1RZFL

Crystal structure of human anti-hiv-1 gp120-reactive antibody e51
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QSILTQPPSVSAAPGQKVTISCSGSSSNIGNNDVSWYQQFPGTVPKLVIYENNERPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGSKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab E51 light chain
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzfL01
2VLKB 4POZC 3ZDYE 2ESVE 1BWMA 2HG5B 4JJ5B 5E9DA 3UEZA 5MI0B 2VDKL 2LAGB 4L9LB 5T5NG 3LB6D 2QV2A 4EQ3A 4PJ9A 3OMZA 3PP4H 3VRLF 2X1PA 3O11B 3SPVA 1FFPB 1C16A 5EOCH 2XQBH 3CDCA 1F2QA 1KFAH 3AREC 5ESVA 1HYSD 4OD3H 3D85A 3DLQR 5FCUL 5LGJA 3IFOA 4N0RA 4KK8D 3WFBH 1JZ4A 5CFHA 3QA3A 4MQXD 2HMIC 4A6YH 5C08A 4F3FB 1UXSB 4KJPC 4MAUH 2R2HB 2VQ1A 4HS8H 4N68A 2HJLA 4ZFOL 4OD1L 3P4OB 3GM0A 2CMRL 2H32B 5HHNA 3NFNA 3JUZA 3W9DB 4D0DB 3L6FB 1IM9B 4ENEC 1KB5L 1IQWH 3HMXL 5E5MB 4JFDA 5F6HJ 3QG7H 3BH8A 1IEHA 5T3XH 1G7JB 4J6RL 1H3PL 4JRXE 5LGHL 1U8NA 4MD0B 4ZS6D 1I9EA 1S78D 4S11A 3CLFL 4V1DD 1VFBB 3IDIA 1U2CA 3ZZ1A 1J1PL 4U31A 4IEFB 4M1GL 3ULVL 1JTPA 2FIKB 3HUJE 1QLRA 3HLAB 1BAFL 4UQ2A 2Z31D 4QTHB 5DQDL 4FABL 1BD2A 3QFDA 3F8UB 5F21B 3GNMH 5E08L 5EPMA 1DQJB 1E4XI 1QLEH 3C5ZD 3RNKB 5JO5B 2O5YL 5I71B 4JRXB 4I0PB 3B2VL 1U8OB 5TH2B 3HNSH 2XFXB 5I73B 1GAFL 4LQFL 2CDGB 5CHNA 4QY8B 5ITFA 3WHE1 4AYFA 2G5BB 2YSSA 3QIBD 5H37H 1O7VA 4UAOB 5GPRA 1RIUL 1VB9A 4NQVA 2WAHA 5F7YC 5CSZA 1FZKA 4HF5L 2RQ8A 4PBWD 3FRUB 2P47B 3P73B 1J0KA 4YHPA 4GBXC 3VG0L 3R4DA 4MA7H 3EOYG 1HDMB 3MGTA 5EBLB 4G42B 4Y5YB 1MRDH 2BZDA 3BT2L 3WXWL 5F8RC 4L3CA 2PTVA 2EIZA 3IRPX 4UINL 3GSWB 5GRUL 1A7OL 1FLRL 3DSFH 1DTUA 1D5MA 2Z8WC 1BF8A 3BEVA 3JBG7 4Z7VA 3RI5F 1FV1B 1U42A 5EC1B 5D1ZC 4MA1B 3MLWH 3QRGL 3MJ8B 1NCCH 1NUDA 1RUQH 3JV4B 1BFVH 3SKJH 3C6LA 3FO1A 5KS9E 1CFQB 3KPSD 3HI6L 1VFOA 3OF6D 3D2UA 4YDIH 5E8OB 2AQ2A 4N8CH 1EBPA 1MEXL 3WNNA 3GO1H 3VXUD 5DRXA 4U0RC 1OM3H 1MPAL 3H9HA 4XP9L 1OVZA 8FABA 3BKYH 3TT3L 4ZNEA 4K2UL 4WDIA 2IH3A 4XCEA 2EYTB 3QIUA 3EYFA 4PJXF 3WSQH 5DJAA 2N1KA 4JM2F 5C0AA 1IGYB 3M07A 1MHHB 5F72S 1NANH 3U7WH 1TVDA 4DGVH 1I7UB 5CBEA 1MFAL 3G6DH 4K23L 2UWEB 3MRQB 3MZGB 4HBQA 3TJHD 1O5DT 5TGBB 4ZTPL 4DKFL 4Q9BA 3S6CA 1T1ZB 1G0DA 3BQUB 4KRNA 4AT6B 4LCIL 1RURH 4HXBH 1NGWA 1K8DB 1QBMH 5EOQL 1INDH 3UYRH 2DQHL 2FATL 5E6YA 2BJMH 1T0NA 4WI7A 4LLAA 1KSRA 1BVKB 3MREA 3Q5OA 5LBSL 5IW3A 4OGYH 1S7UB 2BX5A 3HA0A 5CP7A 2FX7L 2R69H 3TH2T 3QH3A 5DMGD 1T2XA 4Y2DA 5CEZH 2X4OA 1MCPH 4KKBC 4RGNC 1YUHB 3RDTC 4BQ9A 2F5AL 3GSVA 4XPGH 3HCVA 1VADB 2Y6SD 3U48A 5CZXC 3D39B 2OS7A 3T1FA 2LVEA 2ZP0T 4MMZC 5GS0C 4K8RC 1G7QB 2JE8A 3LMJL 1TENA 2R56L 5HI4C 3PABB 1C5BL 1J8HD 5ANMB 1CLZH 3L7EB 5D96C 4LGRB 4CW1B 2VABB 1IAOA 4IMKC 4P46B 5GIRB 4LSUH 5GS2D 4AIXA 5DLML 5K9JL 2RB8A 2AXHA 3QUXC 3IDMA 4YBQD 4HIJB 1R5WA 4PG9A 1FE8H 3TCLB 2C3VA 1EAJA 4H20L 2IJ0C 4P5MB 4KHTH 1RZKH 2PTTB 2APBA 4YXHH 2E7CA 2Y7QA 4WGVB 3TBYB 4PGCA 1XCQB 2MHAB 3FMGL 3C8KA 2WBWB 1HSBB 4HAGA 4LLDA 3ZHLA 1BBDH 1S9WB 4K7FA 3VXNA 2V2WB 4LVHB 4R7DA 4QXTB 3D87B 1G6RL 1PG7L 5HHQB 5FGCB 4OI7A 4LLUB 3O0RL 1RK1A 5LWYH 1ZMYA 1E4WH 3DMMA 1MAML 1ADQL 1U58B 2FHCA 5KANI 4MAYD 1QLFA 4GUPB 1NSNL 5AYUL 5HJ3B 3F58H 1CICD 1Q0YH 4TVPE 5JA8B 3TO2B 1LP9E 1KJ3H 4EEEA 1XT5A 2VZ3A 4OT1L 4CNIA 2RIKA 4PJXA 3RWGA 3FKUS 2PW1B 3GBLA 1PG7X 1JRHL 2IMNA 5HYJD 5TDNA 3V4VL 4JM2A 5I1AB 5FM5O 2ADIB 5DYOB 1SEQH 3PXJA 3I6GA 4NHUA 1LP9B 3O6FC 3HE6A 1W0YT 4M43L 4MCYA 4NO0B 4HPYL 2QJDA 15C8H 2YOCA 3V7AE 4PJ5A 3FT2B 2XY1A 5JORB 3O6ML 1AC0A 3UYOD 2A9NL 5D7IF 4LU5H 1LILA 2F5BH 3TBVB 1LD9B 4ONHB 3CH8A 3VH8A 5JXEA 4P59H 1J0IA 3DX9A 3LEXB 5IQ7L 3QDAA 4P2RA 4WV1C 3BPLC 4HWZB 4PV8A 5IB2A 5IQ9A 3MRGB 4OFVA 2YPVL 5E8DH 4Z7UE 3V6ZB 4LCCB 1QA9A 5KVEH 5D7SH 1CBVH 5AZEL 4G5ZL 4NKMB 4N9GA 1KCRL 3RVXD 4FQIH 4DKEL 1MCBA 5MP6H 3S36L 1KELH 5F1SA 3HG1D 1CE6A 3QUMA 1U3HA 5B3JF 1WSST 3I50L 4LSTL 1MI5D 3NCEB 1F13A 3WNMA 2HT2C 4HG4K 5EO1B 3T2QA 3HE7A 1M7DB 1RJLA 1BQHB 3GB7B 3K0WA 1FCCA 5BVPH 1IEBA 4HUUB 3TLRA 4LPXA 2KPNA 2I9LA 4X5WA 5E6IB 5CGMA 3C09C 4GQ9H 3S36X 1GH7A 4DEPB 3K8LA 4F7MB 1T83C 1GGUA 1TQBC 5KVMC 1F5WA 3IXAB 3C87A 1YPZB 3QXDB 4MWFB 3KLSA 3V0WH 2DQJH 1UKSA 5KG9A 4XTRD 4WFFE 4Q9QL 1E4XL 1U8MB 5DRWB 1ZT7B 3TEUA 1IVLA 4OLZL 4UMGA 1HILB 1ZLSH 3MGOB 2FWOA 4QXUL 1NCNA 4F2MB 1AGCB 4Q2ZB 5FOBA 4N1EA 2H9GA 4QHLB 5D7LD 5F1NA 4CN6A 1BJ8A 1XR9B 1LO2L 4RQQB 3GSNA 1ZWIB 2BSRA 4K71B 2H3NA 1MHEA 1EJ6A 4OB5H 1R24B 4CJ1A 4OLXH 1JNLH 4FFWD 4B7IA 1S7VA 1CT8A 1OTSC 5IMLA 1EEUA 4PJEA 3WE6B 3C5ZA 4MJ6B 4YDKL 3SJVA 4DOHE 3VFVB 3V5KA 3HKFA 5A16A 1AGDA 2XYCA 2ED8A 3UBXG 5JXAL 2WWKO 1I8MA 2W91A 3V6OC 5HYIA 1E4JA 4WY7L 1IGIL 1L9MA 5D7IA 3NIGF 3QIBA 2EDOA 1EJOH 1WUNT 3DV6B 5HVHC 4JDZB 1MQKH 1HKFA 4LP4A 1R0AL 5ALBH 4TSBL 5I2IB 4QEGA 3ZDZE 3HAEG 4OCRL 5HHOA 2BMKA 1YJDC 1JFQH 3INUH 1OP3H 2GJ6E 3MA7A 2PR4L 2DQTH 2NX5E 4X9HA 4CVWA 2PNDA 2AABL 5SX5K 1WBXB 4IJ3B 3EJZC 2VKWA 3CVHB 1PBYA 2J5LB 5DRNA 4HWEL 3QO0A 1BBJA 1N5YH 4ZUVA 2BNQB 2BOBB 1NFDB 2NY0B 2GJ6B 1CL7L 5A3IC 4I2XA 4HS3A 1EEQA 2D0HA 3LD8B 3PXHA 1W8NA 3KPSA 4D9RE 4RGOL 1CVSC 3SOBH 5T1KD 1XFPA 5I66A 3OF6A 2P8MB 4UIMB 4PGBB 1ZLUK 1PJ9A 3PDOA 3VXUA 3WNLA 3CH1B 2ZUTA 3PWVB 2YD6A 3NCBB 1ETZA 2DS4A 4ODSH 2G9HB 5T5NF 4GS7C 4JQIL 4KZEH 3IS0X 4WW1B 5T3XE 1AIFB 2VLJB 2BC4A 5I19L 3M8OL 4YWGH 3RIAK 1A14H 1SJEA 5DVNA 3SBWA 3BUYA 2GIYA 3X12B 5GGUA 3VGEA 2VL5A 1MFEL 2ZKHL 1L6ZA 3T4YB 4GMSL 3ZT5A 5DO2C 5J57B 3BX7C 3CSYA 3MSPA 1RJZB 1F4HA 4OF0A 4G8GD 2R29L 1ED3B 4P2QD 5GGTA 5IOPA 4LHUB 1R5VB 4PGZA 1IFHH 1N26A 4D0BB 43C9B 4U6XB 2N56A 2JB5L 4AQOA 4QXGL 3KVQA 3B6SA 2I27N 5FO7A 4N0YH 5I8KL 4HBCH 2ZSWA 3CZFA 2QL1A 2NY6C 2ZUVA 3TO4C 1P2CB 1R3IL 1RI8A 4HZAA 1NDGB 2VJXA 2EDFA 1MHCA 5LAXB 2DQFA 1OTTD 1MH5B 4NWUH 2F19H 3BZEB 3DTXA 4Z6AT 4PRHA 3VXTA 4B41A 1UCBL 2DQEH 1UWEH 1DLFL 3OB0H 4YQXH 3MO1A 3OR6B 1RULL 1QBLL 3O2VH 3PJSB 4JQXC 1J8HA 2DTML 4HJ0D 3NIFE 1OAXL 3WFBL 4PJFF 2B39A 2CGRH 1PSKH 2EYSB 4PRPD 4N5UA 4X6DE 5D7JD 3F12A 5C07B 3DOSA 4I0CC 4Z77A 4PJIE 3MBEA 2R0KL 4PP2B 4LLQB 5CINH 3QDJB 1RHHA 1OP5H 4HUWA 2IG2H 2XTJB 4GXUM 4PJAF 3HI5H 3PWPD 3OKEB 4QXWA 1A6ZB 4JFPA 2ZSVB 3CFJB 3GDBA 3GMPA 2PXYD 3P77A 2RGSA 3ULSA 2HKHH 1WIUA 2UYLB 4KRLB 4M6NL 4PJIB 3DUSA 1CGYA 2FGZA 4QRUB 4CVUA 2R4RL 3STBA 3O4LE 1ZGLA 2BCKB 5T33H 3HNSL 1PKQE 3S88L 1FDLL 1OWWA 2DYPD 2FD6H 5FYLH 3D5OF 2ATKA 4G8IB 4ISVA 1P7QD 4P48A 4QWWC 4EN3B 5J89A 2GCYB 2MPAH 1EHLH 1MCHA 4ODWB 1C08B 1F11B 3RJQB 4KK9C 3IF1A 2VXVL 2IAMD 1F3JA 1ZSDB 1T0MA 3OAUH 4JO4L 3OB0K 3VFPA 4ZXBD 4X0KA 3E0GA 3O4LB 1NKRA 1PKQB 4FMFA 3BXNA 2Q6WA 3TESA 5LXGH 1LWRA 4JDTH 5CAYB 2GSGA 3C6LC 3O2WL 3PWUB 9CGTA 3NBNA 1VFAB 2DMKA 2ADFL 1I1AA 5EC2B 5CEZE 4U6VH 3ZTJG 4NRYA 2MQCA 1CS6A 5J6GB 1QVOA 4X98B 4DCQB 1AGBA 3HZKB 3MLWL 4QHUA 4GW5A 1QBBA 2R4SH 2WBJC 2IALB 1L0YA 1SYSB 1OAKH 4XNZB 1NMBL 1OP5K 3W2DH 5J3HD 3DETC 3QDGD 4CVXA 1JWMA 5HPOA 3QRFM 2ICEB 1DQML 1GGYA 2EC9U 2XOTA 4RIRA 3PGFH 2FJFB 4O9HL 3NZHH 2W9DL 1H5BA 1LO5B 2HFGH 1BZQK 5EORL 3IETB 2D03L 1V05A 4KKNA 2FB4L 4DQOL 1JGLH 1NLBL 2X4UA 4R4BA 3HG1A 1GOFA 1MI5A 1K3IA 2PO6B 1BOGB 1H0DB 1IE5A 2CH8A 1V3LA 1XR8B 2ITCB 3T3PF 4PJFA 1IRAY 1QEWB 1UC6A 2XY2A 3G6DL 5IJVA 4H1LA 5JW3H 1KN2L 4OLYH 1FL5A 5GS0H 2NTFB 1FORL 4K8RH 1D5IL 1A1MA 2BVOB 4Z7QE 4XGZA 3SN6N 1ULVA 1UB6A 2CLVB 2NXZB 4XVTH 5AAWA 5FO8B 1UM4L 3SDAA 2OTWA 4PJAA 2VDLH 2VDQH 4MLIA 4HSQA 3O3AA 4HXBL 1NKOA 4P2OB 4P57B 3UYRL 4G6KH 4RZCA 4ZFFB 4P9MH 2ZOKA 2WANA 4DGIH 3GI9H 2ZWLT 2IPKA 2F54B 4LEXH 3RTQA 3RVVD 1KTDB 4AQ1B 3MNVB 2BFVL 2W38A 5L2KA 5HI5C 4GW4B 1HH6A 4KY1L 3H9SE 4J3UA 1M71B 2NLJB 3EYOA 4X7TA 3GI8L 2D3VA 3RGVB 3PV6A 1DLHA 5FYKU 5E8EB 1D6VH 1I9RL 2XG5A 1T21A 4XNMB 4P23D 1F8TL 1R3JA 1A1NB 3NTCL 1F97A 5H35A 3HC4L 5CMAB 4H26B 3SDXF 2XT1B 4TULL 3OQ3B 4PGDA 4BQCA 5I76B 1IM9D 1MJUL 4Z8FL 5IVXB 2QSVA 1WISA 5HGBB 2KUTA 3FT4B 2CD0A 3KJ4C 1DJSA 2KDGA 2GT9B 2FYYA 1U8QA 2H2PC 1N59B 3O3BB 3CSGA 4C4KT 5E1AB 5I16B 2YHGA 3DMMC 2X10A 2CLZB 5IW1B 2CR3A 3KXFB 4NZRH 4UTAH 1BBDL 4AENB 1UACL 1C1EH 2H26A 2ZCKL 4JRXD 4I0PD 2AQ1A 5I1LB 3QULA 1A7RL 2PUQT 2UVEA 3LKSB 3PUCA 5HGDA 5CEYB 1EFQA 1UXWB 5GXBB 1LHZA 3TN0B 3IYLW 4LKCA 1BQHG 2Y5TA 4J1UA 3A6OA 2MCG1 4JM2C 1KEGH 3L5XH 1KYOK 3U9UB 1RZGB 5J1TC 3LQMA 3VFRA 3WO3B 4M8QB 1NGZA 1VACB 4IIQC 1YY8B 4AEHL 1KPUA 3V5HA 3DX6B 2DBLL 2DQUL 4MXVF 2BVPA 3M17A 1ZHBA 4RWHA 1DQDL 4JZJA 3PWLA 1SJHA 1KLGA 1FGVH 2J4WH 3SE4C 1MUJA 1F6AB 4BZ1L 4HS6A 3BKJL 4KVCL 1KJ2A 4DJMA 5HPMB 5B4MC 2P45B 5T1KA 4HJJH 3UJTH 2Q76B 3D0LB 4LRIC 1FH5L 2UVFA 1BWWA 1P7KB 4PJHE 4K3DL 1A6AB 2XNAA 3ZSTA 4Y5XB 2R1YB 5F88A 2VB5A 1E28A 4LU5L 5BRZE 4KJYA 4Q9RH 1JV5A 3T3MF 1J87A 4IRZH 5HVGB 5HD8C 5IGXL 1TJGL 3GHEL 4Z7NE 2P7TB 3E6FA 3VXOB 4WU7A 1D5ZA 4IDLA 3G6JE 4DK6A 5GRYA 5E8DL 4PJHB 3SKOA 3EYVB 5CKGA 2MFNA 5C0CB 3QCTH 1VEOA 2BSTA 3FB5B 1QQDB 1OB1B 4JGJA 5JHLL 2F58H 5KVEL 2YZ8A 3LS5H 1I9JH 4G8GA 4P2QA 1KIQA 4MSWB 4MDJA 3HR5A 2OP4L 2APVA 5MP6L 5FM8A 3SDXA 5ISZE 3LB6C 1YECL 5AWNH 1WZ1L 5JOPD 2BY0A 12E8L 1ZA6A 1FL6A 1B4JL 1TZHA 5EZOL 5FYKD 2FR4A 2B0SH 1TETH 4KUCD 2ARJA 2CJUH 2IBBA 3GSXB 4EOWH 1HYSC 5TJWK 4U1KA 3RPIA 3U82B 1XGTB 4KK8C 5E6ZA 1DBJH 4MQXC 2WUCH 4JHZA 3RX8A 3RU8L 2KH2B 1LEIA 4NZDA 3OKLB 1CK0H 4MJ4A 2B2XL 4ZOAA 3BGMB 3IFPA 1R3LA 5IESL 2CQVA 2V2TA 3O41A 2ZCHL 4RFOH 1S78C 4HC1L 3CFIC 2GTWB 5I30H 4GMTH 1DEEB 1FVCA 1WWBX 2J6EH 4UT7L 4XT1C 5HHPA 5D7JA 3P0VH 3T1WA 3O2DL 2GAZB 2Z31C 3VFSB 3A67H 1QBAA 1JHLH 1I4FA 4MJ5B 3U0TA 1INQB 4DW2L 4P46D 3S8WA 2H2SD 3P9WB 2P8LB 5C0FB 5KSBE 1ZS8B 3EYSL 3WLWD 4I9WE 2QEJA 1YEIH 3PWPA 3SE8L 5C6WH 4PRBA 3LEYL 2BNUB 2AJSL 4IM8A 5DD1H 5ALCL 4M6ML 3DHJA 2PXYA 4R26H 1YJDH 1AO7B 5DR5H 1XGYH 1CFSB 2H6PA 2NNAB 1FSKC 4PYHA 4D0CB 3IFLL 1IZJA 2MKLC 3KLAA 3ZDYF 5KSBB 5DJ0A 5A2IH 2FECI 4X6EB 4OGAC 1MLBA 4LF3A 1XF3B 4GFTB 1I8LC 3RZCD 4AIZB 3RIFK 3ET9F 2VDNH 3K1KC 4NT6B 2DYPA 5DJ6B 3VI3E 3ARWA 3T0EB 3MRHB 2AJZB 1MVFA 4P4RA 4N90E 4ZFOB 3D0VA 5CJOH 4W6XB 2Y36H 4XPTL 3MLVL 3QFJE 2IAMA 1GCFA 1ES0B 4XCNB 4OF3A 1OGAA 1FP5A 4OUUB 1MCOL 4ZXBA 1KB5B 3EUUA 4Y4KB 5AEAA 5D1QC 5E2UH 5T3ZL 3TVMD 5L7XL 3U30B 4F7PB 4C58B 1I8IA 3U4EA 1RZIB 3N1GC 1KCKA 2NW3B 4OZGE 4JG1H 4U1HB 1OCWL 1U91B 3BP5A 3C60B 4TVPD 2DLGA 3TC9A 3VGBA 1AQKH 3TBSB 1I1YB 4WO4B 3SO3C 1CZ8L 4NO0D 5CBAB 3S37L 3I6LE 1F58H 3FQWA 4BZYA 3VXSA 1D5XB 1WFNA 1G1YA 4O2EA 3HUJF 3LN5B 5EUOB 2C1OB 4NQUA 2VH5L 3R1GH 2ADGA 3ZKMD 3UTPE 3MYJA 1AFVH 3QDGA 1WT5C 3ARZA 3LQAC 2A1WL 2O61B 5CEXA 4HH9B 1IT9L 1KUMA 3TWCL 4RAVA 3FRPG 2J8OA 4PJBE 3QEUB 1BX2B 3GBNH 2MJWA 1CGWA 4U1SA 4RMQA 5E00B 3BW9B 5FECB 4NCC1 1NEZA 3C9NA 3GIZL 4FQCH 4H25A 4U6HA 3N9GH 1Z9LA 4LKXA 3S37X 4X4YB 4JFQB 2AJYH 4NWTL 1HQ4B 1MFBH 1HE7A 1NBVH 4CMHC 4Z95L 5DJYB 3UAJD 4N0UE 3PHQA 2V5TA 4LPWA 5JOFA 1BZ9A 2O5ZH 2OL3H 2KQMA 4KQ3H 4F9LA 1L0XA 1QFUL 1KLUB 4GRWH 2WMPA 3HAEA 5DMGC 3I75B 1J18A 5K9KB 4NUGL 2AV7B 4PTTB 4OKVA 3VWJB 5T5FH 2CXGA 4JJ5A 4DVBB 4I4WB 3I9GH 1YMME 2DF3A 3RPKA 4GBXB 4NDMA 5BQ7B 4JRYE 5FYLE 4YNYB 4L8CA 5HBBA 3LEVH 5C0DB 3OKNA 4EXPX 4HBCL 5CIPA 3O11A 4AM0A 3QPXL 2GFBB 5CCKL 4FTVE 5C0GB 1FFPA 5DZNA 1P6AB 5ACZA 3SDDB 4HGKC 3MRKB 5KS9F 5IMKB 3RWIA 1OSPL 2ESVA 1OW0C 5JQ6H 2F19L 2YPLE 1YMMB 4P23A 3V6BR 2C3XA 3EFDH 1JUFB 5I74B 3LY6A 4J3WA 2X2YA 3DI3B 3L6FA 1IM9A 3O2VL 4FTVB 1X5IA 1J0HA 1AD0B 5FGRA 5INCB 2Z35B 1KCLA 2DJSA 4KUCF 4NSKB 1ZKAA 1NL0H 4NQSA 4U0RB 4YHIA 4TNWF 3QYCA 1J0JA 1TZIA 4WUKL 1MWAH 4JPWH 4PLJD 2GTZA 4DZ8A 1RFDL 4Q6IC 3LN9A 1MVUB 4MAYC 1T2QL 4LLYB 3RNKA 3O8XA 1SMAA 3KYNB 2QKIB 3BKML 5HDQH 1BJ1J 1CICC 4JRXA 4I0PA 2DDQL 5TH2A 1A7PH 2XFXA 4QF1A 4JVWA 1N8ZB 3E2HB 3WXVH 1S9VB 2XZAH 3HUJA 3EGSB 2ERJC 4X6FB 4M00A 4NM4H 4RMUA 3SO5A 4DTGL 4OZIB 1EHXA 3D18A 1VKXB 4PLKD 3BOVA 5GQBA 4X5LA 4RGNE 3VGDA 3HFML 4MHHG 4PJCE 3P73A 4NQXB 3ELAT 3SDCB 2FD6L 3VGGA 4YFEA 43CAB 2D9CA 1S7RA 1PX4A 2AJUH 1HDMA 4TVSa 4JFEB 4G42A 4LSSL 3ILPB 4D9LH 4YEFA 3MUZ1 2DQDH 2GK2A 3M1BB 3GSWA 4P99A 3LKRA 3BZFB 1HH9B 1KV3A 2KZ1B 3OJ2C 1S7TA 4UILL 3SE9L 4UTBH 7FABL 2BNQD 5BXFB 3C5JB 3JV4A 2GJ6D 4OAWB 4NNXB 4NNPH 1A6VH 2NX5D 3DURA 3WFDL 4KHXL 1JF1B 1KTRL 2V9RA 4N8PA 4NJ9L 4TNVF 5E8OA 3RVXC 1RIVL 4OM1L 4P4KB 2HKFH 4NHCH 3RVTD 4O2FA 3QI9A 3VFOB 3QWRD 5DHVH 5C0EB 4XPFL 4LVNB 4BSJA 4MQSB 1WGOA 1KIUA 5INDB 1WTGT 2QHRH 5KS9A 1EO8H 3NCJL 1G9MC 4D9RD 4K9EC 3PGFL 4YAQB 4I3GA 1A4JB 2EZ0D 1IGYA 3M45A 5LKNA 5GJTL 4JR9H 3FB7A 4W68A 4HCRA 1LP9F 5CWSA 2JJWA 5BJTA 3FJTA 2DD8H 3FQNA 1EFXB 2D31B 1FFRA 3CFBB 5ADOL 1G7LA 1YEEH 1ZGLP 2HH0L 3NFPB 2VXTH 2YD8A 3ABZA 2CDEB 3GSUA 4ODVH 1FBIH 4M02A 2B4CH 4F7TB 1JTTA 1K8DA 2VDPL 2VLRE 4EDWL 1B0RA 1YNKH 5JW3L 3X11B 4U1NA 4XTRC 2IANA 4LK4A 5D1XB 4GAGL 1BVKA 5EIIA 1AXTL 1Z5LA 5F3BB 1T0PB 2J8UE 1KN4L 1V7ML 3HC3L 2C7UB 3IDXH 2ICCA 3O6LH 1H3XA 1IM3B 5DUPH 2RBLA 4UDUB 5JZ7D 3L7FB 3ROOB 4FQ2L 5ESQB 1YUHA 1KXQE 1IBGL 5C0IB 4JPVH 4S0TD 4LCYA 5EBMA 4HIHB 4Y88A 5DVLA 3VXME 5D5ME 1G7QA 4M7JH 1TTUA 2X70B 2ZUXA 5EU3A 3BWAB 3N1MC 2J8UB 2FECL 4HUVB 5HGGS 1RQ5A 4W70A 4Z7UF 4FFWC 2P46B 3NCYP 4QYOB 3TM6A 1XF5A 1XGQA 1MIML 1IGCL 3H3KA 4XBPB 3MRFA 4QGTA 3P3YA 4OM0L 4AH2B 1JIBA 4FP8L 3ZYZA 4ZD3L 4HJGA 5J56B 2F74A 1BGXL 3P30L 4MQ7B 3FHAA 3UXFA 1MCJA 1C7SA 2IMMA 1MREL 3D1MC 4X4ME 4HT1H 1F6LL 4B5EA 4F7EA 4YHMH 3WFEL 2H45A 3HNTH 5IB3B 2XTJD 1KEML 3KPLB 3MBXL 1ZLWK 4DWHA 2CKBL 4QXTA 5C0ND 4LEOA 4S2SA 1YEGL 4LLUA 3LKQB 4HWBL 2HVKA 3T0BA 2EIEA 4Q0XH 1J12A 4M1DL 1J0ZA 1RU9L 1JPSL 1JZ3A 3RZCA 1Y6MR 2JCCE 2YC1B 4WFHD 3ZKND 5I75C 4NZRL 1U58A 3BH9B 3VWKA 4P5TB 1LQSR 2ORBL 1R6VA 4ERSL 4JO1L 1MCNA 2VZSA 3QDHA 4WCYL 4CADA 2YBRB 4HZLB 2AEPL 1W0VA 3ZKQD 4Z78B 4RISH 4MJIB 5JHDB 4HPOL 1BM3H 4EN3D 1M6OA 3TVMA 1CDJA 5DUML 1Q9KB 1KEGL 2PW1A 4WW2A 3QQ4B 1N5AB 2DJUA 5GGSY 5GJSH 3U1SL 1PAMA 5TF1H 5KJRH 3QUZB 4P49A 1BVLA 3O4LD 4HHAA 5HYSB 1OAQL 2FL5A 3TNMA 3MV01 1U92B 3GGWB 1LP9A 1W72A 4QRPE 4NQEE 1QOKA 2GW5A 3I2CH 1B0GB 3B3IB 1JGVL 5CD5D 1BQSA 2H1PL 4Y16A 1NAMH 3QG6A 2VERN 2ZUWA 3D3VB 4C56B 3K2MC 2QQNL 4V2CB 5DMJB 5ETUA 2B5IC 5IFAL 2YR3A 2V5SA 2AXFB 1XZ0B 5EWIH 2VISA 4NGHH 4HWZA 1FC1A 1T89A 4NQEB 2OI9B 5E99L 5IFHL 3IDGB 4NOBA 3V6OE 3V6ZA 1FHGA 5CEZD 1NBZA 1FJ1B 3UJJH 1EAPA 3TH4T 4N8VB 4IMLA 1FFNA 5BVJB 3NFSH 1F4YL 4XX1E 1BZ7A 5TPWL 4APQB 3VI4E 2AW2A 2V2XA 5KVFH 3ZDZF 4YLQT 3DV4B 4NKIL 4Z7UA 4LHQB 1PY9A 5KN5B 1V8HA 4ZFZB 2PO6D 2AQ3A 1J5OL 4LFHG 2HFEB 1VPOH 1BQHA 3WIHA 5I9QC 4L8DB 5AG9A 1X4ZA 4M6AA 5C86A 5I8CA 4UV4L 1WQVT 4K7PL 1Q8MA 3VGAC 4YJZL 1OPGL 4YGVB 3T2NH 1OLLA 4CVZA 1ZANL 1CDBA 5KZCB 1OQXA 4P3DA 1NAKH 1V7NL 4NN6B 3P2TA 1J05B 4XCCL 4TN9A 3RGHA 5ICXB 4GAJL 4P2OD 4QTIL 4R96B 1FZMA 1GVIA 3BHBB 1SY6H 4HJ0C 1KTLB 4OZFH 1KC5H 5FCSH 1WBZB 1ZHNB 4CUCA 4HEME 4X80H 3T77A 2IBZY 5C2BH 1YEFL 3LKOB 1UKTA 5EOCJ 4ZFGH 2P8PB 3K4ZA 1XH3B 5IWLC 4ZPVB 1JP5A 4HK3J 3RGVD 2FJHB 3UCRA 4WWKB 3C5SB 2X4SB 2VAAB 4MCZA 5I0DA 1IILE 2WW8A 1H15A 4QHLA 4RFOL 3HS0B 3W81A 3MRMA 3O9WC 4PPTA 4OUOA 1OAZH 4HK0A 5DMKA 3TZVB 3EOAB 4JN2B 3K1DA 3QUKA 2X4TA 3A67L 2VXSH 1Z2KA 5DS8A 1OGTB 1KPRB 3CDFA 2R0LH 3EYUH 4GS7B 4JY5L 4KRPB 2EH7L 3EDDA 2Y9RT 3JVGA 1G7MA 3WE6A 4MJ6A 4KTYA 3MRLA 4P3WA 1D9KD 4PREB 4UQ3A 4Q97A 3WS6A 4LNRB 5AZ2H 2R23A 4R26L 4P5KB 2BVUA 1RJYA 3KXFD 5K33A 5GGRB 1X7QA 4BJLA 4RMTA 3VE0B 2IAMC 4FQJH 5DK0A 3BD5A 3DV6A 3VD5A 1CTNA 4U1GB 4WEBL 2D7PA 1P9MA 2X4QA 1UVQB 5I2IA 3OG4B 1CR9L 4M48H 4M61B 4FOMA 1AKJA 4W4OC 1JPGA 4GRWE 5DHYB 5DFVD 4I48A 1Q9WB 2Y36L 3U36A 3ZE0F 3LQAH 1WBXA 4YHYB 1T20A 3P40A 3RZWA 2IEPA 3NIFF 4PTUA 2B7DT 4M6OH 1S8DB 4X6DF 3KPRE 3PQYE 3E6HA 4GRWB 1FO0L 1CLYH 5J3HC 4ETQB 4Y4FB 3CLEL 2NX5A 2JJSC 4PJIF 4F37F 1OAUL 1BLNA 5D9SA 3OJDB 4PD4K 2HWZL 3JTSB 4AJ0A 3O3DB 1UADC 4UIMA 3AMKA 2XRAL 4P2CG 5SWZE 3MUJA 4LLMA 3CH1A 4FXGA 5IK3B 5IHBA 1TQCC 4Y7MA 1NGXA 1P4BL 4JPKL 4DZBA 1EDQA 5D2LB 3KPRB 4FQ1H 1MJJB 3PQYB 5DJCB 1SM3L 2Y4SA 4A6YA 3ARDA 2OTUA 4QKXB 3NGBB 4NM8L 2WINB 1Q38A 4QOKB 2WZPD 5C92A 3ZTNH 4LDOB 4X99B 2CRIA 4PLOB 4OLWH 1CGUA 3FO9A 3T4YA 1E4KA 3GMRA 4M93B 4PRDA 25C8L 5FYJL 2EYRA 4KJWD 3IXTA 1A4KB 1CGSH 4X5XB 3S34L 5EZLA 5BRZD 1ED3A 2AJYL 5K9QI 3HRZB 1KLFA 1NBVL 2I07A 1QO3B 2VR4A 5MI0C 5L8JB 43C9A 1PYWB 4L8BB 3EAKA 4L9LC 4U6XA 1EO7A 4LPVA 4ZTOH 2AI0H 4U1IB 2W9EH 3MV8B 1RUMH 3I3BA 3RVVC 1DBAH 4P3CL 3JXAA 4XNUH 3BN9C 2YPKB 3T2PA 3V6FB 2ZUSA 4I77L 4ZOCA 5EIVA 1RVFL 1GGTA 3MMEB 3QEQB 3VXPA 4ETYA 4YHOL 3I3DA 4O5LH 2I25N 5DXWA 4JHWH 3I9GL 5I1KL 3FT3B 3MFFB 4L4VB 2PN5A 3W11C 4HIIA 4K3JH 4N5ED 4RMWA 2AGJH 3HPLA 2YD4A 4F33B 1HWGB 1TFHA 3OR6A 4LCWE 3WFCH 3AM8C 4EZMA 3HZMA 2DI7A 3MLYL 3ECBB 3MNWA 4F7CB 1BQLL 4G8EB 1WIOA 3WMSA 2PYEB 3O81A 3F65A 3PL6B 1QSFE 4KK6C 4QT5B 3EO0A 3UROR 3THMH 3DVNB 4U6YA 5H94B 3A6CH 4NCDA 2YZ1A 3FRPA 2HLAB 3WHXA 4OFYD 1G7IA 4HKXA 4PP2A 4LLQA 2A6IB 5I71C 1FAKT 4I0PC 5B21A 3AAZA 2R1XA 3SGDI 5I73C 3OKEA 2FZ3B 1LK2A 4JJHA 5GHWH 5DEZA 1HOCA 3IKCA 4X6DA 5DJ2B 4JY6B 5F1KC 1WFUA 4RFEA 1MFDL 3NCYS 4IBLT 3DGGB 4S1SH 1KOAA 4GAYB 4Z7QF 1I7ZA 3L1OH 5DC0A 4PRIB 5BO1H 3EKCA 4U1MB 1INEL 3B4NA 1DUZA 2XPGA 2Q8AL 4I9WD 2XG4A 3ARBB 3MQIA 1LMKA 1R3HB 4LFHD 4TUJB 3FHQA 3IJSB 4YHLH 2EE3A 4LPTA 4G8IA 4LSQH 3T0ED 4Y5YC 3K74B 1NJ9B 4LAQH 4JO3L 3QDME 4ODWA 3O6KL 1F11A 2O5XH 4L4TB 1CFNB 1P6FA 4XVJL 4Z0XA 1QZ1A 1QYGH 1N6VA 3ZE1E 1ZAGA 4MA1C 3CK0L 3O4LA 1NCAH 4Y4KD 4XH2B 1PKQA 4DFIA 3FONA 5CUSH 5TE6H 5BW7A 2PCPB 1MOEA 4JLRA 4NBXB 3QXAB 3ZHKA 1UENA 5F7WC 2DQDL 4YR6B 1JMXA 1ZXQA 4N90D 1VFAA 4M9OA 1UWGH 5EC2A 4A2LA 4XP5H 1G9MH 3GFUA 2EDTA 4K9EH 3QWOB 3GRWH 4WO4D 4X98A 2YMXL 1M1SA 5D2NB 1XIWB 4HQQL 1FNEB 1CXLA 5BOZG 1P4LA 2E9IA 1QHOA 2M26A 4XPAH 4ZOEA 1K6QH 4IOIA 3ZKXB 2B1AL 1FPTH 4QRQA 3IVKB 3V0VB 4I3RH 5JIHA 3PHOB 3L3IB 4Z0BH 1BOYA 2AEQH 2FJFA 2EO1A 5B8CB 3IDYC 3I6LD 2Y06H 1LO5A 4NHCL 5C7XH 1W0WA 1CG9B 1KCSH 1DVFB 2NY3B 1NCWL 4ODHL 4F58L 1PEZA 4JZNB 3UTPD 4UB0L 2Z8VC 3BQUC 2APTA 4S1DD 4YK4B 2PO6A 4IS6A 1JGEA 2MOVA 3K3QA 5IW6A 2EDBA 3LV3B 1A47A 4XNYL 3GSQA 3WS3B 2A77H 5JUEH 1VESA 3MRNA 1A21A 5HDBE 4H88L 2VXTL 3RWJA 2BVQA 4RBPK 3B9KB 1JZ5A 1FBIL 5T1DL 1BREA 3FQUB 4OBSA 1E6JL 3DX7B 1UEYA 3RY6A 3V5DA 2NY7L 3BKCH 3FFCE 4P2OA 4E0RB 4GBXD 4J3TA 1YYMH 1GHFL 4IIQB 4EKXA 2H8PB 5DD3L 1FAIH 2R0ZH 1OAYH 3GSOA 2A9MH 4OFDA 3BE1L 2QQKL 4PJHF 5HYSG 3LKNB 4LSPH 3SDDD 4GW4A 1TNNA 1IC5L 2Z92A 5IM7A 3VRJA 4ELME 1M71A 1ERNA 2I24N 3DUHA 3IAQA 4P46C 2BNRB 2Y23A 1CFVH 1F3RB 4RNRB 5D1ZD 1YMMD 2LTQB 1RZJL 3GMQB 5EZIH 5FYLD 3DVIA 5JDSA 4YPGB 1KCUH 5CMAA 5CD3A 4Z7NF 1EGJH 3EDFA 3G5XB 2VR5A 3FCTB 5I76A 4FTVD 3HNVL 2QHLA 4D3CL 3KHOA 1S3KL 4YHKH 5I1HH 3H9SA 5DD6A 4ZAKB 2R2BB 1LDPH 3SKNB 2B1HL 4LVHC 4NBYB 1ACYL 2GJZB 3UTTB 4RWYH 5F93C 1D9KA 2EDJA 3WIIH 4O2CB 3RIAF 1NAMB 2CIKB 4PBXA 1FNAA 2CLZA 3PDGA 1KNOB 4UV7H 4EVNA 3DNKA 4NRZA 3UDWC 2HJKB 4HV8A 1CXFA 2AK1H 4KMTH 3TIEA 4HFUH 2VIRA 4LVOB 3QXVA 5KAQG 2BDNH 4RA3A 1S7WB 3IDNA 3VFMB 3JWOL 5EO0A 1WEJH 4KTEH 4HIXH 3SDCD 1DQLH 5FUOL 3TJEL 1MHPH 4PJ8B 4MMXC 4XMPH 4JFED 3KDMA 1UYWH 2YUWA 4H8WL 3DX6A 4MDIA 2FNBA 35C8L 3SGEH 4RMVA 5IEHB 4KKBD 3L5HA 3RDTD 1F6AA 3BZ4B 1DE4B 1ZTXL 1JGUL 1FN4B 1QD0A 5JW5A 4ZO6A 4ZUTB 5KSBF 4K8RD 4KJQD 3QUML 2G75B 3LPGA 1P7KA 4YPJA 1RIHH 1NQBA 1A6AA 4LCCC 4XRCA 4CU7A 5IHZB 5HGAB 3UTSE 1A6UH 3S97C 3S7GA 3TT1L 5C0RL 1A8JH 4GSDH 4NKOA 5DWUH 2Q1EA 3D9AL 3I85A 4D8PA 4FZEH 1HIML 4LOUD 5D71H 4MVBD 2NY4B 1VEMA 5TDOB 3VXOA 1N3NA 1CD8A 4M7KH 4RAUA 4G6JL 3EYVA 2FBJH 3VI3F 3ARXA 5I8EB 4C4KO 3EO1B 3HZVA 1OB1A 3TFKD 5BRZA 3HPJA 4HUXB 2D4DA 1TCRB 2FSEA 2BHZA 3KHQA 3MLTB 2X7LA 4X7SH 4MNGB 4JM4L 3V9FA 2Q8BH 5BCAA 3G6JA 3UO1H 1AE6H 1PQZB 2NQCA 4AZ8A 5IVOA 5E6IC 5GS3A 5EUOF 4DEPC 1IQDB 4TUKH 4Q6YA 5DFWH 1I3GL 3MV7A 1OSZA 3GSNL 3WL9B 1ROWA 1U8LB 1A3RL 3EJYC 2R2CA 5ISZA 4KDTC 3BDBA 5D1XD 3WUWB 1MCKA 2VZVA 2R2EB 4AY0A 3EOTH 4PY7A 3MOQA 3RHWK 4U1JB 3RY5A 2Z93A 4O02L 3TYGH 3BGMA 5L2JA 5KSVB 1Q1JL 4BYHA 4M7LH 3CXHJ 1YYLH 3MRRA 3O6FD 3U0WL 4K71C 5BS0E 2P5WA 3HC0A 1KIRB 5J12C 1DDHA 1P4IH 1NGPL 1EZVX 1DEEA 1QPXA 1NUNB 4XVUD 4PLJC 2VXQL 4WTXA 3ZDXE 4MD5B 2IQAB 4MJ5A 1C12B 1EHAA 1KBGH 3RBGA 3QISA 2RFXA 2DM3A 5CLTA 4YBLB 1VEPA 2P8LA 3KYMA 4UNTA 4OZHB 1AD9B 1IGTB 5C0JA 1LE9B 1PLGL 3IU3A 3VXMD 3MOBH 1CD1B 1T3FA 4OGXL 3I84A 2NNAA 1NMCB 1RUAL 3LCYA 4U3XA 5D8JH 1K4DB 3PP3K 4WI3A 3W0WB 3MNZA 5IKCA 5KSBA 3BPNB 4PJDE 1FQ9C 4G7VL 3SY0A 4JQVC 4AIZA 4LPCA 1UZ8B 2X4NA 2Y1VA 4Y8AA 5EO9B 4Q74A 2HT2D 2MCPL 1T22B 4M7ZB 2AXGA 4P5TD 3Q6FB 2K7PA 3AY4C 3E8UH 5TQ2L 4FQJL 3RKPA 4FNLH 1J8KA 4IJ3C 3WN5B 4XCNA 1I7RB 4BSWB 5LGKA 4OUUA 1HINL 4X9GA 2J5LC 4MJID 3U2SA 5JHDD 3NN8B 4M48L 4XP1H 5FK9A 1ND0A 5D70L 1RMFL 2Z4QB 2NY0C 1VGEL 3BGFC 1UJTA 3KWWA 1EEYA 3LD8C 3MLRH 3QUZD 1BFOB 1DFBH 3AREA 2DJ4A 1CXEA 2CK2A 5I15H 5IBTL 3QFJA 4RX4D 3MRIA 3TBSA 4YE4L 4K3EH 3C2AH 6FABH 1D5XA 2MKWA 3VCLB 5CSGA 1PZ5B 4Z7WE 2VE6B 5GGTL 1WFTA 1FYHB 2AERT 4OZGA 4NRXB 5F9OH 5IVZA 2O61A 3QO1B 1BVZA 4U2ZA 1T1WB 1NDMB 5JQHC 3IU4L 4YEEA 4FFYL 4NQED 4GW1A 3PWJB 1YDPA 2ITDA 1NCBH 5JMOC 4HIEB 1E27A 1BEYL 1XF1A 4FFZH 3BW9A 1MNUH 3S5LB 1Z3GL 5F3HB 4G6ML 5DJ8A 4DGYL 5HYJE 3FO0L 4OLUH 3ZL4L 2OJZH 3B8SA 1WK0A 3MUY1 3IJHB 3QQ3B 4R4FL 1QP1A 4YHZH 4ZYKB 3IDJA 1Y6KR 5K9OA 4O58L 4GLRH 4PJBA 1QFPA 3MUGA 2C4FT 1B6UA 4FXKB 2QQLL 4BK5A 3NVQA 3D25A 1AXSB 1CYGA 2H32H 4TUOB 4JKLA 4CU6A 5GGSA 4E9LA 4EIGB 5B38B 1P69B 1CD9B 1I1FB 2BVYA 5JZ7C 5T1LB 4PTTA 4OCMC 4DVBA 4I4WA 4YX2L 5F7DB 4GBXA 2XA8H 4EUPB 4MD4B 5C0DA 4N0UA 5F89A 5C09E 2A6JB 4NJAH 1SBSH 4WHYH 4XNUL 2EDNA 1QR1A 4YC2B 2Y72A 4FQQA 1ZT4B 2GFBA 4KQ4L 4FQLH 3CFEB 2EICA 3SDDA 4YFLI 3X3GL 1CU4L 1GJIA 5JLZB 1UJ3B 3BEWB 4PR5B 1YMHA 5D1ZA 1YMMA 4Y19A 5LCVL 2WBKA 4JRYA 3L3DB 2I5YH 3IFNL 3Q1SL 3TBWA 1NCDH 5C09B 5ENWB 5HYFA 5F8QC 3LH2H 1IC7L 3ARUA 4NYLB 4WWKD 4XMKL 5SX4I 3F62A 5DD0L 2XKNB 4X8JA 1AJ7H 2XTJC 3OX8A 1LO3L 4WTZA 3QIWB 5I1CL 3FL7A 2YPLA 4NSKA 3TZVD 5C0NC 4HMDA 4P2YA 4XVSH 1DANT 1XGUB 3O3EB 4KRPD 4JDVA 4MZ3A 4HWUA 4IDJL 4X4XB 3DUUA 1G0YR 3H3PH 4TOYL 4KWUA 4MX7A 4PUBH 3IGAB 4R7NB 1FRGH 3SE9H 3MJ7B 2J12B 3MLUH 2IQ9L 5CILL 3PGDB 2JIXD 5DO2D 2OR7A 5ILTL 5T1MB 3OZ9L 4EN3C 1EUUA 5ICZA 5KSUA 4G3YL 3KR3H 1KJVB 1F90H 4JFHE 3P0YH 4OCYL 1MCEA 2P24B 4J2XA 3UZEA 3BIKB 2J8UF 5I1GH 1YEHL 3JWDH 1NFKA 1GZQB 5L9DL 4IRSB 3SDCA 3F7VA 1Z9MA 1DBKL 3VFUA 4YDLB 1JHTA 1JHKH 3GUTB 4JHBA 3PIQB 3TO4D 2W0LA 4X6CE 5FKPA 2O5XL 5DJZA 2JK5A 1QFWI 3AS1A 1M05B 3VMNA 3Q0HA 3BZFA 2IH1A 1PY4A 3RDTA 1XGRB 4PJCA 4UBDC 5LQBL 1UQSA 1I8KA 1YC7A 3FTGA 2OSLB 1AP2B 2E7BA 4XNZC 5ADPL 2X1OA 4XNXL 5BZWB 1L7TL 3C5JA 5JPNB 5J0BA 4Y4FD 2C1PB 5JPMA 5FYKH 2BSSA 4JY4A 4YXKL 5EU6A 4F15B 4YGAB 2YUVA 2FEEL 2ZJSH 1UT9A 1N6QH 2ADJA 4IMKA 4YHNB 4JANA 1OWRM 4P9HH 3QUXA 7CGTA 1U3YA 1HKLH 1RUKL 4BH8B 2I9TB 4XCFL 4YUEL 3NABL 2JELH 3KPRD 3OJVC 3PQYD 3G5ZB 2I26N 1ORQB 4OSUL 2JCCF 1T4KB 4YDVA 2PO6C 4U1LB 2DIJA 1CDCA 3R06B 3BJLA 4L29A 4YAQA 3MRBB 1CGVA 5SWZD 4GKSA 4QOKD 1IARB 1F3DH 4LPUA 1HNFA 1ZLVK 3ZTJH 1I3VA 2R8SL 5IHUH 3TA3B 4KU1A 4J8RB 5IIEB 3DIFA 1T5XB 2ZNXA 3QZWB 3AMLA 1RSFA 4N1HB 4PB0L 3P11H 3MR9B 2NXZC 1YNTA 3NFPA 3RIFF 3ULUC 1UM5H 4WU5A 3RAJH 2BP3A 1VSCA 1DN0B 2ID5A 4F7TA 2CLRB 1K8IB 3AXLB 2D0GA 3CFKA 5JUEL 3QEHB 4QWWD 1F4AA 4J23A 5D1XA 1X9QA 1IKFL 4I18B 4FG6C 4KK9D 3GJEA 3V52L 2HJFB 3QEQD 2C7UA 4WIQA 3MC0A 3RGVC 1HXMB 5CZKA 3IJYB 3WNPA 4PRNA 1H3TA 5FKAA 3I6KB 1Q0XL 2HVJB 4L4VD 5MEOB 4ZMAT 3O6FA 3ESUF 1FAIL 2VLRA 2R0ZL 2Q86A 2AJXH 1G9NC 5FUZH 1ORSB 4LARH 3STZB 2X70A 2UZIL 3C6SB 3S3JA 5KOVC 1P84J 2J8UA 4HUVA 3N85H 4XB7A 5J6HA 1KGCE 2EEBA 2PYED 3U6RB 1FG2A 5KAQF 3PL6D 3WO4B 4OV6F 3T65B 1HHJB 1CLCA 2LU3A 2WBJD 4AH2A 3W9EB 5HI3C 5KVGH 4WV1A 1X4XA 5HVFB 5BV7B 3VXMA 3WYRA 4L5FL 1AI1H 5D5MA 4NO3A 4OZFG 5A43C 3VI4F 4MQ7A 2W0KA 2VUOA 1X6LA 3RWHB 2WQ8A 4HGWB 4E41B 3OAYH 3SCMB 1F42A 1ODAA 3LZFH 4JG0L 3NAAL 2OJEB 1U8JA 3LKPA 3NH7L 4ZSOB 1QSFD 1HHIA 5B3NA 4KZDH 4QRTB 1ZT1B 1CFTB 3GZKA 3TN0C 1ZVSB 3FO2B 5FA3B 5E4EB 1IAKB 4PRID 4X4MA 5DTFB 4P5TA 1T7XA 1KJ2L 1TVHB 1ZA3B 1ZVHA 3R8QA 3ARBD 3RUGE 4XC3H 1AY1H 2GHWB 4LASH 3AB0B 1FZJB 2YBRA 3U7YH 5DT1L 4GRLB 1WJ3A 3KPPB 3MLSL 4KPHH 5KSAB 2A73B 2JCCA 1IC4H 1WIPA 1YQVH 5DEGB 2W0FB 2F53E 2EDRA 2DQGH 3O45B 2EECA 3OTTA 4G9FB 4EXKA 3G04B 3U0PB 1T83A 3ARFB 1U41A 3WUWG 4UU9A 3MTRA 4BZ2H 3RUGB 5HYSA 3GMNB 5KTEH 3GHBH 3WLBB 3DPBA 4C59B 3BWUC 4RX4A 5F9DC 4ZS7H 3WKMH 2YK1H 1QNZL 1B0GA 3QDMD 1YEDB 4Y5XC 2VO5A 2EH8H 2R0WL 2CIIA 2F53B 3PNWA 3PG2A 4AMKL 4L8SB 5TE7H 1ITBB 5J06A 3FAXA 5E8NB 5HHVH 4WUUE 2J88H 1XIWD 4JFFE 3LPWA 1M7XA 2FJGA 1ACZA 3SGDH 5L88H 2AXFA 1RZ7H 4PG2C 4IRJB 3QEGL 4QRPA 4NQEA 1V3KA 3TBTB 3LSOB 3IDGA 4NUJA 4BFIB 1TTFA 3LHPL 4KJWC 4OLEA 1TDQA 1CGTA 3MLZH 3C8DA 5ECJE 5FV1L 1YA5A 2CUMA 1CIDA 4FQHB 3ARTA 5I18L 2H2PD 1TIUA 3ROLA 4JFFB 5D71L 4OQTH 1J9CT 4Y0GA 1ZHKA 3TH3T 5GGQH 1B4RA 1JK8A 2J6EA 1J0YA 2NY3D 1UB5A 3MODH 3OPZH 4IHOB 5KBNC 4KKCD 3QCUH 4Q9CA 4FQXB 1QKZH 3V6OA 1S7SB 4ZFZA 3L9RA 1YEKL 4GRWF 1JPTL 1IGFH 5DQJA 1DUYB 1FFOA 3QAZB 3MJGX 1GGCL 5C3LD 1FO0B 4X7SL 5FF6A 3BAEH 1RUPH 3VFNA 1D6EB 4I3SL 3RWDA 3UO1L 1A6WL 1X5JA 4N5EC 2XWBA 1KXVC 3QHZL 5EA0H 2EC8A 3B9KD 5HHXL 3GSRB 4JB9H 5MENE 3KPNB 4K94C 1HSAB 4LCUA 5IFJA 1J05A 4N0FA 4Y4HB 4ZUUB 3FN0L 2IWGA 3P4NB 5HHMB 4GKNA 4F57H 5E2TH 4GG8A 4R6UA 2CK0L 5F96H 1MRFH 5CGTA 5MENB 1PW3A 2DWEA 4PJ9B 5KW9H 2OK0L 5IMMA 2YWZA 4WWKA 1KULA 1AR2A 3SPVB 2X4SA 3BPCB 3S35H 1C16B 2AP2A 3HS0A 2ATPB 1MIEL 5CS7A 1JE6A 3D85B 1KT2B 3TZVA 3EOAA 3IFOB 1NBYA 3K2UH 3QA3B 5CP3H 5C08B 3KS0H 1KPRA 5E7BA 2VQ1B 4MJ2A 2HJLB 2VLKE 4ZAKD 5GSRA 1N4XH 4MS8C 3NFNB 5HD8D 3MRPB 3FFDA 1NLDH 3UTTD 3CVHH 2GUOA 3CC5A 3BH8B 1MCIA 1LK3H 1QFWL 1U8NB 5FO9A 4XI5C 2Y07L 5F7MC 2JIXA 3T0EC 2HFFA 2X41A 1JYVA 2JTDA 5EG6C 1T1XA 4M4PA 1K2DA 1QLRB 4UQ2B 2I60L 3UZVB 2FHBA 2BY1A 5E5RB 5CKAA 1NC2A 2G2RB 3QFDB 4HDIB 1U8IA 3PV7A 1FNGA 5GRWA 2J2ZA 3OKOA 4Y4KC 1I7TA 1EHNA 4KXZH 3MA9H 2FX8L 2A0LD 5B38G 1N0LA 4AEIL 3OWEA 5FM5M 3U30C 4PS4L 2M8XA 4KUZH 3UJIL 5I1IL 3OXSA 3CCHA 1X3DA 3TO4A 5ITFB 4EUPG 3RL2B 8CGTA 4JVPA 3VDBA 3C60C 2YUXA 2YSSB 1B2WL 4GAFB 4WO4C 4NQVB 1MJ7H 5CSZB 1FZKB 3C08L 5L0QB 2OR9H 3MXVL 2OL3A 3EOBA 1MF2H 1DN2A 1NGQL 3BSZH 4ETQA 5D72L 2DL2A 1FIGL 5J1AA 5I1JH 4DFHA 2CO6B 4PYGA 4JQXA 1S5IL 3W82A 4L3CB 1JNHA 1GC1C 1A0QL 1D5MB 2FGWL 4GXVH 3ORJA 3BEVB 1D5BB 1OARH 1YN6A 1L7IH 1DQQB 5TE4H 4TSCL 1FNSH 3KPRA 1MJJA 3PQYA 1A7QH 2A6KA 1V3MA 5E2VH 1J7VR 1CDYA 5L6YL 4S1DC 2FX9L 5F9OL 1X5KA 4XC1H 2IFFL 3BD3A 1JNJA 4QCIA 1F00I 5SWZA 5C0AE 3JTTA 3D2UB 2E27H 1NCBL 4X99A 1NGYA 5DRXB 5DMIL 1UM6H 2N7AA 4BH7B 5IEKA 5GGVH 3UTSD 2G60L 5DJDA 1CF8H 4LVEA 8FABB 5C8JB 2OJZL 3BMVA 4WDIB 2IH3B 4XCEB 3VWJC 5F9WB 3QIUB 3EYFB 4OGAD 1PYWA 4L8BA 5DJAB 5DC9B 3ZE1F 5C0AB 2X1QA 1MWAA 3KPOB 1T03H 4Y5VC 5CBEB 3QQ9C 4LSDA 5CJ8A 2SEBA 2Z91B 3EFFA 1DBBL 3SDDC 4Y89A 3TGXA 3MMEA 1U93B 5KVDH 1S9XB 2IF7A 4ZG1A 1U8PB 1FVDA 3V4UH 5D1QD 3F7RA 2P5EE 1I3UA 1NGWB 1X5GA 4R97B 3DXAE 4I13B 5I74C 3NIDE 3NZ8A 1HQRA 1T7ZA 4U7MA 4JFZH 3V7MA 3NACL 1TJIH 3MREB 4OIIH 3QT2A 4KAQH 3L3KA 4XWGH 3OXRB 5CP7B 4UT9L 4KK5C 2UWEE 2V7HA 3G5YB 4LRNH 4Y2DB 2X4OB 5TFSH 5JOPE 2P5EB 2WBJA 3GSVB 4QT5A 3HCVB 3DXAB 4KVNH 1DQTA 3GMLA 5FYKE 1JYXA 3RFZC 3Q6GL 4XP6H 4LCWA 4YIQA 4CGTA 3TCXA 2BRRH 4QHKI 3OKYA 1CL7I 1VGKA 4M7LT 3MCLL 3IDYB 5BS0D 1SJXA 1IAOB 3E2HC 4MNQE 1QSFA 2VMFA 3IDMB 3GM8A 1R5WB 4PG9B 4QO1A 4XCYB 2C3VB 3DX8B 5C9KA 4UIKL 5HDBF 4EI5B 5GISL 4PJGE 2LFGA 3W0WD 3OR7B 1F4WL 5H2BA 4G9DA 4PGCB 1ZVYA 4FZ8L 2HN7A 4LLDB 4TQEH 1IGML 2X4PA 3QZWG 3SDCC 4ONGH 5E8PB 3ARBA 3D39E 4K7FB 5ICYB 3VXNB 1A1OA 1TXKA 3K81A 4GKZA 1RZFL 3IKKA 4MNQB 5DSCB 5AG8A 5DHVA 2AJVL 2HTKD 1RK1B 3E3QC 2VOTA 3FQXA 5ANME 4O4YL 3QJHA 4PJGB 4F8TA 3TYFA 3DO7A 4ELMF 3QXUA 1QLFB 4DVRL 5CJQH 3VGHA 3AFLA 3NCCB 1KJMA 4KJQC 1GYAA 3QXAA 4UI2A 1U6AH 3BUTA 4QRSA 4YR6A 4H0GA 4XMLH 2GYSA 3QDMA 2QSCH 5E2WL 4CNIB 4GQPH 4PJXB 3RWGB 1QFOA 1GGIH 1N0XH 5FGCE 2D7TH 4J3VA 5TDNB 5DK2A 1C5CH 5HXMA 4HCRL 4LOUC 2AAVA 4P4KC 3T0VA 2PW2A 4MVBC 4HXAH 1FNEA 3I6GB 1KIPA 1N7ML 1FVEB 3FOMB 4LVNC 4MCYB 3HE6B 3BP6B 1CLOL 2CO7B 2BHUA 3H9ZA 2ZPKL 5GRJL 4L1DA 4OCSH 5HDLA 3WNKA 3QHFH 3VW3H 3CDYA 1FGNL 1UH2A 3TFKC 3ULUH 1CXIA 4PRAA 3V2AR 4LBEA 3L3IA 5FHAL 4F80A 1AR1C 1HKLL 1XCTB 4EIZC 4LIQH 5IR1B 4RA0C 3DECA 1CE1H 3QBTB 3JV6A 3SGJC 3DX9B 5SWQA 3VFGL 4P2RB 4JHAH 1T7YA 4PV8B 5IB2B 5IQ9B 3NA9L 1BMGA 1KENL 1J1OL 5F1IA 2FO1A 2V17L 1QA9B 3KPMA 3BN3B 5EU4B 5C9JB 2H41A 5D1XC 3WS3A 4JRWA 4N9GB 2C3WA 1OHQA 1A5FL 4ONOA 1G9NH 1FNHA 5CZVH 4ORZC 1K5NA 4NO5B 4NZTH 5SV4A 3OL2A 3B9KA 3STLB 1CE6B 3BP7A 1U3HB 5T1LD 4OCXL 1QRKA 2V5RA 1J1XL 4G80A 4ONFL 4Z7OE 3GJFH 4IIQA 3HE7B 1RJLB 2WM0A 2H8PA 2DWDA 1FIEA 1UWXH 5I1DA 3MRJA 2X05A 3AS3A 2VC2L 1DBMH 3CMOL 4XVUC 1IEBB 4NC1C 1UG9A 1F2XK 1ONQA 3LKNA 4XZUA 5JNYA 3SE4A 4NPYA 4HH8A 2I9LB 2GJJA 4X5WB 4RNRA 2DIAA 3FFCA 3GMQA 4UOJA 3WEXA 3GK8H 3HB3C 1Q72H 5IB5A 4WI2A 4N1CA 2CKNA 4KI5C 5C09D 4LRIA 3X13A 4C83A 3CVIL 1WVZA 2W9LA 3LS4L 5KG9B 2K1MA 2K3TA 1YEJH 1PKOA 2IGFL 4ELMA 4ZAKA 2XXMB 3RL1A 2FWOB 3BRFA 1HWHB 3S4SB 1LO4L 1HYRC 5C71A 3H9YA 4PJEE 1VERA 3ARQA 3REVB 2H9GB 5F1NB 1WC7B 4O2CA 3U9PH 3GSNB 3ARVA 4BSVA 1NAMA 4V2BA 5EFIA 3RA7H 4U7SA 4P5TC 2H3NB 2VDOH 2OZ4H 1T1YB 4I0KA 1KB9J 4S1RL 1IL1B 4TVPL 1YPZE 3AS2A 5I6XB 1W72L 4KDVA 1OQOA 5MEQA 1S7VB 4KZDL 1CT8B 2Q87A 4PJEB 3C5ZB 3SJVB 1ITCA 4YXLL 1GGBH 2F8VA 5J9PA 3LN4A 3V5KB 4DN4H 1NMAL 1AGDB 4PGEA 1S7WA 3DARA 2XZZA 3WDJA 3P9LA 3GJFK 4G7YH 1A3LH 3QUZC 2EC9T 1I8MB 1UWXK 3G9AB 4IRSD 5D7IB 2VDRL 3QIBB 2ICWI 2JJUA 3N1QC 4OZHF 4P0DA 1MCWW 5I1EH 1JI2A 3IB4A 5SX5H 1NANI 3TV3H 1I1RA 1S5HB 4R0LB 1MY5A 3B9DA 2DQGL 4O51A 4JFHD 4NP4L 1SEBA 5HHOB 4Y1AE 2BMKB 3ZDXF 3DJ9A 5IEHA 2W60A 2WIIA 3VJ6A 5FB8A 4XAWL 3KYKH 4V1DA 1N64H 3DBXA 3L3OA 4TYUA 2W1NA 5ITBH 3WKML 3WD5L 5J12B 1MLCA 5IB4A 2OI9C 2G75A 1ZLUH 2WUBL 2YK1L 4QNPE 3CIQA 2EH8L 1FNLA 2Z31A 3N06B 3QO0B 1BBJB 1NBQA 4FN0A 4ZUVB 4Y1AB 3WIHL 3O3UN 1SY6A 4OLVL 4OZFA 3F6LA 3MOAH 4WFGE 4I2XB 2XQYG 4HS3B 2DM4A 5D6DC 4WNQA 4YH6A 1AGFB 2XZCL 1HHHA 4ALAH 5TDOA 4APQC 4PJDF 5I66B 5EU7E 1ZEAL 2J7LA 4S1QH 3PDOB 1E6OL 2DLHA 2RCSH 4K94H 3CFDB 2XV6B 4OJFH 1AXIB 3UTSA 4EBQH 1GPOL 3D69A 2XWJB 3BVNA 4WI9A 5JIPA 1VHPA 2PYFA 2BC4B 5DD5H 1I8LA 5FHBH 2BNQE 1NFDE 4DAGH 5GS1B 3BUYB 4LGSB 3QCUL 1QKZL 5GGUB 3BYYA 3BDYH 2DRUA 2VL5B 4NN6C 2AXJA 1F4XL 1CWVA 3MZTA 2VXUH 4RCAA 2CDFA 3EW3B 1TZGL 1X4YA 3LQZA 1MJ8L 2XZQL 5C6TH 5IOPB 1RUPL 1G7PA 5AUMA 4NN5B 1OF2A 5D1QA 4LSRH 4NZJA 3A6BH 3E1F1 4MA8L 3JV0A 1DSFL 3CDGA 2VDKH 2BRQA 4NKDA 3BGFB 5JW4M 2VITB 2DQIL 4PRHE 1Q94A 3B6SB 1JZ7A 1S9YA 1AGEA 5FO7B 4WWKC 2ZSWB 4Z7WF 2VLJE 5E2JA 5KSVA 3DRQB 3UC0L 2KL6A 5TQ0L 5E2TL 3TZVC 1MHCB 3AS0A 4XPBH 2DQFB 4LMQI 4MXWH 1DEDA 4WHTA 2NCMA 4XXDA 3DTXB 4PRHB 3VXTB 4KRPC 1C12A 5DJXA 4OD1H 2CMRH 1WT5A 3MO1B 4WHYG 4NIKB 2ZG2A 1UA6L 3REWA 1IGJA 1AD9A 1KB5H 1J8HB 5HYQA 5BS0A 3HMXH 3QHTC 3KYAA 4J6RH 1H3PH 1WICA 2E9BA 5LGHH 4WTWA 3SKMA 3OKMB 2HT4D 2DN7A 1CD1A 4FHBD 1J1PH 4OCWL 4UT6L 4NZUL 4M1GH 3U46B 2FO4A 4LHJB 4E41D 1KGCD 3F12B 3SCMD 1BAFH 3PDDA 4XBEH 4M3JA 1IAIL 5DQDH 4FABH 4U1GC 3MBEB 4JO2L 5E08H 2EDKA 3UPCA 3L3GA 1XMWA 5FYJU 2YKLL 4OF7A 4HUWB 2O5YH 1Z6JT 3H42L 4HX1B 4JFPB 3S35X 1EXUA 4OF5A 2VZOA 3P9MB 3GMPB 1A9BA 1F45A 3P77B 1GAFH 4LQFH 3DROA 3Q6FA 4R3SB 2ZOLA 5EB9A 3DUSB 4YHYC 3T0XA 1I7RA 4GRLD 1GC1H 4PJDA 4BSWA 1RIUH 3PP4L 3NN8A 4HF5H 1ZGLB 5C07E 3G6AA 4KUZL 5EOCL 2XQBL 4Y4FC 3O4OB 1PDKA 2ATKB 1KFAL 4ISVB 3VG0H 4OD3L 3ZE0E 3R0NA 4G9FD 3QDJE 1DP0A 3ARFD 3LIZH 3UPRB 2XTJE 2JB6B 1JTOA 1M4KA 3MYZA 4A6YL 2JJTC 3WXWH 5HGHB 1OW0A 4KKAD 4MAUL 3IF1B 4UINH 5D7KE 4HS8L 1F3JB 1KACB 1A7OH 1FLRH 1VENA 2IBGA 5GRUH 4X0KB 1R5IA 2DLEA 1IC1A 1MF2L 4WFHE 3VCLA 2F53D 3BXNB 1IQWL 5I1JL 2VE6A 3QG7L 2GSGB 5T3XL 2X42A 1CCZA 4NRXA 3O9WD 2DQCH 4DKDC 1I1AB 3ESVF 5HY9B 1XF2A 3NGBC 2XN9E 1NDMA 4NRYB 3GMOA 4IRJD 1QVOB 3HI6H 1MCWM 3PWJA 2NZ9D 4M93C 4DUXA 4HIEA 1AGBB 3GNML 1T04A 1MEXH 2DBJA 4QHUB 3LRSA 1QLEL 5FIEA 3VD7A 4Q6IA 4Z7WA 4JZOA 1JZ6A 1MPAH 2LU4A 4XP9H 4MAYA 1MFCH 2W0PA 3TT3H 2IPUK 4K2UH 4WUUD 5ID1A 4JFFD 1CICA 4CVXB 3QQ3A 32C2A 2XN9B 1B6DA 4RIRB 3K8KA 5EUKA 2X5PA 1H5BB 4FQXD 3T8XA 4HAFA 3W5NA 4U2YA 1MFAH 1T5WA 2P4AB 5F70A 5K93A 3L95B 2X4UB 4R4BB 4X6CF 5B38A 5HYJA 5AD0A 3HG1B 4ZTPH 5T1LA 4DKFH 4D94A 1LNUB 4MA7L 3AROA 5F7DA 3VFWB 4EUPA 4PJFB 4OD2A 4LCIH 1MRDL 4X9BA 5IJVB 5EOQH 4H1LB 4PIRF 2R1WB 2DQHH 2DL9A 3TPUA 1CFBA 3DSFL 2FATH 4BFEA 3WFHB 1PZUB 5EN2A 1FL5B 3CFEA 4ORGB 1A1MB 1A9EB 4XGZB 2A6DB 1UB6B 3FB8B 3SDAB 2FX7H 3PL6C 2OTWB 5JLZA 1NCCL 4DUWA 3O3AB 1RUQL 1U2HA 1U8KA 3L3DA 1BFVL 5C09A 3SKJL 1OOAA 5MEND 2F5AH 2ZOKB 4QRRE 4PJ9D 3VDAA 2IPKB 3RTQB 1IZKA 3SHSA 4YDIL 4N8CL 5L2KB 5FYJD 3GO1L 3LMJH 3F7PC 1AHWC 2R56H 3T04D 1HH6B 5DC4B 3MRCB 4OZ4A 1OM3L 4X7TB 3D85D 1C5BH 4ZQKA 5TFSL 3PV6B 4Q7DA 3BKYL 1DLHB 5M7QA 1P1ZA 4ZPTB 1T21B 5DLMH 5H35B 1U3ZA 1T7VA 4QRRB 3O3EA 5ESAA 3WSQL 1U95A 5GSVA 4PGDB 4X4XA 3ULUE 1EIBA 4H20H 3IGAA 4R7NA 3GRWA 3U7WL 4DGVL 3MJ7A 1A6TA 4LIQE 3ARBC 5MERA 3FMGH 2F54E 1FYTE 5IMOA 1ZGLM 1QFHA 2APXA 5EBWB 2FYYB 1U8QB 3BMWA 2E6QA 1G6RH 3MROB 3ISWA 1PG7H 3Q3GB 4G43A 4CAGA 2VLKD 3O0RH 1VA9A 2P24A 1RURL 1QBML 2Q7YB 4YDJA 1INDL 3OKDB 1XF4A 2M1KA 1MAMH 1ADQH 2BJML 5F7EH 4ZNCD 2H26B 1FYTB 1NSNH 2B20A 3QULB 5AYUH 4GXUN 4OGYL 4LLVA 3BN9D 5K9QG 5HGDB 1Y0LA 3T4AB 2R69L 5IVXE 5FGBC 4Q58C 3V4PH 3OG6B 1FC2D 5CEZL 1I9IH 1MCPL 3QPQC 4OT1H 4LKCB 2B4CC 2D7OA 1M05A 2Y5TB 4J1UB 4XPGL 3L5WA 5D7LA 5D2NC 1XIWC 4Z18A 3W11D 2APWA 1JRHH 3G9VA 1IMHC 3RHWF 3VFTA 3V4VH 3G08A 3VFRB 1NGZB 4HMEA 5EU5A 4K07A 3KXFE 4J12A 5JPNA 3WHE0 4M43H 3ZKXC 1CLZL 3V5HB 4X6CA 1C5DA 3LRGA 4HPYH 4LSUL 2BVPB 3I02A 3M17B 4POYA 1WZLA 4JZJB 3PWLB 1SJHB 2D7TL 1KLGB 3GJFB 5B8CC 1FE8L 4BELD 2Q3AA 4KK6D 3O6MH 5DZLA 4HS6B 4KHTL 1RZKL 2A9NH 5FAAA 1KJ2B 4ODUA 4YXHL 1DVFC 1UZ6E 2NY3C 5T1KB 1NPUA 2X1WL 4KKCC 1ORQA 4OV5B 5IQ7H 3S4SG 4YK4C 1T4KA 4S10A 3UPAA 4NQCE 2YPVH 5F88B 2X4RA 2DI8A 3MRBA 4TNWK 1E28B 4HK3N 3D2UD 5TF0A 1U8HA 5LWYL 4KJYB 4GO6B 3RUGF 3VG9C 1E4WL 1EGJA 3ZSSA 1GRWA 3BD4A 4EI6B 3QJFB 2E5EA 4X7EC 5AZEH 4G5ZH 5IIEA 1KCRH 3E6FB 4DKEH 2ILLA 1HHGA 3B9KC 4WU7B 1D5ZB 3S36H 1GOHA 4JCMA 3F58L 1Q0YL 3QIUD 4NQCB 4UNVA 1BIIA 3RWEA 1CTOA 1KJ3L 2BSTB 1UGNA 1DN0A 3MRDB 4LSTH 1R3KA 5C0AD 3AXLA 1K8IA 4G8GB 1KIQB 2GSIA 3SDXB 3QNYA 3NOIA 1JYNA 4BA8A 4XNQA 3RWCB 1SEQL 4XBGA 1MCRA 4HLZG 1TZHB 2LTQC 2FR4B 3B5GA 15C8L 2ARJB 4JAMA 4JVUA 4U1KB 1W2KT 5F7KC 3RPIB 5ID0B 5C0CE 1DBML 1TITA 5FA4A 1N2RB 2XKSA 5GGVY 1U0QA 4AEEA 1LEIB 4Q9QH 4ZAKC 1E4XH 2PETA 2F5BL 2V5MA 5DEFA 2ZG3A 4P59L 2NPLX 4OLZH 5FUCE 2AKRA 2APFA 2Z0BA 4LLWA 1HHJA 3IFPB 1R3LB 2P5ED 4QXUH 1EEZB 3W9EA 2V2TB 3DXAD 4RSVA 3SE3C 2NY5C 1LO2H 5F7NC 1JF6A 1FVCB 2Y25A 5HHPB 5D7SL 5D7JB 1CBVL 2C4FU 3EYQC 4FQIL 4FXLA 5J11B 1KELL 4X83A 4LVOC 2DMBA 2A0LC 3U9PL 4YDKH 1JN6A 5B22A 3PWPB 4UZGA 1BP3B 4PRBB 3BQUD 4EI5D 5D93B 4U0QB 3QP3A 2PXYB 1S7XA 4KV5E 4UOW0 5BVPL 2H6PB 3L3JA 2DICA 1G7HB 4PJ8C 1IAMA 4RDQG 4WY7H 4MNQD 5DQ9A 1EERB 2A74B 3KLAB 5DJ0B 1WCBA 2A73A 1LEGA 1MLBB 4LF3B 5DF0A 2E7HA 4RGMB 4GQ9L 1R0AH 4TSBH 2W0FA 2XTLA 2DYPB 1K4CA 3O45A 4OCRH 5FDWA 3ARFA 3V0WL 2DQJL 2PR4H 2YRZA 3D39D 3D0VB 3RUGA 2HRPH 2NW2A 4PRPA 3H8NA 2AABH 4XAKE 1YNLH 1OGAB 4JE4B 1ZLSL 1AO7E 4ZXBB 2VZUA 1IKNC 1YEDA 5IWLA 3QR2A 2F53A 4OFPA 4HWEH 1YN7A 2AV1A 4L8SA 3RWFB 1K85A 4R2GB 3U4EB 3KYKL 1MCQA 1CL7H 4HKJA 2NY4C 3O9WA 3BP5B 2OQJA 4G8FA 4N0CD 1BFSA 4OB5L 4URTB 1RK0A 3T0EE 4OLXL 1JNLL 3FQWB 4UDTB 4NO2A 2BSED 5DUBB 3L3HA 3VXSB 5I0ZA 1T7WA 4O2EB 1HEZA 4FQHA 2ADGB 4D9QD 2EEAA 4WUUA 4HKZA 4JFFA 3QDGB 4JFYA 2BOCA 5JXED 1PX3A 5BMFH 4LHUG 5CEXB 5I19H 1AC6A 3M8OH 1P7QA 4P2RD 3ULVE 3S9DB 2UZXB 4U1SB 1EJOL 1MFEH 2C3HA 4GMSH 1MQKL 4QHNB 1NEZB 1DUYA 3C9NB 5ALBL 4H25B 1IEAA 4U6HB 2EE2A 2R29H 1B0WA 5FHBL 1JFQL 3INUL 2DQTL 2VQTA 4ODXA 5EUOE 2JB5H 4W4OA 5IF0A 3GSRA 1U3HD 3RJDA 4QXGH 1C8PA 3PHQB 4CMMA 2N4IA 5JOFB 4R90H 3ZLQC 3P4NA 3HAEB 5DVOA 1R3IH 4LSRL 1N5YL 3A6BL 2DTSA 4OKVB 5IBLD 1RZ8A 4PB9H 4NDMB 4L8CB 1JNNH 5D6CB 1JWSA 3OKNB 5MENA 1UCBH 2FBOJ 2JJSA 4LNVA 3SOBL 1EUTA 1DLFH 4YBLC 5CIPB 4AM0B 4MLSA 1MAKA 1PD6A 3BPCA 1QRNE 1RULH 1QBLH 5ACZB 2ATPA 2AVGA 1KG0A 4XPBL 4KKLD 5IJKC 5IG7B 4MXWL 3RWIB 1KT2A 2ESVB 2VRAA 5JA9A 2DTMH 1OAXH 4ODSL 4KZEL 4P23B 3UBXA 1NMCC 2Z9TA 4FS0A 3P0GB 4YWGL 1A14L 3MRPA 3BPOB 3BPNC 1QRNB 2W65A 2R0KH 4CN1A 1M7IA 3MJ9A 4F8QA 3ALXA 4NQSB 4YHIB 3CSBA 2HTKC 4HMCA 1TZIB 4M7ZC 5EDXA 1YY9C 2VLKA 1FNFA 1IFHL 2LQRA 4XBEL 3CAFA 4OI8A 2GTZB 4DZ8B 1O7SA 3WN5C 2HG5A 2G2RA 4HW6A 4HDIA 4M6NH 4L9LA 3SGKC 3VA6A 3O8XB 4NQDE 3SJVD 4N0YL 3AVEA 5I17B 2R4RH 2ZCLH 4Y5VB 4PY8J 5E6ID 4QF1B 3S88H 1FDLH 1MCSA 2OMBA 1QFWM 3NIDF 4NFCA 3HUJB 3RL2A 2DKUA 2OXGA 4NWUL 3MFGB 3EJYD 1GC1L 4H1LG 3D18B 4QHMB 1UXSA 5LG1A 4F3FA 2DQEL 2R2HA 1UWEL 4NQDB 2VXVH 1FG9C 2UWEF 4JO4H 3P4OA 4YQXL 1A22B 2H32A 4KGLA 1H3GA 5HHOD 3W9DA 4D0DA 1S7RB 2DM2A 5IHLB 3AM8A 1Q9LB 3LIZL 5E5MA 1G7JA 2CGRL 4MD0A 1ZV5A 1PSKL 3O2WH 1VFBA 2ADFH 3LKRB 1AH1A 2FIKA 1PG7W 3EJJX 1D5BA 2VTFA 3HLAA 4HKBB 1S7TB 4QTHA 1DQQA 5JR1H 4Z76B 3TNNB 4OZIE 4Y1AD 5CINL 1DQJA 1LGVA 5GZOD 4EQ2A 2IG2L 5JO5A 3HI5L 4M5ZH 1NMBH 2DQCL 3DURB 4PJGF 1U8OA 3RX7A 3WIFB 2HKHL 5CJXC 2CDGA 4JFEE 1DQMH 4CN4A 4QY8A 4O9HH 2W9DH 2G5BA 3F6IA 3E3QE 4BH7A 3ARYA 5EORH 1HN1A 2D03H 4O2FB 1MFCL 3QI9B 1JI1A 2FB4H 5C8JA 4DQOH 3WJJC 2AEWA 1NLBH 1F3DJ 4FFVC 5T33L 4WFGD 2YA0A 3FRUA 3CSPA 5KS9B 3H7BB 5FYLL 3TP4A 3CUPB 3UTOA 2GY7B 5EBLA 1HXYB 3GKWH 2MPAL 3KPOA 4YC2C 1EHLL 4Y5YA 3FB7B 2DI9A 2QTEA 5CWSB 2IANE 5BJTB 2Z91A 4OFIA 3OAUL 3FQNB 3NPZB 1KN2H 1H3VA 1U93A 1FORH 1G7LB 1S9XA 1D5IH 1UJ3C 3K7UA 4Y2OA 1FV1A 1U8PA 5EC1A 5HSFA 2VYRE 2CPCA 1UM4H 2VNCA 3GSUB 3MJ8A 5LXGL 2YA1A 4JDTL 3B43A 4XXCC 1MFNA 2NY0D 1G6RB 1XGPB 5E94B 1B0RB 3LPFA 3NPSB 4OF8A 2VLMD 4LP5A 4U1NB 3H2WA 2IANB 4U6VL 1CFQA 3EDKA 5EIIB 2BFVH 1Z5LB 4JGMA 2YA2A 3QIWC 3OXRA 1CIUA 4K3HA 2R4SL 4KY1H 3G5YA 1OAKL 3U7AA 3GI8H 3W2DL 2P5EA 4GRMB 5L8KB 3DXAA 1I9RH 4LCYB 4PRHD 5EBMB 2EYTA 1F8TH 3NTCH 2VLLB 3HC4H 4F37K 4TULH 2VLJD 3NZHL 5EU3B 1MHHA 1WCQA 2HFGL 1MJUH 2OYPA 4Z8FH 5FOJA 1I7UA 4UOW1 2UWEA 3ARGB 1XF5B 3MRQA 1XGQB 1JGLL 1ZLWH 5TGBA 3MRFB 3VRIB 1B88A 1T1ZA 2E6JA 2D9QB 4LHUD 4XCYA 5E5UB 3DX8A 5JW4R 4HJGB 3BQUA 2F74B 3EO9H 4EI5A 4AT6A 3QUYB 4PFEA 2EDDA 1H3UA 3OR7A 4KROB 3MBED 4IRSC 4F7EB 4RFNB 5E8PA 4OLYL 4Z7OF 5ICYA 5GS0L 2E8ZA 3WBDA 1UACH 4K8RL 2ZCKH 4YDLC 4ZO7A 4MA3B 4MNQA 2YN5A 2YD5A 3GMMB 5DSCA 1A7RH 4LEOB 4S2SB 5SWSE 2HVKB 4XVTL 3X3FH 1S7UA 2QADB 3EHBD 4NC1E 2VDLL 2VDQL 2IBZX 3RZCB 4NFDA 5JDJA 1TVBB 4G6KL 2MTPA 4PJGA 1WZMA 4P9ML 4DGIL 5F7EL 3GI9L 3VWKB 1A02N 1KXTB 1EV2E 1VADA 4LEXL 4KI5E 3D39A 3LDBB 5J4MA 5CJBA 4CADB 1EMTH 5SWSB 3V4PL 4LPYA 1W0VB 5JIIA 3PABA 1I9IL 4F15C 2ZG1A 1K9TA 1WF5A 4AEHH 5ANMA 4B7LA 1M6OB 3L7EA 4CW1A 2VABA 1D6VL 2DBLH 4P46A 3TVMB 5GIRA 2DQUH 2NY1B 3V79C 4WW2B 1DQDH 1G6VK 4JFXB 4HIJA 1BVLB 3TCLA 4U49A 1J88A 4HHAB 3HTLX 5C07D 3WV0A 4BZ1H 4P5MA 1EX0A 2FL5B 3BKJH 4PJEF 4X4ZA 3TNMB 4KVCH 2PTTA 1FVEA 3FOMA 3KAAA 1W72B 3BP6A 4LDEB 3TBYA 1XCQA 2MHAA 3QDJD 1HSBA 1FH5H 1T6VN 1X5HA 1S9WA 2V2WA 4Y16B 1I1AD 3QG6B 4K3DH 4M9PA 2CR6A 5D7KD 5HHQA 1T66C 1YPZF 1XCTA 4MJIE 5IR1A 5JHDE 3TA3C 3ZHDA 5ETUB 4KMLB 3ALWA 4UTAL 2UUDH 3FN3A 3CFCH 5IGXH 2VISB 1TJGH 3GHEH 5DURB 1C1EL 4GUPA 3WDHA 1HI6B 5HJ3A 3UDWA 4X6BB 3TO2A 4DN3H 2XN9D 3ZE2E 1NBZB 2P48B 5JHLH 5EU4A 1EAPB 5C9JA 4IMLB 4NN7C 1FFNB 2OP4H 2D7NA 3T0AA 1BZ7B 4I18C 2QSQA 1DR9A 3D3VE 4C56E 3L5XL 1YECH 4NO5A 1WZ1H 2V2XB 5I1AA 12E8H 3STLA 3N50A 2EDEA 2ADIA 5DYOA 4Z7UB 2AJ3B 4WI8A 1T6WA 1B4JH 5EZOH 4NO0A 4JN1H 3FT2A 1JCKA 2NY5H 1FGVL 2J4WL 5I8CB 1WITA 2YN3A 4DK3A 5JORA 4QNPF 3RU8H 4CVZB 5CLWA 4P3DB 3SDAD 3WO4C 3TBVA 1LD9A 4ONHA 4UBDD 4HJJL 3UJTL 2UZYB 3LEXA 2B2XH 1FZMB 5DDHB 5BV7C 5IESH 3MRGA 5FDYA 2ZCHH 3T77B 2HT4C 3RTQD 1GL4B 4HC1H 4LCCA 3ARPA 4TTGA 4RDQF 5L2KD 2VN7A 4Q9RL 2QR0B 4UT7H 3SCMC 4IRZL 3O2DH 4NKMA 1CI5A 2UUDK 3S4SA 3A0OA 4DW2H 1CXHA 4MCZB 1RAMA 3KS0J 3REVA 5F6HI 1H15B 1A6PA 3BDXA 3MRMB 1WC7A 3QCTL 4QRRD 4JPIB 3EYSH 2EE9A 5E4EC 4HK0B 1NFDF 2F58L 5DMKB 3SE8H 3LS5L 1I9JL 1X5YA 5EO1A 3LEYH 2E9JA 3QUKB 1T1YA 2AJSH 2X4TB 1LEKB 3MGAA 1M7DA 5ALCH 5DS8B 4M6MH 5F6IB 1IL1A 3GB7A 4JGUA 3AB0C 5AWNL 5A2FA 1KTKE 4U33A 4GRLC 1G7MB 2OMNA 3IFLH 4JREB 4HUUA 3MRLB 5KSAC 4UQ3B 4HFWB 5HTSA 1NEZG 2NXZD 4JFOB 2B0SL 1TETL 2R23B 3ULUD 5E6IA 2CJUL 4EOWL 3ES6B 1RJYB 4F7MA 3ARFC 1X7QB 1DBJL 3IXAA 2WUCL 1YPZA 3QXDA 4KKAC 2F54D 1FYTD 4MWFA 4OQTA 1EA9C 4KDTA 1U8MA 5DK0B 5DRWA 1ZT7A 1Z9OA 1CK0L 4XPTH 3MLVH 2X4QB 1S5HA 4DOHB 4FG6D 3VXQB 1HILA 4R0LA 1MCOH 3MGOA 5CGYD 1AKJB 4L8SC 4EDXB 5T3ZH 4F2MA 2IPUG 1AGCA 4Q2ZA 1JPGB 3CPLB 5L7XH 1HHKB 4I48B 1XR9A 4RQQA 4L3AA 1ZWIA 2HRPL 5I30L 4GMTL 3U36B 4IRJC 2J6EL 5IB1B 1YNLL 1OCWH 3P0VL 3TF7C 1T20B 2NZ9C 1JHLL 4PTUB 1A7BA 1JVKA 3MV9E 4HEPG 1CZ8H 1R24A 3S37H 4Y1AA 3GIVB 3E6HB 4WI4A