y7IA 4RPNA 5H8NB 4N6PA 5A5XA 4O3CA 4F31B 4KYEA 3D4CA 4Q0CA 4R73A 5CBSA 5HPQA 3HCQA 3UGWA 5AA4A 1R6ZA 3CG1A 4BDMA 2ABHA 3OD7A 3PD9A 1EZPA 4U23A 4XKPA 3K0VA 1LSTA 4FIMA 4ECFA 3K6WA 3K1MA 4ZDMA 1GTKA 1SDXA 4KCDA 4EQ7A 3LUYA 3DELB 3C33A 1S50A 2Q88A 3FUZA 3IR1A 2QS3A 4H6DA 3H7MA 2V3UA 4OEVA 3UP9A 1MH4A 3LSLA 5FTHA 1MXVA 4Q30B 1FQDA 2P0SA 2AYSA 2QSXA 2RCBA 4JSDA 3SERA 4AB5A 1MY4A 4OQOA 2O69A 1UTBA 3SESA 3CR9A 3TMGA 2F36A 3EQ1A 3K6UA 3SEWA 1XS5A 2ZYOA 3KZGA 4PETA 3I5OA 2Z22A 2H4IA 3N26A 4LONB 3MWBA 3TUSA 1EH3A 1OMPA 1XC1A 4YAHX 3M3LA 1XVXA 3M8UA 1I69A 2DP8A 2GH9A 2HCAA 1XOCA 2XXPA 3OOAA 4GD5A 3VV5A 3M3FA 2FA7A 1B4ZA 1BIYA 2IA4A 2ONKE 3HO7A 4G2ZA 4G68B 4HW8A 1JVYA 2XXQA 1POTA 3UORA 3P7IA 5LOMA 1N7WA 4UA8A 2F6PA 2UVHA 3KJ7A 3O66A 4PFUA 5KCJB 1XHYA 1OIBA 2QS2A 3O29A 4OMBA 1QUKA 3RGYA 1MPBA 3RNNA 3UN6A 2H98A 2UVJA 3PUVE 4WXJA 3TQWA 1MS7A 3IOTA 4XXUA 2DQVA 3CSBA 3FATA 3QIMA 3WAEA 4TOZA 3CFXA 5CBRA 1IXHA 1IIWA 2F35A 2Z23A 3H03A 5I2NA 5I59A 3BKIB 3B6WA 4GWOA 3H3GA 1BLFA 2REGA 3JZJA 3IO6A 1PC3A 1AH5A 2GFEA 2ZMBA 3MZBA 3R26A 4XTCQ 5AA2B 5AA2D 1ATGA 1Z7NE 2NXOA 2RINA 1TXFA 1Y4CA 4POXA 3HPIA 4LQ2A 4LUBA 1EZ9A 4F3PA 1FQEA 1BTJA 5ISUA 3SEUA 3U8QA 2XXVA 2Q2CA 4O3AA 3H4ZA 1FQBA 3FZVA 1MDQA 2PT2A 2XXTA 3FIRA 1A8FA 1SBPA 2FNCA 3PPOA 3OO7A 2H99A 2Y7WA 4FE8A 1TT1A 4YB7A 2V3TA 3W9VA 1SI1A 1ZBMA 3VVDA 3DP8A 3O6GA 4EQBA 4Z7EA 1EZOA 4GXAA 3G3KA 1CB6A 1USYH 5I57B 5AA2A 2AL5A 3UIFA 2H9BA 5JTYB 1LFHA 5ITOA 1M5BA 4XIGQ 3S2VA 1M5FA 4GVOA 1MH3A 3CVGA 1B58A 3EPEA 1P1UA 1N3WA 4M4GA 1D9VA 3GXAA 3S9LC 4HTGA 3EHUA 4JDFA 4DCYA 1FCKA 1MPCA 4BLAA 1MXUA 5HM4B 3Q29A 3THIA 3USDA 3IOWA 3K2DA 4LA9A 3UK4A 1JW1A 3U1OA 4POWA 1DPEA 5JK4A 1MY3A 4P11A 4IO5A 4F3GA 1H43A 3T9XB 4H8JA 4NE4A 4OXVA 1URGA 1NH7A 3RUMA 2A5SA 3SKPA 2OZZA 4F29A 1F9BA 3MQ9A 1AOVA 1QVSA 4RK9A 4F39A 2QL3A 2OWSA 4G8NA 4MH5A 4BDRA 1XVYA 3HN0A 2XHDA 3M3KA 1OQGA 2I3WA 4QFKA 1IITA 4G8MA 2E1SA 1SQYA 3LSFB 3U72A 3TODA 1B0HA 4RA1A 2DXYA 4RJZA 4DXBA 5TPAB 5IKBA 3G3GA 3TTMA 4OZ9A 1MXWA 1B32A 3BBRA 3PD8A 2DOJA 4F1YA 3GBBA 3PPNA 2THIA 3OSRA 3DLNA 4F1UA 3T9VA 1NNTA 1LFGA 2LAOA 2ZNSA 1H45A 3FV2A 4QRZA 2X26A 1GR2A 3G3FA 4YB5A 5JEIA 1RYXA 3FVKA 5H8QB 3RN8A 3FXUA 2DXRA 4K3FA 3IOUA 4KYSA 2QS4A 5AA4B 5TP9B 4M1VA 3SETA 2HXWA 2OBGA 4G68A 4I62A 1TFAA 5CRYA 3KSJA 2ZYKA 3FVGA 1FW0A 4PFWA 5K2YA 5JTYA 2XXYA 5TU0A 3L6GA 4U2RA 5L9OA 4GF8A 2IEEA 2QMXA 5A5XB 5TPAA 1H76A 2PYYA 3C36A 3QUJA 4FATA 1B7UA 1NMUA 5H8NA 1R9LA 2E0SA 4IB2A 1T0KA 3FJGA 3KSXA 2F7BA 2DWJA 3LR1A 4F2QA 4JWXA 4ELQA 5KDTB 3RPWA 2M8CA 1MM6A 1NNFA 4IY5A 1B9JA 2UYEA 4TQUQ 4X48A 1ZU0A 4EXKA 5B7DA 1A99A 3MW0A 1FTOA 3ILTB 3OENA 4IGRA 3A09A 4YKKA 4P0IA 3EHSA 3OMBA 2Z8DA 3MPKA 3N6UA 4IGTA 4OFJA 1A40A 2D3IA 1QUIA 3K1PA 4N13A 4P0GA 3TQLA 5AA3A 5ICQA 3IB2A 3PMXA 4R2FA 5K2XA 4C1UA 4QFOA 4F3BA 1JEVA 5I58A 4H65A 1B52A 1Q35A 4NF4A 1S7YA 5BUUA 1DTGA 3CG3A 3LSXA 4G4PA 3KN8A 3CFZA 3C32A 2ALUA 2V3QA 1LAFE 2O7IA 3ODBA 4LZ5A 1QKAA 2XXWA 2ZYMA 3GBAA 3BFTA 3MJNA 4WKMA 2GRVA 4F19A 3H6WA 3E9XA 4BDLA 1YPNA 3T22A 4OENA 3I6VA 3VLWA 3E3KA 1B1XA 2I58A 1NH8A 1VFEA 2F34A 4OFOA 1VE4A 3E13X 4RXLA 4YICA 3TFLA 3VVFA 4ZE9A 1B3LA 1DOTA 4JWOA 4RY1A 2RC7A 4OERA 2I3VA 2VGQA 1URDA 3TCHA 5KCJA 4R9GA 4H5GA 3EHTA 4QFLA 5B70A 4G8HA 5KZTA 3G7WA 2Z8EA 4KR5A 4DE8A 4EXLA 3I3VA 2XX8A 3R6UA 4XKNA 1MPDA 1Y1MA 2DVZA 5FHOA 1PEBA 1MXYA 4UACA 3VDFA 1MY2A 4LP2B 2W7YA 4ZZEA 4EF1A 1Y3QA 3U93A 1O7TA 4O3BA 2I0CA 5L9MA 3K00A 1MQIA 2ONRA 2DE2A 5DEXA 1P99A 3L6HA 1N0TA 1B7ZA 1HSJA 3O2AA 4KQPA 3RLFE 1SW5A 4OFLA 4PP0A 2H25A 3B6TA 3W9WA 2VD3A 2KLFA 4R74A 1IZ1A 1DPPA 1GV8A 3IL1B 1GVCA 2G93A 3KEIA 3ZKKA 1FQCA 1PBPA 2H5YA 3T93B 1Y3PA 2X7PA 4NWCA 5I2NB 3TPAA 5IAIA 1R1NA 3S9EA 4DCXA 2PVUA 1FQAA 3TTNA 5TP9A 1Z7ME 3VXCA 1FQFA 3QYTA 3K02A 4MBPA 4ELOA 2O7UA 2VD2A 2O51A 1QULA 2RCAA 4KCCA 3W15C 3IORA 5BWJA 3PV0E 4G68C 1H3DA 3KGCA 3V83A 2UVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QXM A;  2CZL A;  1USY E;  2YLN A;  3MC2 A;  1MRP A;  2HAU A;  4QFN A;  2A5T B;  1O63 A;  1WOD A;  2F97 A;  4BDO A;  2Y84 A;  4QSE A;  1R9Q A;  3DM0 A;  1B05 A;  1B3F A;  3FXR A;  4KHZ E;  2NVU B;  3JV9 A;  5CMM A;  1ZIU A;  2Q89 A;  4RNS A;  4GXS B;  2ZNT A;  2PT1 A;  1B7H A;  3T66 A;  3VLV A;  4H0W A;  5EHS A;  4JSO A;  2I0B A;  3PGF A;  3KBR A;  4X1D A;  4Z0I A;  5FTI A;  5H8S A;  3SEY A;  3MP8 A;  4QSC A;  4H8I A;  4X9T A;  2V84 A;  3K4U A;  1B3G A;  2HEU A;  3MPL A;  2HQ0 A;  3FVO A;  3B6Q A;  3CIJ A;  4WED A;  4NF8 B;  3VXB A;  1ANF A;  4IY6 A;  1LBB A;  2X7Q A;  2Q8J A;  1MXZ A;  4NMY A;  3IB0 A;  1SYI A;  1I6Q A;  1LAX A;  2PBW A;  3PU5 A;  3PMV A;  4Q8R A;  3EF7 A;  1B0L A;  1IEJ A;  1US4 A;  2AIX A;  2V93 A;  3OEK A;  4GLI A;  2DVC A;  4IO6 A;  4DIG A;  4DXC A;  5AE4 A;  4C0R A;  1ZJL A;  1UTH B;  1N7X A;  1Y20 A;  2XXI A;  1OQH A;  2F6G A;  2UXA A;  3IB1 A;  4ZZA A;  5I57 A;  3LC8 A;  3Q28 A;  2Y7R A;  1WDN A;  3KG2 A;  4H1X A;  2PMS A;  4MLV A;  3O9P A;  2R71 A;  2XXX A;  5I58 B;  2ONS A;  5DVI A;  5H8Q A;  1MQH A;  2HZL A;  3G3J A;  1LFI A;  1BP5 A;  3MVX A;  4H67 A;  4EUO A;  1B6H A;  2FYI A;  1JNF A;  3TTK A;  3MP1 A;  1MM7 A;  1UQW A;  2O84 X;  3TZA A;  3ZS6 A;  2BJJ X;  2OLB A;  3C34 A;  2OCU A;  3SDF A;  1RYO A;  2I4C A;  3OO6 A;  4WEP A;  4ZEI A;  2XXR A;  2O1L A;  5ELV A;  2OWT A;  3FJ7 A;  5KDT A;  3VFJ A;  2D21 A;  5I56 B;  1RKM A;  3FGS A;  4RPO A;  3H6U A;  3RTF B;  3O28 A;  4LVQ A;  1DMB A;  1FTL A;  3LSW A;  3Q26 A;  1VSO A;  2I4B A;  1N3X A;  4NTL A;  1Q1K A;  3VE1 B;  2YPN A;  4JB7 A;  3OEL A;  4YU0 A;  4OET A;  2XXU A;  5FHN A;  2ZNU A;  3C35 A;  4ISU A;  4L17 A;  5M2V A;  1B3H A;  2I48 A;  1N04 A;  2VHA A;  3QUF A;  4OHN A;  3MBP A;  3E4R A;  4NWD A;  5H8F B;  1WVJ A;  5I59 B;  2NOO A;  1XT8 A;  3H6T A;  3TDJ A;  4LQ5 A;  3AXF A;  4PFT A;  3K1N A;  2DE3 A;  4KFQ A;  5HBC A;  3D4G A;  1BKA A;  2VOZ A;  4FJP A;  1LCF A;  1LLS A;  5DVF A;  3SEV A;  1QW0 A;  3MUQ A;  4TLL B;  5H8F A;  2HAV A;  3WAF A;  3MP6 A;  5I84 A;  1PB8 A;  1PBQ A;  4GRK A;  1NL5 A;  3A3U A;  3TKD A;  4E0X A;  3JYR A;  1QJM A;  4YKJ A;  2DE4 A;  1SYH A;  2DWI A;  3K01 A;  4QSD A;  1ZMG A;  3TCF A;  3FV1 A;  1LAG E;  3KOS A;  4HCY A;  3V8X B;  3RTW B;  1Y1Z A;  4G77 A;  1JVX A;  4GFR A;  4F22 A;  1LCT A;  3C31 A;  4ELP A;  5I56 A;  1POY 1;  3OEM A;  4IO7 A;  3KN7 A;  2I49 A;  3PUZ E;  4ND9 A;  3RT8 A;  2Q9T A;  1LAH E;  3F11 A;  4GQO A;  3ECR A;  4IO2 A;  4BDN A;  4E0W A;  4N07 A;  4KYD A;  2YJP A;  3TCG A;  3U94 A;  1I6B A;  3DP4 A;  4ZED A;  3TTR A;  3CRB A;  4EF2 A;  1N84 A;  3HHF A;  1JW5 A;  3PMW A;  4R2B A;  1MXX A;  1OLC A;  2GHB A;  4R9F A;  2P1S A;  1NFT A;  4GIZ A;  4IO4 A;  3V5A A;  5I2K A;  1B2H A;  1P1O A;  3IX1 A;  1QUJ A;  2CMO A;  2HZK A;  3ONM A;  2RKM A;  4JBZ A;  1AIV A;  3S9M C;  4MFI A;  3ZSF A;  5F7V A;  4LZ7 A;  4H5F A;  2QS1 A;  4GL8 A;  1UTH A;  1SVX B;  2PX1 A;  2XXH A;  2RF1 A;  3PPQ A;  4U4S A;  3OSQ A;  4RK2 A;  5H8H B;  1D9Y A;  3BFU A;  3S9N C;  1NNK A;  3DP6 A;  2XD2 A;  1JET A;  1MG1 A;  1M5D A;  2F78 A;  4YKI A;  5DYH A;  3SEX A;  1Y9U A;  1QKB A;  1J1N A;  1TWY A;  3FJM A;  4DLD A;  4YKP A;  3TEL A;  2R6G E;  5I2K B;  2GHA A;  2XX7 A;  5CI5 A;  4ZS9 A;  4XKQ A;  3K6V A;  2O6A A;  4FED A;  4NF8 A;  3C4M A;  3TEP A;  1LGB C;  1N76 A;  1FTJ A;  2F8D A;  2REJ A;  3PUX E;  3H6V A;  3PUY E;  3B7D A;  4ESW A;  4F2O A;  1A55 A;  1YCJ A;  2B65 A;  4C1T A;  1DSN A;  2D5W A;  1B3E A;  4U1O A;  2R9J A;  1IXC A;  4XKR A;  4OTE A;  4OYV A;  5EYF A;  1SW1 A;  2ANJ A;  2QPQ A;  1PB7 A;  3LBS A;  5DVJ A;  4GOT A;  1B5I A;  3KFM A;  3QSL A;  2VP1 A;  1OLA A;  5CMB A;  3OXN A;  1TFD A;  2DWA A;  3RY3 A;  4ESX A;  4RYA A;  3PPR A;  3G3H A;  4YZZ A;  5L9S A;  3FXQ A;  1FTK A;  1D3K A;  3OO9 A;  1MQD A;  3TTL A;  1CE2 A;  4U4X A;  3RT6 B;  3G3I A;  4KD5 A;  4U22 A;  3R7X A;  4U21 A;  1JQF A;  1OVT A;  4PQJ A;  4DXU A;  2ESN A;  4OVJ A;  3PPP A;  2XD3 A;  1B4H A;  1FTM A;  1JW4 A;  4TLM B;  1ZTY A;  5F1Q A;  1I6A A;  3N6T A;  1SD3 A;  1EU8 A;  3CFL A;  3CI8 A;  1O64 A;  3MZ9 A;  2Y7P A;  1M5C A;  3FD3 A;  4NED A;  4QF9 A;  3VLU A;  2XX9 A;  4JXI A;  2B3B A;  5L8D A;  4AQ4 A;  3IK6 B;  4ONY A;  4HS7 A;  1NKX A;  2Y7K A;  1US5 A;  1A7L A;  3FVN A;  2HFB A;  3HHG A;  4GL0 A;  4X1B A;  2DYX A;  4OEU A;  4QFP A;  4YMB A;  1DTZ A;  3KJT A;  3Q25 A;  1AMF A;  2V25 A;  4R72 A;  4R75 A;  1URS A;  2B3F A;  4OES A;  1UTB B;  3U92 A;  2F5X A;  4F3S A;  1II5 A;  4KI0 E;  4NF5 B;  4QHQ A;  3QK6 A;  1IQ7 A;  4R6H A;  4I1D A;  4JWY A;  3C9H A;  1VR5 A;  2DWH A;  4PE5 B;  1SI0 A;  1UIV A;  5CM6 A;  1B40 A;  1A54 A;  1HSL A;  3H06 B;  1JEU A;  1A8E A;  3GZG A;  1PB9 A;  3ILU B;  4FEB A;  3MZ1 A;  4ZEB A;  3TYH A;  1IXI A;  2Q2A A;  2AL4 A;  4FAJ A;  3MAM A;  3IJX B;  3EN3 A;  2UVG A;  1ZKB A;  3GLB A;  3A3C A;  4ZEF A;  3IO4 A;  5FHM A;  3VVE A;  4MF3 A;  4FOR A;  4I8C A;  4THI A;  4YMA A;  1YTV A;  3IAZ A;  3N5L A;  4F18 A;  2WKY A;  1P1N A;  5CMK A;  3UA8 A;  5ICT A;  4LAT A;  5CMC A;  5DT6 A;  4EDP A;  1MQJ A;  1LB8 A;  3N94 A;  3OO8 A;  1B5H A;  2QJE A;  5AA1 A;  4Q5T A;  1LB9 A;  3O6I A;  1D4N A;  2DS9 A;  1HSE A;  3PUW E;  1B46 A;  4LZ8 A;  1B5J A;  3V89 B;  3K6X A;  1VFD A;  2F7A A;  4ZEK A;  1IUD A;  1LBC A;  1S9T A;  1MY1 A;  2UYF A;  2ZYN A;  4I9D A;  2O1M A;  4OWD A;  5EHM A;  1MY0 A;  1UIU A;  3HV1 A;  3IJO B;  2DSF A;  3ZKL A;  2I6E A;  3T9H B;  3MVW A;  2ZXT A;  5DEX B;  4NF6 B;  2QRY A;  4MLQ A;  1L5T A;  3FAS A;  4EQ9 A;  4FEC A;  4HCW A;  1GGG A;  3S4U A;  4ZEC A;  3T9U A;  1Y4T A;  5J1D A;  1B1H A;  1NNP A;  1P1Q A;  2F7C A;  5CC2 A;  5ITP A;  1PDA A;  3HST A;  3MVZ A;  1IXG A;  4AB6 A;  1SW4 A;  4NF4 B;  4BDQ A;  3O97 A;  4YB6 A;  3Q27 A;  3QAX A;  4R6K A;  4ELR A;  2G29 A;  1M5E A;  4DZ1 A;  4F1V A;  1MDP 1;  1YAE A;  4PFY A;  3T96 B;  1P1W A;  2OJT A;  5DTB A;  1ZLQ A;  3RQT A;  2OK2 A;  4NF6 A;  3CSG A;  2RC9 A;  3KOT A;  1SW2 A;  4KPT A;  1H44 A;  3IOV A;  1ELJ A;  2O68 A;  2P2A A;  4IO3 A;  3TAJ A;  1Y3N A;  4ZE8 A;  2NWJ A;  4DDD A;  4U1Z A;  4NF5 A;  3O6H A;  3MVY A;  1OVB A;  2A5T A;  2NUV A;  3KN3 A;  2RC8 A;  5H8H A;  1AL3 A;  2Z8F A;  4R6Y A;  1MQG A;  1KWH A;  1B51 A;  2QMW A;  2Y7I A;  4RPN A;  5H8N B;  4N6P A;  5A5X A;  4O3C A;  4F31 B;  4KYE A;  3D4C A;  4Q0C A;  4R73 A;  5CBS A;  5HPQ A;  3HCQ A;  3UGW A;  5AA4 A;  1R6Z A;  3CG1 A;  4BDM A;  2ABH A;  3OD7 A;  3PD9 A;  1EZP A;  4U23 A;  4XKP A;  3K0V A;  1LST A;  4FIM A;  4ECF A;  3K6W A;  3K1M A;  4ZDM A;  1GTK A;  1SDX A;  4KCD A;  4EQ7 A;  3LUY A;  3DEL B;  3C33 A;  1S50 A;  2Q88 A;  3FUZ A;  3IR1 A;  2QS3 A;  4H6D A;  3H7M A;  2V3U A;  4OEV A;  3UP9 A;  1MH4 A;  3LSL A;  5FTH A;  1MXV A;  4Q30 B;  1FQD A;  2P0S A;  2AYS A;  2QSX A;  2RCB A;  4JSD A;  3SER A;  4AB5 A;  1MY4 A;  4OQO A;  2O69 A;  1UTB A;  3SES A;  3CR9 A;  3TMG A;  2F36 A;  3EQ1 A;  3K6U A;  3SEW A;  1XS5 A;  2ZYO A;  3KZG A;  4PET A;  3I5O A;  2Z22 A;  2H4I A;  3N26 A;  4LON B;  3MWB A;  3TUS A;  1EH3 A;  1OMP A;  1XC1 A;  4YAH X;  3M3L A;  1XVX A;  3M8U A;  1I69 A;  2DP8 A;  2GH9 A;  2HCA A;  1XOC A;  2XXP A;  3OOA A;  4GD5 A;  3VV5 A;  3M3F A;  2FA7 A;  1B4Z A;  1BIY A;  2IA4 A;  2ONK E;  3HO7 A;  4G2Z A;  4G68 B;  4HW8 A;  1JVY A;  2XXQ A;  1POT A;  3UOR A;  3P7I A;  5LOM A;  1N7W A;  4UA8 A;  2F6P A;  2UVH A;  3KJ7 A;  3O66 A;  4PFU A;  5KCJ B;  1XHY A;  1OIB A;  2QS2 A;  3O29 A;  4OMB A;  1QUK A;  3RGY A;  1MPB A;  3RNN A;  3UN6 A;  2H98 A;  2UVJ A;  3PUV E;  4WXJ A;  3TQW A;  1MS7 A;  3IOT A;  4XXU A;  2DQV A;  3CSB A;  3FAT A;  3QIM A;  3WAE A;  4TOZ A;  3CFX A;  5CBR A;  1IXH A;  1IIW A;  2F35 A;  2Z23 A;  3H03 A;  5I2N A;  5I59 A;  3BKI B;  3B6W A;  4GWO A;  3H3G A;  1BLF A;  2REG A;  3JZJ A;  3IO6 A;  1PC3 A;  1AH5 A;  2GFE A;  2ZMB A;  3MZB A;  3R26 A;  4XTC Q;  5AA2 B;  5AA2 D;  1ATG A;  1Z7N E;  2NXO A;  2RIN A;  1TXF A;  1Y4C A;  4POX A;  3HPI A;  4LQ2 A;  4LUB A;  1EZ9 A;  4F3P A;  1FQE A;  1BTJ A;  5ISU A;  3SEU A;  3U8Q A;  2XXV A;  2Q2C A;  4O3A A;  3H4Z A;  1FQB A;  3FZV A;  1MDQ A;  2PT2 A;  2XXT A;  3FIR A;  1A8F A;  1SBP A;  2FNC A;  3PPO A;  3OO7 A;  2H99 A;  2Y7W A;  4FE8 A;  1TT1 A;  4YB7 A;  2V3T A;  3W9V A;  1SI1 A;  1ZBM A;  3VVD A;  3DP8 A;  3O6G A;  4EQB A;  4Z7E A;  1EZO A;  4GXA A;  3G3K A;  1CB6 A;  1USY H;  5I57 B;  5AA2 A;  2AL5 A;  3UIF A;  2H9B A;  5JTY B;  1LFH A;  5ITO A;  1M5B A;  4XIG Q;  3S2V A;  1M5F A;  4GVO A;  1MH3 A;  3CVG A;  1B58 A;  3EPE A;  1P1U A;  1N3W A;  4M4G A;  1D9V A;  3GXA A;  3S9L C;  4HTG A;  3EHU A;  4JDF A;  4DCY A;  1FCK A;  1MPC A;  4BLA A;  1MXU A;  5HM4 B;  3Q29 A;  3THI A;  3USD A;  3IOW A;  3K2D A;  4LA9 A;  3UK4 A;  1JW1 A;  3U1O A;  4POW A;  1DPE A;  5JK4 A;  1MY3 A;  4P11 A;  4IO5 A;  4F3G A;  1H43 A;  3T9X B;  4H8J A;  4NE4 A;  4OXV A;  1URG A;  1NH7 A;  3RUM A;  2A5S A;  3SKP A;  2OZZ A;  4F29 A;  1F9B A;  3MQ9 A;  1AOV A;  1QVS A;  4RK9 A;  4F39 A;  2QL3 A;  2OWS A;  4G8N A;  4MH5 A;  4BDR A;  1XVY A;  3HN0 A;  2XHD A;  3M3K A;  1OQG A;  2I3W A;  4QFK A;  1IIT A;  4G8M A;  2E1S A;  1SQY A;  3LSF B;  3U72 A;  3TOD A;  1B0H A;  4RA1 A;  2DXY A;  4RJZ A;  4DXB A;  5TPA B;  5IKB A;  3G3G A;  3TTM A;  4OZ9 A;  1MXW A;  1B32 A;  3BBR A;  3PD8 A;  2DOJ A;  4F1Y A;  3GBB A;  3PPN A;  2THI A;  3OSR A;  3DLN A;  4F1U A;  3T9V A;  1NNT A;  1LFG A;  2LAO A;  2ZNS A;  1H45 A;  3FV2 A;  4QRZ A;  2X26 A;  1GR2 A;  3G3F A;  4YB5 A;  5JEI A;  1RYX A;  3FVK A;  5H8Q B;  3RN8 A;  3FXU A;  2DXR A;  4K3F A;  3IOU A;  4KYS A;  2QS4 A;  5AA4 B;  5TP9 B;  4M1V A;  3SET A;  2HXW A;  2OBG A;  4G68 A;  4I62 A;  1TFA A;  5CRY A;  3KSJ A;  2ZYK A;  3FVG A;  1FW0 A;  4PFW A;  5K2Y A;  5JTY A;  2XXY A;  5TU0 A;  3L6G A;  4U2R A;  5L9O A;  4GF8 A;  2IEE A;  2QMX A;  5A5X B;  5TPA A;  1H76 A;  2PYY A;  3C36 A;  3QUJ A;  4FAT A;  1B7U A;  1NMU A;  5H8N A;  1R9L A;  2E0S A;  4IB2 A;  1T0K A;  3FJG A;  3KSX A;  2F7B A;  2DWJ A;  3LR1 A;  4F2Q A;  4JWX A;  4ELQ A;  5KDT B;  3RPW A;  2M8C A;  1MM6 A;  1NNF A;  4IY5 A;  1B9J A;  2UYE A;  4TQU Q;  4X48 A;  1ZU0 A;  4EXK A;  5B7D A;  1A99 A;  3MW0 A;  1FTO A;  3ILT B;  3OEN A;  4IGR A;  3A09 A;  4YKK A;  4P0I A;  3EHS A;  3OMB A;  2Z8D A;  3MPK A;  3N6U A;  4IGT A;  4OFJ A;  1A40 A;  2D3I A;  1QUI A;  3K1P A;  4N13 A;  4P0G A;  3TQL A;  5AA3 A;  5ICQ A;  3IB2 A;  3PMX A;  4R2F A;  5K2X A;  4C1U A;  4QFO A;  4F3B A;  1JEV A;  5I58 A;  4H65 A;  1B52 A;  1Q35 A;  4NF4 A;  1S7Y A;  5BUU A;  1DTG A;  3CG3 A;  3LSX A;  4G4P A;  3KN8 A;  3CFZ A;  3C32 A;  2ALU A;  2V3Q A;  1LAF E;  2O7I A;  3ODB A;  4LZ5 A;  1QKA A;  2XXW A;  2ZYM A;  3GBA A;  3BFT A;  3MJN A;  4WKM A;  2GRV A;  4F19 A;  3H6W A;  3E9X A;  4BDL A;  1YPN A;  3T22 A;  4OEN A;  3I6V A;  3VLW A;  3E3K A;  1B1X A;  2I58 A;  1NH8 A;  1VFE A;  2F34 A;  4OFO A;  1VE4 A;  3E13 X;  4RXL A;  4YIC A;  3TFL A;  3VVF A;  4ZE9 A;  1B3L A;  1DOT A;  4JWO A;  4RY1 A;  2RC7 A;  4OER A;  2I3V A;  2VGQ A;  1URD A;  3TCH A;  5KCJ A;  4R9G A;  4H5G A;  3EHT A;  4QFL A;  5B70 A;  4G8H A;  5KZT A;  3G7W A;  2Z8E A;  4KR5 A;  4DE8 A;  4EXL A;  3I3V A;  2XX8 A;  3R6U A;  4XKN A;  1MPD A;  1Y1M A;  2DVZ A;  5FHO A;  1PEB A;  1MXY A;  4UAC A;  3VDF A;  1MY2 A;  4LP2 B;  2W7Y A;  4ZZE A;  4EF1 A;  1Y3Q A;  3U93 A;  1O7T A;  4O3B A;  2I0C A;  5L9M A;  3K00 A;  1MQI A;  2ONR A;  2DE2 A;  5DEX A;  1P99 A;  3L6H A;  1N0T A;  1B7Z A;  1HSJ A;  3O2A A;  4KQP A;  3RLF E;  1SW5 A;  4OFL A;  4PP0 A;  2H25 A;  3B6T A;  3W9W A;  2VD3 A;  2KLF A;  4R74 A;  1IZ1 A;  1DPP A;  1GV8 A;  3IL1 B;  1GVC A;  2G93 A;  3KEI A;  3ZKK A;  1FQC A;  1PBP A;  2H5Y A;  3T93 B;  1Y3P A;  2X7P A;  4NWC A;  5I2N B;  3TPA A;  5IAI A;  1R1N A;  3S9E A;  4DCX A;  2PVU A;  1FQA A;  3TTN A;  5TP9 A;  1Z7M E;  3VXC A;  1FQF A;  3QYT A;  3K02 A;  4MBP A;  4ELO A;  2O7U A;  2VD2 A;  2O51 A;  1QUL A;  2RCA A;  4KCC A;  3W15 C;  3IOR A;  5BWJ A;  3PV0 E;  4G68 C;  1H3D A;  3KGC A;  3V83 A;  2UVI A; 
#chains in the Genus database with same CATH topology
 1USY E;  1MRP A;  5A5L A;  4QFN A;  2F97 A;  1R9Q A;  5CMM A;  2KQZ A;  4GXS B;  4OVT A;  3T66 A;  3MP8 A;  4X9T A;  4WED A;  4NF8 B;  4IY6 A;  1LBB A;  4P3L A;  3EKI A;  1IEJ A;  2AIX A;  5AE4 A;  4NGU A;  1ZJL A;  5I57 A;  3IB1 A;  2Y7R A;  2PMS A;  4MLV A;  1MQH A;  2PFZ A;  3MVX A;  1B6H A;  3MP1 A;  4NX1 A;  2BJJ X;  3C34 A;  3OO6 A;  2O1L A;  3VFJ A;  2D21 A;  1FTA A;  3RTF B;  2I4B A;  1N3X A;  3VE1 B;  2ZNU A;  1N04 A;  3QUF A;  1XT8 A;  4KFQ A;  3SEV A;  1FBP A;  4GWY A;  2HAV A;  5I84 A;  1PB8 A;  2GQ1 A;  3JYR A;  3K01 A;  4QSD A;  3KOS A;  4HCY A;  3RTW B;  1Y1Z A;  3T0J A;  1LCT A;  5I56 A;  2QVU A;  3RT8 A;  2Q9T A;  4E0W A;  4N07 A;  4KYD A;  3TCG A;  4EF2 A;  1MXX A;  2P1S A;  4GIZ A;  4UAB A;  4HXV A;  2QS1 A;  1UTH A;  4U4S A;  3BFU A;  3CHG A;  4NHB A;  3SEX A;  1Y9U A;  4MAG A;  4IR8 A;  5I2K B;  2GHA A;  5CI5 A;  1LGB C;  3PUX E;  4F2O A;  3H6V A;  3B7D A;  1A55 A;  2B65 A;  1B3E A;  4GOT A;  1TFD A;  1K9Y A;  4YZZ A;  1YYZ A;  1CE2 A;  4KD5 A;  4NN3 A;  4U21 A;  2ESN A;  4P1E A;  1B4H A;  4GX6 A;  3N6T A;  1SD3 A;  1EU8 A;  3VLU A;  4AQ4 A;  1NKX A;  2DYX A;  1DTZ A;  2FVZ A;  4R75 A;  4OES A;  3U92 A;  4O8M A;  4JWY A;  1VR5 A;  1B40 A;  1A54 A;  3MZ1 A;  4FAJ A;  3EN3 A;  5FHM A;  3VVE A;  1YTV A;  3U65 A;  5CMK A;  5ICT A;  4LAT A;  5CMC A;  3N94 A;  1LB8 A;  5T3J A;  1D4N A;  1HSE A;  1B5J A;  3V89 B;  2F7A A;  5I59 B;  1IUD A;  1UIU A;  3HV1 A;  3IJO B;  3ZKL A;  4NF6 B;  2QRY A;  4MLQ A;  1L5T A;  4EQ9 A;  5J1D A;  5CC2 A;  5ITP A;  3Q27 A;  4R6K A;  4DZ1 A;  3MYU A;  4F1V A;  3T96 B;  4DI3 D;  1P1W A;  2OK2 A;  3CSG A;  3KOT A;  1ELJ A;  4ZE8 A;  4OA4 A;  4U1Z A;  4MNI A;  3MVY A;  2Q8M A;  5H8H A;  5H8N B;  5CBS A;  3RYD A;  3D4C A;  4AS5 A;  3UGW A;  1R6Z A;  3CG1 A;  1EZP A;  2FBP A;  4XKP A;  4ZDM A;  3A29 A;  3DEL B;  3C33 A;  3IFA A;  2V3U A;  3FXB A;  1MXV A;  1UTB A;  3CR9 A;  3SEW A;  3NOH A;  2Z22 A;  3MWB A;  1EH3 A;  1XC1 A;  2P3V A;  1XVX A;  1I69 A;  3VV5 A;  3B50 A;  4G68 B;  2ONK E;  1POT A;  3P7I A;  3O66 A;  5KCJ B;  1XHY A;  1OIB A;  1QUK A;  3RGY A;  4N8Y A;  1MPB A;  4WXJ A;  1MS7 A;  3CSB A;  3QIM A;  3WAE A;  4XF5 A;  3CFX A;  5CBR A;  3H3G A;  3IO6 A;  1PC3 A;  1AH5 A;  2ZMB A;  2RIN A;  4PF6 A;  3HPI A;  4LQ2 A;  1FQE A;  5ISU A;  3U8Q A;  4O3A A;  3IR1 A;  3FZV A;  1MDQ A;  1A8F A;  1SBP A;  3OO7 A;  5I2N B;  4YB7 A;  3G3K A;  5ITO A;  1M5B A;  3CVG A;  4AS4 A;  1P1U A;  1FBD A;  1N3W A;  4M4G A;  1FCK A;  1JW1 A;  4P11 A;  4PF8 A;  1FPJ A;  1NH7 A;  4PAI A;  3RUM A;  4P1L A;  4F39 A;  2QL3 A;  1IIT A;  1LBW A;  3G3G A;  3TTM A;  3PPN A;  1RDX A;  1H45 A;  1RYX A;  3FVK A;  3SET A;  2HXW A;  2OBG A;  4I62 A;  1TFA A;  1FW0 A;  4PFW A;  3L6G A;  4GF8 A;  2QMX A;  2FIX A;  5A5X B;  3C36 A;  1FRP A;  1R9L A;  4F2Q A;  1G0H A;  4JWX A;  4TQU Q;  4IY5 A;  4X48 A;  1NV3 A;  1NUY A;  4PBQ A;  4P0I A;  3MPK A;  4IGT A;  1QUI A;  3K1P A;  4R2F A;  4QFO A;  4F3B A;  1JEV A;  4H65 A;  4PDD A;  3ODB A;  3BFT A;  4F19 A;  4BDL A;  3T22 A;  3VLW A;  3E3K A;  2I58 A;  1NH8 A;  4OFO A;  3TFL A;  4ZE9 A;  2RC7 A;  4OER A;  1RDY A;  2B4L A;  5IZ1 A;  4XKN A;  2ZZX A;  2XWO A;  1LEV A;  3K00 A;  1MQI A;  1KA1 A;  2XA5 A;  3SZP A;  3O2A A;  1HSJ A;  3RLF E;  2H25 A;  1DPP A;  1GVC A;  4N8G A;  1PBP A;  3T93 B;  2H5Y A;  3TPA A;  4DCX A;  3E78 A;  1FQF A;  4KCC A;  4P8B A;  3IOR A;  4PC9 A;  4G68 C;  4YIC A;  2R8T A;  2Y84 A;  4QSE A;  4KHZ E;  1B05 A;  1B3F A;  1ZIU A;  1B7H A;  4H0W A;  4JSO A;  2I0B A;  4OVS A;  4QSC A;  2V84 A;  2WBB A;  3K4U A;  2HQ0 A;  3FVO A;  3B6Q A;  3CIJ A;  5IM2 A;  4P56 A;  1ANF A;  1AWB A;  2Q8J A;  1MXZ A;  5LDZ A;  2QFL A;  1G0I A;  1I6Q A;  2OWZ A;  3OEK A;  4IO6 A;  2XXI A;  1N7X A;  1OQH A;  2F6G A;  5EQ9 A;  5LTC A;  2HZL A;  1LFI A;  3ZS6 A;  5FBP A;  2O84 X;  2OLB A;  1QGX A;  1RKM A;  3FGS A;  3H6U A;  4KXP A;  4O7M A;  1VSO A;  2YPN A;  4JVI A;  3OEL A;  4OET A;  2XWI A;  3C35 A;  2VPN A;  5M2V A;  1B3H A;  2VHA A;  3E4R A;  2NOO A;  3TDJ A;  1Q9D A;  4LQ5 A;  5HBC A;  2DE3 A;  3D4G A;  1BKA A;  2VOZ A;  1LLS A;  5DVF A;  4TLL B;  1NL5 A;  4YKJ A;  1ZMG A;  3FV1 A;  4MIJ A;  1JVX A;  3OEM A;  4IO7 A;  3KN7 A;  3LUZ A;  4BDN A;  1LAH E;  3KC1 A;  1NV5 A;  4HE0 A;  3DP4 A;  3HHF A;  3PMW A;  4R2B A;  4P47 A;  2GHB A;  5I2K A;  1NFT A;  3ISP A;  4IO4 A;  3IX1 A;  2CMO A;  2HZK A;  1AIV A;  1SVX B;  5H8H B;  3OSQ A;  2XD2 A;  1JET A;  2F78 A;  5DYH A;  2R6G E;  2XX7 A;  4MEV A;  1LBZ A;  2O6A A;  4FED A;  4NF8 A;  1FTJ A;  2REJ A;  4ESW A;  1YCJ A;  4C1T A;  1DSN A;  4XKR A;  4GX3 A;  2L5V A;  1IXC A;  4OTE A;  3LBS A;  3QSL A;  3RY3 A;  2DWA A;  3G3H A;  4DI4 B;  5L9S A;  3FXQ A;  1BK4 A;  1FTK A;  3TTL A;  1MQD A;  4U4X A;  4U22 A;  1OVT A;  4OVJ A;  3PPP A;  4TLM B;  1JW4 A;  5F1Q A;  1I6A A;  4NED A;  1A7L A;  3KJT A;  3Q25 A;  2V25 A;  4R72 A;  2B3F A;  1UTB B;  2F5X A;  1II5 A;  4R6H A;  3C9H A;  2PCR A;  4PE5 B;  5CM6 A;  3H06 B;  1JEU A;  3ILU B;  3TYH A;  1IXI A;  1EYJ A;  2AL4 A;  3MAM A;  5IZ3 A;  1ZKB A;  1LBY A;  3IO4 A;  4YMA A;  3IAZ A;  3UA8 A;  4EDP A;  5DT6 A;  1MQJ A;  5AA1 A;  3OO8 A;  2QJE A;  4NQ8 A;  2Y5L A;  4MNP A;  4ZEK A;  1NUW A;  4OWD A;  5EHM A;  2DSF A;  2I6E A;  2WYK A;  3T9U A;  1Y4T A;  2XWV A;  3HST A;  3MVZ A;  4BDQ A;  4ELR A;  4PE3 A;  4PFY A;  3RQT A;  2RC9 A;  2P2A A;  4IO3 A;  1Y3N A;  4DDD A;  2A5T A;  2RC8 A;  1MQG A;  2QMW A;  1B51 A;  4N6P A;  5JK4 A;  4O3C A;  4F31 B;  5AA4 A;  2WEF A;  1LST A;  3K6W A;  3K1M A;  4KCD A;  4FBP A;  4OEV A;  5FTH A;  3LSL A;  2P0S A;  2AYS A;  4JSD A;  1NUX A;  4OQO A;  2F36 A;  4LON B;  3TUS A;  2DP8 A;  2F3B A;  2XXP A;  3OOA A;  4MMP A;  4PAF A;  1BIY A;  3HO7 A;  2XXQ A;  2UVH A;  4PFU A;  1NV4 A;  3O29 A;  4OMB A;  1NV0 A;  3RNN A;  2VT5 A;  2DQV A;  3H03 A;  1IIW A;  5I2N A;  2CZI A;  3BKI B;  4GWO A;  1BLF A;  3JZJ A;  4XTC Q;  5AA2 D;  4PBH A;  1TXF A;  1Y4C A;  4MNC A;  4X8R A;  2XXV A;  2Q2C A;  3H4Z A;  2PT2 A;  2Y7W A;  3W9V A;  1SI1 A;  4PGN A;  4GXA A;  1EZO A;  5ET6 A;  5I57 B;  5AA2 A;  2AL5 A;  4XIG Q;  3S2V A;  4GVO A;  4XFE A;  3EPE A;  1FJ6 A;  1D9V A;  3S9L C;  3EHU A;  4JDF A;  4DCY A;  1MXU A;  3Q29 A;  3THI A;  3IOW A;  3UK4 A;  4POW A;  4PCD A;  1MY3 A;  4F3G A;  1H43 A;  3T9X B;  4H8J A;  4F29 A;  2OZZ A;  1AOV A;  1QVS A;  4BDR A;  4QFK A;  4H46 A;  1SQY A;  4RA1 A;  1CNQ A;  1B32 A;  3GBB A;  2THI A;  4F1U A;  3FV2 A;  4QRZ A;  2QVV A;  4YB5 A;  3RN8 A;  2DXR A;  4K3F A;  3IOU A;  5AA4 B;  5TP9 B;  4N6K A;  4G68 A;  3KSJ A;  3FVG A;  1NI9 A;  4X04 A;  5JTY A;  5L9O A;  1B7U A;  1NMU A;  1T0K A;  4GX4 A;  3KSX A;  2F7B A;  2M8C A;  5B7D A;  4H45 A;  5I7I A;  4YKK A;  3A09 A;  3V83 A;  2Z8D A;  4P0G A;  4OFJ A;  3TQL A;  3IB2 A;  3PMX A;  1S7Y A;  5BUU A;  3CG3 A;  3KN8 A;  3C32 A;  1QKA A;  4WKM A;  2GRV A;  3H6W A;  3E9X A;  1YPN A;  3I6V A;  1VFE A;  2F34 A;  4GWS A;  3VVF A;  1B3L A;  1DOT A;  4JWO A;  2I3V A;  2VGQ A;  3TCH A;  5KCJ A;  1IMB A;  4H5G A;  5B70 A;  5KZT A;  4EXL A;  2XX8 A;  1Y1M A;  2DVZ A;  1PEB A;  4UAC A;  3VDF A;  5DW8 A;  2W7Y A;  1O7T A;  4O3B A;  5ET7 A;  2ONR A;  2DE2 A;  1SW5 A;  4PP0 A;  4R74 A;  3IL1 B;  3KEI A;  3ZKK A;  2X7P A;  3S9E A;  3TTN A;  1FQA A;  4ELO A;  2VD2 A;  5BWJ A;  1LBX A;  3PV0 E;  4KYE A;  3KGC A;  1FSA A;  3QXM A;  2CZL A;  2YLN A;  1NV6 A;  2A5T B;  1O63 A;  4BDO A;  3FXR A;  3JV9 A;  2Q89 A;  2ZZV A;  2PT1 A;  4Z0I A;  5FTI A;  4X1D A;  5H8S A;  2HEU A;  3MPL A;  4I3Y A;  4G61 A;  5ESY A;  4NMY A;  3IB0 A;  1SYI A;  2PBW A;  3PU5 A;  4P9K A;  3PMV A;  3EF7 A;  1B0L A;  4DIG A;  4GLI A;  4C0R A;  1Y20 A;  1IME A;  4ZZA A;  3KG2 A;  4H1X A;  2R71 A;  2XXX A;  5H8Q A;  1BP5 A;  2DDK A;  3TZA A;  2WBD A;  3TTK A;  1UQW A;  4WEP A;  2OWT A;  5KDT A;  5I56 B;  3LSW A;  3Q26 A;  4NTL A;  1Q1K A;  4JB7 A;  2XXU A;  1EYI A;  3MBP A;  4I3E A;  3AXF A;  3K1N A;  1IMD A;  1LCF A;  1QW0 A;  1PBQ A;  3TKD A;  4E0X A;  1QJM A;  2DE4 A;  1SYH A;  2DWI A;  3TCF A;  2B4M A;  4GWZ A;  4G77 A;  4ELP A;  1POY 1;  3PUZ E;  3F11 A;  4GQO A;  4ECF A;  4IO2 A;  3ECR A;  2YJP A;  3U94 A;  4N81 A;  1I6B A;  3CRB A;  1JW5 A;  4R9F A;  3V5A A;  2PFY A;  1B2H A;  3ONM A;  2RKM A;  4JBZ A;  3S9M C;  1VDW A;  3ZSF A;  4LZ7 A;  4H5F A;  2XXH A;  1FBE A;  2RF1 A;  3PPQ A;  1NNK A;  3DP6 A;  4QXD A;  1M5D A;  4YKI A;  5ET8 A;  4DLD A;  1J1N A;  1IMA A;  4YKP A;  1NV1 A;  3TEL A;  4XKQ A;  3K6V A;  3C4M A;  1N76 A;  2F8D A;  2D5W A;  4U1O A;  2R9J A;  4OYV A;  1OLA A;  4ESX A;  4RYA A;  1FBC A;  1D3K A;  3OO9 A;  5I59 A;  3R7X A;  2XD3 A;  1FTM A;  3CI8 A;  3CFL A;  4QF9 A;  2Y7P A;  1M5C A;  3FD3 A;  4JXI A;  3IK6 B;  1K9Z A;  4HS7 A;  1US5 A;  4PFB A;  3HHG A;  4X1B A;  3T1B A;  4QFP A;  4NF0 A;  1AMF A;  1URS A;  4KI0 E;  4NF5 B;  4QHQ A;  1IQ7 A;  4I1D A;  1SI0 A;  1UIV A;  4N15 A;  1A8E A;  3GZG A;  4FEB A;  2Q2A A;  3IJX B;  4QBA A;  4ZEF A;  4FOR A;  4THI A;  3N5L A;  4F18 A;  3GYY A;  2WKY A;  1FPD A;  5EYG A;  3O6I A;  1B46 A;  3K6X A;  2UYF A;  2O1M A;  1MY0 A;  3E79 A;  4OVP A;  3MVW A;  3T9H B;  5DEX B;  3FAS A;  2CZH A;  1GGG A;  3S4U A;  1PDA A;  1IXG A;  1NUZ A;  1SW4 A;  2XXK A;  4NF4 B;  3O97 A;  4YB6 A;  3QAX A;  1M5E A;  1MDP 1;  1YAE A;  5DTB A;  1ZLQ A;  4NF6 A;  4I40 A;  4KPT A;  1H44 A;  2XWK A;  2O68 A;  3TAJ A;  2NWJ A;  1OVB A;  3KN3 A;  1AL3 A;  2Y7I A;  1XI6 A;  5HPQ A;  4Q0C A;  4R73 A;  2ABH A;  3OD7 A;  3PD9 A;  2HHM A;  4LN5 A;  4FIM A;  1GTK A;  1SDX A;  3LUY A;  1S50 A;  4Q30 B;  4Z7E A;  1DK4 A;  3SES A;  3TMG A;  3EQ1 A;  3K6U A;  1XS5 A;  2ZYO A;  3I5O A;  1OMP A;  4YAH X;  3M8U A;  4GD5 A;  1XOC A;  3M3F A;  4NAP A;  2FA7 A;  1B4Z A;  4G2Z A;  5LOM A;  3UOR A;  4UA8 A;  2F6P A;  5I3S A;  2H98 A;  3PUV E;  3IOT A;  4XXU A;  3MZB A;  1ATG A;  1Z7N E;  3KBZ A;  2Y5K A;  4LUB A;  4F3P A;  1BTJ A;  3ROJ A;  4POX A;  1FQB A;  3PPO A;  4MH5 A;  1IMF A;  2H99 A;  2V3T A;  3O6G A;  4PDH A;  5IZZ A;  3UIF A;  2H9B A;  1LFH A;  2BJI A;  4BLA A;  5HM4 B;  4LA9 A;  3U1O A;  1EYK A;  1KZ8 A;  4O94 A;  4IO5 A;  2A5S A;  5EYH A;  3SKP A;  1F9B A;  3MQ9 A;  3MST A;  3HN0 A;  2E1S A;  2CEX A;  3LSF B;  3U72 A;  4DXB A;  1B0H A;  4RJZ A;  2DXY A;  5TPA B;  1MXW A;  4F1Y A;  2P3N A;  3OSR A;  3DLN A;  3T9V A;  1FPF A;  1LFG A;  2ZNS A;  2X26 A;  1GR2 A;  5JEI A;  5H8Q B;  3FXU A;  4KYS A;  4M1V A;  4PAK A;  4XEQ A;  5F24 A;  1DBZ A;  5TPA A;  1H76 A;  2PYY A;  3QUJ A;  2E0S A;  1NV2 A;  3FJG A;  5ET5 A;  4ELQ A;  1NNF A;  2UYE A;  1A99 A;  1FTO A;  3EHS A;  3OMB A;  5ICQ A;  4C1U A;  1B52 A;  4NF4 A;  3LSX A;  4G4P A;  3CFZ A;  2V3Q A;  4LZ5 A;  2XXW A;  3GBA A;  3MJN A;  4JVD A;  1B1X A;  4RXL A;  1VE4 A;  3E13 X;  3QMF A;  1YXI A;  4RY1 A;  4G8H A;  3G7W A;  2Z8E A;  3R6U A;  1MPD A;  4OAN A;  5FHO A;  1MY2 A;  3U93 A;  5L9M A;  2F3D A;  1P99 A;  1B7Z A;  3W9W A;  2VD3 A;  2KLF A;  1GV8 A;  2G93 A;  1Y3P A;  4NWC A;  1FPB A;  2PVU A;  5TP9 A;  1Z7M E;  3VXC A;  3QYT A;  2O7U A;  3W15 C;  4U2R A;  3B6T A;  1D9Q A;  2KR0 A;  5EQ8 A;  3MC2 A;  2HAU A;  1WOD A;  3DM0 A;  2NVU B;  2WX9 A;  2JJK A;  4RNS A;  2ZNT A;  1FPL A;  3VLV A;  3PGF A;  3KBR A;  3SEY A;  4H8I A;  1B3G A;  3RPL B;  1FPK A;  4HE2 A;  3VXB A;  2X7Q A;  4O7I A;  1LAX A;  4Q8R A;  1US4 A;  2V93 A;  4DXC A;  2DVC A;  4OVR A;  5J16 A;  1UTH B;  2UXA A;  2V4C A;  3LC8 A;  3Q28 A;  1WDN A;  3O9P A;  3RPL A;  5I58 B;  2ONS A;  5DVI A;  3G3J A;  4EUO A;  4H67 A;  4GWW A;  2FYI A;  1JNF A;  1MM7 A;  2OCU A;  3SDF A;  1RYO A;  2I4C A;  5IZ3 B;  4ZEI A;  2XXR A;  5ELV A;  3FJ7 A;  4RPO A;  3O28 A;  4LVQ A;  1DMB A;  1FTL A;  4YU0 A;  5FHN A;  4ISU A;  4L17 A;  2I48 A;  4OHN A;  4NWD A;  5H8F B;  1WVJ A;  1KA0 A;  3H6T A;  4PFT A;  4FJP A;  3MUQ A;  5H8F A;  3WAF A;  3MP6 A;  4GRK A;  3A3U A;  2HPG A;  3PTY A;  1LAG E;  3V8X B;  4GFR A;  4F22 A;  3C31 A;  2I49 A;  4ND9 A;  1FPG A;  2FHY A;  3BIG A;  4ZED A;  3TTR A;  5IGA A;  1N84 A;  4N91 A;  1OLC A;  1P1O A;  1QUJ A;  4MFI A;  5F7V A;  4N6D A;  4GL8 A;  2PX1 A;  4RK2 A;  1FPI A;  1D9Y A;  3S9N C;  1MG1 A;  1INP A;  1QKB A;  1TWY A;  2WYP A;  3FJM A;  3D1R A;  2OX3 A;  4ZS9 A;  2HXR A;  3PUY E;  1SW1 A;  2ANJ A;  2QPQ A;  1PB7 A;  5DVJ A;  1B5I A;  3KFM A;  2VP1 A;  5CMB A;  3OXN A;  3PPR A;  3RT6 B;  3G3I A;  1JQF A;  4PQJ A;  1SPI A;  5EQ7 A;  4DXU A;  1YZ0 A;  1ZTY A;  1O64 A;  3MZ9 A;  4NG7 A;  1FBH A;  2XX9 A;  2B3B A;  5L8D A;  4ONY A;  2Y7K A;  3FVN A;  2HFB A;  4GL0 A;  4OEU A;  4YMB A;  2CZK A;  4F3S A;  3QK6 A;  2DWH A;  1HSL A;  1PB9 A;  4ZEB A;  2Q74 A;  4PTK A;  2UVG A;  3GLB A;  3A3C A;  4N4U A;  4MF3 A;  4I8C A;  1P1N A;  4MCO A;  1B5H A;  4HE1 A;  4Q5T A;  1LB9 A;  4GWX A;  2DS9 A;  3PUW E;  4LZ8 A;  1FBG A;  1VFD A;  1LBC A;  1S9T A;  1MY1 A;  4I9D A;  2ZYN A;  3TOD A;  2ZXT A;  5EQA A;  4FEC A;  4HCW A;  4ZEC A;  1IMC A;  1B1H A;  1NNP A;  1P1Q A;  2F7C A;  4AB6 A;  2G29 A;  2OJT A;  1SW2 A;  3IOV A;  5I5P A;  4NF5 A;  3O6H A;  2NUV A;  2Z8F A;  4R6Y A;  1DCU A;  1KWH A;  4RPN A;  5A5X A;  3HCQ A;  4GBW A;  4BDM A;  1JP4 A;  4U23 A;  3K0V A;  4EQ7 A;  3FUZ A;  2Q88 A;  2QS3 A;  4H6D A;  3H7M A;  3UP9 A;  1MH4 A;  1FJ9 A;  4AB5 A;  1FQD A;  2QSX A;  2RCB A;  3SER A;  1MY4 A;  2O69 A;  3LV0 A;  3KZG A;  4PET A;  2H4I A;  3N26 A;  3M3L A;  2GH9 A;  2HCA A;  2IA4 A;  3IFC A;  4HW8 A;  1JVY A;  1N7W A;  3KJ7 A;  2QS2 A;  2QVR A;  1FBF A;  3UN6 A;  2UVJ A;  3TQW A;  4PFR A;  3FAT A;  4TOZ A;  1IXH A;  2F35 A;  2Z23 A;  2ZZW A;  3B6W A;  2REG A;  3R26 A;  2GFE A;  3KC0 A;  5AA2 B;  2NXO A;  1EZ9 A;  3SEU A;  3FIR A;  4FE8 A;  2XXT A;  3FBP A;  2FNC A;  4MX6 A;  1TT1 A;  4MJO A;  4EQB A;  1ZBM A;  3VVD A;  3DP8 A;  1CB6 A;  1USY H;  4N17 A;  3HFU A;  5JTY B;  4MHF A;  1M5F A;  4PFI A;  1MH3 A;  1B58 A;  3GXA A;  4GWU A;  4HTG A;  1MPC A;  3USD A;  3K2D A;  1DPE A;  1RDZ A;  4OXV A;  4NE4 A;  1URG A;  1FPE A;  4RK9 A;  2FIE A;  2OWS A;  4G8N A;  1XVY A;  2XHD A;  3M3K A;  1OQG A;  2I3W A;  4G8M A;  5IKB A;  4OZ9 A;  3BBR A;  3PD8 A;  2DOJ A;  1NNT A;  2LAO A;  3G3F A;  3B8B A;  3BIH A;  2QS4 A;  4GBV A;  5CRY A;  2ZYK A;  5K2Y A;  2XXY A;  5TU0 A;  2IEE A;  1LBV A;  4FAT A;  5H8N A;  4IB2 A;  2DWJ A;  3LR1 A;  5KDT B;  3RPW A;  1MM6 A;  4EXK A;  1B9J A;  1ZU0 A;  2CEY A;  3MW0 A;  3ILT B;  3OEN A;  4IGR A;  3TEP A;  3N6U A;  5EYF A;  5AA3 A;  1A40 A;  2D3I A;  4N13 A;  5K2X A;  5I58 A;  1Q35 A;  1DTG A;  4JVC A;  5EHS A;  2ALU A;  1LAF E;  2O7I A;  2ZYM A;  4OEN A;  4OVQ A;  1URD A;  2MKZ A;  4R9G A;  3EHT A;  4QFL A;  4KR5 A;  4DE8 A;  3I3V A;  1MXY A;  4LP2 B;  4ZZE A;  4EF1 A;  1Y3Q A;  2I0C A;  5DEX A;  3L6H A;  1N0T A;  4KQP A;  4OFL A;  1IZ1 A;  1FQC A;  5IAI A;  1R1N A;  1NV7 A;  3K02 A;  4MBP A;  2O51 A;  1QUL A;  2RCA A;  2VPO A;  2UVI A;  1H3D A;  4PGP A; 
#chains in the Genus database with same CATH homology
 3QXM A;  2CZL A;  1USY E;  2YLN A;  3MC2 A;  1MRP A;  2HAU A;  4QFN A;  2A5T B;  1O63 A;  1WOD A;  2F97 A;  4BDO A;  2Y84 A;  4QSE A;  1R9Q A;  3DM0 A;  1B05 A;  1B3F A;  3FXR A;  4KHZ E;  2NVU B;  3JV9 A;  5CMM A;  1ZIU A;  2Q89 A;  4RNS A;  4GXS B;  2ZNT A;  2PT1 A;  1B7H A;  3T66 A;  3VLV A;  4H0W A;  5EHS A;  4JSO A;  2I0B A;  3PGF A;  3KBR A;  4X1D A;  4Z0I A;  5FTI A;  5H8S A;  3SEY A;  3MP8 A;  4QSC A;  4H8I A;  4X9T A;  2V84 A;  3K4U A;  1B3G A;  2HEU A;  3MPL A;  2HQ0 A;  3FVO A;  3B6Q A;  3CIJ A;  4WED A;  4NF8 B;  3VXB A;  1ANF A;  4IY6 A;  1LBB A;  2X7Q A;  2Q8J A;  1MXZ A;  4NMY A;  3IB0 A;  1SYI A;  1I6Q A;  1LAX A;  2PBW A;  3PU5 A;  3PMV A;  4Q8R A;  3EF7 A;  1B0L A;  1IEJ A;  1US4 A;  2AIX A;  2V93 A;  3OEK A;  4GLI A;  2DVC A;  4IO6 A;  4DIG A;  4DXC A;  5AE4 A;  4C0R A;  1ZJL A;  1UTH B;  1N7X A;  1Y20 A;  2XXI A;  1OQH A;  2F6G A;  2UXA A;  3IB1 A;  4ZZA A;  5I57 A;  3LC8 A;  3Q28 A;  2Y7R A;  1WDN A;  3KG2 A;  4H1X A;  2PMS A;  4MLV A;  3O9P A;  2R71 A;  2XXX A;  5I58 B;  2ONS A;  5DVI A;  5H8Q A;  1MQH A;  2HZL A;  3G3J A;  1LFI A;  1BP5 A;  3MVX A;  4H67 A;  4EUO A;  1B6H A;  2FYI A;  1JNF A;  3TTK A;  3MP1 A;  1MM7 A;  1UQW A;  2O84 X;  3TZA A;  3ZS6 A;  2BJJ X;  2OLB A;  3C34 A;  2OCU A;  3SDF A;  1RYO A;  2I4C A;  3OO6 A;  4WEP A;  4ZEI A;  2XXR A;  2O1L A;  5ELV A;  2OWT A;  3FJ7 A;  5KDT A;  3VFJ A;  2D21 A;  5I56 B;  1RKM A;  3FGS A;  4RPO A;  3H6U A;  3RTF B;  3O28 A;  4LVQ A;  1DMB A;  1FTL A;  3LSW A;  3Q26 A;  1VSO A;  2I4B A;  1N3X A;  4NTL A;  1Q1K A;  3VE1 B;  2YPN A;  4JB7 A;  3OEL A;  4YU0 A;  4OET A;  2XXU A;  5FHN A;  2ZNU A;  3C35 A;  4ISU A;  4L17 A;  5M2V A;  1B3H A;  2I48 A;  1N04 A;  2VHA A;  3QUF A;  4OHN A;  3MBP A;  3E4R A;  4NWD A;  5H8F B;  1WVJ A;  5I59 B;  2NOO A;  1XT8 A;  3H6T A;  3TDJ A;  4LQ5 A;  3AXF A;  4PFT A;  3K1N A;  2DE3 A;  4KFQ A;  5HBC A;  3D4G A;  1BKA A;  2VOZ A;  4FJP A;  1LCF A;  1LLS A;  5DVF A;  3SEV A;  1QW0 A;  3MUQ A;  4TLL B;  5H8F A;  2HAV A;  3WAF A;  3MP6 A;  5I84 A;  1PB8 A;  1PBQ A;  4GRK A;  1NL5 A;  3A3U A;  3TKD A;  4E0X A;  3JYR A;  1QJM A;  4YKJ A;  2DE4 A;  1SYH A;  2DWI A;  3K01 A;  4QSD A;  1ZMG A;  3TCF A;  3FV1 A;  1LAG E;  3KOS A;  4HCY A;  3V8X B;  3RTW B;  1Y1Z A;  4G77 A;  1JVX A;  4GFR A;  4F22 A;  1LCT A;  3C31 A;  4ELP A;  5I56 A;  1POY 1;  3OEM A;  4IO7 A;  3KN7 A;  2I49 A;  3PUZ E;  4ND9 A;  3RT8 A;  2Q9T A;  1LAH E;  3F11 A;  4GQO A;  3ECR A;  4IO2 A;  4BDN A;  4E0W A;  4N07 A;  4KYD A;  2YJP A;  3TCG A;  3U94 A;  1I6B A;  3DP4 A;  4ZED A;  3TTR A;  3CRB A;  4EF2 A;  1N84 A;  3HHF A;  1JW5 A;  3PMW A;  4R2B A;  1MXX A;  1OLC A;  2GHB A;  4R9F A;  2P1S A;  1NFT A;  4GIZ A;  4IO4 A;  3V5A A;  5I2K A;  1B2H A;  1P1O A;  3IX1 A;  1QUJ A;  2CMO A;  2HZK A;  3ONM A;  2RKM A;  4JBZ A;  1AIV A;  3S9M C;  4MFI A;  3ZSF A;  5F7V A;  4LZ7 A;  4H5F A;  2QS1 A;  4GL8 A;  1UTH A;  1SVX B;  2PX1 A;  2XXH A;  2RF1 A;  3PPQ A;  4U4S A;  3OSQ A;  4RK2 A;  5H8H B;  1D9Y A;  3BFU A;  3S9N C;  1NNK A;  3DP6 A;  2XD2 A;  1JET A;  1MG1 A;  1M5D A;  2F78 A;  4YKI A;  5DYH A;  3SEX A;  1Y9U A;  1QKB A;  1J1N A;  1TWY A;  3FJM A;  4DLD A;  4YKP A;  3TEL A;  2R6G E;  5I2K B;  2GHA A;  2XX7 A;  5CI5 A;  4ZS9 A;  4XKQ A;  3K6V A;  2O6A A;  4FED A;  4NF8 A;  3C4M A;  3TEP A;  1LGB C;  1N76 A;  1FTJ A;  2F8D A;  2REJ A;  3PUX E;  3H6V A;  3PUY E;  3B7D A;  4ESW A;  4F2O A;  1A55 A;  1YCJ A;  2B65 A;  4C1T A;  1DSN A;  2D5W A;  1B3E A;  4U1O A;  2R9J A;  1IXC A;  4XKR A;  4OTE A;  4OYV A;  5EYF A;  1SW1 A;  2ANJ A;  2QPQ A;  1PB7 A;  3LBS A;  5DVJ A;  4GOT A;  1B5I A;  3KFM A;  3QSL A;  2VP1 A;  1OLA A;  5CMB A;  3OXN A;  1TFD A;  2DWA A;  3RY3 A;  4ESX A;  4RYA A;  3PPR A;  3G3H A;  4YZZ A;  5L9S A;  3FXQ A;  1FTK A;  1D3K A;  3OO9 A;  1MQD A;  3TTL A;  1CE2 A;  4U4X A;  3RT6 B;  3G3I A;  4KD5 A;  4U22 A;  3R7X A;  4U21 A;  1JQF A;  1OVT A;  4PQJ A;  4DXU A;  2ESN A;  4OVJ A;  3PPP A;  2XD3 A;  1B4H A;  1FTM A;  1JW4 A;  4TLM B;  1ZTY A;  5F1Q A;  1I6A A;  3N6T A;  1SD3 A;  1EU8 A;  3CFL A;  3CI8 A;  1O64 A;  3MZ9 A;  2Y7P A;  1M5C A;  3FD3 A;  4NED A;  4QF9 A;  3VLU A;  2XX9 A;  4JXI A;  2B3B A;  5L8D A;  4AQ4 A;  3IK6 B;  4ONY A;  4HS7 A;  1NKX A;  2Y7K A;  1US5 A;  1A7L A;  3FVN A;  2HFB A;  3HHG A;  4GL0 A;  4X1B A;  2DYX A;  4OEU A;  4QFP A;  4YMB A;  1DTZ A;  3KJT A;  3Q25 A;  1AMF A;  2V25 A;  4R72 A;  4R75 A;  1URS A;  2B3F A;  4OES A;  1UTB B;  3U92 A;  2F5X A;  4F3S A;  1II5 A;  4KI0 E;  4NF5 B;  4QHQ A;  3QK6 A;  1IQ7 A;  4R6H A;  4I1D A;  4JWY A;  3C9H A;  1VR5 A;  2DWH A;  4PE5 B;  1SI0 A;  1UIV A;  5CM6 A;  1B40 A;  1A54 A;  1HSL A;  3H06 B;  1JEU A;  1A8E A;  3GZG A;  1PB9 A;  3ILU B;  4FEB A;  3MZ1 A;  4ZEB A;  3TYH A;  1IXI A;  2Q2A A;  2AL4 A;  4FAJ A;  3MAM A;  3IJX B;  3EN3 A;  2UVG A;  1ZKB A;  3GLB A;  3A3C A;  4ZEF A;  3IO4 A;  5FHM A;  3VVE A;  4MF3 A;  4FOR A;  4I8C A;  4THI A;  4YMA A;  1YTV A;  3IAZ A;  3N5L A;  4F18 A;  2WKY A;  1P1N A;  5CMK A;  3UA8 A;  5ICT A;  4LAT A;  5CMC A;  5DT6 A;  4EDP A;  1MQJ A;  1LB8 A;  3N94 A;  3OO8 A;  1B5H A;  2QJE A;  5AA1 A;  4Q5T A;  1LB9 A;  3O6I A;  1D4N A;  2DS9 A;  1HSE A;  3PUW E;  1B46 A;  4LZ8 A;  1B5J A;  3V89 B;  3K6X A;  1VFD A;  2F7A A;  4ZEK A;  1IUD A;  1LBC A;  1S9T A;  1MY1 A;  2UYF A;  2ZYN A;  4I9D A;  2O1M A;  4OWD A;  5EHM A;  1MY0 A;  1UIU A;  3HV1 A;  3IJO B;  2DSF A;  3ZKL A;  2I6E A;  3T9H B;  3MVW A;  2ZXT A;  5DEX B;  4NF6 B;  2QRY A;  4MLQ A;  1L5T A;  3FAS A;  4EQ9 A;  4FEC A;  4HCW A;  1GGG A;  3S4U A;  4ZEC A;  3T9U A;  1Y4T A;  5J1D A;  1B1H A;  1NNP A;  1P1Q A;  2F7C A;  5CC2 A;  5ITP A;  1PDA A;  3HST A;  3MVZ A;  1IXG A;  4AB6 A;  1SW4 A;  4NF4 B;  4BDQ A;  3O97 A;  4YB6 A;  3Q27 A;  3QAX A;  4R6K A;  4ELR A;  2G29 A;  1M5E A;  4DZ1 A;  4F1V A;  1MDP 1;  1YAE A;  4PFY A;  3T96 B;  1P1W A;  2OJT A;  5DTB A;  1ZLQ A;  3RQT A;  2OK2 A;  4NF6 A;  3CSG A;  2RC9 A;  3KOT A;  1SW2 A;  4KPT A;  1H44 A;  3IOV A;  1ELJ A;  2O68 A;  2P2A A;  4IO3 A;  3TAJ A;  1Y3N A;  4ZE8 A;  2NWJ A;  4DDD A;  4U1Z A;  4NF5 A;  3O6H A;  3MVY A;  1OVB A;  2A5T A;  2NUV A;  3KN3 A;  2RC8 A;  5H8H A;  1AL3 A;  2Z8F A;  4R6Y A;  1MQG A;  1KWH A;  1B51 A;  2QMW A;  2Y7I A;  4RPN A;  5H8N B;  4N6P A;  5A5X A;  4O3C A;  4F31 B;  4KYE A;  3D4C A;  4Q0C A;  4R73 A;  5CBS A;  5HPQ A;  3HCQ A;  3UGW A;  5AA4 A;  1R6Z A;  3CG1 A;  4BDM A;  2ABH A;  3OD7 A;  3PD9 A;  1EZP A;  4U23 A;  4XKP A;  3K0V A;  1LST A;  4FIM A;  4ECF A;  3K6W A;  3K1M A;  4ZDM A;  1GTK A;  1SDX A;  4KCD A;  4EQ7 A;  3LUY A;  3DEL B;  3C33 A;  1S50 A;  2Q88 A;  3FUZ A;  3IR1 A;  2QS3 A;  4H6D A;  3H7M A;  2V3U A;  4OEV A;  3UP9 A;  1MH4 A;  3LSL A;  5FTH A;  1MXV A;  4Q30 B;  1FQD A;  2P0S A;  2AYS A;  2QSX A;  2RCB A;  4JSD A;  3SER A;  4AB5 A;  1MY4 A;  4OQO A;  2O69 A;  1UTB A;  3SES A;  3CR9 A;  3TMG A;  2F36 A;  3EQ1 A;  3K6U A;  3SEW A;  1XS5 A;  2ZYO A;  3KZG A;  4PET A;  3I5O A;  2Z22 A;  2H4I A;  3N26 A;  4LON B;  3MWB A;  3TUS A;  1EH3 A;  1OMP A;  1XC1 A;  4YAH X;  3M3L A;  1XVX A;  3M8U A;  1I69 A;  2DP8 A;  2GH9 A;  2HCA A;  1XOC A;  2XXP A;  3OOA A;  4GD5 A;  3VV5 A;  3M3F A;  2FA7 A;  1B4Z A;  1BIY A;  2IA4 A;  2ONK E;  3HO7 A;  4G2Z A;  4G68 B;  4HW8 A;  1JVY A;  2XXQ A;  1POT A;  3UOR A;  3P7I A;  5LOM A;  1N7W A;  4UA8 A;  2F6P A;  2UVH A;  3KJ7 A;  3O66 A;  4PFU A;  5KCJ B;  1XHY A;  1OIB A;  2QS2 A;  3O29 A;  4OMB A;  1QUK A;  3RGY A;  1MPB A;  3RNN A;  3UN6 A;  2H98 A;  2UVJ A;  3PUV E;  4WXJ A;  3TQW A;  1MS7 A;  3IOT A;  4XXU A;  2DQV A;  3CSB A;  3FAT A;  3QIM A;  3WAE A;  4TOZ A;  3CFX A;  5CBR A;  1IXH A;  1IIW A;  2F35 A;  2Z23 A;  3H03 A;  5I2N A;  5I59 A;  3BKI B;  3B6W A;  4GWO A;  3H3G A;  1BLF A;  2REG A;  3JZJ A;  3IO6 A;  1PC3 A;  1AH5 A;  2GFE A;  2ZMB A;  3MZB A;  3R26 A;  4XTC Q;  5AA2 B;  5AA2 D;  1ATG A;  1Z7N E;  2NXO A;  2RIN A;  1TXF A;  1Y4C A;  4POX A;  3HPI A;  4LQ2 A;  4LUB A;  1EZ9 A;  4F3P A;  1FQE A;  1BTJ A;  5ISU A;  3SEU A;  3U8Q A;  2XXV A;  2Q2C A;  4O3A A;  3H4Z A;  1FQB A;  3FZV A;  1MDQ A;  2PT2 A;  2XXT A;  3FIR A;  1A8F A;  1SBP A;  2FNC A;  3PPO A;  3OO7 A;  2H99 A;  2Y7W A;  4FE8 A;  1TT1 A;  4YB7 A;  2V3T A;  3W9V A;  1SI1 A;  1ZBM A;  3VVD A;  3DP8 A;  3O6G A;  4EQB A;  4Z7E A;  1EZO A;  4GXA A;  3G3K A;  1CB6 A;  1USY H;  5I57 B;  5AA2 A;  2AL5 A;  3UIF A;  2H9B A;  5JTY B;  1LFH A;  5ITO A;  1M5B A;  4XIG Q;  3S2V A;  1M5F A;  4GVO A;  1MH3 A;  3CVG A;  1B58 A;  3EPE A;  1P1U A;  1N3W A;  4M4G A;  1D9V A;  3GXA A;  3S9L C;  4HTG A;  3EHU A;  4JDF A;  4DCY A;  1FCK A;  1MPC A;  4BLA A;  1MXU A;  5HM4 B;  3Q29 A;  3THI A;  3USD A;  3IOW A;  3K2D A;  4LA9 A;  3UK4 A;  1JW1 A;  3U1O A;  4POW A;  1DPE A;  5JK4 A;  1MY3 A;  4P11 A;  4IO5 A;  4F3G A;  1H43 A;  3T9X B;  4H8J A;  4NE4 A;  4OXV A;  1URG A;  1NH7 A;  3RUM A;  2A5S A;  3SKP A;  2OZZ A;  4F29 A;  1F9B A;  3MQ9 A;  1AOV A;  1QVS A;  4RK9 A;  4F39 A;  2QL3 A;  2OWS A;  4G8N A;  4MH5 A;  4BDR A;  1XVY A;  3HN0 A;  2XHD A;  3M3K A;  1OQG A;  2I3W A;  4QFK A;  1IIT A;  4G8M A;  2E1S A;  1SQY A;  3LSF B;  3U72 A;  3TOD A;  1B0H A;  4RA1 A;  2DXY A;  4RJZ A;  4DXB A;  5TPA B;  5IKB A;  3G3G A;  3TTM A;  4OZ9 A;  1MXW A;  1B32 A;  3BBR A;  3PD8 A;  2DOJ A;  4F1Y A;  3GBB A;  3PPN A;  2THI A;  3OSR A;  3DLN A;  4F1U A;  3T9V A;  1NNT A;  1LFG A;  2LAO A;  2ZNS A;  1H45 A;  3FV2 A;  4QRZ A;  2X26 A;  1GR2 A;  3G3F A;  4YB5 A;  5JEI A;  1RYX A;  3FVK A;  5H8Q B;  3RN8 A;  3FXU A;  2DXR A;  4K3F A;  3IOU A;  4KYS A;  2QS4 A;  5AA4 B;  5TP9 B;  4M1V A;  3SET A;  2HXW A;  2OBG A;  4G68 A;  4I62 A;  1TFA A;  5CRY A;  3KSJ A;  2ZYK A;  3FVG A;  1FW0 A;  4PFW A;  5K2Y A;  5JTY A;  2XXY A;  5TU0 A;  3L6G A;  4U2R A;  5L9O A;  4GF8 A;  2IEE A;  2QMX A;  5A5X B;  5TPA A;  1H76 A;  2PYY A;  3C36 A;  3QUJ A;  4FAT A;  1B7U A;  1NMU A;  5H8N A;  1R9L A;  2E0S A;  4IB2 A;  1T0K A;  3FJG A;  3KSX A;  2F7B A;  2DWJ A;  3LR1 A;  4F2Q A;  4JWX A;  4ELQ A;  5KDT B;  3RPW A;  2M8C A;  1MM6 A;  1NNF A;  4IY5 A;  1B9J A;  2UYE A;  4TQU Q;  4X48 A;  1ZU0 A;  4EXK A;  5B7D A;  1A99 A;  3MW0 A;  1FTO A;  3ILT B;  3OEN A;  4IGR A;  3A09 A;  4YKK A;  4P0I A;  3EHS A;  3OMB A;  2Z8D A;  3MPK A;  3N6U A;  4IGT A;  4OFJ A;  1A40 A;  2D3I A;  1QUI A;  3K1P A;  4N13 A;  4P0G A;  3TQL A;  5AA3 A;  5ICQ A;  3IB2 A;  3PMX A;  4R2F A;  5K2X A;  4C1U A;  4QFO A;  4F3B A;  1JEV A;  5I58 A;  4H65 A;  1B52 A;  1Q35 A;  4NF4 A;  1S7Y A;  5BUU A;  1DTG A;  3CG3 A;  3LSX A;  4G4P A;  3KN8 A;  3CFZ A;  3C32 A;  2ALU A;  2V3Q A;  1LAF E;  2O7I A;  3ODB A;  4LZ5 A;  1QKA A;  2XXW A;  2ZYM A;  3GBA A;  3BFT A;  3MJN A;  4WKM A;  2GRV A;  4F19 A;  3H6W A;  3E9X A;  4BDL A;  1YPN A;  3T22 A;  4OEN A;  3I6V A;  3VLW A;  3E3K A;  1B1X A;  2I58 A;  1NH8 A;  1VFE A;  2F34 A;  4OFO A;  1VE4 A;  3E13 X;  4RXL A;  4YIC A;  3TFL A;  3VVF A;  4ZE9 A;  1B3L A;  1DOT A;  4JWO A;  4RY1 A;  2RC7 A;  4OER A;  2I3V A;  2VGQ A;  1URD A;  3TCH A;  5KCJ A;  4R9G A;  4H5G A;  3EHT A;  4QFL A;  5B70 A;  4G8H A;  5KZT A;  3G7W A;  2Z8E A;  4KR5 A;  4DE8 A;  4EXL A;  3I3V A;  2XX8 A;  3R6U A;  4XKN A;  1MPD A;  1Y1M A;  2DVZ A;  5FHO A;  1PEB A;  1MXY A;  4UAC A;  3VDF A;  1MY2 A;  4LP2 B;  2W7Y A;  4ZZE A;  4EF1 A;  1Y3Q A;  3U93 A;  1O7T A;  4O3B A;  2I0C A;  5L9M A;  3K00 A;  1MQI A;  2ONR A;  2DE2 A;  5DEX A;  1P99 A;  3L6H A;  1N0T A;  1B7Z A;  1HSJ A;  3O2A A;  4KQP A;  3RLF E;  1SW5 A;  4OFL A;  4PP0 A;  2H25 A;  3B6T A;  3W9W A;  2VD3 A;  2KLF A;  4R74 A;  1IZ1 A;  1DPP A;  1GV8 A;  3IL1 B;  1GVC A;  2G93 A;  3KEI A;  3ZKK A;  1FQC A;  1PBP A;  2H5Y A;  3T93 B;  1Y3P A;  2X7P A;  4NWC A;  5I2N B;  3TPA A;  5IAI A;  1R1N A;  3S9E A;  4DCX A;  2PVU A;  1FQA A;  3TTN A;  5TP9 A;  1Z7M E;  3VXC A;  1FQF A;  3QYT A;  3K02 A;  4MBP A;  4ELO A;  2O7U A;  2VD2 A;  2O51 A;  1QUL A;  2RCA A;  4KCC A;  3W15 C;  3IOR A;  5BWJ A;  3PV0 E;  4G68 C;  1H3D A;  3KGC A;  3V83 A;  2UVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...