1RYZA

Uridine phosphorylase from salmonella typhimurium. crystal structure at 2.9 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-functions studies of uridine phosphorylase from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 57
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ryzA00
3OPVA 1V4NA 4M1EA 1T0UA 4BMXA 3KUKA 1PR1A 1WTAA 4NY1A 3K8QA 2AC7A 1V48A 2A0WA 1JE0A 1A69A 3OZDA 4TXLA 4YNBA 3OZEA 1PR0A 2HSWA 4PR3A 1A9TA 4TXJA 2A8YA 4L6IA 1Y1SA 1PR5A 3KHSA 1U1GA 3OZBA 1RYZA 1ODIA 3PHBE 1T8WA 4NS1A 4BN0A 4LNHA 1TD1A 5KB3A 2OC4A 1QE5A 3KU4A 4TS3A 5IU6A 4R2XA 2RJ3A 4U2KA 1OV6A 1YR3A 5C80A 5CCEA 1PF7E 1RFGE 3O4VA 3OOEA 4F2PA 3SCZA 3UAZA 5F7JA 3LA8A 1RXYA 3UAYA 4GLJA 1SJ9A 1SD1A 5F77A 1ZL2A 4R2WA 4TXNA 1RCTE 1JE1A 1OTYA 3NBQA 5F7XA 4NSNA 4D8YA 3DDOA 1V41E 5EPUA 1Y6QA 4F3CA 1NC1A 3O6VA 4M3NA 1OU4A 4WKOA 3KVVA 4GKAA 4OGLA 5K1ZA 4IP0A 3DP9A 3IOMA 5ETJA 1PKEA 3BJEA 1RXSA 4FFSA 1Z5PA 3DJFA 1PR6A 4TXHA 4DABA 5F73A 4LDNA 1I80A 2HWUA 1RXCA 4DAEA 3ODGA 1FXUA 1A9OA 4G8JA 1TGVA 4JP5A 1YQUA 2A0XA 4MARA 5F76A 1LVUA 3P0EA 4E1VA 4BMZA 5CXQA 3E0QA 1TGYA 1C3XA 1G2OA 1A9SA 1U1FA 1Y1QA 4G89A 1Z5NA 5B7GA 1U1CA 3MMSA 1U1EA 1OVGA 4PNPA 4KN5A 5CCDA 4OGKA 1Y6RA 3UT6A 1RXUA 4JWTA 1TCUA 5FAKA 4DA6A 1K3FA 1Z36A 1PBNA 3ONVA 4WKNA 3EEIA 2QDKA 2GUWA 2OECA 3FAZA 1PK7A 1Z33A 1SD2A 4LNAA 4MCHA 2IQ5A 1JDVA 4LZWA 3LGSA 5EFOA 4YJKA 3OOHA 4UC0A 1V45E 3NM5A 1B8NA 4WKBA 1RT9A 1ZOSA 4TS9A 1K27A 4L5AA 3GB9A 4K6OA 1VHWA 4L5CA 1XE3A 2A0YA 1NW4A 3EUEA 2H8GA 3K8OE 3FWPA 4ECEA 1T8SA 4D8XA 5B7NA 4DANA 1TCVA 3FB1A 2I4TA 3OF3A 1VHJA 1PW7A 5CYGA 3GGSA 3FNQA 1Q1GA 4D98A 5JPCA 3MB8A 3BGSA 3UAXA 4EB8A 4TTAA 1Z34A 5F78A 3PNSA 3OZCA 4L5YA 1N3IA 3EMVA 3FOWA 2HRDA 1V2HE 1Y1RA 3UAVA 2AI2A 1LV8A 1VMKA 5CYFA 4R31A 4WKPA 4RJ2A 4QATA 4QAQA 1VFNA 1ODJA 1PK9A 4YMLA 1PR2A 1Z5OA 4OF4A 3U40A 4OJTA 2P4SA 4QFBA 3DPSA 2I8AA 3EUFA 1ULAA 1JPVA 4BMYA 2XRFA 1A9RA 1B8OA 1JYSA 4F1WA 2AI1A 4LKRA 5I3CA 2AI3A 4P54A 2HN9A 1Z39A 1A9PA 2QSUA 4GMHA 3D1VA 4DA0A 3IEXA 3NM6B 1SQ6A 2QTGA 2Q7OE 4DA8A 4H1TA 1Y1TA 4X24A 4DAOA 1CB0A 1A9QA 3DF9A 1YRYE 4F3KA 1JDTA 3PNPA 1K9SA 2PGAA 3LBAA 1RR6A 5B7PA 4TYMA 1Z37A 1PR4A 4D9HA 1T8YA 2QTTA 4QEZA 5B7QA 3T94A 1Z38A 5CXSA 3F8WA 4QASA 5EUBA 1ECPA 3UAWA 5DK6A 1NC3A 1U1DA 2OC9A 2ISCA 1RSZA 1JDUA 4YO8A 1M73E 5F7ZA 4EARA 3QPBA 3C74A 1CG6A 1JDZA 4DA7A 4TTIA 3PHCA 4WKCA 3INYA 3BL6A 3P0FA 1YBFA 3E9ZA 1ODLA 4M7WA 3E9RA 3KVYA 3OCCA 1T8RA 2ON6A 4G41A 1ULBA 5IFKA 1V3QE 2QPLA 1YQQA 4TXMA 3NM4A 4I2VA 3ENZA 4QARA 1JDSA 4DARA 4D8VA 3BSFA 1PWYE 1Z35A 4F2WA 3KVRA 3FUCA 1OTXA 1ODKA 4MCIA 4OEHA 4L0MA 4TTJA 5F7OA 1JP7A 4OY3A 4JOSA 2BSXA 2OXFA 1LX7A 1OUMA 2B94A 3TL6A 4GLFA
chains in the Genus database with same CATH superfamily
3WMGA 3NIFB 4X1KA 3CG4A 4K9LA 4W7HA 2GEUA 3ZCVA 4PPQA 1Y4SA 2WWRA 1P74A 3WKCA 2LXNA 3C8UA 2VUHB 4YJHB 1LJ8A 4J0KA 4YROA 3WDMA 1SZDA 1LDBA 5IJ0A 3RYFA 1QHXA 3O2QB 1V48A 2LR0A 1M0EA 2ZYTX 4U0KA 2H16A 1G8FA 3HPQA 2B7BA 3OFND 4X5OA 1VM6A 4G0WA 2PIDA 2YYZA 1Z7BA 3BF8A 3Q11A 3CLVA 2R6GA 3HI4A 3K05A 1ZWLA 2BFDA 3RBVA 4KE9A 4M38A 4PR3A 4LJ9A 2G28A 4DXDA 4EAQA 5HIKA 3MMPA 4JD5A 1TUGA 2X42A 4TXJA 4YO7A 3A6EA 1DINA 1NQUA 3D6UA 3NHPA 2I3GA 5ILGA 1J1ZA 3U4AA 4AZSA 4QUKA 1GZ3A 1EWVA 1NJFA 1QGUB 2JVIA 1Y3BE 3V6LA 3GZJA 5FI1B 1VKNA 5E1BA 1Y81A 4F9FA 3D0KA 4IBOA 2PY6A 3PKIA 4Z7JA 3DE6X 3ZKWB 2VTBA 1K6XA 3SEFA 1GZUA 2HLNA 5E2BA 1V71A 2O2SA 1YA8A 2OK8A 4XGIA 5HJ2A 2W2MA 1NMYA 1FQJA 1WZUA 3RVJA 3SXUB 3C6ZA 3RFUA 3NH9A 1K0FA 2B61A 3QUBA 3N0VA 1Q2UA 3URKA 1KI6B 2JKVA 3MJRA 4EVRA 2CLOB 4DDVA 2X0NA 1TU3A 3KL4A 3EGDB 4UQLA 2G76A 3D02A 1BOOA 1M75A 4NCKA 4WFQA 3UJ6A 4XCVA 5REQB 1Y1KE 2L2QA 2RHMA 4U2KA 2QJOA 2DR2A 3AJAA 4NAHA 4TVSA 2HXSA 4OUDB 1J56A 1NXPA 2A30A 4A8TA 3V34A 1T9ZA 3PVSA 3ST7A 2VHCA 4JYAB 1O7JA 1WMSA 3C70A 4IKPA 2HA0A 4EM6A 4ZI5A 5E4FA 2VJYA 3FOBA 1YR8A 2H2WA 3LA8A 1P73A 1PT9A 3UFBA 1N6OA 4Y67A 3ZQ4A 3W2GA 4EUHA 3FF1A 4YPFA 4GZMA 1DI0A 3L05A 4X92A 2X2EA 3W5CA 2BSAA 3WSVA 4JC4A 3GLTA 1CRPA 3B1FA 4MA0A 4I8IA 2JCXA 5AK6A 3UMSA 2ZUCA 4LC9A 1TC1A 5E6SA 2REOA 5J4YA 1WZIA 3IJ5A 1OBCA 3MTQA 1N5RA 5CH5A 2WG2A 3WK8A 3WWEA 2JZCA 3U3DA 2AVNA 5JS6A 3R5SA 1UBTS 3FIJA 2D6FA 3DP7A 2VH5R 2JCSA 1A9XA 4TLBA 1Q11A 3WIDA 4XOIA 3WKAA 3HA5A 3TH5A 4V0MA 1RTKA 3RODA 5JALA 1QQAA 3ZN2A 3OLVA 1E3SA 4KR3A 2PSJA 4K9QA 1EVEA 1OYOA 4UNIA 4HNRA 2WYHA 2SICE 1ZH2A 4ZI7B 2YRWA 1KFJB 1WEKA 3KVVA 4FMDB 4C0HA 5JSKA 2X9VA 4QYTA 1EK5A 4JA0A 4D4JA 3WXBA 5LZ2A 4XB2A 2ZBDA 2FE1A 4EJSA 1L4HA 1ACJA 4QO8A 1YK1A 2IYAA 5ERXA 5HP4A 3WIOA 2QKYA 2FJPA 3GEIA 1S6YA 4D97A 1XL0A 4MGHA 5HF9A 3FZYA 3OHSX 1ZK4A 4E70A 5CBKA 2D5IA 3MQ4A 2YCLA 3FCEA 4NESA 1MQ9A 5CHYA 4Z1OA 1TCAA 1KGDA 3BMCB 4P86A 1O3YA 4JJZA 4DC1A 2MOKA 3S44A 2QLLA 4PHFA 5B64A 2GM5A 2WIAA 2C4NA 2WWXA 4HH3C 3IV7A 1U0EA 1NXWA 4UM9D 1FXUA 1JDBB 3KVNA 4EVIA 5CLLA 1LQUA 1U9IC 2FPLA 1F06A 4OHBA 3ELWA 4YXWA 2NV0A 3W6PA 2QRMA 3LCJA 4U5QA 3WJAA 1SBQA 4ZMBA 3KYJB 1U99A 3LLSA 4H18A 2W2QA 1OH8A 2J7PA 1V96A 1OWMA 2E87A 2BJVA 2FP4B 3PC8C 4L22A 4EVSA 4NH4A 1X94A 2Q6KA 2XVZA 3MCWA 3B2QA 1QB8A 2V59A 3NDJA 5TMDA 4BATA 1W94A 1HDGO 4CQJA 3KLBA 3SWWA 4DVJA 1PSZA 2AQIA 3E22B 5HX7A 5AM0A 2WKRA 1QO0D 3ESDA 2WAAA 4G5YA 3PQDA 4J75A 1SQ5A 3F67A 1P2SA 1FMLA 2OO3A 3HB4X 2BRUA 3K5HA 4B2LA 2VXCA 1W46A 2MSCB 3P2YA 4WGFA 3KLMX 4UM8B 3RHFA 1UDAA 2PANA 2R6AA 3UJ7A 1WM1A 5F52A 2PKYX 2W4IA 2Z0MA 4QT4A 1E1CA 1J8MF 2BEUB 2HA4A 2P90A 2WZBA 1SC3A 1YCDA 4U9UA 3PXGA 3AR7A 4DCPA 2WKPA 3KQQA 5ES4B 4L95C 4DV2B 4I4NA 5HS6A 4RDXA 1LPSA 2JLBA 1F3LA 1YZUA 2ZE5A 3I9KA 2IOFA 3UOAB 1WBDA 3DNMA 4AJHA 1QLJA 4EX7A 2QN7A 4N54A 2QYOA 4TLEA 4DA6A 2NTYC 1CJUC 1N6HA 3M8KA 4G09A 4LEIA 4M9RA 3WHIA 3RHTA 1PUXA 4ER5A 2GZSA 2I1WA 3QU2A 4H3VA 4E2XA 3NEYA 2QDKA 4G0OA 4OBBA 1OXVA 1XDSA 3WL3A 3TG2A 1CEEA 2PU7A 3NWOA 5IM4A 2JLVA 2NM0A 2C5LA 3OUTA 1SOAA 4I19A 3UAGA 4E2WA 3WGOA 4UE3S 1DBPA 1I36A 1AHHA 2CK3D 5IKOA 2A9RA 4EB6B 1K6JA 3TW4A 1LDEA 1DCMA 3FWZA 4YYZA 2RHLA 1D2AA 2GCEA 4ND2A 3EA0A 3DSRA 1AH2A 4MQEA 1GG5A 3N7TA 2FPOA 3NKFA 4PYIA 2CMHA 2O3UA 1EZZA 3M6AA 3O8OB 4R98A 3VH2A 2A0UA 4AUMA 4ONEA 2L42A 3UJ8A 4LF5B 3AL0C 5THQA 3BIFA 2XUQA 4GDMA 1U7DA 2D1QA 2K6GA 5BRNA 2CXHA 1XNJA 3LYLA 4KN9S 3HJFA 5E1DA 1DJLA 2Y6VA 3P20A 1V26A 5BW5A 3NVDA 4UNSA 2VT2A 3OKPA 4N7RA 5CA1F 2D2IA 2IK8A 3HBFA 5C1OA 1QHIA 3IXLA 3QXHA 1N5LA 1R16A 2QJRA 2IXGA 3F7MA 3NEJA 1HDEA 2GZHA 1GAEO 2I3BA 1IY2A 4H1HA 1E3IA 5IF3A 2C5FA 4HS4A 3VSAA 1Z29A 4XPZA 2R1ZA 2NU8A 3DBOB 3SG0A 4BNFA 3NBXX 2ZPUA 3QKRB 4GYJA 3NTLA 4K88A 3T6KA 2ZVDA 4KR7A 2CUNA 3L4BC 5HMLA 2H9IA 3THYB 3L7KA 1ZW1A 4I5IA 1WABA 3IP1A 4LDAA 1Z25A 4EABA 5TMEA 5EZYB 3NHRA 3WK7A 1E3EA 4Q18A 1NMXA 2J6HA 3U4IA 4MUAA 5JPCA 1CUGA 4PANA 2A78A 1AG9A 4R1OA 3B36A 1XYYA 2A33A 3GRVA 5DNYB 1ABFA 1P91A 1DC6A 4DHEA 3B3AA 2X1VA 1L7NA 1X7YA 4N8SA 1U2EA 3I83A 1RLTA 3L7LA 2NYRA 3KC2A 3C1UA 2PFSA 4RIIA 3T5TA 3UEOA 1P5JA 4OH7A 3DEHA 3SFTA 1JR3A 4OGFA 2K4MA 3G2HA 3PQCA 1NVUQ 2JIDA 2AFHB 2QM7A 5A5FA 3UFXA 3H84A 4BUJA 3B70A 4FUQA 4BMSA 4R0MA 1JEYA 2C7QA 2CDAA 1L5LA 2OG2A 3I30X 4RZSA 4UUPA 1N3LA 1BMTA 1ZX1A 2BUCA 4ER6A 4CTMA 1JI0A 1W581 1ODJA 3GRAA 2GFIA 2ZTSA 3PRHA 5T4FA 1UOPA 2OSBA 3CU5A 1V7CA 3NGMA 1E4OA 3QKRA 1Z8HA 5FBZA 1XRSB 1TTHA 2XXJA 1ZOLA 4LMAA 2PZAA 4TUYB 1PLJA 2HF9A 4NOKA 3K1AB 4G3XA 5FWYB 3O95A 3T3EA 3O91A 3PHJA 4BCBA 1DAMA 4CG1A 4AIIA 5GJCA 2JAUA 5ILOA 4KHZA 1SA0A 4EECA 4Z9YA 4G2TA 3HJTA 1NR1A 1UAAA 3HE3A 2H63A 2C1EA 1OAKA 2DKOA 4ARUA 1NHWA 4D9IA 2WIGA 5MFPA 2MINB 1FU8A 1U80A 3FZEA 3QMPA 1BW9A 1N7HA 2ZAIA 3BFJA 4NJOA 5IT4A 3OPYA 1XG5A 4HDMA 3OLZA 3EK2A 3NHUA 4BU1A 3QI7A 4K46A 4NZMA 3M34A 2BM8A 1A8IA 3LL4A 1PFVA 1UXIA 3EVEA 1HDYA 1XMJA 2JDID 2M98A 3RRJA 2IDKA 2ZI9A 3T52A 4G37A 3AOGA 1RWVA 2X0JA 3LZCA 4Y7DA 2NO7A 4S2UA 4EI7A 1UZMA 1YRWA 1F4VA 2LCQA 4DIOA 1AV7A 1TRKA 1XPOA 1RHRA 4OQLA 3ICQB 4N5IX 3G5TA 2YV2A 3BG5A 4IUDS 2O8VA 1X80A 3IMKA 3BX1A 5F3DA 1C4OA 1POXA 4EVQA 3MS2A 4HDRB 1C9MA 2XI4A 2QVLA 1FEZA 2O1XA 2OV4A 3OTQA 1AQ6A 5IAOA 1QONA 4M99A 1U4NA 4KQJA 4MUIA 4R1PA 5HBRA 4U7PB 5BNZA 2Z3VA 1QYWA 4E08A 1IUOA 1RRCA 2GK7A 1D07A 3A14A 4KLZA 1G5QA 4HGPA 1CUDA 5J43A 5HKKD 1ILWA 3WL5A 3PWTA 1M6VB 3BZUA 1IK6A 3OZUA 4IUYA 4UU8A 3SJBA 1A82A 5B1EA 2V9ZA 2DMRA 1L5NA 1RPZA 4K0KB 5TR9A 2AOTB 4TV9F 2ZJ7A 1MA0A 2QW0X 1NUUA 2B3TA 3W6OA 4I4CA 5PGMA 3RIYA 1Q22A 1YKSA 3EEQA 4GNKA 2B4AA 5I4CA 1I0IA 1QCYA 1P4GA 2HBZA 1IB0A 4MROA 3R9IA 3V80A 3ZNNA 3ZIAA 4CKXA 5JAHA 3ABQB 2J46A 4J9UE 1UJ2A 1CR0A 3PD1A 1D6SA 2RAPA 1OYVA 4PAGA 5ALUA 3UY4A 4CF4A 4FGZA 3VV3A 2UZ3A 4D41A 4U5XA 1P2BA 2YHIB 4ZAXA 5DVZA 3R23A 1NGSA 1QPGA 1EFUA 1XEAA 2WF7A 1SUFA 1U6IA 2GYVA 3WYFA 4OBXA 1I01A 4YCJA 5GONB 1QH8A 2YS6A 3FMGA 5ALHA 3S28A 4C0SA 5IXJA 4MS3A 1JEOA 1GGMA 1Y34E 4MIOA 4ZWNA 2I03A 2XKKA 4O4JA 3U81A 2YYYA 3HCFA 3MT8A 2CCJA 1DJNA 3ENVA 1KYZA 1NC3A 1Z63A 3AUYA 4RC9A 3ZGZA 1I8TA 2VLBA 2QD4A 4YRNA 2O5RA 3PSHA 3IKTA 1HG0A 3VI4B 1SXGA 4HD8A 4IL5A 1R88A 2B30A 4HFJA 1T9CA 2WFLA 1M73E 1M6VA 3AEQA 5AJUA 3VNSA 5F7ZA 1G3MA 1J25A 2AOUA 2WIBA 5DTMA 3MA0A 4EGJA 1P9RA 3IP7A 2ZJZA 4KXVA 3T95A 4Q1AA 1A2BA 4TTPA 3K32A 5E1MA 5SZIA 3W05A 3N2EA 1F2UA 1GPAA 3V9AA 1IOLA 2G8NA 4REQB 3P2OA 4YGYA 4ETWA 1BWSA 3ELBA 3IIEA 1A8PA 2BFNA 3VR6D 3WLNA 3WC4A 1M66A 3DHNA 4LJLA 4DT1B 2ILVA 1ADBA 4TTQA 3QU7A 1CJBA 1QV9A 2BCEA 4R54A 4X6YA 4FKZA 1G7RA 2FRDA 3FHJA 1KJIA 3HJHA 5C1IA 3OCJA 4QJ3A 5D01A 3ROXA 2QV7A 3KCNA 1T4GA 1GFWA 1PS8A 2QI9C 1Z4LA 3CGGA 4IKEA 4EW1A 1QH1B 3GFRA 3CLTD 5IFKA 2EKQA 4C7XA 3OI7A 2ZB7A 2Z9CA 2UV8A 3IT0A 1JHOA 2IC5A 3LU1A 4CIWA 1GO2A 1WF3A 4TKLA 2GAFA 4WA8A 4OFXA 4F6RB 1NE7A 3IQFA 1GGEA 4ODIA 1Q6ZA 1NKVA 1ST2A 4NEHB 3ZCSA 5ITWA 2SKEA 4OHPA 4A0QA 4UVGA 2VJMB 4TV9A 4EFDA 1SOVA 5H4HA 1XNRB 1D5CA 1YT5A 1HFEL 1M6NA 4ZCLA 4H0NA 1KARA 4RD6A 4ROSA 2ZSKA 5CK5A 3ENZA 2PKQO 4M9UA 3KELA 4XIFA 4ROTA 2XGOA 4UAJA 4YONB 1GZ7A 3DPIA 4GIBA 2QVBA 4OXQA 1I7QB 1DCTA 3R8FA 3NIDB 2J9XB 4B3CA 2WI8A 3DONA 1AGXA 1ZRNA 1QO9A 1VRWA 1Z35A 4TYWA 4WBNA 3NV7A 3JD4A 2I7XA 3DMRA 3LGXA 5GOTA 1GRCA 4DV3B 2NZYA 4R9NA 4N48A 3O7WA 4K2HA 1X13A 3CRW1 3BGDA 1AO3A 3NRJA 4BJHB 4B3HA 3B2EA 5JAIA 2TMYA 3QE4A 1SBHA 3J81A 2IH5A 4GVPA 5F7OA 3F73A 3LW8A 3OE7A 1OYYA 2HMWA 4WK6A 2DH6A 1IYZA 2JIZA 2P6RA 2BHLA 4HDKB 5HKOA 5B6IA 3DXYA 1CF2O 4TRNA 5AQEA 2BHNA 2AX3A 4F8YA 2D06A 1DKUA 2EL7A 4BVKA 2FN7A 4DYHA 1EGHA 4M6WB 1Z3IX 3OKAA 1ZZGA 1E2LA 1GT91 5AJVB 1XLUA 2DPGA 3IBSA 2BMVA 2BAGA 3PXCX 3D3WA 1Z62A 4NY1A 2DT8A 3SOZA 1GCUA 3DOHA 1NA5A 3K8QA 3AB8A 3A9SA 3KKNA 1EKXA 3RFCA 3KKQA 1ADFA 2UXCB 2A5DA 3BXXA 1PEDA 2W6OA 3F2IA 3FPSA 4KNVA 5FI3A 5L3RA 3Q0TA 5LP6C 1CIVA 1QG4A 1MFPA 1A8HA 2XIQA 2VSXA 1T9AA 1SXPA 1HFKA 2AIRA 4LRUA 3HCNA 4C4AA 3L46A 3GOQA 1N2OA 3NEAA 4H4CA 1P2UA 2B34A 1ZXBA 3B20A 1E2JA 1IHPA 1BA3A 1RACA 4FGKA 4OGGA 1PR5A 3F3YA 3TQOA 4IFEA 3CVWA 1W36D 1Y98A 4Z4QA 1JG1A 2ZE7A 4BFUA 3QUTA 4QGHA 2OUKA 3KQKA 4PLGA 4MJ3A 3CS3A 3FFWA 1PHPA 1PRYA 2Z04A 4ND6A 4PSUA 4ZC8A 1UZLA 4RVNA 2C2WA 1R7RA 2SNIE 2VTKA 2BZ1A 3HVRA 3PEUA 2IS1A 4IG9A 3GF4A 3S68A 4E1BA 1Y8ZA 4BN0A 1I1OA 1VE5A 3IBYA 3JTEA 1EB8A 3CTMA 3H8WA 4E14A 1I1HA 3KXKA 4E46A 2GAIA 5G1NA 1N78A 2A1UB 1OLXB 1QF9A 2NZXA 2YW9A 3LDUA 2VCHA 1T9DA 4XD2A 3IO5A 2COKA 3H9QA 2ECPA 4YI3A 1QE5A 4M1MA 3WR5A 4CI0B 2OORA 3BE6A 4QGAA 3CLSC 1IONA 3VR2A 1OV6A 4LMPA 1E3DA 3VSDA 4RQTA 3Q8LA 1O95D 4ESEA 2E3JA 2HV8A 3QPUA 5KHOC 3ANSA 2H4YA 5EKTA 1IEWA 3TIXB 1ITZA 4HTFB 1XDWA 1DBRA 4RKEA 1C0LA 3TPFA 1LLCA 3C41J 3CCBA 2ZIGA 3I5AA 5JS1A 3IUNA 4KGZA 4YAJA 2ONKA 5GJBA 3N2LA 3K73O 1EFDN 1N5JA 1CJSA 1H9AA 3L8CA 1SUBA 2EARA 2VDOB 3K1JA 2I6QA 2IY9A 2YMQA 3GK3A 2CUKA 2HEIA 4P38A 4X97A 3C3WA 2ENWA 1RI2A 1D5WA 1H2WA 1U3FA 3AVOA 4YBRA 2QLTA 4J0FA 4ZV4A 3LF2A 1S3GA 1U5CA 2CNLA 1Z6ZA 5DASA 3RJ5A 4YUAA 1NM5C 3ZU6A 3WLFA 2ZSJA 4JLOA 4OP1A 4ZVKA 4QYWA 1RI5A 2GEBA 3RC1A 4IICA 2XHEA 3ZKWA 1Y8RB 3DNFA 5TQJA 3AR2A 2XKAA 2ZROA 2EBUA 4CKBA 3K9FC 4YCSA 4PCUA 3HDHA 4EF4A 2AJTA 1HQCA 1GL6A 3IAHA 1EUZA 2QWXA 5J4VA 3UKOA 1GZ4A 2GZ1A 2BOVA 1SGWA 3A6FA 1SVMA 3B6MA 1YDWA 1C3LA 3N75A 1KSFX 3O6VA 4Y2RA 3Q3EA 2F59A 2DUUA 4BDSA 4IOLA 4LF9B 3JXEA 3T7TA 4PRYA 4B73A 4MEBA 1GIAA 2GXQA 2H1LA 2HADA 2MJLA 2XRMA 4QVIA 1D2GA 3ACCA 3Q8XB 1BX0A 3K8YA 4RVUA 3MLEA 3ROMA 1SUWA 2I3DA 5LP6F 4TLMB 2BM1A 2Q1WA 3AR5A 3KCQA 4IP0A 2BSQA 1XWIA 2G5PA 2X5JO 2XTZA 3MOGA 1AKMA 1LWOA 4HFNA 1TQDA 3ZCXA 1FMTA 4MITA 4OHVA 3DBRB 2DFKB 3EXIB 1JSLA 4CMCA 4I6GA 1DZ3A 1GNSA 2GBPA 1NRWA 4FFSA 4EHIA 3A1VA 4II3A 4KR6A 3TFQA 4MICA 1P2GA 2CV2A 1M8PA 2WFZA 1VHLA 1RXCA 1NT2A 3KZ1E 3L06A 4H7PA 5E1OA 5G4KB 4IGIA 4JI6B 3WAGA 1YJQA 2BKAA 5EG5A 1NBEA 2QZSA 3PFWO 3S8YA 1P45A 2W93A 1NW9B 2YXEA 4CE6A 4XDGA 4KPYA 5I47A 2IZ5A 2XB6A 4GGPA 3DKKA 1JXAA 2AXEA 2G9UA 1SOUA 2HBQA 2QG9A 4UOZA 5EWLA 4IZ6A 3TKYA 1L0BA 1WVGA 2GXAA 5E9QA 5HWSA 3HL4A 4FJ1A 1ISMA 1XFDA 3IHKA 5EIHA 2IHVA 5TS2A 2Y67A 2FUKA 1ZISA 4BMZA 3E0QA 1RYNA 1KVSA 5FWNA 1COWA 5KX5B 1TGYA 4EUEA 4EB0A 3I2IA 3SBDA 4H6PA 1CBUA 4MP3A 4BB6A 4V0OA 1DHTA 3NZEA 5I9BA 3H8VA 1G2OA 2Y1CA 4XQEA 1U1FA 3WIEA 1N6PA 4CCAA 1SEVA 4CKYA 2P9ZA 2VT3A 3NHFA 4RA6B 2YJ6A 3F6SA 4OHOA 2DKNA 4E6EA 1M0TA 1OIWA 3DXZA 1U1CA 5BSTA 4QFCA 1U28C 3QF4A 4GM4A 1KVTA 1U90A 1I9GA 1T9GS 1G4HA 5KOJA 4I3HA 4Q3NA 4C87A 4F4HA 4TTRA 4FDLA 1MV8A 3PFIA 3PICA 3WFIA 4YMSA 4N76A 2R68A 4O2AA 1U7ZA 3DVAB 1C8LA 2VOJA 3F98A 3PPIA 4ZVVA 4DM3A 4C3OB 3WB1A 4O6VA 4UOQA 4EQ6B 4QM6A 1FUIA 1WCYA 2FVYA 2JFFA 4M0CA 1C9JA 1UPTA 2ECFA 2PX2A 1P6UA 2BFDB 2E4UA 4PLFA 4R5MA 3NRCA 3MM4A 3UA4A 3INNA 3AVWA 1GTVA 2OVFA 2AE1A 1Q19A 3BH7A 4QUDA 4UMVA 1P5HA 4OX9Y 5DLEA 2G72A 5EWLB 5JYDA 2H92A 2CT8A 5KI6A 1A77A 1FB5A 4JI3B 3VHXA 4TQGA 5BQFA 3KXLA 4XR4A 1VI2A 4NL4H 3VVBA 4E4TA 3FNBA 1HV8A 4AB1A 2II6A 2W8BB 2JW5A 4ETMA 4Y2UA 3RQIA 3TQIA 1O9BA 1YBHA 3ZWDA 3IMFA 5SZKB 3DEJA 2X13A 5FEUA 1R4MB 4IHAA 2D2VA 1ZD5A 1TM3E 4CUZA 4UC0A 5ED4A 1KE1A 4YMVA 1W36B 4R3WA 4D4MA 4F56A 1W25A 1GILA 5A6SB 3U61B 1XZFA 1XXHA 2QQEA 3OCUA 1H0SA 5GM2A 4DCSA 3N2KB 5JPDA 2NO6A 4GL4A 1OZAA 2CLMB 3GYGA 2BFWA 3PNLA 4ZJZA 1JHAA 2QLBA 4I6JA 3F6PA 2G8LA 2OY0A 5HPYB 1U2DC 1L5RA 4RPIA 3VOSA 1DAIA 4UREA 3VR6H 3DOJA 3UVEA 3SYLA 1NW6A 1NSTA 1GQQA 1SVIA 2JI4A 3HG7A 2O6LA 3TXXA 1PFWA 2PPLA 3Q87B 1X6VA 1FDVA 4RELA 3ZNPA 1Y3FE 2ZRGA 1EXVA 3VJMA 4Z9XA 4N8DA 4AS1A 4IWXA 3BXOA 3AUKA 3I01M 4I2NA 5K20A 1I32A 3HMQA 4EBFA 3F8SA 5AVUA 1CS0B 2O9JA 2V7WA 4ZV7A 5HFNA 3U4MA 1ICIA 1TCVA 4RL4A 1RNLA 2J07A 4FYVA 2GCGA 4KXNA 1FP2A 4EG7A 4ZYXA 3KKKA 4HQ6A 1CJTC 1LF5A 3A6KA 1SBYA 4UXIA 4UZSA 5AXAA 4XVHA 4YA6A 4AG6A 4H9GA 1EIZA 3ZHVA 2ZCVA 1BCRA 2GZ3A 4LHXA 1B7GO 4UBLA 2JJMA 1KJWA 4LXXA 4ZCTA 1BGWA 1PGQA 2BFEA 2XZTA 1KVRA 5LP1A 3NOQA 1B2LA 1PS9A 3ZZ0A 1W0CA 4PLHA 1SCDA 2WF6A 1LZKA 2PKCA 3DCJA 3G5UA 1Y7LA 2JAHA 2HIHA 1A9XB 2ZW9A 3L7DA 4QQ8A 3TW0A 1U2TA 2KSQA 4FS3A 4I9NA 3AHDA 2Q07A 5A2QA 1T36A 3RC8A 4Q4HB 1M7HA 2ZJOA 3B53X 2RBKA 1BKDR 5I51A 2R7AA 3ETCA 3UMYA 5EI5A 5K5EA 1Q7GA 4UZEA 3RU7A 3FBTA 3FOWA 3EAFA 4US1R 2BH9A 2Z2XA 3ZV5A 2GF9A 3GBSA 4OK5A 1DSSG 3Q2KA 2A0KA 3CRVA 5DBIA 2AI2A 3X0DA 1K7SN 1T9KA 3KLOA 2UXBB 1PUIA 2PXAA 4RVCA 1YRAA 2GN1A 1JTEA 3A4IA 5KNBA 1Z6AA 3LCUA 3GAAA 4RJIA 3S5JA 3CSDA 4DBZA 4NEGA 1DCFA 3QVVA 3IULA 1PDVA 1NX9A 1JSXA 1GZ6A 1XMQB 1TYAE 3IVXA 2JGFA 4GGOA 2FK7A 2WJHA 4RH0A 2RGWA 1FP4B 1ATZA 1EM8A 2FEKA 2QYTA 2R8BA 2RK4A 2XUIA 5FADA 5FBRB 1DC4A 5FKJA 4CVNA 5L6MB 2I33A 4B3XA 5AM4A 1HETA 5ESDA 2RAVA 1BVYF 3FJYA 2IPLA 5FNVA 4D9MA 3MLAA 1D2HA 4RETA 4DLPA 1BJKA 4PEVA 1SAYA 3T0IA 3WL8A 1ZVVA 3IOYA 3AP3A 1T36B 3FSJX 3UBMA 3P1JA 4Q37A 2VUSA 4EA7A 5JQGB 3HTXA 2GLUA 2VP2A 1U7HA 2HU5A 3A05A 3KTDA 1CCWA 3B3QA 4WNAB 5IJ0B 4GRDA 5AKJA 1X3LA 4GZ3A 4QO7A 4AMBA 1XTRA 2INGX 2XLBA 3HCBA 1OASA 4L8FA 1MHTA 4XIJA 3BIWA 1FFBA 2BTQB 3CX6A 2WPNA 4L4YA 2I4OA 2YRXA 2G1UA 5KTPA 3LUAA 3VNRA 1XK6A 4L08A 4GPAA 3Q10A 4PNHA 2AFHA 1KDZA 3MWFA 4U9HS 1PV4A 1V5EA 4DV0B 3OP1A 3KKLA 5DKFA 5DRYA 5DI9A 4YMLA 5CEFA 2QV0A 4K9PA 3ID6C 4HKTA 2BFCB 3IH5A 5E2AA 1SXJE 2VP5A 2IHKA 3H7AA 4I36A 2IUUA 4EPTA 3AVXA 2C8LA 2P30A 1W5AA 4M1QA 1C9YA 2ZSDA 4IG4A 4ICIA 1MC4A 2V7QA 3QYPA 2GX6A 3BGOS 5FWYA 1PJLA 4OQZA 5DJ5A 3FR8A 2GI4A 1W2HA 3KWJA 3LPCA 1I7PA 5D3ZA 5AW5A 4KVZA 4RLQA 4ERXA 2PGOA 5I7UA 3H65A 1XB2A 2Z9BA 3K6SB 3FETA 5IC4A 1ZWKA 4XB1A 2PX5A 2WM3A 4IAOA 1XZNA 1JDTA 1KZ9A 1CC1S 3HLKA 2QAGB 1BW9B 1DLJA 1Q7CA 1E0SA 1QQ6A 5IP5A 5I45A 2EZTA 2WAYA 3ND6A 3HKDB 3MCVA 2NU7A 3O75A 4ZV9A 4V1CB 2YWJA 3LBAA 3ADDA 1RR6A 2YUTA 5K8UA 2H2AA 2CWWA 3OMXA 3UICA 3P5BA 4RD1A 3ACDA 3UXEA 3AEUB 5LDHA 2VUTA 1GKKA 4NPCA 2WMOB 1DHRA 4DLBA 2AOXA 1BAPA 2QNBA 3UNXA 2WKQA 1IXKA 2DH5A 3L0SA 2EC5A 4EHJA 4DSAA 2W6ID 2F9MA 4ZEWA 1D2NA 2F55A 3JQAA 1O96A 3R3JA 5B53A 4DRXA 2QX6A 3ITDA 3SVZA 2WQ7A 1DO2A 5FA5A 2V7TA 3A70A 3ZBPA 1JS1X 4Z4HA 1U0BB 1UBHS 3SGLA 1KU0A 2ZYAA 5JXHA 3EZFA 4X1YA 3KSBC 3CVXA 3DG9A 1Z6GA 3K0CC 4D3XA 4WLFA 3L5KA 3Q1KA 2BHTA 5FO0A 1QHYA 4TOIA 5KYXA 1ZP6A 1RVDA 3FOFC 4TRRA 1ZI8A 4UEWA 5DX0A 1Z4JA 2CVPA 1TJ4A 4WLNA 4AAYA 4R05A 1CNFA 2I3AA 4JI0B 4LISA 1C7EA 3CKYA 2F1JA 1P6XA 5E6UB 1GGNA 1GYRA 3B6IA 3WWYA 3OEYA 1YNSA 2WNHA 3C74A 3S7TA 3A7EA 5DM1A 4BGEA 4K6HA 2HJGA 1YIOA 4TTIA 1XROA 1DMRA 3FUWA 2YKGA 1AZLA 3FDXA 1FDOA 1SVLA 1KOJA 2AL7A 4X93A 3JAWA 4UQPA 4Y6RA 4RUKA 2B0JA 1T4DA 4Q7JB 5E8RA 2V98A 3UHOA 4BIIA 1L5WA 2O2DA 2XMCA 3CWCA 4RMHA 1Q91A 5ANRB 4LV8B 4A0GA 4AYWA 2RH9B 3PEVA 3F96A 3LFUA 1QMGA 3II6X 1DKMA 3L8EA 1GTZA 2YNMD 3O7MA 1DRUA 3TFOA 2Z58A 1D3AA 4EJSB 3DTYA 5JSZA 1IZ0A 4QDTA 2I7VA 4MWZA 3EGEA 4OYLA 1FYXA 2F4VB 2FHSA 4HEQA 1VZ3A 1GSIA 1L4YA 1WEHA 2IU3A 3TW6A 2VZ0A 3D4PA 5B3LA 5FA6A 4BY9E 2I91A 3H9CA 2Z83A 2WYWA 4UATA 5EQFA 1K97A 1Y8AA 3OZIA 4HVLA 4GSKA 1EESA 1IM5A 2I6FA 3ADOA 3S5UA 4FZVA 3S81A 1IVNA 1ISFA 3I09A 2P9YA 3LFTA 3ZWNA 2C9DA 4INOA 4QARA 3UB3A 4CTOA 3FHOA 3ZCRA 3VNUA 4JUAA 4QFMA 1I2ZA 5DYIA 2XXAB 1PBTA 1VI5A 1ZIPA 1QZUA 5I6DA 1GPLA 2VA8A 2Q4EA 3GWZA 4A0FA 1LBHA 1M2VA 2PL1A 1AK2A 3KLNA 4P3KA 3BBPA 2VJDA 2DPYA 1B8VA 2AR9A 3FTNA 3IQWA 3Q6NA 5C8ZA 1FTGA 1D4FA 1TVMA 4B33A 4BB9A 5L3SB 1X1TA 4PIMA 4WH0A 3H4MA 5AVZA 1FS5A 4XUDA 1A9YA 2R44A 2NU9B 1ORIA 4ALJA 4DWJA 1JP7A 1F0YA 3P9YA 4JOSA 4CEJA 5I8PA 2CEAA 4MI3A 3H2JA 1SU8A 2EJCA 2NTNA 3HU5A 1FS6A 1W88B 2VKQA 4NULA 3WSTA 3NWBA 4KE8A 2KYRA 2L82A 2MINA 3B13B 3T9EA 4ER7A 5H68A 1LX6A 3TNJA 5JVDB 3FYCA 5CB8A 2O8BB 3L92A 1PCXA 3AKCA 2CK3A 2RG7A 4NTZA 5CD9A 3A58B 3T5CA 3LUGA 4YJDA 5IKXA 1NSYA 3V7UA 2F7SA 4P7GA 4OUDA 4A9AA 2Q6VA 3OEWA 4LXHA 3SOPA 3TLJA 5AXDA 4AMUA 2H4FA 4HXEB 3HJRA 3DEZA 2RHHA 3ORYA 1CF4A 3RPEA 4QU9A 3WJ2A 2ZRNA 3B82A 4PYQA 2CB9A 1COWD 4TWJA 5FLEX 3O1LA 3E05A 5F12A 3UXYA 2ZYUX 3E84A 5CITA 2O3TA 3DEIA 1NXXA 3HJNA 4FWIB 2PKQP 3W6NA 1RU3A 2LZ0A 2VJCA 2IYVA 3PDIB 4ZZ3A 1Q92A 1BWQA 4JROA 4XYBA 1CUWA 1J0XO 1PWHA 1RWWA 2Z30A 1TYEB 3RK4A 4V2IA 3LP5A 4P53A 1P33A 3P97A 1JU9A 5FLYA 3G7NA 2EIHA 3DHEA 1IZ9A 4R6WA 3ZDFA 1L5HB 3L6EA 1G1MA 1E1NA 3QI2A 5TSDA 4JWTA 1XMOB 1R8QA 2C5EA 3BAZA 3J7TA 3PHBE 3AUAA 5INTA 2VWGA 4LNHA 4OJKA 1HNZB 1NUHA 4LBZA 5D87A 1NRIA 3SE7A 2V8OA 2XQVA 1GSHA 1IG3A 2N3ZA 1DZIA 3EXHB 4FCTA 4KO3S 1T3ZA 1HH4A 3W6UA 3BBLA 4FE7A 3KAPA 4CG2A 3VYSB 3FCSB 4DCGA 4E5KA 1C14A 3BRWA 1COZA 3DBIA 4GF5A 4IEFB 4K40A 3SM3A 2YJNA 4GE3A 3C8HA 3BH6A 2B20A 3BGIA 1SC1A 4S1WA 1KQNA 4DLSA 3EQ9A 3EVBA 1D6NA 3V32A 1USUA 5IABA 3DMGA 3T7RA 2VRWA 4YV0A 1XYVA 5IN5A 3ZDAA 2WF9A 4MS4B 4RHUA 4TMKA 2OGTA 4Y0VA 4XM0A 5DYYA 1IUPA 1NBIA 1PJBA 1CHNA 2JGAA 2E82A 3PQ7A 1AOXA 3PXEA 4NAUA 2Z2JA 3O84A 3SHQA 5ISMA 1JDNA 5K8IA 4YJFB 2DLCX 1QRDA 3G0IA 3WADA 3GFOA 5AVVA 1BEUB 4F7DA 1Y7TA 4TSKA 5E9AA 2J59A 1MQ8B 1OBFO 3NTQA 2O5EA 4X9XA 5TMPA 1HM5A 4DUGD 1YVEI 1R66A 5EKXA 4CM1A 3VKGA 4RMGA 4P58A 1NBOA 2OO5C 3HCCA 4DBLC 3ABIA 1Z22A 2AT1A 4JYMA 4E21A 3BXGA 1DV1A 4D6YA 4XWOA 3M70A 2OCDA 1NVEA 1AXGA 1B1CA 3HCOA 3KSMA 4M3NA 1A1SA 1D7AA 4OQPA 4DE5A 3L0BA 5HOQA 5GQSA 4WKOA 4B7XA 3O3OB 2ZE6A 1ODSA 3LIPA 3VBCA 1V9SA 1PNTA 5HIJA 1F8XA 3DEYX 1X87A 2Y27A 2WABA 1BH2A 1FVOA 2BLLA 2JIRA 5HG0A 1QAQA 2EQAA 2IS2A 1E20A 3WWCA 1A4RA 4P4GA 2RGDA 3EOAI 1UBNA 3MSCA 4BB5A 1LNZA 1IZZA 1X1BA 4J9VA 3PUZA 3T5GA 4F9GA 1WIWA 1KEEA 4WDRA 1U28A 2HMTA 3LQRA 4H3KB 1GQOA 3HU3A 3TLAA 1UBUS 2FN3A 3PL5A 4J0IA 3A3YA 4PQYA 2GCPA 6REQA 3D3QA 2HGSA 4DABA 2YWGA 1H5UA 2FX5A 2D54A 1ECBA 3JVVA 4WN9B 2QY9A 3FPBA 4L9WA 3GEMA 4W5WA 1ZRMA 1LBQA 4Q9AA 4ZVUA 4EOGA 1VHQA 1YDHA 2P5TB 3MBKA 3GFQA 4IY1A 1VXOA 2XUHA 5DP2A 4Z2YA 1N9ZA 2JAQA 4EMSA 5FF9A 3T1OA 3X1KA 5JS8A 5LMZA 2O07A 3LWDA 5K99A 4WMLA 5F9FA 3DE7X 1XJQA 1XRQA 4OYYA 1EP9A 3ZUGA 1L1QA 1YQUA 4FFDA 5KQMA 2AGVA 4FPXA 2J9YB 3MPOA 1ZSNA 3AFNA 3L8ZA 1EZ4A 4BP3A 4ARAA 1AHPA 3LY7A 3QBDA 2F1OA 4GOND 3WBBA 3PGVA 5JBIA 2J0SA 4S0XA 3FLEA 4OQEA 4EELA 2AXQA 1ZM9A 1HPLA 3M89A 3JQ7A 3A1WA 1DC8A 3AU9A 3H05A 1LFAA 4RVSA 5CBPA 1QBKC 3SYKA 1F8UA 2Z08A 3UPTA 2WWWA 1ECFA 3CLUD 1Y5IA 5J5AA 1N2JA 3L7NA 3VZBA 3I6IA 2X3UA 4X41A 1SNYA 3EUAA 4RADA 3VKVA 2CN1A 3TMYA 3RT7A 1VDMA 2R60A 3A1FA 4C6HA 2J3JA 4ZA2A 3VTAA 6GPBA 2UYCA 1RM5A 1JKMA 2VJKA 2X6QA 3K9QO 3OICA 3EIWA 1ZZEA 2LW7A 3R24A 4OGKA 4XW2A 4XYEA 2ZJFA 1BMQA 1U31A 4V0RA 4EYEA 3B5EA 3NDIA 3ZY5A 1TCUA 4OHZA 1XEWY 4J16A 4KUGA 3O2SB 3PGMA 4LC1A 2YJTD 1EM6A 2IOYA 5EHGA 4F91B 2XYVA 4AWAA 3HDYA 3ONVA 1E94E 4U6SA 1YF3A 1T0BA 2EWVA 4ND8A 1GARA 1ZCFA 2GJ9A 2JFQA 2VDPB 1NQOA 2B82A 1ECCA 1ZCBA 2QT1A 3AZQA 4FUTA 5EIOA 1FUKA 1EG7A 2XMGA 3L9XA 2OECA 4J0HA 1VLJA 4NFYA 4QPCA 5ALFA 5LC1A 2AF3C 1PK7A 2BELA 4PE5B 4C4YA 2EV9A 2CC2A 1E7RA 1HFWA 2XYPA 4LOKA 2B92A 6ADHA 2KBEA 2D3TA 2IHYA 4KJXA 4KSCA 4X84A 1V95A 4L50A 2I6GA 4PZYA 4LY3A 5EFOA 4L6AA 4YP9A 5KWJA 1E1MA 3OOHA 1RWQA 2GS9A 4ARIA 2GETA 5DTIA 2JKYA 3CVUA 1WB9A 1VGVA 2A9FA 2YTZA 1AQYA 2UAGA 2YCBA 4RZIA 1ZOSA 2ZRBA 3DDCA 1HKHA 4R2KA 5K0FA 4BNIA 4DDTA 1ZLYA 1ETUA 2WQZA 2O2ZA 2VXOA 1E59A 4LFBB 1L1FA 1D1PA 5ECYA 1U3UA 4MHOA 1AVTA 4DL9A 1F9EA 3RREA 2XYHA 1IAVA 1NI4B 1ZDMA 2O8FA 2QN9A 3GU3A 2HHHB 4QXOA 1TK3A 3JALB 1HWYA 2H1RA 1GFZA 1NW4A 3G2QA 4TROA 4A27A 4RWEA 4S24A 3RK1A 2C4VA 5EE5B 3BWEA 4MB0A 3LYAA 3BB4A 121PA 3DZFA 4BFSA 1SRQA 1MVOA 1KK1A 3GQVA 4W6ZA 1TE2A 3PUXA 1KMMA 2WMDA 4G4SP 4YRSA 4J94A 1FFWA 3VYRB 3R0JA 3FOZA 2EFEB 3IEVA 1EGMB 1K08A 2E37A 2XWSA 2ZZMA 3QTLA 2PRJA 2E0IA 5KTTA 1MXHA 1UPFA 4N18A 3RQSA 4YFVA 3K9LA 2XUKA 3D81A 4ENUA 1QRSA 2ZWIA 4DZRA 4W5NA 1RI4A 1G7CA 5AVYA 4G9BA 3VJLA 4ILKA 4R1UA 4EY5A 3GPIA 5FRDA 4DWOA 2E2WA 2MIIA 2QJFA 2BF7A 3OD1A 4TTAA 4NRDA 3OQ1A 3RLIA 5BUCA 5C5IA 3OOSA 2WK1A 7AT1A 4MWBA 3TOCA 2F1KA 3ZE2B 4QBFA 4BECA 1B42A 5AW1A 2X1LA 3I8OA 1B74A 1H4VB 3ZDQA 2O05A 4ALNA 3W78A 2X2PA 3IB3A 3D3JA 4H35A 1TPZA 4RFSA 4YQFA 1OILA 2XBUA 4MRNA 1F9AA 1E3WA 5HIAA 1V2HE 2R5NA 3L8YA 4LRXA 3A10A 2B37A 3HFSA 4JXZA 3I0NA 5KYTA 4U7WA 3TWOA 3K71B 4H6XA 1UK9A 3R0ZA 4YACA 3RIGA 4HAZA 1ZRHA 5EWMA 2OHFA 3IYLW 1GGVA 3DFMA 1NVMB 5LBIA 3RROA 3W2IA 4MKGA 2PMEA 2KI5A 2GNPA 1P1IA 2I2CA 1FVXA 1Q5PA 1B3BA 1IB6A 2UUCB 1Z5VA 1PR2A 3EY4A 3V97A 1ZXLA 5KDDA 2A35A 1KAQA 4US0R 1J21A 2PUAA 1P2VA 1SCAA 5DE3A 1NBHA 3DPSA 4BV8A 5G4KA 1KJ9A 3FCYA 1DJPA 4FYPA 3BTSA 3ZHOA 2RHRA 1Z3CA 2PLRA 2Z43A 1HC7A 1J8YF 1QMPA 5C1PA 2PUJA 3GELA 4U1RA 1JPVA 2CXOA 3R20A 4IUBS 4MQLA 2D3WA 5AIAA 2PNJA 4BNDB 1X7DA 1TB4A 3IFSA 2P27A 5DHAA 1ML4A 2MSKA 1S5PA 2PRZA 2PX6A 3KXDA 4N0DA 3L4JA 2B8WA 2YOGA 2OCYC 2VDRB 3RVBA 2FLWA 4U0JA 3H16A 3U17A 2XCOA 4B3RB 3HHPA 2B9VA 5DBFA 4L0DA 4ZDWA 4EI8A 5L9AA 4KRFA 5LVAA 2I1VB 1IJEA 4EARA 2H1OA 1FUEA 4MKRA 3E22A 5JU6A 2V4MA 1NFQA 1U5BA 2HNBA 2B36A 1FTNA 3CLSD 1EK6A 3LUCA 3MXOA 4LMBA 4Q15A 5TT0A 1D2CA 4PX2A 2NP7A 4D46A 1PT6A 4WINA 2ZK7A 3NM6B 3OX1A 5TEVA 4CV3A 2FRVA 4WBSA 3O83A 3FZQA 4TVKA 3RUIA 1JHYA 1IPFA 2BBOA 2RHJA 3CKLA 3TZKA 4L51A 2QZJA 1A4XA 1XTUA 2ODNA 4FI3C 5FH9A 1JYFA 3T4UA 2GD6A 3BOSA 2ZETA 4ZO7A 3R9KA 2RCYA 5KSZA 3VX3A 4PSVA 3P9QA 3H4VA 1XD8A 4OIFA 2JBWA 4R9VA 2KLBA 2V55B 1U4OA 2WFLB 4LYYA 4X90A 2BEJA 1HLPA 2H1SA 4KQFA 2BGMA 1KJ8A 4UDOA 1GNRA 4WXRA 1IWBB 4MW7A 3MVEA 4AIRA 4D99A 1KC1A 2Q3HA 3JAKB 4DPKA 2VO1A 4BNJA 1K9SA 5BSFA 3CE6A 3A27A 4UDYX 2DP4E 2FDRA 3KQPA 2FZEA 2XITA 4YMUA 2HRZA 3AGQA 2W5UA 5FUMA 3DO5A 4IO0A 2PMWB 4R2IA 2CFTA 5KINB 3HKCB 3N3BC 1BXRA 1SCKA 2JGMA 3OZTA 4I08A 4NBSA 1A2KC 4TMZA 4G5XA 2VCEA 4JLWA 3TQHA 3ADCA 3TL2A 16PKA 3KKEA 1XQ1A 4O63O 3SKVA 1T34A 1QG6A 4JLPA 1GDTA 2VAMA 2WINI 3PNVA 4FE3A 1V1JA 3KJHA 5G3YA 3T7CA 4KH1A 4DJEC 4OHRA 4E7PA 3ZEAA 3LY9A 3L6CA 3Q41A 1U2GC 4FMBB 5TE9A 2FFAA 2JLQA 4LS3A 1JIUA 1VG8A 3M82A 4F6RA 2FEWB 3MF4A 2HMAA 2W2KA 4Q5IA 2MYNA 3UT5A 4F1JA 2H8KA 4P7FA 1GG9A 2VJMA 2YDXA 1JKJB 2FW0A 5LNK6 5BSUA 4BQQA 1YWGO 4ZT6A 2VQFB 4V0NA 2JJ1D 4PO3X 4H7KA 4P4LA 1JHPA 1IBKB 3SAJA 3QOXA 5FD8A 1ECJA 1Z6XA 3DLAA 1ADGA 4HG2A 4HXFB 5C35A 3KYDA 2PUEA 3COPA 4ARZA 3G8YA 4HNSA 3A9UA 4IIJA 3KYCB 4CLEA 3PC2A 4L8YA 1TTQB 2JRLA 2FUCA 3MINA 5BN4B 1K7EB 3BL6A 1P7VA 1AN0A 1RHJA 4PXYA 3OM1A 4C2AA 3ZJ5A 2F90A 4DC9A 4RMNA 1U0OC 1OHHA 1Q15A 1VIVA 2AZ4A 5FDFA 5E6RB 2D0PB 2PDAA 3SSOA 2HU8A 2BCGY 2NTEA 2J08A 4ZK2A 5A06A 1I6WA 4AY4A 2Q4BA 2ON6A 4LZZA 2OCLA 4NQRA 2G3YA 3ACBA 1HYEA 3FF4A 3FYDA 3ISJA 4DKXA 1Z75A 5G41A 4Z0HO 3KSAC 1TECE 1GPYA 1SH7A 3CJTA 4AJ2A 4B0PA 2PAAA 3STTA 2MSLA 3DV9A 4YTEA 4HAUA 1PR9A 1WDKA 3R7WA 4M7OA 1KK2A 4UVIA 5CH8A 4WLOA 1N6NA 2H4JA 1I5OA 2D13A 2H1IA 4RANA 4PRKA 1HDXA 2ZJ0A 5C34B 3RGGA 5HW0A 1E0KA 4CF7A 3AF5A 5IRCD 5CM2Z 3MC1A 4F6CA 1YZYA 1X8LA 2VNHA 4I99A 3KB1A 5JROA 3R44A 3TW8A 1I13A 2HJHA 4DB4A 1M2GA 1ODCA 1Q7EA 1DWQA 1NG1A 2FOLA 1SR8A 1SU7A 3KVRA 3KWFA 2Q6OA 4M37A 1JSZA 1USIA 2H2IA 1K2VN 1BHJA 3KAQA 1NQAO 4JOQA 4OOEA 3R2JA 1ZJ5A 4D79A 1L7PA 2YHUA 3GVHA 4FLEA 1BMFD 3RC9A 4X1IA 3DZBA 1SELA 4MV4A 2VOEA 4WVFA 4MVXA 4Q9LA 2JHFA 4DNOA 2WU0A 2FMIA 1Z56C 1KDPA 3GGDA 2H59A 3I04M 4J7XA 1KFKB 3MJSA 4RZXA 2HW8A 4WLUA 4QUBA 2HCRA 5KQGA 3TZEA 4ED9A 2VWQA 2VF8A 3H2SA 4RTSA 5EJIA 1YI0A 3AFOA 3ZTWA 2KJQA 1QIIA 1C0KA 4PCLA 2XA9A 4CT4B 1HEIA 1QFSA 4LF8B 2XVMA 4M2LA 3JY6A 2RGNA 2DERA 3KFVA 4IPTA 3ZY6A 1AXEA 5J2UF 1A69A 4RK1A 3UJAA 1KH1A 1OFTA 4YNBA 1NVGA 5D5PA 3K0BA 3U19A 4OB7A 1E2EA 3TJZA 3SVLA 3OA0A 5KYUB 3AR9A 3ETNA 3RAPR 1JHVA 2Z3ZA 5FI0B 3VPXA 1L7VC 5TS3A 2VT7A 4E5MA 4JP8A 4L6IA 2ZLBA 1LXCA 2YH2A 3BTUA 3I9FA 4E1AA 2O14A 3GJQA 3B48A 4INJA 4CKWB 1IM2A 3AG6A 5ELLA 3U9TA 1OJ7A 1KP2A 1FRVA 4Y2HA 1SIOA 1H94A 2C04A 2RH5A 5C8DA 1PVDA 3ZBQA 2V5UA 1FFAA 2WV7A 1AUPA 1C1DA 5CURA 1ODIA 4CZ2A 2V74B 5FPKA 4DR2B 1G3QA 1X86B 4CKBB 5LYJF 5BXQC 5KKCA 3LBFA 4MVJI 3FKJA 3KE9A 4YRCA 5B1YA 5JZVA 2LCFA 2UUBB 2QRKA 2OLEA 2RBEA 2SBTA 4LV5B 5FAXA 5FOVA 3ABSB 4BZWA 3ZD9A 2RGGA 1V9CA 4KQIA 3UJ9A 1KZ1A 4Q19A 3SHFA 2YY7A 2GASA 3OIWA 1TAQA 4NDAA 4PYMA 4S1NA 1JBKA 1UP4A 7REQA 3R74A 1YR3A 2OFWA 3EE6A 2NYVA 2W2NA 4HDNA 3RANA 1D2EA 2ZWOA 4QTXA 3KUUA 3M7IA 3VSEA 4BBPA 1NBMD 4BNWA 5CCEA 2J6CA 4O1IA 1OREA 1Z4OA 5BVHA 3O9VA 4FYHA 1YCGA 3INTA 1G8YA 1QBGA 3RRYA 4RQUA 2OGZA 3JYNA 3KWMA 4HQFA 3OE5A 4MRSA 2ZBFA 5JZBA 1ABBA 3DE0X 3E9DA 2H0RA 2DAPA 2FUG6 1JBQA 3UAYA 1SJ9A 2WC1A 3GAZA 1IG0A 3D3KA 2YY5A 3K9BA 4EAAA 2CNKA 3E8XA 3KJQA 4NXMB 3F9CA 1G2PA 4PQEA 1E32A 4LE1A 3VZPA 4PS0A 4B6FA 4TXNA 4ZI7F 4J4HA 1R0YA 1JW9B 2EP8A 1LRJA 4QULA 1JGTA 4XQ0A 5CP8A 5KWVA 5BSHA 3NBKA 1IU9A 3K16A 3LZDA 3SFZA 5AW6A 2P4EA 4A36A 1QM5A 1SIUA 2IIVA 1XZIA 1CP2A 3VVMA 2DHRA 1VIYA 1NSFA 4ZAVA 1P3JA 4YUYA 4MCJA 2YJZA 2XSZA 2X23A 4PBSA 5I4BA 1WXHA 4FYJA 3JQEA 4TL9A 3U62A 3W04A 5C37A 4PFSA 1Z2OX 3JZMA 2VCYA 5AESA 2QMYA 4F3YA 2E5LB 2PQ0A 4UBMA 3PUWA 2ROQA 3DOEA 3W90A 4KH0A 5EEGA 4DF3A 5L3QA 1FDRA 2YR0A 2H5EA 3QKSB 5K2MA 1R27A 1I1NA 2ZQYA 2E7ZA 3N8HA 3OLYA 4CGYA 1XT6A 3QOYA 2FF7A 3JQ9C 5IDVA 1NULA 4J6FA 1R0KA 3KPWA 1LGYA 4E13A 2OPBA 1YUBA 3YASA 2B4TO 4XWTA 3ZDRA 2JEOA 3PT9A 2EJTA 2FFBA 3PU6A 3C87A 4LVNA 4UMFA 4TXHA 1C80A 2X9NA 4CDMA 5LDGA 2G1AA 1ZIYA 4S2EA 2FLVA 4LMRA 5LFAA 1XWFA 3VJKA 1I3MA 3CKKA 2VIIA 1JAIA 3GMDA 5JUWA 2H18A 3QNWA 1EBUA 5CFLA 2AXPA 2HF8A 5AJHA 2WJIA 1BZYA 4NU6A 1H3EA 4Q9HA 2FUEA 3OIUA 2NAFA 4YMGA 2EZUA 1B0ZA 1Z82A 3FCCA 4NCIA 4UUNA 4JSTA 5BORA 1DEKA 1P1KA 3BJRA 1E64A 2NNLD 1ZR4A 1TGVA 4V3CA 4MYTA 4EX6A 4E11A 2A0XA 2V7QD 4NONA 1FZQA 4L5IA 3GDGA 1H9BA 4EY3A 2Y0BA 2GARA 3K0FB 3SEAA 1FSZA 2POCA 4QGGA 1ZK0A 3IEPA 1JZSA 3NHJA 4WXMA 3G49A 3G9UA 4JWKA 1ZN9A 5DW3A 3A2KA 5CH3A 3ZH2A 4AJEA 1I3KA 3VKFA 1LS1A 4PPFA 4JI5B 3SBOA 2NG1A 3OTOB 1A9SA 2FN4A 1OW3B 3DCNA 3Q3CA 4LNUA 3T5MA 2PUBA 1MJ5A 2WJ4A 4AUEA 3FYUA 2H52A 5JCOC 1EX7A 2FN8A 3RS5A 3FB4A 1ABEA 4DCCA 5EIBC 2RK3A 2ZXEA 4JT8A 2GM9A 3OCVA 1NRXA 1EFRD 4JI7B 3NC1C 1JX6A 4FYWA 5NULA 1JIJA 3KOXA 1RBYA 3BGVA 5G0TA 4FD3A 3VDNB 1MPTA 2QN3A 2AW5A 4ZCPA 3Q8KA 1L4KA 3BJZA 5IAKA 3T5AA 4ITVA 1A8SA 2YWRA 3PI6A 3WFJA 3U0BA 1RXVA 5KU7A 3O8QA 1G5IA 5HKBA 2C03A 4MO9A 1NV8A 4X7RA 3HEMA 3SDSA 2BTOA 1E98A 3K6SA 1BOFA 2AN9A 3BCHA 4CDGA 2C84A 4LSWA 4HAWA 4R1MA 5J40A 4IIEA 4E07A 4EEXA 4FHZA 1PJ8A 3L2OB 5FFMA 1CQJB 3RKUA 4QGFA 3RSQA 1EAYA 2P4QA 4FFRA 4RA9A 1CDEA 3E8MA 1X14A 3EGXB 3U44A 2OZLA 1Z26A 1RABA 2VVTA 3THYA 2PQ6A 1X70A 3TXYA 4BQOA 3AVUA 2C82A 2O7VA 1LS6A 4B3IA 5DNWA 1S9HA 5HJEA 4QUHA 3WG9A 4AN0A 4GDFA 4F72A 4NX2A 4RVGA 4W8OA 4WCFB 4FSXA 4ZAWA 5CD1A 3G17A 2P5YA 3JZDA 3I3OA 1MJGM 2VNSA 4C7OB 1PX0A 3JD0A 5CBPB 3KUCA 2Z56A 1BFDA 1WHSB 4B44A 2QXTA 3DKIA 3AO0B 1DKLA 3DKVA 3FH0A 4I55A 1XRLA 4KRYA 4NAVA 5H70A 3RHSA 4UUOA 1BFUA 1Y37A 4M0LA 3ZNQA 5D8DA 5HKKA 2IXTA 1G21E 2C4WA 2OLJA 3VM6A 1A5AB 4ZRDA 1VHWA 3GRCA 1B73A 3AF4A 2NUAB 3FTEA 3DXXA 4MUBA 2EHDA 2SCUB 1T1RA 2BKUA 4L5CA 3ADKA 1XRJA 1N25A 2PZJA 1XZMA 1ZJ4A 3SZ3A 1T2AA 1Z88A 2XDYA 2Z2IA 4MUKA 2G9RA 4QBHA 3D64A 1QC5A 3CE9A 3AIIA 2PLAA 1WL8A 1RPNA 4BX9A 3V4OA 4AKGA 1VPVA 1P61B 2QM3A 3IDFA 3EFHA 1MJHA 4ZJYA 1E1QA 3JAWB 1H6AA 3FWKA 3WTCA 4HZGA 2OV8A 3QBTA 1IY8A 1EFLA 3X1XA 2BKLA 4J7UA 2R4TA 2Q3LA 4J1SA 5CYGA 5JS2A 2DULA 3K5WA 3KX2A 1JWAB 1N3YA 2SHKA 2G82A 1T26A 3CRNA 4BFLA 3HR4A 3L0ZA 4A92A 4BZQA 2I55A 1UXOA 1TLTA 3A31A 4JKIA 4KIWA 2GZ2A 1J24A 1EHCA 2HA2A 2QTHA 3GFSA 4M88A 3IOEA 2ARKA 1G6OA 2VJBA 3X1ZA 4CR7A 1YU6A 3VKWA 4YIKA 1ZMRA 5TC4A 1NBMA 2ET6A 1E4YA 3THSA 2C77A 4F4IA 4XYLA 4G5OA 2XNKA 1L8LA 3V2GA 4A16A 2FB9A 4CFSA 2AN4A 3KOOA 3RH0A 4Z7NB 2GMWA 1XVVA 3OCWA 5DFAA 4JB2A 3TXAA 4M49A 4LYJA 2ILTA 1E8MA 3NATA 5SZJA 2PU5A 2ZYGA 1BEEA 4DIMA 1VMKA 2G5GX 3PKZA 3ZJTA 1DFGA 3KEFA 1W8IA 1X80B 3MCTA 3PL1A 4KV7A 3I92A 1EFPA 2JFOA 2OEPA 3LQ2A 1W6UA 4RESA 3MELA 3QE9Y 1RRGA 4C06A 5LIRA 3MMXA 3NBAA 3CVJA 3QUQA 5KUTA 1Y5LA 4E31A 3JSXA 4M76B 1P7PA 1Z18A 2Z09A 4MQFA 4NARA 4NBTA 3V7YA 4DV5B 2YNMA 1W1UA 1Z5OA 5IAAA 2ZB8A 4MXDA 2JLCA 2QT9A 4FWTA 1KTVA 1OLUA 2ZJ5A 4IIUA 3Q7TA 3ZHXA 4B6JA 4A7PA 2NPIA 4P3YA 5DPMA 2OYRA 3MWDA 4E33A 4PZEA 5JI2E 2R11A 4LQLA 1UXHA 4EHBA 2B1JA 5DM0A 1GTSA 5AMXA 3FX2A 1I14A 3IQXA 4XSHA 1BE8A 5DISB 1N2CA 4LDQA 4XX1A 4G8DA 4UU1A 3WGMA 5BT9A 4WQMA 3T1QA 4G5GA 1WPGA 2ECOA 4QIHA 4IJWA 3O82A 4TN5A 4GZ6A 3MT9A 5K3AA 4AW9A 2AFHE 1SEPA 3QEMA 3C5EA 4FE4A 3SEQA 1JNYA 2JIPA 3V5NA 1NVKA 4H60A 3DM9B 2JHAA 3VZSA 4C4SA 1E2BA 2AV6A 1XU7A 1GU7A 3HXPA 5JDIC 2ZUUA 2N47A 3CO5A 3PK0A 1O0CA 2QGFA 1O1YA 2A1IA 4S05A 1ONPA 1NUTA 4AY6A 2COEA 3EXAA 2F43A 5HUHA 1SPXA 4WACA 2VK8A 1YUMA 4AZVA 3C0KA 2H1VA 3BRCA 4R7GA 3TI7A 4N7JA 2CLDX 1SQ6A 1ISHA 2H4ZA 3KEOA 4B6RA 3G02A 4WXYB 4YUVA 3HUEA 4YAKA 3D6NB 3UB4A 1SD5A 4Y1EA 1PQ4A 1Q83A 5KYXB 2W58A 3K1ZA 3THWA 2Z6AA 2H29A 3DVAA 4X95A 1AHIA 3O31A 4ND3A 2BHRA 2PEYA 1CR6A 1S8AA 3AEQB 4MUEA 3FDFA 4KYUA 3V2HA 2WJPA 4BMPB 1MJFA 1TAUA 1Y9AA 2PKRA 3UMMA 4ZYYA 4R83A 2ZSAA 4YJGA 3OQIA 4MUJA 3DC7A 1Y63A 2HREA 2W2XA 3D4IA 3DDWA 3H75A 4MLZA 3QKWA 4LWQA 2FA9A 3PENA 3LC7O 1K92A 1XUOA 2Y6UA 3P0IA 2QZ4A 1P5FA 4D5EA 4ZIRA 1F20A 5JATA 1E5DA 3WGYA 4UAUA 1N8SA 4F4DA 3ETGA 1OAOA 1OTHA 1J20A 3S4YA 4LTNA 1U0LA 3X2SA 4UQOA 1P4HA 2PL9A 4OFZA 3ETLA 4MI6A 1JXOA 3AGPA 4R1QA 1QTNA 1H8EA 1PYGA 3BREA 5G0UA 2XE8A 3SK0A 3USZA 3T94A 5A02A 4NE7A 1XAIA 1ODFA 1QU3A 1IZ7A 1BXKA 2XMDA 3AKYA 1CLUA 2V97A 1V39A 4N6GA 3MHPA 1ECPA 4NLLA 3DKRA 4EG1A 4JI4B 3AM1A 1V8DA 4NCBA 3H1BA 1G5FA 1C0IA 3HJBA 2VYVD 3AONB 3OSUA 1Q0QA 3WRYA 4KQXA 4YLYA 2D74A 2PSFA 2O1EA 2VH2A 4G23A 2D7JA 1ZGBA 3FFBA 1RWMA 5EGSA 3D4LA 1F1BA 1E8NA 2HFKA 2YXNA 3G1WA 3WQHA 3GN2A 1DXOA 2UVQA 5IANA 1KHTA 4FBGA 4BNYA 3TSWA 3C1TA 1NWCA 1PW5A 3UXMA 2Z5GA 3D7LA 4BAGA 2WHXA 1QYIA 1JDZA 4TKZA 2R8PA 4UVEA 1LV7A 2WZCA 1DGQA 3NDPA 1N6IA 2CNOA 3M1YA 5AJZA 4RVFA 4C76A 2P6MA 1XX6A 4Q4LA 3B6ZA 1RPAA 3OE7D 2ZRCA 4HK4A 3INYA 4TWRA 4TMTA 1U65A 3CUVA 3NNDA 3I4CA 2FVXA 4XDYA 5AKIA 1NLZA 5F4ZA 3KE8A 3HXOA 4FFBA 5LA6F 1NZFA 3BD6A 1Q74A 4O4HB 1QIHA 3TN7A 2O23A 1JI3A 4FHGA 1YSCA 4XSGA 1B23P 1RHQA 8MHTA 1XA0A 3VR3D 2DC1A 1AGRA 1ULBA 1UKZA 1CUJA 4HN9A 1BN6A 2Q2WA 4JYBA 4AI6A 5JAMA 3I8XA 5L7WA 4MWEA 4IRUB 4PICA 4ZVSA 3TD2A 4FHEA 5JTTA 3RYCA 4ZTZB 2XUOA 3I42A 1IRXA 3CUSA 3CMCO 3P9PA 3ITKA 4QUEA 5FUQA 1XKXA 1CEXA 3HB0A 1U7XA 1T0PA 3TQSA 2J30A 2OILA 5K4HA 5E4YA 1EXDA 3SP1A 1QU2A 1AB5A 3IXQA 3PSAA 3D1LA 1YO6A 2HQRA 3O1HB 5DHSA 3VDQA 4CKEB 1B6TA 4CMIB 4J2HA 1H3FA 3BHNA 4JEIA 2BMAA 1G7TA 1U0HC 2HZBA 4JLBA 2V3CC 2RMKA 1H0KA 5ADVA 1DXYA 4JLUA 2CFIA 4UBNA 1IN7A 1UXJA 2O0JA 4OYHA 2YBDA 5CNKA 1PSDA 2EFCB 4I9GA 4XR9A 5BN4A 4OEHA 4CM4A 3UG6A 2C92A 1YS6A 2FMXA 3MGCA 2LCIA 3BWCA 4GRAA 4JP1A 3F74A 2OA0A 2WM9B 3WKBA 2XE4A 1AS3A 5KIAA 3HWRA 3K2EA 4KYVA 2WSSD 1PV1A 4G4GA 5D86A 2ZRLA 1E5LA 1UK8A 2XUJA 3C8ZA 2JF0A 1ZYUA 4O4LA 1N5DA 1LVHA 4PZDA 3GLHB 4MUGA 4YGXB 3TTSA 5KSYA 1Q6YA 3AEKA 3T1VA 3T3DA 3UOGA 3M3HA 1RAGA 3Q72A 3GV0A 3HCAA 4KDCA 4LY6A 3BC1A 2G5CA 5BYJA 1DRJA 3PFKA 4NP6A 6LDHA 4L5JA 1WSAA 1EE1A 2WNIA 3ELYA 4RDIA 3HDGA 3ON5A 3TEFA 2DUJA 1ECGA 2N42A 3DAGA 1WJGA 4NPHA 1ZGAA 2BKEA 1FNBA 3IPCA 3JQGA 4GAEA 2XD9A 3LXMA 4KYIB 1L7QA 5I9TA 4A6DA 4B32A 4Q66C 3TZQA 5KWSA 2CZGA 1GTL1 5ALIA 5GADl 4BNLA 4GD3Q 2PA0A 1VYVA 4CMAA 2AG0A 1ZMOA 1Z6PA 4GWGA 4QL3A 3IIIA 1X19A 4MS1B 1RDFA 3I01A 5FOQA 4AU1A 3OJ0A 4U7TB 5T6MA 1FW6A 2CGEA 1RRVA 1EFVA 4RH3A 4JC8A 2X14A 3L8DA 3WDSA 3DV0B 1AZSC 2ZB3A 2PTHA 4FWBA 3WLRA 5A03A 1KNXA 4KPUB 3OTWA 4CDRA 2RCNA 4GEGA 3W8NA 1OMOA 5HRCA 4AY2A 3IIMA 1NYRA 1X1RA 4MQ5A 3PJEA 1G9SA 2QTMA 1NDHA 3JU3A 1CUEA 4X63A 1QHNA 4DIEA 3T9DA 2GN2A 3LX5A 4XIGS 1CULC 4UDNA 3TL3A 2NO0A 3LXXA 1MF7A 3PCXA 2QTLA 2OBYA 1VPEA 1PNRA 2ZDGA 3DF7A 3EZLA 1NP3A 3N0WA 1O58A 3WKEA 4A5OA 1UOQA 3BHJA 4HZUB 2XOXA 1FW8A 1HOTA 1Z13A 5DEIA 4F85A 1DCKA 1ZAKA 5L51A 4JELA 1P9NA 3H1GA 3P9CA 4WRRA 3E9MA 4Y0AA 4YJ2F 1RYMA 4DRXB 3HV2A 3TLYA 4ATNA 1KEEB 4INPA 4F2PA 4DMRA 3R7NA 5AW7A 4J6EA 1UANA 5TLSA 2Q8QA 2DTEA 2ZVQX 5AWFC 5A9SA 3F46A 2AFVA 1UAYA 3W3AH 1QGUA 2EP5A 2XHZA 4RVHA 2K7ZA 1ZONA 2AF4C 3EDRA 3P4XA 2QN6A 4FGUA 5ITVA 2ZBUA 3M6MD 4XE5A 1R9NA 1G7SA 1U9JA 2V3VA 2J1LA 1SQ0A 4DEVA 2X5NA 4D9KA 4JMLA 4TT3D 2VSYA 4JKYA 1NBAA 3O3NB 3NBQA 5K05A 4OLBA 1R6BX 4CKCA 3WYCA 2F48A 4ZK6A 1BVRA 4TLLB 5ECWA 5HE9A 2DBQA 4DTIA 5FX2A 4P31A 2GBFA 3SJAA 5A71A 1MX9A 1HNXB 4MW2A 4KXYA 1KZYC 3KJEA 3KYDB 6ABPA 4DA9A 4M1YA 2QVZX 3GVIA 1OFUX 2ZIWB 5EA2A 3UW1A 1XAGA 4CV1A 2ZJ3A 4C0AC 3WYGA 4UTPA 1C9KA 1PJAA 1SU6A 4PAOA 3E5MA 3O8RA 2PUFA 1P9OA 4L7QA 4DNXA 4ZGGA 3PA8A 3QVGB 1Q17A 3T0FA 4Z4CA 4N0QA 3GVCA 5BMVB 3ROGA 5BOSB 3NUZA 1WP4A 3UK6A 3V4VB 4ZO6A 1OQAA 3DP9A 4HLNA 5ITZA 3AUUA 4MRPA 2XT0A 1DBVO 5EGNA 3TIIA 5JDCC 4U3JA 3RC7A 3UWMA 1TM1E 3JS5A 4BFCA 5JCPA 2J5XA 4UHBA 5KTSA 1KFBB 1XQXA 1SVKA 3R0IA 5CMLA 2FSUA 3K0KA 5AI5A 3TQFA 4J76A 4PG8A 1OXBB 2CHVA 5CLJA 1C8BA 3NJRA 4ALMA 4LDNA 2I5PO 2RGYA 4J7CA 1NMEA 2OE2A 4FHFA 4BEVA 2CLSA 3K09A 1HA3A 2Q3FA 2HK7A 2E6KA 1RJDA 4BZZA 1FFDA 5KO2A 2AG8A 1M6YA 2AXNA 2WBLC 2XIJA 1F2TB 3ZUPA 3IQIX 5J1TB 3WRVA 2FFJA 3UJ3X 1JHZA 3RVLA 1NVFA 3IGFA 2IHZA 4HFMA 4KAAA 3IKMB 2A9JA 3FJOA 3ILYA 4U8HA 4B6QA 2G80A 1F48A 2VHTA 2O4CA 4QYIA 1AV6A 1DEXA 1E3JA 2WWFA 2ZRIA 5DBGA 5GV8A 4UNRA 4HGQA 2YIMA 1GPJA 1FIUA 4KQGA 1E9CA 3ZHBA 1E96A 1GT6A 5EJMA 2AN5A 1WY5A 2E4XA 1Z7GA 1DT3A 3EBPA 1EA7A 1GPNA 1FP1D 2V7XA 1OI7A 3ZHUA 4M0KA 3MTIA 4FYMA 1NZDA 3H8JA 1IH8A 1SOWA 5KMGB 1Z5NA 1IQ0A 2QD1A 3MWEB 1T2VA 3ONEA 3WRXC 2OMEA 4MVJA 4G0NA 3OEEA 2C7VA 3PR3A 5LMCA 3D3NA 3DWGA 1ZO8A 3CYFA 3EW7A 1FP7A 2WVAA 4UM9B 3PHLA 3AB7A 5JD6A 3QMVA 4D0NA 1QJ4A 3PKJA 4L27A 1F7UA 3GI1A 1SWVA 2OHHA 2XMZA 1MZPA 1L2TA 4HEHA 1RYYA 3ESZA 3PJRA 5EHNA 5A0VA 3KJIA 1K3FA 3VPDA 4ECAA 1WUJS 4G36A 1D1SA 4DDKA 3E7FA 2VPZA 3CVOA 1FJGB 3JR3A 4CCYB 4CU5A 4NV0A 2QU8A 1MG5A 2VEOA 4P83A 3DAHA 4Y6QA 3ZDBA 1KI4A 3ILHA 4BWYA 1SXJD 4OHKA 1RWXA 3HRHA 1BXRB 3MRVA 4Z9BA 5B36A 1Z5UA 1P0MA 1MA3A 3GEHA 3GLQA 4OSPA 5KNCD 1CSEE 1D1QA 1BJTA 4QTTB 4RMJA 1HE8B 3LCMA 4KC0A 5ALQA 1UJMA 3BD8A 4L72A 3HM2A 3OQHA 3DPUA 5ULLA 1QTQA 2NGRA 3CF6R 2B21A 2WWTA 3R3ZA 4FEAA 4O08A 4JP3A 4YJKA 4WXEA 4I50A 3STUA 4KFSA 4CRWB 3NRBA 4PQFA 3NM5A 4WOBA 3EHDA 1QXSA 3JZAA 3TRJA 5CVEA 4WKBA 1ZHOA 3IQGX 3LVBA 3A9RA 2PVSA 3QE2A 2DEUA 4M60A 4TS9A 2J87A 4UNNA 4D42A 5JECA 3PUYA 5FFFA 2FQ1A 3VYTB 1R9JA 3Q9NA 2ZUVA 1KDOA 2ACEA 2DSNA 1PHRA 3TLGB 3VU1A 3X1MA 4AECA 1D7OA 4YCNA 2HRQA 2OVBA 1MABA 4V2UA 2V03A 3FWPA 1WUIS 3VC7A 1NW7A 2C2MA 1MP0A 1VE9A 3WLTA 4U4AA 4RBNA 3WMWA 3T34A 1VA4A 1IXRC 1UDXA 3DHVA 3TTYA 1GSOA 2NPFA 1EFHA 2O7RA 3W8FA 1J90A 3SZMA 4OQNA 4DQ0A 4QXPA 4B34A 4LGVA 1X7WA 4FOSA 1VLLA 4OD0A 5MGNA 3ZU5A 4JMPA 1T2EA 3LV8A 1F6DA 2W6IA 3FVQA 2OHOA 1L5KA 4AROA 1CY6A 2BEVB 2FSFA 3PNQA 2OP1A 5E6SB 2NU6A 1UQRA 1GKUB 1OC4A 2DR0A 3VR5D 2VUIB 5LUAA 1XJ0A 1OLSB 3GGPA 3NJ8A 3CRMA 1XFAA 3FWHA 1YRQA 4G1CA 1WXIA 4KSBA 4RW0A 5HQ3A 4JBWA 3PFBA 4CL8A 1MAHA 4ZP1A 3KSZO 3QBVA 4B76A 3A1TA 2BGKA 2NQ8A 2WTBA 4L5YA 3O8OA 4BO4A 1SCNE 2P2NA 5JQGA 3BWMA 2NZVG 5JVDF 1ECLA 1H8HD 3R7WB 2P2LA 1A50B 1SUPA 2Q0XA 1CV2A 3E35A 3RFVA 4MKFA 1QNFA 3U1VA 3EODA 5SYMA 5JLAA 5CCXA 2R47A 4JJIA 2Q1UA 1SZCA 4QJBA 2QRGA 2C7GA 2HRDA 5CTAA 3I6BA 2BJWA 2QMQA 5HDQA 3I8SA 3VDRA 3I52A 3WZLA 1U8TA 1I94B 1YZKA 1BDMA 4DV6B 5SY6A 2GB4A 1EXNA 3AP2A 1Y9ZA 4R31A 1XHLA 4RJ2A 1BJRE 4JNKA 3F3SA 1X9HA 5C8YA 3EIHA 4GX1A 4B6PA 1DFHA 1E79A 8OHMA 3B9PA 5EHQA 4D82A 1VLHA 6REQB 2RAFA 2B83A 1QGED 3TX6A 3UWPA 2WVHA 4Y6PA 3SHVA 4BP1A 1XTQA 2VHVA 2YN2A 3Q2IA 3T54A 1B14A 2W6QA 4GXNA 4O8ZA 2VUUA 5JJBA 4H7FA 3F5FA 2P4SA 5DWQA 5FXMA 3WWZA 5K3BA 4AD8A 1Y6JA 1Y8CA 5BR8B 3IAAA 4J4TA 5K6TA 2BGIA 5IM4F 2RKOA 4RGBA 4ISBA 1Q21A 2OKCA 4V0SA 4BEJA 2VF5X 3FN4A 1ZI6A 4ZOQI 4BPBA 2O5CA 4TWAA 4W9RA 1Z2AA 3CLKA 4HB4A 1CRQA 5MGBA 3F1KA 1DIAA 2CMDA 1P1JA 2PWZA 1CX9B 5KYVA 2D2XA 3U3JA 3RUEA 2JGNA 4R68A 2A4KA 2ODEA 3Q98A 3GO4A 2FEOA 3JQAD 4JHXA 5L6LB 3PQ5A 1G55A 4EL0A 2ZB2A 3I23A 5DM4A 1MH1A 4ZI2A 4PG7A 4YJ3F 3U2QA 1E9FA 2FW6A 4DA0A 4L7VA 3HRKA 3LUBA 5IVHA 1UBFA 3DMPA 5CLGA 5GJWC 4TLAA 2WNSA 4X54A 2QEQA 4G8BA 3GX1A 1OAOC 1OBHA 2XD4A 4WSOA 4Y1GA 1YZVA 3W9UA 2ZAMA 1H5NA 4X1YB 3ZWAA 1QYRA 2Q1TA 2W2KB 1J2JA 4CU2A 2WG0A 3F90A 1WVMA 3H04A 1H2ZA 3IPAA 3F3KA 2JI6A 2JBHA 3R5XA 2VHYA 4L07A 2D1RA 2XWPA 2PCLA 1N0WA 2GJ8A 1J09A 4M9XA 5B12A 5KYKA 3MGKA 1A9QA 1SKQA 4U2CA 4Q3EA 3WIVA 4OA8A 5KAMA 4OSOA 1Z0JA 1A5SB 3FPFA 3RVPA 1MKYA 2JARA 2WSIA 1D8TA 1W2WB 3PPXA 3LQ4A 1T0HB 4IVPA 2IJGX 5FL3A 1XAJA 4EPVA 1NW3A 2MDTA 2O0HA 2YBEA 2C57A 1YB6A 2G4CA 5D3MB 3SBXA 4MV0A 4OU5A 4BRWA 5JJKA 4LRWA 3EGXA 1VJ0A 1JJIA 3BTOA 2XX3A 5REQA 5BW6B 5AUNB 4MKZA 1Z37A 4X7PA 4ZPJA 5K03A 3AESB 3F4KA 4BGUA 3U7HB 1TPYA 5EERA 2PUDA 1E1LA 1PYOA 2O1SA 2ZVJA 1LDNA 4ZOCA 1KQFA 1VSQA 5J2TA 3K6JA 5AVJA 2VJOA 3KTAB 3U4GA 1VL2A 3V55A 2I80A 2HKIA 4EHDA 3UG7A 2IUYA 1FRZA 1Y3DE 1YK0A 2X22A 4DT1A 4EGFA 4NIMA 1SHLA 2XNDD 2PX0A 2GLTA 3TQTA 1NIJA 5IX8A 3CJQA 3TINA 1TFRA 1IM8A 2RHBA 2VK4A 2YJ5A 4JB0A 4B4OA 5BURA 4BNMA 3M9WA 4P1ZA 2PZLA 3NHWA 1AD2A 1CUSA 1MENA 2NVOA 2PZKA 1Y6ZA 2VQSA 3BXEA 4HRVA 4EP1A 1W34A 2C95A 4JLDA 5AQ1A 2BN4A 3OUZA 1IMJA 3OC0A 5K4GA 3ESCA 2R5WA 3E7WA 4NKRA 4E51A 4IINA 3C7KA 1CG6A 1HE4A 3K72B 3LDAA 3QWBA 3H0KA 4L0MA 1TVCA 1JZTA 3REQA 2PWPA 2H2FA 3M4NA 3C6KA 2J31A 4KJZA 1XRPA 2FWRA 5JWRA 1M8GA 4WKCA 1W4RA 1QSGA 3BCUA 5EZYF 1QOQB 3C3YA 1LY1A 5JSHA 3T15A 4A6EA 5L3SA 2X0KA 3HL0A 5IAEA 3QLUC 3P0FA 5JZSA 4NENB 4QDXA 4TTTS 3A36A 3ZJ4A 2CLLB 4MKXA 3W5DA 1ZIDA 4MW4A 2V6BA 4PQRA 5DDIP 1FYEA 4UCWA 5K3CA 1VXRA 4H17A 3EARA 1IJKA 3H4TA 3OZXA 1VTKA 3LP6A 2AC4A 3WLHA 1JQDA 4HMPA 4RS3A 1QGYA 4ZZ0A 2HWKA 1NG9A 2VI5A 1N1MA 3AR4A 4ZDJA 1X2EA 1ZUHA 4P80A 1FPMA 4HJRA 1KZHA 1ULZA 2GPAA 1YGYA 3SBEA 4BE9A 3IRUA 1TFUA 3BMXA 1QVRA 4Q3OA 3VO8A 1MC1A 1V3QE 4O4JB 3BB1A 1DDOA 2VRCA 1M34A 3UK0A 2O1WA 5JFGA 2OZVA 4Y9DA 2BFMA 1ZMTA 1B1AA 1A71A 3OF5A 2RHTA 4YRRA 1CD5A 4H7IA 4M98A 4JUFA 3CBQA 4ZC1A 4LF6B 3I2GA 3QVTA 4IH4A 1GLVA 2I4LA 3GLHE 3ZE6A 3O92A 5ELXA 5TQ0B 1B93A 4DY4A 2FWNA 3RTDA 2OUIA 3O21A 5ALMA 4QKQA 1YQTA 1NMSA 3LSTA 1UBOS 1VOTA 4DR3B 4G9EA 2QHXA 1V3VA 2V7BA 4ALLA 1J9EA 3C7TA