1RZKH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
229
Chain Sequence
b'EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
total genus 41
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzkH01
3K8MA 4N8PA 2HJKA 2GAZB 2X4TB 3P3YA 4OZHE 5F89B 3EDFA 3C2AH 4FFWC 1IFHH 5IVXF 5DFVC 5AZ2L 4FXKB 3OHXB 3CLEL 3LKSB 4YHYC 3WCYA 3VFWB 1BZ7A 1T04B 3NFPB 1S9XB 1IM9A 4PTTB 4HULB 4XI5D 1MJ7H 3QPXL 4ZUUA 1JFQH 5TH2A 4YDKH 1I7RB 1W0WA 5DHVB 1BF2A 5C1MB 4PJEF 1CDBA 3IU4H 3RDTC 5ICXB 43C9B 5IHZA 4UQ2B 5DGRA 3F7QA 4XPBH 2A9ML 1MJJA 3AAZB 3T0WA 4X7TB 2NY1D 5KSAD 4ZOBA 3OZ9L 1U6AL 1LP9B 3BX7C 3KYOA 1B4JH 1YY8B 4X7SH 4X9IA 2DQGH 4BH7A 1HCFX 2HT3D 1IC7L 3E2HB 4ZFOL 4PREB 3MGOA 1G0YR 5LQBH 3B9KC 5GZND 5CZVL 2HFFB 5C08D 2CH8A 3QUMH 5DK2B 2OBGA 1X4ZA 1A6VH 2CRZA 4DGVL 3T3PE 4IOIA 2B1AH 2BNRB 5M95B 5DJZA 1Q9LB 4XP9L 4JHZA 1JHTA 4J3WA 3G5YA 2ED8A 1HINL 2XZCH 1C5BH 3HZVA 4LVHC 2QHLA 4HHAA 3BIKB 2PYEE 4S10A 1U0QA 1D5BA 2D7MA 4KVNH 1HKLL 5AYQA 1RPQA 1O7SA 1S78D 4NPYA 1Z5LB 4JG0H 1NLDL 4PJDE 1X4YA 3O3AB 2NX5E 4MQ7B 4P3CL 5F88B 5EBMB 2XQYG 5EUOE 3IJYA 1YJDL 4JM2A 1IAIM 5C0EA 4MD4A 1CCZA 2A77H 3PABB 1BF8A 3WNMA 4LSUL 3WJLC 1CDIA 1KIRA 1AD0A 1KB5A 4U05A 3SGJA 4X7SL 4JFYA 3VGAB 4DVBA 1YN7A 1MQ8A 3SE8L 2WLZA 3UTTE 2UZYB 4WWKA 3OZ9H 4X7CC 4KUZL 3BPCB 3QA3B 4G7YH 1S7UB 5KVEH 4Y4FD 2CJUL 1FFPB 4KUCF 3RA7L 5ELIA 5D7JC 1S3KH 5EFIA 4LP5A 1CFVL 2NY0B 3U30B 3N1GC 3MREA 1VESA 4QNPE 3L3JA 1JWMB 1TCMA 1B0WA 1OGAB 2H32H 4I2XB 4EBQH 5LGJB 2XZQH 3K4DA 4GXVL 4XBPA 3EDEA 4G43A 5CJBA 4U6HA 3QCVH 3UTPE 4H0HB 3VD7A 1EFXA 2YOCA 4P46B 1WBYA 3GNMH 3UTSA 1JZ7A 1ZT7B 1OTTC 4YDLB 5F1IA 2F9BT 2VIRA 5CEXA 4PJGA 1J10A 4YHOH 4JREC 4MAYA 4OM0H 4UAOB 4APQA 1UEMA 2NLJB 3D39A 5FUCC 3RWGB 3VRIB 5GS0C 3TZVB 3E8UH 4Y5VC 1Q1JH 2FNBA 3S88H 1GOGA 3AVEA 3BRFA 2FCBA 4HEME 4ZFOB 4Y4FB 5HVFB 2LU7A 1R3HB 3OKLB 2IJ0C 1GGBH 1MCBA 2XG5A 3B3IB 4IDLA 3QUZC 1YN6B 3NN8A 1AIFA 2AV7A 2DB8A 2JELH 3MRNB 2LU4A 4U1HB 4UBDD 5T5NF 1JI2A 3GJFB 4XCFH 2AGJL 5F3BA 3L3OA 2E6PA 4NQVA 3FFDB 3WEXB 1FN4A 3IF1B 1CICD 3NABH 4HAFA 4L4TD 1Y6MR 5DR5H 1MHEB 5SWZB 4FTVA 5ANMA 2PXYB 5F7EL 4P48A 1REIA 2BERA 2YKLH 3K80A 3KYMA 4TOYL 3MRCB 5DK3A 1OHQA 1HXYB 4BKLA 5M94B 2J8OA 1U92B 4ORGB 3QI9A 1GZQB 3D3VE 4NHUB 2A6JA 4C4KO 2WM0A 2P5EA 1XIWA 4W6WB 3ALWA 3ARRA 2F19L 1MH5A 2VQTA 4DOHB 5FF6A 2HRLA 2AJUL 1CQKA 3NFNA 5CGYC 3VFVA 3GSWA 4NM4L 3X11A 5IV2B 5TF1L 4ODWA 1JNNL 4PLJC 1FYTB 5EU6E 1N2RA 2AEPH 1KCRH 1H0DB 3A67L 4MB3A 4OM1L 2QR0B 5C07A 2DLEA 1ZA6A 3O41B 1XGQB 4ONOA 4ODVL 4WHTB 1JE6A 4R7DA 4DAGL 1DZBA 3LDBB 1TCRB 1WGOA 3CDYA 2Y36L 4ZTOH 3S88L 4ZUTB 4O00A 3Q3GB 5H37G 1N59B 4NQCD 1S7XA 5ESAA 4L8SC 5D7IB 5GS1B 4F58H 3GSQB 1DSFH 3N85L 1EGJH 1RZKL 5JXEC 4XC1H 5CHNB 1FIEA 2XNAA 4D3CH 3BXNB 1CZ8H 5ID1B 2L4OA 1BIIB 1HNFA 3IFPA 5GS3A 3FQXA 5IBUG 4BA8A 6FABH 1EFXB 5JA8B 5HHQB 3TP4A 1TENA 4BK5A 3UDWC 3HE6D 3QUKB 1P7HL 1UENA 1PG7X 2P5WA 3CU1A 1I4FA 4DVRL 3PDGA 1SBSH 3JV4B 2PNDA 5D1XC 2IALB 4JRYA 2CGRH 3NCCB 2NY3C 4P2QB 1CU4L 3UJTL 3NABL 1RIHH 4TULH 5ADOH 1WBXB 1LDPH 3DROA 1D5ZB 4YGVB 2EH8H 4YDJA 4N8VB 1E4JA 2VLKD 5IROC 1FL6B 2FX7L 1PX3A 3IFOA 5MEQB 2XWBB 1BVLA 2HFTA 4HDIB 3HMXA 3UTSE 5LJYH 2JB5L 3KJ6L 3TJEL 3GMQA 2WUBL 1ZTXL 1OTUC 4K94H 2PYEA 4XVJL 5TF0A 1D5IL 3QJFA 2IC2A 2Z9TA 3QIUD 4PB0L 3BPOC 2HJLB 1EBAA 5JHLH 3HG1D 1TIUA 4G8FB 5BXFB 1U8HA 3H7LA 3O3BB 4TSBL 4YBQC 1F3DJ 5D7LA 3SDCA 5C2UB 3LQZA 1FDLH 1NGWB 5JIPA 4JJ5B 4XPTL 5CD5C 2N1KA 4UTAH 2BVQB 1CVRA 3QIUB 4YHMH 2G2RB 3F12B 1SJHA 3ULUC 4HIEB 3G6AA 2QHRH 3OJDB 1WITA 4BQBA 3L5HA 2P5EE 1FV1B 2AJYH 4EN3A 1G9NC 3RKPA 1KJVB 2QQLL 2RGSA 2FIKA 1A9BA 1VADA 4JKWA 3RVUC 3QR2A 3MODL 1AQDB 5DZLA 1A6ZA 4TNWF 1J1XH 3BKCL 5JORA 2OMNA 2F8OA 5E8EB 4Z8FH 5I1AA 2C4XA 5BV7L 5MP6L 3QRFM 4Z77B 4OIIH 5E2VL 4EUPH 3WXWH 1JJUA 1G1YA 2AXGA 1JGDA 1KN2L 1CFSB 5DT1H 1HEZB 2UZXB 5FYLE 3T04D 4G80B 4HMEA 4OI9A 3QT2A 1JUFA 5KVMC 3U9UB 1YEEL 2BNUA 1OP5K 4QHUB 1OAZH 1DANT 4L4VD 2IAMD 1CL7H 5BRZB 3LSOA 4XMKH 1OOAA 3GSOA 3DMMA 4JFFA 5ETUB 1XF3A 3B9VA 3LAFA 3MO1B 4DN3H 1KV3A 2YA1A 3ARDC 2H2SD 3DTXA 2WWKT 1PY9A 4EOWH 2LFGA 5A2JH 3LN5A 1BJ8A 2FATH 2FYYB 3VG0H 5IMMA 1JYNA 1FL5A 3QIWD 2VUOA 2VZ1A 2DWDA 2ZSWB 5E7BA 4YHLL 2BDNL 3OR7A 3NCYS 1D9KD 4AG4L 3EYVA 3UDWA 4J8RB 4P57B 5DJ8B 3ARBA 4WTWA 4JO2L 4FABH 2HG5A 2OR7A 3RVTC 3DURA 5EBGA 4XCNB 3MV7E 5DD1H 4MZ2A 5EWIL 1I1RA 1AKJB 1ZAGA 4HIIB 3HC0B 3V6OA 2RAMA 1MCFA 3KYKL 2R0KL 3LKPA 3QQ3B 3SDDB 3CZFB 5E5RB 1PW3A 3BGAA 4YHML 4DAGH 1PG7L 3HZKA 1RY7B 2X9YA 3MJ9L 4CVWA 5AUMA 3BT2L 5DJXB 1YEJL 1EAPB 2B4CC 5KVGH 2FGWL 35C8H 3IJSA 3U4EA 4W4OC 2OI9B 3RIAF 5FM8A 4CVUA 5J56B 1GGIL 2IAMC 4U1SA 4CMHB 3CSYA 4GAYB 3FOLA 1UZ6E 3U79A 2BVOA 3FT2A 3CVHA 3GHBL 3RUGE 4HT1H 4EIGB 4OZFH 4OCRL 3W11D 1CG9A 3RNKB 3FFCB 3JWOH 4JM2B 3STBA 5JHDB 3PV6A 2JJVA 1I9RH 3QULB 3T2NL 1AHWB 3DIFB 1PX4A 4TSAL 1BOGB 4X0KA 3S35L 3QXDB 1I9IH 5GPRA 1N6QL 1PFCA 4LCWD 4RMTA 3CFBB 3IKKA 2W07A 2XWTA 5JW4R 5HHOE 1G9MH 4YO0B 4NKOA 3HAEH 4KK9C 4XWGL 1JPSH 3MROA 4RGNB 5ESQB 1DLHA 1GH7A 3G5VA 5KZCD 4HK0A 1EFXD 1QVOA 3G5XB 4TQEL 3H9SA 4AIXA 5ICYA 4IMKC 2GSGA 1BEYH 1MFDL 2YEZB 4M8QA 4PRHA 3U2SA 1WWCA 3ZT7A 2DKSA 3NAAH 4QCIA 1SBBA 1X5AA 5EZLB 2YD3A 1KCUL 3S37X 3BVNB 4ONHB 2VB5A 5F6IC 5JLZB 2WAHA 3L5XH 3T77B 1K4CB 3PWUA 5E4EB 4UV4H 5CEZH 2CKNA 4W81A 4PJHB 1FFNB 3SJVB 2CDGB 5FYKU 2R8SH 4GSDH 4M48L 3EFDH 4NM4H 4JO2H 1U8NB 4ZUSA 3IRPX 4PRNA 4XBGA 2A6DB 2BSTA 2MNUA 4QRTA 3HC4H 2GUOB 1PD6A 4UBDC 2ITDB 4BQ9A 4LQ1A 2B1HH 3DUSB 5K9KA 3ES6B 4P3WA 1FL5B 4FFYH 4ZYKA 4XNQA 4JQXC 5J12B 1OCWH 2XN9E 4IDJH 4Q9QH 3FO9B 2FJGA 4KI5F 3AREA 3BI9X 5I30L 2GJ6A 4NQVB 1CXEA 2JCCA 5F7EH 1GHFL 5KANG 1K2DA 4P5TD 2P8MB 1LK2B 2O5YH 2GTZB 3QFJD 2I27N 2P46B 3QQ3A 1BPVA 3VG9C 2DQDH 1WV7T 2X70A 3HZKB 2VZOA 4HBCL 2BY2A 4OLEA 3WXWL 4D0BB 1TNNA 1NBZA 2EYSA 3HE6A 4WI5A 1OSPH 5B8CB 3D2UA 5KVDL 2X4UA 1A6AA 4OJFL 1WICA 4OFYD 4MJIB 4OM0L 1RZJH 4KJYA 2AI0H 3O4LB 4M6ML 4JFHE 4GBXC 4XHQA 3RNQA 4LRNH 5I75B 4N8VG 1IKFH 2YD7A 3CX5K 5J9PA 1GGBL 1CLYL 3MRGA 2RJMA 1BVKA 3RHWF 5C0BB 3T09A 3WIIL 5JZ7C 1EEZB 4GAGH 5FO9A 3CD4A 2R4RL 5GS0L 5H35A 1IL1A 2CRYA 2B39A 1ZLWK 2NXZD 4LCYB 5AZEH 2ICWI 1CDHA 1MCWM 1RK1B 5F1SA 1EJ6A 3WNKA 5C0FB 2EDTA 3K4AA 3KPRD 3BP5B 3F8UB 5HI3D 4UU9A 1CXLA 2AS5M 1SY6A 3OGCB 4YAQA 2V2TB 4ENED 2DQTH 2KZWA 3MXWL 3T65A 1N26A 1BZ9A 3ME0A 3ARED 2XRAL 2YEZA 4PRHB 3ARQA 3RZCB 1DBJL 5B38A 3R1GL 2A6KB 1I1AD 3ZHLA 1OPGH 4JFFD 4UB0H 4P5KB 4WJ5B 3QNYB 4RMWA 3DX8A 2A6IA 3O3AA 1C5DA 5EU5B 4P4KD 5BZDB 2EDFA 1INQB 4NQEB 5IW1A 3O81A 4LSRL 3MC0A 3E3QE 1Y6KR 3PGDA 4K9EH 1YYLL 4JFYB 4DVBB 3ALXA 1MLBA 3TIEA 4TVPH 3T2PA 3VXOB 4LCCC 3LMJL 5HYJB 4GG6A 5C0CE 1KYOJ 5C0ND 4NP4L 1OF2A 4NZDA 1V3LA 1KIUA 1MPAH 5LXGH 5HI4D 4FHBD 4L9LB 3GKWL 1FH5L 4HQQL 1H3UA 4U7MA 1YJDH 3QFDB 4Y16B 3WYRA 2FX9L 4RAVB 5TE6H 5HYQB 1CZ8L 1FZMB 4NNXA 3ULVD 4JRYD 4JQXA 3UTTA 1CD9B 4BFIB 2DIJA 4JM4H 4HV8B 4YFDB 3P4LA 4PJ5E 3MGTB 5GSVB 4XB7A 5I1JH 3BKYH 3VFOA 3U7YH 4JFDE 4FXGB 3QIBB 3KPLA 1S7QB 4FFZL 4NO3B 3OGOE 2FLRT 2Q8BH 4WO4D 5FYJD 1A64A 3CX2A 3QUZA 5I74C 5TQ2H 2I60L 3MV7D 3A67H 1D5ZA 1XF5A 4P9HH 4JFDB 4PREA 5D96C 4OI7A 1JRHI 1LO2H 4AEEA 1LO4H 2D0HA 3H0TA 4HUUB 1WFUA 1ZGLM 4AEFA 1MSPA 1EEUA 2ITCB 3HMWH 2V9TA 2BNRD 3MOBL 4LKCA 1LILA 3FRPA 5TE4H 2UY7A 3CMOH 4ZXBC 1IGML 4KFZC 4XPHH 1U6AH 1U8OA 1I9EA 3NPSC 4PG9B 4FRWA 4YX2L 3T0EC 3H9SD 3FCTB 5I1IH 2QQNL 2OL3H 4BZ1L 3LB6C 2HRPL 4ZOEA 2YUZA 1K8IA 3VH8A 1KSRA 4JFZH 5F7KC 4X4MA 4IEFB 4F7PA 4QRUB 3SGJC 4UQ3B 5HHME 4EN3D 1SJXA 4OCXL 4JZOB 2GHWB 2Z31B 1E6JH 2JE8A 3JWDL 3TIDB 2NYYD 3GK8H 3QYCA 4M93C 4HPYL 2EIBA 4FQQB 1A6UH 4KKCD 3BKCH 3IT8D 1VEMA 3ARBB 2X40A 5C0RH 4NJ9H 5L6YL 1T66C 5F7YC 3W2DL 1XGUB 4IRJB 3U48A 3P4MA 3OXRA 5BS0E 2EC8A 4Q97A 5GGSY 1DUYB 2HAZA 2ZG1A 3MYJB 2E27H 3O11B 5GRVK 5LBSH 4GJTB 4KDVA 4DW2L 3VG0L 2IPKB 5I16A 2O5ZL 3CH1A 3OF6D 3H42H 2C3WA 1NFIA 4OD2A 3NFPA 4AT6A 3TN0C 4TUJA 5IB5A 1U3HB 3REVA 1T03H 1AFVH 3C6SA 1S3KL 1BQUA 1RZGA 3SPVA 3V0VA 3MO1A 1OSZB 5HGBA 3GKWH 2ATKA 5TQ0H 3V9FA 2VYRE 1J05B 4F57H 5TPWL 2KBGA 2F53B 3STLA 3EYSH 3GSNA 4NO3A 3DECA 1D9KA 4LOUC 5F7FA 1E28B 4PRPA 1A7RL 3CFDA 4PB9H 4D8PA 4J3VA 3E1F1 1U91B 4R4FL 1I8KB 1CFNA 1S7TA 4WFGD 2MKLC 2J8UF 4J8RA 4P57A 4XBEL 3N06B 5I1GH 2UUDH 3R0NA 2HP4A 3KPMA 2DYPA 5D2LE 5T5FL 1PBYA 3RUGB 2WBJA 1C12A 4HEPG 3P4NA 1L7TH 5EZOH 1YMMA 2I07B 4K94C 4LKCB 3UJTH 1M7IB 2ADJB 5IM7A 2V7HA 3BE1H 5CIPH 3DO7B 5F96H 1BFVL 5EC1A 3UXFA 3QUMB 3R8BB 4QGTA 3DJ9A 3G5ZB 1RUPL 5IF0B 4X99A 3DSFL 3QG6B 4PJ9D 5LGHH 1OAQL 3QBTB 4OLYL 1NCCL 4H0IA 2CDGA 3A6CH 2YBRA 5AD0B 1KPUB 4X9BA 5EC2A 3BKJL 4QHKI 5INCA 2R1YB 4HWZA 3OJDA 4OCYL 3CVHH 4EVNB 4K3DH 3OAZK 4YHKH 4R26L 1KBGL 2EEAA 5A16B 1MHHA 3DI2B 5JZ7D 5E2WL 4HJJH 4ZTOL 2JB5H 2K7QA 1I1YB 3KJ6H 4LP4A 4U1LB 5I8EB 2EDLA 3VFMA 1YNTA 4J4PC 3VD5A 2MCPL 5I71B 1T1WA 3TYFA 4OT1L 4HK0B 4X6DF 3GJFH 1S9XA 3FT3B 1SJEB 3FL7A 4M1CD 3VW3L 1H3PL 4O51B 3G04A 5DD5L 5KSAB 1BECA 5HI5C 2CGRL 3IDGA 1LO0H 4TVPE 4TRPH 3RGVD 4KRPB 3AS0A 4D9LL 5J8OA 5HHPB 2APTA 3IDXL 4QHUA 4XTRC 3KWWA 1JGLH 3PWVB 1RIUH 4HIHA 3JTTA 4DK3A 1ZVHA 1UZ8A 2ZZUT 1WQVT 32C2B 1OGAA 1UA6L 5EBWB 4FQLL 1NLDH 1FNGB 1CIUA 1J1OH 2V6HA 3HC4L 4WEMB 3QH3A 4FFYL 1A5FH 4NQCE 4U6TA 1NFDB 3UO1H 2FD6H 1TFHA 5AWNH 3C5SB 5JO5B 3UAJC 3PWJA 4KXZH 3MGOB 3OAYK 2NY6B 4XPGL 3MRRB 3OR6B 1T22A 5ILTL 3X14B 5DUMH 4APQB 2ADIA 2BNRA 1N7ML 4QO1A 3MRNA 3NGBB 4TSCH 2AEQH 1BEYL 4QEGA 1CD0A 4AMKL 5D7LD 5D1ZB 1MQKH 3BP6A 3U36A 1KLGA 1NMCC 4JZJA 4Y0GA 2P7TB 1MFEL 2EDXA 3BGMA 5TQ2L 2IBGA 4NO0B 3T65B 1W0YT 4PYHA 2E6JA 2H8PB 3QFJB 1D5BB 5D7LB 4K3EL 3PWNA 4WW2B 3ULSB 4NIKB 5SV3A 3H8NA 3MRKA 5JIKA 4QTIH 3LRSB 2VXQL 5CJ5A 4JVWA 4UUJB 4JZNA 1ZHNB 1DDHA 5TDNB 2EIDA 3RWJA 5ITBH 1YEHH 1NSNH 2DM4A 5ESVB 1H5BB 4Y1AD 1AI1L 2IQAB 5IW6A 4XPHL 3IFLH 3QUXA 5EG6C 4P23A 3FO2B 4NWTH 1LP9F 4K8RL 3B6SA 5BJTA 1YA5A 4I2XE 3VRJB 1U93B 4KRMB 5AYUL 4D9LH 3S8WA 4Q0XH 3QA3A 3ZYIA 2DQHH 5C0CD 2PCPB 2XA8L 5IVNA 1PZ5B 4G8GD 2ICWA 4NQDE 2GAZA 3KPQB 5KOVC 5HYQA 4OQTA 5FA3A 1BD2E 2XTJB 4F7CA 3IS1X 2YPLD 4E9LA 2KQNA 1UXSB 3GMRA 2X6MA 1R3IH 2PTTB 3TA3A 4GKZA 1BQHA 3OKKA 3BISA 4G6ML 4P4KA 3VFWA 1HN1A 1FNAA 1KTLA 4RIRA 5IG7A 2XNAB 2R2HA 3VFNB 4YE4H 4PJ5D 5BVJB 3KYNA 4PRHE 1W0WB 1MJUL 5DHVA 5LGJA 5DMIL 2CKBL 2DD8H 3HFMH 3QUKA 3MQIA 4OZGA 5D2LA 4GG6E 1ODAA 4FQLH 1BD2B 1F58L 4ODTH 1WSST 3TBSB 2KL6A 3X17A 1ZHLB 3O6FC 1P6AB 3V79C 2B0SL 4O2FA 3OKLA 4AZ8A 2FX8H 3HI6L 5FM5M 3NN8B 4L4TE 2NR6C 2JK5A 3NH7L 4XTRD 3QG7L 4LVNC 3QIWB 4LPVA 2ZUXA 3I2CH 1A5FL 1YC8A 4M61A 4GBXD 5ANMB 1K6QL 3NCJH 2YPKA 4FQ1L 2BNRE 4MDJB 3W5MA 4ZTPH 1JMZA 4KKAD 1C5CH 2XY1A 1PZUB 1P5UA 3FZUD 1CVSC 2IFFH 4M02A 1E0OB 4OLZH 4XNMA 5IJVB 4XBEH 2PF6A 3BH9A 3L3HA 4ZO7A 3S4SB 4J6RH 4KROB 1NBYA 4JCLA 5HYJD 4N5ED 5E99H 2CIIB 2XPGA 3O4LA 3VW3H 3P0VH 4CN6A 3N50A 1HINH 3UYRL 1S7VA 3LS4H 4KZEH 5K33A 2V2WA 3QPXH 1BOGA 4F8TA 5HJ3B 4MLSA 3T3MF 2G75A 3QNZA 2G60H 3PWPB 2L7UA 5DA0B 3B6SB 4FQCH 4H8WC 5K59E 1U8MA 3X3FH 2I5YL 5I8KH 1EAJA 2ZWLT 2LAGB 3DX9B 5F9WB 1PVHA 2X1WL 4QXGL 3S4SG 1ZTXH 2XOTA 1DQQB 3Q1SL 5E4IA 4FQIH 3PNWA 1UM5H 3GEWB 4LCUB 2QSTA 4OGZA 4OJFH 4YEEA 1D5XA 4L4TA 1NUNB 2OJEB 5FGCB 1A6UL 5IB5B 5D2NB 4BSWA 3GMRB 3MNZB 2XKNB 1BHGA 1JPTL 2AQ2A 3DV6B 3IDMB 3KPSB 1P84K 4KK6D 3N1MC 4LSPH 5CAYB 4G6AD 1NC4A 2OSLB 4M4RA 5ETUA 4FA8A 1WIUA 3U7AA 1FVCA 4NZTL 2A6DA 2BSTB 4MLIA 4OF5A 2VLMD 4O2CA 4MXWL 2O5YL 2Q7YA 1LVEA 3FQWA 4P46A 4APQD 3ZL4L 3QDGB 1MFAL 2H45A 5GRXG 5C8JA 4YK4B 1IM3A 5IHUH 1KN2H 3K8KA 1QQDB 1N5YH 3QDMD 1P4LA 4PJDA 3O4LE 2MOVA 3HZYB 4JN1H 3QHTC 3UZQA 3DURB 4QOKA 4JCMA 4HIJB 1QYGL 5FGRA 5E2UH 3HE6C 2J12B 3RRQA 5CZXC 4AIOA 3GIZL 4XC1L 4FP8L 3MA9L 5I0DA 4F37K 3MV9B 2YD4A 1G7LB 2E9WA 4QRRA 5HVHB 3VXMD 2Y5TA 3UJIL 3KS0J 5C0DA 3FZUC 4RAUA 3Q0HA 1MCDA 5L0QB 3ARYA 1ACYL 5FM5O 1F42A 1KN4L 3SDCD 3O6KH 5GSRB 4PGDA 3P9LB 4L4VB 1OAXH 1T21A 4B53A 5EZIL 1U91A 4GT7A 1BJ1H 1NEZA 3I6KA 4OM1H 2X7LA 4LSTH 5DQJB 4LLVA 4OFPA 5E8NB 3DNKA 4FFZH 2X5PA 3GSNH 3LQZB 4UIMB 1RJYB 1ZANH 4HLZG 4HKBB 2HTLC 1RZFL 1KENH 2W1NA 3BQUD 5FV1L 4F3FB 5BW7C 3DGGB 3WDIA 3X3GH 2Y7QA 4FQ2L 2EXYC 4MWFA 3ZYOA 4G5ZL 4GW4A 1MUJB 3EDDA 3OKMA 1TCRA 3MROB 4JPVL 4NQSB 3FT3A 2D9QB 1KJ3H 4Y2DD 3W82A 2BCKA 4CVXB 5FGBA 3SBWC 1N59A 2O5XL 1JV5A 1AQDA 3I3EA 4DJMA 1V7NL 3NH7H 1I7ZB 3OGCA 4YAQB 4QRQB 1X7QB 4K7FB 4LRIC 1MRFH 3LKSA 4Y8AA 3CFCH 3LZFH 2YPLA 2BNQA 3RTQB 4NOFA 4OZIA 4NSKB 3KNBB 3P73B 3PUCA 1A7BA 1U41A 4HWZB 4IMLA 3ARUA 1FZJA 5DSCA 5IB2A 1TVHA 4XVUC 2Z31A 3BKMH 5CHNA 1S7RB 3W9DA 2XFXB 4Y89A 1FGNH 3CXDH 4QRTB 3C8DA 3C5JA 5T1MB 1OTSD 5I1KH 4IOFC 3LCYA 3HR6A 4LLYB 3GIVB 5CP7B 5FKAB 1BD2D 4HIXL 1IARB 4ZPVB 3VXUB 1MOEA 1R3IL 4XBGB 1F6LL 2D3VA 4J7RA 3P2TA 4WTZG 1DEEB 5GGRB 2P5WB 3VD9A 2L0DA 2GJ6D 1UYWL 4L1DA 5D70H 4E5XB 4OQTL 4IOIB 3GJFA 4OF6A 3QUYA 5HHPA 2GTZA 4LHQB 3K2UH 3HZMB 1EH9A 1MY5A 2Y4SA 3RL2B 3D85A 1WZMA 2FH8A 5HGHB 3KYMB 1AGBA 1YEFH 2AJVH 2X4OB 3MRDA 1EEYA 1NL0H 1GC1C 1KJ2H 2HWZH 3ZLQC 3U0WH 1OW0C 2OL3B 4QHNB 1T7ZA 1G6RB 4V1DA 1WWBX 1BBJB 4JG1L 1JGEA 4PB0H 1FZKA 2CMRL 1RZJL 4OCWL 4H8WL 3VU2A 3P9LA 4L4VA 3WHXA 1A7OL 1LK3L 4WHCA 5L9DH 4GRWH 4NDMB 1CFNB 1S7TB 4V1DD 3S9DB 3F5WB 1HZHL 1BFOA 3TBYA 4M62L 4NQDD 3FO2A 5FUOH 4KK5C 1L9NA 3FAWA 2FO1A 3ELAT 1W8NA 2RCSH 3LQAL 4N9OB 3PQYB 5T3ZH 4AY0A 5FUCE 4GG6F 3TVMB 5IBTL 4MD4B 3WFBH 4HUVB 1KTRL 4R4NC 4AMKH 5ADOL 1VSCA 1RJZB 3O3EA 2VDLH 4UINH 4RISH 3P4OB 4XXDA 5IGXH 4PJ5A 1YUHA 4DVRH 5ESAB 2H8PA 1HEZA 2V2TA 1OCWL 4PGBA 5BOZG 1D6EA 1X6NA 1MJ8L 3HE7A 3G5VB 3S5LG 3LKNA 5CP3A 5GHWL 2JLLA 4NQTA 5EFIB 5CEZE 1F00I 3FQRB 2AK1H 5CINH 5BO1L 1QBBA 4XP1H 4JY5H 3HPLA 1K8DB 4HX1B 2J4WL 4ZFGL 1I4FB 3MV8D 1RIUL 1BVZA 2PW1B 3WJJA 4G8IB 1HILA 2VOTA 4JR9H 3HG1E 1EHNA 5DJYB 2NY7H 5I1HL 5ICZB 1YYML 5CP7A 5FKAA 2R1WB 4N0FB 4JRXB 5LVEA 1UWGH 4YZFE 3IKCA 3C5ZA 4H1LB 4M6MH 3NCYP 4HZAA 3KPPB 5HYIA 3FQUB 3MUGB 5CFHA 2X1QA 5D5ME 1GHFH 5JDSB 2ED7A 1UJ3B 1A8JH 5IB1A 5EUOF 2A9NL 3CFEB 3O0RL 2WNGA 3ESVF 3QJHB 3KXFB 4J3UA 4CDGC 1MHEA 3ARFC 2D03L 3KGRA 5E8OB 3VDBA 4N68A 5FM4A 4U49A 3QZWA 1WBZA 4I18A 2AXFB 3O6FA 1BLNA 4BUGA 2A83A 4GUPB 5EU4B 4DZBA 5E9DD 1CBVL 2WW8A 3I6LD 4GOSA 4M43L 4R3SA 1Q8MA 4R0LC 1JZ8A 2ZG3A 1JGEB 2WIIB 1YPZB 1WF5A 5F6HI 3BQUB 1A3QA 1A1MB 1MH5B 3RZCD 3OPZH 1Y18A 5ACLA 5EUKB 1Q9KA 1QFUL 3WS6C 4PJGF 2LABA 2FRGP 1P4IH 1EZVX 4JZJC 1DVFC 1MCPL 1A3RH 1G7HA 1HH6B 1XF5B 3NCFB 5DUPL 3BE1L 3WHE0 2NW3B 3MLTB 1CG9B 3MJ9H 1MFDH 1KB9J 5C0BE 4XXCC 5LG1A 3UX9B 4LPXA 1G7MA 2D7TL 4OB5L 3RVVC 1KCRL 4OGYL 4FP8H 5HGDA 3TO4C 3OQ3B 4P2RE 1TVDA 2AJ3B 2C7UA 5DRXA 4HW6A 3S36H 4NQEE 4PJIF 4ODUB 3C60B 4NUGL 5H35B 3RVWC 4EKXA 1JPSL 4C55A 4KXZI 5D4QA 3LEVL 3BN9D 2CIKB 4C56A 5LQBL 2AJZA 2V9RA 2DQJH 1HQRA 3MACL 1G1CA 3O8XB 2W92A 3PIQA 3OB0H 1IQDB 3BP5A 3ZSSA 5EH1A 2YMXH 4QY8A 5KJRL 5CD5D 3H7BB 4OCXH 4HKZA 5IBUB 4HLJA 5F70A 1WAAF 1CLZH 3D0LB 3EOTH 3VXOA 3AXLB 4ODWB 3JUYA 3ARSA 3QDJE 1NCNA 3AUVA 4KKLD 5DMJB 1EZVY 1VA9A 2SEBA 5IP4A 1LO2L 1FFNA 3I6LE 4JFXA 3TYFB 4ODXB 4YBLC 1KOAA 1MJ7L 2I60H 5TGBA 3BZDA 1MY7A 2MQ3A 3T2NH 1MFCH 1U8JA 1ZSDA 4LSQH 3IKCB 1FAKT 2X4RA 3Q1SH 2CXKA 4F7TB 4G6KL 2E7MA 1T89A 4Y1AE 1X4XA 1IC5L 2VXTL 4BFIA 3CVHL 4XWOC 4EDWL 4PRIA 5AUMB 2NXYB 4OD2B 5EORH 4JM4L 3KWWB 4H5SA 4OGYH 4F9PA 4Z76A 3OJMB 4M7LH 3U0PB 2A83B 1FZOB 4TPRH 5FA4A 3G6DH 5I0ZA 2QQKH 1NMBL 3C6SB 2XXCB 1WISA 1HE7A 1MELA 5IEHA 1WT5A 2X4NB 1E4WL 4XNXH 4K07A 4XMKL 4TVPD 4EDXA 1P7QA 4OGAC 3RNQB 4I18C 4QRPA 1IBGH 3DETC 2YSSB 1QLRA 1IVLA 1OW0A 1H8NA 1T83A 4NCDA 4X80H 3LV3A 4RA3A 1CBVH 1D5IH 1B0GB 4GAJL 4ACPA 3KAAA 1PQZA 1I1CA 1RUKH 3MLRL 4TTDC 2VN7A 1BOYA 2UYLA 4S1SL 2OZ4H 3MLUH 1XGRA 1YQVL 4QRQA 2ADJA 1A7OH 4GRMA 5CD3A 4NC0B 1XGQA 3O6MH 5IVXB 2PTVA 4HC1H 1GC1L 1IAIH 2N7AA 1OAYH 1OGAE 1UVQA 2A9MH 3F58H 4O9HH 1T5XB 2GK2A 3H3KA 2GTWB 1SMAA 4PRIE 4KK9D 1UFUA 4L3ED 4WWKC 4ZO8A 1N0LA 4NO5B 5EOCH 1HH9B 2OXGA 4XNUL 2YBRB 3IGAB 5EIQA 4A2LA 2ID5A 2XRAH 3GIVA 1MF2L 3ZDYF 2VQ1B 4P9ML 3S6CA 5DVMA 1R3JA 4P3DA 5M7QA 2PR4H 4FS0A 4KMTH 4L1HA 1YNTB 5DTFB 1R0AH 2I9TA 5L2KB 1AP2A 4A6YL 4XAWL 4J4PD 1OARL 3JV4A 5IKCB 3NIGF 2FJGB 1DN0B 4P4KC 3WO4C 1RD6A 4WI8A 3KPQA 2Y6SC 3P9MB 5I1KL 3CH1B 4TPRL 3WIIH 3QDMA 2YPLB 3DO3A 4DN4H 2Y07H 4JQIH 4AH2B 1O0VA 3NBNA 1MCJA 4R2GB 1ZVSB 2NY1C 3OHXA 3B3IA 3GSRA 1QLEH 3HRZB 3PHQA 3U4EB 3CZFA 4LFHD 4HMCA 1TVHB 4XVSH 3L3GA 3O45B 4LNVA 1L4IA 3BZ4A 3IXTB 5FDYA 1RFDL 3ILQC 3VA2C 4LSVH 1NC4D 3OAUL 4WUKH 3K2MC 3DV4B 1AR1D 2R29H 5JHDA 8FABA 4O2FB 1GZQA 4PG2C 4YHIB 3EYVB 3MXWH 3S37L 2XYCA 4JG1H 1VGEL 1M6OA 3OKEA 1X5JA 3RNKA 4AEIH 1JPFA 3SDCC 3GUTB 5MI0C 5ADPH 5BCAA 4MSWA 3QI9C 2FZ3B 1JRHH 2WINB 4WV1A 1U3JA 1Z0MA 2DMCA 2VDQH 4JGJA 2R69L 3GB7B 1CWVA 1NFKA 1U8OB 5DRNA 1Z9SA 5E9DA 3AB0B 5F7WC 1NMAH 3IJSB 1IC4L 4OKDA 1HQ4A 1BBJA 3MACH 5ACZB 4PJCA 2EKSB 2DTMH 4N1EA 5I1DB 3EFFA 3QEGL 3LKQA 3RWEA 3V52L 1UM6L 4F2MA 1IGCL 4Q9CA 3BH8B 3B9EA 3UYPA 3FN9A 4PLJD 4QCIB 4CDHA 4NN7B 3RWJB 3I6GA 4HF5H 3FFCD 1F45A 2Q76B 3WDJA 3LRSA 1AHWA 3DIFA 4JQVA 4F7PB 1INDH 4YPJA 4XAKD 3FQXB 2H2SC 5DVLA 2E7CA 2IG2H 3MLVL 2GQHA 5FF6B 2E8YA 3OSKA 4J23A 3UCRA 1QRNA 3IU3B 4FZ8L 4JFEE 3W0WD 1RURL 3BD4A 3PABA 4Z9KB 5I30H 2W38A 4WEUD 1QLFA 2OL3L 1X7QA 3DMMC 1HOCB 1X5LA 2P8PA 4Q9QL 2HKHH 3KXFA 2EDNA 2D31B 3OXSB 4X6EB 3W0WA 1PKQE 1YEKH 2BJML 1I7RA 3BGFB 1FL6A 3MA7A 1IEHA 3CMOL 1CGVA 2COQA 3QUZD 4NYLA 3HC0A 4NBYB 1QNZH 3QHFH 3D39D 3VFOB 3HRZA 2PW2B 5GGQH 4JFOA 4QRRE 4R26H 3RIFF 4MNHA 4GSDL 3TVMD 3PL6C 1DQJB 1JGVL 4KHTL 5T1MA 4NUJA 3UTZA 2EO1A 3FO0L 5DO2D 1UWGL 1XGYL 32C2A 1KCUH 1KJ2L 3U0WL 1NDGA 5DZNA 3RAJH 3ZTNL 5DXWA 3DSFH 5DD3L 4Z7WA 5HHVH 2ZUSA 1B0RA 8FABB 4PJGB 4KPHH 5T3XE 2FJHA 5FO7A 4MB4A 3F62A 3W11C 4OFYA 3FB7A 4RGOH 4PGJA 1NCWL 3S96B 5FO9B 5I18H 4Q58C 1FIGL 4A6YH 4WI9A 3ZT6A 4OTXL 2LU3A 2CJUH 2ENSA 5BV7B 3CH8A 3WLBB 3WSQH 2JK5B 3IFOB 2ZOLA 2W9EL 1JF1A 3CUPA 1T0NB 5F97E 1EEYB 1MF2H 2AXFA 1QFWL 2CRMA 1KXTB 3REWA 3CCHB 4UNTA 4MDJA 1RZIA 3I9GL 4Y4HB 3G5XA 1EERB 3PHOA 5SX5H 5IM7B 3D25A 4TTGA 3WFCH 1JCKA 2GFBA 4XHJC 5FK9A 1BZ9B 2EC9U 1HSBB 3H3PH 2DL9A 1UKQA 3HCVB 5E00A 2HFEA 1U8IB 5BZDA 4PGZA 5DURB 3MPCA 3VRLE 1UB5A 2BRQA 3UTSD 4EIZC 5BVPL 2VISA 1YYLH 5TQ0L 3GI9H 3VFMB 1ZHNA 1U8KB 1K5NB 2X05A 1YZZA 3BD5A 4CBPA 1NDMA 2Q8AH 4LIQH 3UJJL 4M62H 5INDB 4M5YL 1Z2KA 4HGMA 5E03A 4N0YH 3KDMA 3ROLA 1CF8H 1KJVA 4WUUA 3BEVB 4G9FA 4PJ5B 1MCRA 2MCPH 5C0JB 1SM3H 2P42B 1DQQA 2APBA 2P5WE 4LCIH 5D70L 3MLWH 3WN5B 2IF7A 1A2YB 1MIMH 3K74B 1MNUH 1A9EB 3V7AE 1BBDL 4YHLH 2HVJB 4P2RB 1UZ6F 4MNGA 4ELKA 5AG8A 3AREB 4TUJB 1N5AA 1TZIB 5I18L 5J3HD 3NA9L 4OCYH 2FSEA 1HK6A 1AXTH 1HHGA 1JGDB 3EO9L 1YY9D 4NRXB 3JV6B 3HI1B 4KPHL 1G6RL 2ORBH 5T1DH 3GSNB 1CDJA 1Q94A 3ARGB 3JTSB 4N0UB 1EAPA 1G7IB 3DX7A 3IDNB 1IAKB 4M6OH 4WFHE 5KAQF 2FECI 2BX5A 2OSLA 2UUDK 4I0PC 1CR9H 2R1WA 4PPTA 4M5ZL 4Y4KD 5D5MF 5TGBB 3VWJC 3SDAC 1MLCB 4DTGL 3H3PL 5DT1L 3FT2B 3N9GL 2MMXA 1LEIB 1CTOA 5LCVH 4OIIL 1XH3A 5E2VH 4JANA 4LSQL 4X8JA 2XQBL 1CGUA 1CLCA 1FCGA 4RMRA 5F3BB 2R56H 1WBXA 3QULA 3QUYB 1F4YH 4PRBB 4KDWA 1QBAA 2OTPA 2D0GA 3VXRD 4RWHA 5DJDB 2JIXA 1BVKB 2VAJA 4Z76B 1DLFH 5HYJE 5DYOB 5F7MC 2BSRA 1X5GA 1IGYB 4YH6A 3EJYD 1JK8A 4PD4K 2A1WH 1CLZL 2NTFB 1C08A 4MMXC 5IB3B 4R3SB 2FBJL 5JPNB 1JI1A 2QQKL 3H9SB 3QAZB 3GHEL 4MMZC 1DEDA 1FC1A 4QRUA 2DKMA 1J0JA 2CD0A 4JB9L 2YPVL 4MCYB 1ZOXA 4UIMA 1XF4A 4Z7VB 1GGTA 4XVTL 3TO4A 1RUML 4Y4KC 3JWDC 3T77A 1A6PA 1G7QB 4IMKA 3TIDA 2R0LL 5EPMA 4BELD 2VXUL 4KV5E 4YE4L 5LWYH 4KH2A 4JY4B 4CAGA 1Q9OA 1RJCA 1K3IA 2Y23A 3ALPA 4NGHL 3TIEB 4HKXA 4G6MH 2OTUA 3I85A 2E3VA 5GGSA 2HT2D 4AIZB 3DVIA 2FIKB 1DQDH 2DICA 1P84J 4U1KB 1LDSA 1P4IL 1LE9B 3VXSE 4ZFFB 4OUUB 15C8H 1G84A 3TYGH 3QEQB 4PJAF 3S7GA 1JPGB 3KPOA 2YKLL 2EIZA 5T1LD 4P2RA 4ELKB 3MJ8B 5L8KB 3MLZH 4FQJL 4NSKA 4CNIA 5EA0H 4NJAH 5AEAA 4HMDA 1BJMA 4XAKE 5HGAB 4BUHA 4GW5B 2XN9B 3BPLC 4JFEB 1SY6H 4U33A 3QEQD 5IB2B 2ZKHH 3IGAA 3D2UD 2H26B 2ARJQ 1QO3A 4HS8H 5IFAL 4YUEH 4K2UH 1DJSA 2HLAB 3KPLB 4JFPB 1I1FA 4JY6B 1VENA 4MA3A 3SO5A 3GDBA 3VMPA 1J8KA 1KCSH 3OG6B 4N0FA 4PJDB 4C59B 3CFJB 1LP9E 1C5CL 4PRDA 2RR3A 4DKEH 4MSWB 3QDJA 4FQIL 1W72B 4XCFL 1GGIH 4Z95L 1YNKL 5K9KB 1KJ2B 3DRTB 3SDXE 3X13B 4Z6AT 2CLZB 3O4OB 5L8LB 1FJ1B 4U6XB 1QFUH 4RFEB 1CLYH 2E9BA 5D7KD 4Y5YC 5TE7H 5KTEL 3C8KA 5LGKA 3D87B 2ZUQB 3DVNB 3MV9A 4Z0XA 2H32A 4U1GB 3I6KB 5SWSD 2D2OA 2V7NA 4G7YL 3O6LL 1C7SA 5KVEL 3H9SE 3BWUC 4YHNA 1I3RA 1SM3L 3L5IA 1MEXL 4F15C 1BQHG 1AD9B 2X4QB 4BJLA 4ODSL 2R29L 4YDVA 3V5KB 3L1OH 1B6UA 1GIGL 4PR5B 5E8PB 1H3VA 4GMSL 4PJDF 4UMGA 1JBJA 1A6TA 2UZIH 3O9WC 1F2XK 3GKZA 1C8PA 1F90L 3QHZH 3RVUD 3UPRA 4HKBA 4HK3N 4QXTA 1KFAH 4EUPB 2MHAB 1TJHL 5DVNA 2VDNH 1IMHC 4OFKA 4PJ8C 4L29A 5DEGA 4R4FH 5I8EA 1IILE 3JVGC 2VLJB 4LASL 2XTLA 1ZV5A 1T7YA 1MVUA 1EUUA 2P8PB 4XPAH 3F7YA 3OTTA 4NKMA 4PFEA 3U0TB 3ILPB 3DO7A 3GO1H 1IAOB 5DEFA 3OKYA 4JO4L 4BH8B 2M2DA 1VPOL 3RU8L 1RHFA 2A2QT 1LD9A 4M7KH 2VAAA 3CLFL 4LCCA 1I8MA 3DV6A 3IDMA 3IDYC 2QSQA 5IHLB 2WBKA 4IMLB 1A6WH 4U0RC 3FQNA 4YHOL 3GSOB 2UWEA 1BZQK 3BPNB 2BNQB 3FN3A 3ZO0A 5CJXC 2CR3A 1ZLWH 4W70A 3VGHA 1DBJH 3DXAE 2CLVB 3MCKA 3T2OA 1QRND 4K3DL 4F80A 2H26A 3QWQB 1TVBB 1DE4B 1ZA3A 1FNLA 5C8JB 1FO0H 2BY0A 3BDYH 5DWUH 1DL7L 2VITA 1INQA 4NQEA 3FO1B 3WD5H 4X7TA 5GS0D 4UTAL 1A7PL 1NGYA 1QFOA 2ZP0T 4PRID 4YFLI 4EI5C 1DR9A 4PTUA 1MI5D 1XIWD 1V8HA 4D9QE 1U36A 4ZYKB 3CUPB 5E24E 1NGXA 3HS0A 1QFWM 3O3UN 1KIPB 3OL2A 5GGRY 4YXKL 1A0QL 4P5TB 3SO3C 4EI6A 2NXZC 4RNRB 1YQVH 3NZ8A 2RB8A 4KHTH 3QZWB 5I8CB 5JUEH 4GAJH 5I2IB 4O2EB 2BP3A 3BZEB 1HSAB 1NCAL 5E00B 3HPJB 1QPXA 4BKLB 5L7XH 1WAAA 3QRGH 1EEQA 4HWEH 4J1UA 3LZFL 4JKPH 4M7LT 4G9FD 3WV0A 4QYOB 2I26N 3MOBH 4MJ2A 5TDNA 1FO0A 2AXHA 2DIAA 2PYFA 3DSNA 1B0GA 3OX8B 4H25A 3K0WA 4CW1A 5ACMA 3GSUB 1J7VR 3X11B 3MBEA 3N1FC 3CXHJ 5KOMC 1MHCA 3U4BH 2YC1B 1XIWC 1AC6A 4GG8A 5EIIB 3ZTJG 3BYYA 1LEKB 3SCMD 1R3LA 1TQCC 1FNEB 5ENWB 1MAMH 3SKOB 2PCPA 1LNUB 3V6FB 1LEGA 2AAVA 3EYOA 4HCRH 4TUOA 3HG1B 3TA3B 5EO9A 3HMXH 1S7UA 1ZVYA 3OXRB 5MENE 1KNOB 4PGEA 3MV8E 3HCVA 2VKXA 2LQRA 5D7SL 3GI8L 3D0VB 2DLFL 4NO5A 5HDQH 3GGWA 3U4AA 5DS8A 3NIGE 3LPGA 3QPQC 1IAKA 3RWFB 4G6FB 4Y2DB 2A6KA 1F11A 4MCZB 3BMVA 2R2BA 5JIHA 2YA0A 5DTFA 4X6CB 2ATKB 3EZ8A 1OAYL 4ZS7L 4ZFZA 4Z78B 1J12A 2HT3C 3V4UH 1RHHA 2NPLX 1YDPA 4O58L 3H9HA 4FQJH 1KELL 1RZJC 4HWEL 4L8BB 2LTQC 1AGCA 3GBML 1FAIH 4IJ3B 1N4XL 3DROB 4PRBA 3QP3A 3MZGB 1UKSA 3DYMA 5A3ID 4NRZA 1UH3A 2DQUL 2P8MA 5FV2A 1ZSDB 4YHZH 1CGSH 5JW5B 2BC4A 3D69B 2MTPA 5F7LB 3MUHL 4O02H 1CFQB 5BS0A 3D3VB 5LWYL 2W9LA 1DQJA 5GQBA 4MVBD 3T3PF 3MRDB 2IANB 2A0LD 1L0YA 5FYLH 2BXZA 1QSED 4XP5H 4XVTH 2RFXB 1BWWA 3VGBA 3HB3C 3BT2H 5J13C 3VA6A 4Z7VF 2FWOB 4Q6IA 3ARXA 2X44D 5D2LF 5AD0A 4NFBA 4K23L 2G75B 2BNQD 3QNZB 4QGYA 5MENB 4EXPX 3FTGA 1JPST 2NW2B 1MUJA 1WFOA 3GSUA 4XVJH 5I73C 2JIXB 2UYLB 4WWKD 3UYOD 1T0NA 2BHUA 1NC2A 4MXVF 4L5FL 3FQTB 4RBPK 3P11H 5LGHL 5T5FH 4A6YA 2H1PH 3MNVB 3BRGC 1WCBA 2EXYD 3VWKC 1D5XB 1OP9A 5C86A 3LS5H 3MRIB 5DMKB 5EOTA 1PY4A 1E6JL 3WJLA 1V5JA 3PNWB 1AGFA 3SJVD 2BFVH 2HLFD 1A3LL 4NCC1 2P8LA 2PKDA 3WHE1 1T5XA 2MFNA 1BQHB 4H88H 1QO3B 2XFXA 1G7QA 3JWNC 3PF2A 3MV8A 1MRCL 3MRJA 3MJGX 1RUKL 3MLRH 5DD0H 4AJ0A 4LHUB 4PJ7A 4N1HB 5MEND 1NCDH 4LLQB 4H8WH 3CFJA 2JB6B 1J86A 2HN7B 2ZCLL 5D5MB 4HUNB 4EUPG 3HFML 3GI8H 2HFGL 4JPWH 3PQYE 3JSSA 3RI5F 4L8BA 4F37F 4NHCL 1KXQE 3QXVA 1D3CA 4U1NB 5GISH 3SY0B 3L95B 3ET9F 3ARDA 1SMOA 4RGMC 3ZKNC 2P1YA 5E2JA 1IAII 4NN6B 5C9JA 3PL6A 1A3RL 4MAYC 4V2CB 4ZAKB 5KTEH 3BO8B 4PJ9C 2VDLL 4POYA 4C56D 2W65B 3G6JA 3RQ3A 5C0IA 3M17A 3EYFB 1CFQA 4HH9B 1Y6NR 3D18A 5I6XC 2GJZA 1VKXA 4HD9A 2Q8BL 4NO2A 5HI4C 4JDTH 3QWRA 1OTSC 4IM8A 4ETYA 3ULVF 4S2SA 1CGSL 2DMKA 3DV4A 1LWRA 3A0OA 3SQOH 5KBNC 5C0AA 2B2XL 1QSEA 4O4YH 4FFVD 3INUL 4IHOA 3Q6FA 4LEXH 1XH3B 5GRVL 3Q5OA 4TOYH 3CDGB 3ORJA 2YS4A 1N6QH 2G5BA 1CFTB 3DUUB 5B39G 5MENA 4B0MM 4HWUA 3TT1H 3VFGL 3QO0B 3CK0H 2ZOKA 2C26A 3GMPB 5H8DA 5D6CB 3QNXA 4WHDA 1T7VA 4PLOB 1JZ2A 2WUCH 2VH5H 4P23C 5F9JA 3K46A 3VXPA 2C7UB 3NMEA 4PY7A 4V2BA 5DRXB 3HAEA 1N0XH 4LCUA 3LQAC 3KLHD 1N7MH 3C9NA 3BEWA 3RTQA 2R0ZH 1IQDA 1MCKA 2GSIA 4IS6B 2GTWA 4K3EH 4YGAB 4M1DH 1ROWA 5DURD 1GZPB 3GSNL 3V6OE 4XRCA 4LSSL 5EWIH 3KLAB 2DL2A 1T66D 1XCTA 4D9QD 3B9AA 3FO1A 5ICZA 1OAXL 3L6FA 3MNWA 1IEAA 2ZPKH 2VL5A 1VHPA 4P2OB 2GI7A 2J8HA 2BVPA 3OKMB 3P77B 5JXED 4E41A 4OGAD 3QDGA 4W6YB 3S97C 2BVYA 1K85A 3UBXB 1S9KC 4QT5A 3VJ6B 3ZDZE 3H9YA 2X1OA 3V6ZB 1JNNH 4HPOH 2EIZB 3LD8B 4RNRA 3TNNB 3V4VL 4HUMB 2DMBA 1XCQA 2NY4C 4HGKC 1S7SB 3IFLL 4P59L 4XNYH 3CPLB 2NTSP 4U3HA 2Y06L 4YR6B 4K9EC 1QSFB 4X6EA 1DLFL 1P53A 1XF1A 4GRLC 4JFEA 1S9VB 4KY1L 3INUH 2IG2L 3MLVH 4LEXL 4OD1H 1SYVB 1OP3K 4HH8A 1KACB 3KPRA 3OKKB 3SGKA 2DQCH 1FZKB 1RZ8A 2I24N 4WDIA 4PJ9A 3TBVA 1NLBL 2QBWA 4GS7C 4C56E 3GMMB 4PJFA 3HR5A 3HUJE 3O0RH 4FQHA 5E2WH 1ONQB 1UADC 2IEPA 1I7UA 2Q87A 3K81A 4G9FE 1EJOH 3QDJB 4BFEA 2J7LA 1ORSB 4NQDB 4Z7VE 3SE3C 1TQBB 4JHAL 2R2EA 1F6AB 1H3WM 1NCCH 2C1OB 3QEQE 2V2WB 1SJVA 4KRNA 2ZCKL 3MZTA 2ILLA 3QQ4A 5T1DL 5DF0A 3UMTA 4EI6B 1MFBH 4NC2B 1VACA 5EU6A 2F74A 1IQWL 2DQEL 5ACZA 5JW3L 1EO8H 3SOBH 2OYPA 4NNYB 5KG9A 1UACL 4U2ZA 5D1ZA 3P4OA 1XGRB 7FABL 2CKBB 3E6HB 4Z95H 2YHGA 4PP1D 3HE7D 4P23D 4FQPA 4XP1L 2BSSB 5ICYB 5J57B 4RQQB 2B5IC 3ZKMC 2F58H 2E7LC 2NZ9D 3GJEB 3ARWA 1S5HB 1G7JA 1B2WL 1M7XA 3QHFL 3KNBA 4JLRA 5CIPB 2ZG2A 1UWXH 4P5KA 1PKQB 3T8XB 1I1YA 1AXSB 4U1LA 1M05A 4DZ8B 3G08A 3MBEB 4FQXD 3T4YA 4UTBL 3ZDZF 3LEYH 1Q38A 5DQ9B 4U1IB 3WUWB 1OB1B 3WBDA 3KPSE 4OCSL 5T3ZD 2PUQT 1EJOL 3QUXB 1GC1H 1IAIL 3VDCA 4RFNB 1IE5A 1TZHA 2IFFL 3RX8A 2AVGA 1QBML 2RCSL 5FXCH 4U4BA 3RY5A 4FXKA 4JDVB 1OF2B 5IMKB 4WO4C 3C5ZB 4H1LA 4PJCF 5CSZA 3D1MC 1KEML 4LSDA 1IFHL 4KQ4H 3MUJA 1D5MB 3CFIC 4ODHL 4XCEB 1MI5A 1ZKAA 4X4XB 4RAVA 5FKPB 5FUZL 4XMLH 2W9EH 1AJ7L 4F57L 4FQCL 1UXSA 5D2NA 3SDAD 1P1ZA 1HI6B 1GJIA 4Y5XA 2BMKA 1CN4A 1T20A 1VFMA 5GJSL 2VDRH 4CMMA 4NN5B 1OD9A 5KVFL 5C7XH 1YEFL 2AJVL 4GUPA 5EU4A 4DFHA 1RZ8B 4DZBB 5JW4N 2NY5C 2MSPA 3SQBA 3ZHKA 4Z7WB 4MA3B 1T1XA 4PJ7F 3BQUA 3IJHB 2IMNA 2R0WH 3X14A 4FNLL 3SN6N 3KYOB 4NUJB 3TH3T 5DRZA 2VABB 1WIPA 3BESR 1WEJH 4LLVB 5E8NA 3MOAH 4TNVK 5JPMA 3D3VD 1X44A 2C1OA 5GS2H 1A1OB 4LPTA 5GRWA 5SWZE 1AIFB 2AV7B 4PP2B 3EUUA 2ZJSL 3QDAA 1UH2A 2MCG1 25C8H 1FSKC 1SQ2N 2VLME 3DBXA 3ECBA 2BDNH 2FZ3A 3QO1B 1U8LB 1K6QH 1UVQB 3D3VA 4AK1A 1X5HA 1F3DH 2PXYA 5EUOA 5FDWB 3SCMB 2WUCL 5CCKL 3EO1A 2HJFA 3RWEB 3OAUH 4WUKL 5C70A 5GZNC 4CVXA 4FQXC 3T1FA 4U6VH 1FP5A 1I8LA 3MGAA 3I6GB 2J5LC 3S35X 2ATPA 2QADD 4QOKD 2EE3A 1H3TA 2Z8SA 5HYFA 1A22B 1LO4L 5D93C 4Z7WF 5E9DE 1CQYA 3DVGB 1NUGA 1I3GH 1UH4A 4ZXBD 3LN4A 3U7WL 1ZMYA 3UTTD 5FCUH 1VB9A 3HE7C 5IV2A 4PGCA 1FZJB 5DSCB 3VXQB 3WFHA 4C58B 5TE4L 2P5WD 5KSVA 1GOFA 1J8HA 4X4ME 1GCFA 5IQ7H 3E8UL 1IAMA 4HFUL 1IEBB 4PRAB 3F7YB 4KK6C 2Y7QB 5EU3A 4DTGH 1DSFL 1DBAH 4UDUB 2I5YH 1QRKA 3MV01 1CDYA 3NTCL 1Z3GL 1FG2A 4JDTL 1T1YB 3KPPA 3GSVB 5KVGL 2AJYL 3ZKQD 1PEZA 1PLGL 5JR1H 1DUYA 4P2QE 3E3QC 1P5VA 5J06A 3L5WA 2I25N 2NXYD 4MYWB 2VLKE 3HUJA 4H26A 2EDQA 3VDAA 4WO4A 5KN5A 4HCRA 4AT6B 5CJOL 5BRZE 1MHPL 3D0LA 2X89A 1T2QH 3C8HA 4LHUD 5I8OL 1AGDA 1WLHA 3RY6C 5I1JL 3QISA 5AWNL 4J6RL 3RGVB 1QFHA 2K1MA 1FE8H 4NZRL 1RI8A 3TWCH 1NCAH 4LCWA 4U6VL 4MXVE 1T7XA 4G3YH 3SDXA 2Z8WC 2GCYB 3ZDXE 4UQ2A 3DX7B 2VXQH 4Y5XC 2D0FA 4PRDB 5JUEL 4P2CG 2BVEA 2PO6A 4LVOB 1RIVH 4HJ0C 1P9MC 1I8KA 1MIEL 3OKOB 4ZFOA 1MPAL 5LXGL 3I9GH 2ARJB 3GSXB 1MCQA 3I2CL 3X13A 2YPKB 3MRBB 1AXIB 1B90A 3QPQD 1AKJA 5A2IH 2YD9A 4PRIB 2H3NA 3CXHK 4M7ZC 5HHXH 2ZCHL 1V3KA 2JIXD 4ZOAA 4WGVB 5IJVA 3UTPD 4OB5H 4I0KA 4ONFH 5EN2B 4HXAH 4OT1H 5GJTL 4LSPL 2J3SA 4HWBL 1HSBA 3MUZ1 4MHHI 2BSRB 3LPFA 4JR9L 1RUQH 5E8DL 4GAGL 5GS0H 3QUXD 3WFDL 4B5EA 1D6EB 3K1DA 1TJGL 5H2BA 5CKGA 2F54A 2FWOA 2DDQH 2OCFD 4P2QD 1GL4B 4B7LA 1XCTB 3FQRA 4DQOL 3PV6B 3QQNA 3ZKXC 4OTXH 3HPLB 1F02I 2Y9RT 5FUZH 2YD5A 2ADFH 4QOKE 1X6LA 4XHJD 2EKJA 1MHCB 5J0BA 1B4RA 3BEVA 4U1KA 4P99A 3FQTA 3UJJH 5DI8B 4X98A 4JO4H 1KCVL 3EJZC 1JNLL 1FDLL 4Q9RL 1MCHA 2FX7H 1Q9OB 2VE6B 3U6RB 5DEGB 5CMAA 5E6IB 3VXRA 1RJZA 1U8JB 3O3EB 3RUGF 1VCAA 5DQDH 3TA3D 1QUNA 5FYJE 4GKSA 1HHGB 3GBNL 3U46A 3SDYL 4UTBH 3IU4L 4IRSB 4YIQA 3CZJA 4K94L 5IB1B 3L3GB 4DKFH 3AMKA 2HT2C 5F7NC 4WFGE 4NM8H 1TZIA 5DHYA 1G0DA 3LSOB 3TBVB 3U9PL 3L1OL 2VXSH 5GGTH 5F7UA 1NAKH 5I76A 2D7QA 2GITA 4P3DB 1LP9A 2X1PA 3VRLF 4HF5L 1FFOA 4E41B 5IW3A 2IMMA 1CU4H 3T08A 1EGJL 3MXVL 1FPTL 3EHBC 2E7BA 1UACH 5T3XL 3OKEB 2VMFA 4KZDL 1SBSL 4DUXA 2XZZA 3VXSB 3OJ2C 2EDRA 3CAFA 5IIEB 5CJOH 4PJEE 3SDDD 1YEGH 3TT3H 4NRZB 3FT4A 3WNPA 4HWBH 3FB5A 4TSCL 4PJAA 3U1SL 1YY8A 4Y19D 5EO0A 5DJ2B 4R4BA 4JANB 1AO7E 1JTOA 3WIHA 2IAMA 2FJFA 2AEPL 5JDSA 1CLOH 1I1AB 2XY2A 3DVNA 4Z0XB 4BZ2H 4R96A 2CKBH 5DK2A 1VGKB 5DVOA 3EFDL 3BGMB 3D25B 3UO1L 4U6XA 4GKOA 4Q7DA 3RL2A 4Q6IC 2IGFL 2WBJC 2N56A 3BH8A 1HHKB 4G6KH 3STZA 4MA1B 1N4XH 2YK1L 1Z9OA 5D72H 3IETA 3MRKB 4ZXBA 1J0KA 3U9PH 2V7NB 3WNOA 3GMNB 3VFTB 4JFDD 1IKNC 3JV5A 3NA4A 4F9LC 3CSGA 3BUYA 2IAND 3DVFA 3E6FA 4XGZB 3OKDB 2QSCH 4TRPL 4X0KB 4KKNA 5FGCE 1Y0LB 2NY5L 1QRNB 4WV1B 1DQTA 4X6CF 2AK4A 3VWKA 3U83A 4J3TA 2OR9H 1FYTD 2VWEE 1S78C 2F74B 4WFHD 5ISZB 4GG8B 4GKNB 5J11B 1XAUA 1G6VK 4K7FA 4A6YB 1V7NH 3B2VH 3NCMA 4EUPA 4B41A 4R9HA 4DN4L 2VAAB 4WFFD 3MJ7B 4QTIL 3VXPB 1D5MA 1X5KA 1NAMA 2ICWB 4G5ZH 3GMOB 3WDHA 3OWEA 2GSGB 5KSBA 3K4ZA 2H2PD 2VRAA 1A1NA 4U6YA 2OXHA 3MJ6A 4QWWC 4YJZL 2A74A 1QHOA 2C4FU 1CR9L 4ZUTA 2XQYK 3WFEH 3GRWH 4JFFE 1CL7I 5IQ7L 4XNZC 4LF3A 5JHDD 4BYHA 1IGIH 1F97A 4MVBC 2D4DA 3FHAA 4I77L 4JM2F 4I3GA 3WD5L 3V5DB 4YHYB 4OZFG 3WKMH 1LE5A 1ZHBA 5EB9A 5IK3B 2AV1A 3AXLA 3RVTD 4GG6B 4BH7B 3Q6GL 3QCTH 2ARWA 4XX1E 1DFBH 5HSFA 1EPFA 2QV2A 5GJSH 2QADC 3V6OC 5DJYA 1OAZL 4XNQB 5CWSA 4MZ3A 4ODXA 4YHIA 5DLMH 4TYUA 2CUHA 3MA9H 4Y1AB 4U3XA 1FL3A 1Q72L 3S96A 4YC2B 5CCKH 4MDIB 3B2VL 2KH2B 2VKWA 2Z93A 5J3HC 1JHLL 5JA9A 1FGVL 1OQOA 4PJAE 3IDXH 4UDTA 2EDOA 1T83C 1T20B 3O3DA 4NP4H 4U1JA 1BVLB 1KCLA 3WNNA 2OQJB 2Z31D 3UTQB 3E2HC 5I17B 1HQ4B 5F1KC 2GW5A 2RFXA 1H3GA 4FFWD 4NHUA 3B9KB 4NZRH 3C8KB 1XF2A 2VR5A 4LBEB 1WZ1L 3AGVA 3MRCA 1T03L 5D72L 5ID0A 5FIEA 4HJGA 1BGXL 4S1SH 4YNYA 2HVKA 4YDKL 3NVQA 1OT2A 4R8WH 1DQMH 4HXBL 2X9XA 1HHJB 2UV3A 4NT6A 3IDUA 4ZG1A 1ZA6B 4Y4HD 1U9KA 4LVHB 5DEFB 3WSQL 3ZE1E 4NHCH 2DOCA 1X5ZA 3QEQA 4ALAL 4TUKL 1LEKA 3LN9A 3P0YL 1CICB 4J4PA 4I5BA 3CVIL 1MFAH 3RWFA 1YNKH 2OLDA 3VGAC 4TVPL 1GOHA 2OP4L 5C71A 1BFVH 5GS1A 2FH6A 3AM8C 4GRWE 4LF3B 4IIQC 2HLAA 4O5LH 5D9SB 3VXQA 3WFHB 3D0VA 1JN6A 1SYSA 3CFCL 3OKNA 2KPNA 4WNQB 2H2PC 3X12A 5GGQL 5KVDH 3IXTA 3LHPL 4C54A 1X5IA 3H9HB 5ABDE 1ADQL 4DCQB 2OZ4L 3MLUL 5TDPB 1MIEH 3ZDYE 3ULVE 2PO6B 1F4XL 4PRAA 4LKXB 3FB8A 3RWGA 3VRIA 5D7JB 4I3RH 3OKOA 2NY0C 2WWMD 5SWZD 5C0JA 3LIZL 2BOCB 3L7FA 4AEHH 4IRJA 3PL6D 1M7DB 1SY6L 4KGJA 4KY1H 4XPBL 5FOJA 5BZWB 5HPMB 4X8JB 3TC9A 1HHIA 4P46C 1AGCB 3S3SA 5CILL 4PTUB 1CGTA 3LKRB 5D1QB 5C3TA 1R5IA 2BZDA 1U42A 4JREB 1QKZH 2NY2B 4UAOC 3VH8G 4KK5D 4M4PA 5GZOC 3RAJL 1MRDL 3NZ8B 3O6KL 1BM3H 3C6LB 5C0AD 4LCWB 1TNMA 4Y4FC 5I1DA 1ND0A 3QJFB 1E28A 2O5ZH 2VLJD 4KI5C 4PRPB 2AI0L 2VZUA 3EOBB 2GFBB 2OTWA 3FONB 4G8GE 4UOJA 2A0LC 5CUSL 3MYZA 4JPIA 1KPRA 3RFZC 4DUVA 2X4PB 1ULVA 2EECA 4NRYB 4JJ5A 2PXYC 1FYTA 4X5XB 2B8OT 4QYOA 2EZ0C 2NX5B 2E9IA 3DXAD 1KB5L 4FQXA 4LARH 3NIDE 4KMLB 4RWYH 3BOVA 5FCUL 1FRGH 3LRGA 2WSKA 5B3JF 5FYKH 1HNGA 4X6CE 1AQKH 4FQ1H 4FMFA 1WK0A 4MWFB 5D6CA 3ROOB 1DBKL 1IRAY 4JB9H 4C57C 3EHBD 4QRSB 1ZS8B 4Q0XL 3V4VH 1FVDB 4N90D 4IRJD 3D39E 15C8L 4IDJL 2FBJH 4GFTB 4QY8B 3FQNB 2YMXL 1HDMA 4HKZB 1R5WA 3W0WB 1BZ7B 3HNSL 3MV8B 3L3KA 1XF4B 4Z7VA 4LQFL 4MAUL 4P9HC 4OCRH 3KR3L 5HDQL 4NWUH 1JNJA 4OBRA 4EVNA 2KQMA 1L0XA 3GBNH 3IJYB 1QR1B 4PY8J 3LDBC 1IJ9A 1MHPH 2GY5A 4LNRB 3TZVA 1FVEA 1T89C 4L8SB 4WFEE 1JGUH 2YUWA 4YGVA 4NZUH 5GS1C 3MLPA 2R0WL 4NQCA 4M6NL 4ZUVA 5T1LB 1I7TA 1UC6A 3FT4B 5CMAB 3DTXB 1N0XL 1U58B 5AZEL 1H9VA 5DJ2A 1MFBL 4CN4A 5ALBH 2VH5L 3I50H 2VDRL 4WTZA 4DWHA 3KJ4B 4ZUUB 3VWJD 4PP1C 4OLVH 1XR9A 2Z4QA 3DXAA 3S34L 5SWZA 1JWMA 1ZHKA 3QEUB 3ZKND 4HSQA 3TNNA 4M43H 3WFBL 4CN1A 1D9KC 2EZ0D 4KUZH 1YMHA 1CI5A 1AGBB 3P30H 2PXYD 4QF1B 3MRHA 3FRPG 5KSUB 2X4NA 1OSZA 3HNVL 5DC9B 3G6JB 1MIML 1NBQA 2WWKO 5MEOB 1WUNT 1RZIB 4MQXD 4JFOB 1QSEB 3V5KA 4OKVB 3FRUA 4O4YL 2Y1VA 2CDEB 1WZ1H 2H6PB 1TMCB 4OCWH 2G5BB 4TNWK 4R97B 1JWUA 1KPRB 2Y06H 2ZUUA 1UG9A 3HKFA 4X6DE 3Q2CA 5FB8B 4MJIA 2HFFA 1N2RB 2HWZL 2LE9A 5DK0B 1ITCA 3BPOB 5FO7B 1YNLL 3D48R 3FFCA 2UVFA 1A47A 1OM3H 2E9JA 5SWSE 3GUTA 1FYTE 1VACB 5EU6B 4UOW1 4PLKC 2J88H 5T1KB 4PY7B 4WFED 5GGSB 4YXLH 2OJZL 3LQMA 2AKRB 3KHQA 1CE1L 2NCMA 5K59F 4PS4H 4RQQA 5GISL 1S9YB 3V0WH 4DGYL 2C3HA 4OZHB 2ERJB 2BNUB 5LKNA 3LKNB 1KBGH 1MEXH 4L8DB 1YMME 3EFFB 3ZYJA 3BUYB 2V2XA 5CIPA 3ULUD 2DQTL 4F2MB 1UJTA 3QDHA 5HHQA 1H5BA 4K71B 3H9ZA 4RAHA 3O2VL 5IGXL 2G5RA 3ULUL 5DJ6B 1UM4L 1GZPA 1Q94B 4N0UA 5J6GB 3HN3A 3RX5A 4YBQD 4LU5H 2DWDB 4H88L 4KUCD 1I1FB 4JY6A 3F6LA 5JOPD 3DOSA 2XWJA 4M7JL 3GM8A 4WHYG 5GGRA 2WLYA 4KQ4L 4J3SA 2OMBA 4DEPB 5F9AC 2W0FB 3GJFK 4G42B 4NKDB 4L3CB 1NEUA 5IWLA 5JTWA 3VFSA 2W65A 4OLZL 2CO6B 2IPTL 3Q48A 3BDBA 1PG7W 3V8CA 1F3JA 2NX5D 3OBAA 4Y19B 3SDAA 3T3ME 1KTKE 3HC3L 1KTLB 2P45B 5IG7B 4JG0L 5E5MA 2MKWA 4FQ2H 3MODH 1U3HA 3REVB 3GHBH 2IQ9L 1ZGLP 4ERSL 2BMKB 1TJIL 4G8EA 1HKLH 3TJHC 3IF1A 1QSFA 3BAEL 4KVCL 1IGYA 1TVBA 1WIOA 3RVVD 1TPXC 3Q6GH 3QCTL 3RVXD 1ZHBB 4F7EB 2V5TA 5MEOA 4AENA 3ARFA 3STLB 1BQSA 1NFDA 5ID0B 1VEPA 4NJAL 5GRZA 1IT9H 2DI7A 2W0KA 2WBJD 2P44B 4X5WB 3WXVH 2GIYA 3CLEH 1T3FA 4XP9H 2WINA 4EN3B 1I7UB 4WU7B 1EHAA 3EDKA 1QSVA 2DAVA 1I85C 4IHOB 2YRLA 4R4BB 2RBLA 1YMMB 4CMHC 4MA7H 4X9HA 3K1KC 1YEIL 3EYOB 4TUOB 3HNTH 5EIIA 1NJ9B 5E6ZA 2XA3A 3BN9C 3CDFA 4LLUB 1Q9LA 1IKNA 1UXWA 4JM2C 3C09C 5I1GL 5I9QC 4BH8A 1AHWC 5BMFH 4LMQI 3BVNA 1FFPA 4PGEB 4GW1A 3DYPA 2DF3A 4AM0B 2YRZA 4B7IA 4RA0C 2EH7L 1UQSA 2EICA 3VI3E 4WW1A 1CGXA 2J2ZA 4PJXE 2PYFB 4U1MB 2AABL 3T4AA 3C9NB 4PGCB 1YY9C 5B21A 4U6HB 3LN5B 3MSPA 4NC1C 4WJ5A 5JMOC 2YC1A 3EGSB 1H0DA 5CJQL 3LEVH 3LRHA 4XCYA 2ZJSH 1I9IL 4HS3B 3DPBA 1R24B 5D7SH 5DJ8A 4BFBD 3B43A 5FFLA 4I3RL 3RDTB 4Y16A 1RVFL 5JXAH 3WJJC 1R6VA 2IANE 1FZMA 1X3DA 5FAAA 5C92A 5L2KD 4L4TB 5HPOA 1DTUA 1SEQL 2DWEA 3EDJA 1ZLSL 2FGZA 2K3TA 2QHRL 4IOSD 3GMLB 3S5LB 4YWGH 1J11A 1MFEH 4RRPA 4PJIB 2XZAL 1RUMH 1FJ1A 5J7CC 3VD4A 5DHYB 4WY7H 2HKFL 4P9HL 4J12A 3FJTA 4OLYH 5C7XL 2XTJE 1YEJH 2P5ED 1MCWW 2J4WH 4ZFGH 5IT2L 3K8LA 4S2SB 3PXHA 4JO1H 2BK8A 4S1RH 1MWAH 4N8CL 5MEPB 1U2CA 5J1AA 4L4JA 3L3IA 4JPIB 12E8L 4HAGA 1NAKL 1IQWH 2DQEH 4R90H 1AD9A 2X4QA 2D7OA 2IQ9H 1GXEA 5IMOA 4PR5A 2ZCLH 4OLWL 4AQ1B 2CQVA 1GGCL 2Z8VC 4H1LG 3WLBA 1MCIA 1S8DB 2XWBA 1W72A 3WE6A 1X9QA 2FATL 3MFFA 5D1QD 2NW3A 1FLTX 1BX2B 1FH5H 1I1AA 2W9DL 4HQQH 3ZHDA 1YEDB 5GIRB 4OCSH 4UDTB 4QRSA 5C0FA 5DDHA 3WMSA 4OLXL 2Q8AL 3PHOB 4QKXB 2BOBA 4YHPA 3ILPA 1X5XA 3PP4H 5DD6A 2ATPB 2WP3O 4GBXB 1U8HB 3O3BA 1ND0B 4NC1E 5I75C 1RIVL 1B3JA 2VLRE 3IETB 4PY8I 5JLZA 1FLRL 3T1FB 1I8MB 3QNYA 3P11L 1AGEB 4OD3H 1C5DB 5IF0A 3D9AL 4TVSa 4ORGA 1KC5L 2CUMA 2DD8L 4MJ4A 4P59H 5JMRA 2XI9A 1NCUA 4P9MH 2EDYA 2JJSA 1MCNA 1AO7A 5B4MC 5D5MA 3VXRE 1GPOH 5EC2B 1HYSD 5T1LA 3U30C 2Y36H 3HLAA 4PS4L 1YECL 3T2QA 4YFLF 4ZFZB 2F54E 3RZCC 3MNVA 1W72H 4JFXB 5C09D 5I1EL 1N8ZB 2VE6A 3J8F7 4QRPD 4KRPD 3QIBD 5SX4H 1TZGH 3EYUL 3IVKB 3JWDH 4YDLC 4NKMB 3U0TA 5F89A 4I3SL 1J5OH 4XPTH 5HGGS 1KT2A 1LE9A 4JDVA 4M6NH 3JXAA 1IKFL 2ICES 3ZE0E 4JPWL 5EDXA 1CD1B 2R15A 1C16B 1NGXB 4OFDA 5C0AE 1RSFA 4ONHA 5AYUH 3LMJH 4GKSB 4LCCB 3D69A 4QTHA 4XX1G 3MYJA 1P2CA 3TJEH 3TZVC 1PYWA 3MRJB 4Y5VB 2VDNL 5DUBB 2D9CA 5I16B 1J05A 5FYJL 5IWLC 3PQYD 4R7NB 5HGAA 1U8NA 1XT5A 1XZ0A 2GCYA 5CEZD 2X4UB 2GUOA 3QUZB 4ELME 5FA4B 3MV9E 1QNZL 1JHLH 1CS6A 4CMMB 4YUEL 5E1AB 1I3VA 5EZJB 4XNYL 1LO3L 3BIBX 3THMH 1W2KT 2WWMC 2OX5A 12E8H 2GJ6E 3BWAB 4OF0A 3Q6FB 3B9DA 5D1ZD 2X41A 3PWJB 5D8JL 5JOFA 1WT5C 1NQBA 3QIBC 1KJ3L 2NW2A 5FYJU 2VSDA 1OAUL 3F7VB 1YMMD 5JPMB 3KPSD 3WKML 1C08B 5IB3A 5KSBF 3TNMA 1T5WA 3W39A 3IRZA 2DM2A 4GLRI 1JL8A 2CSPA 3BH9B 5DWUL 4RMQA 5F8RC 3BEWB 3G5YB 5EO9B 3SDXF 1QPPA 1Z5LA 5DFWH 3RTQD 4JRXD 4GLRH 1UM6H 3T0XA 4OI8A 4R4ND 5EPMB 3MLXL 3GGWB 4ZXBB 2NNAB 2YUVA 4K2UL 4MAYD 1DDHB 2P5EB 1BREA 4IRSD 3RDTD 1T4KB 1YEKL 2BJMH 4X6FB 2AJUH 4D9RE 2R4SH 1A14L 3OX8A 4PRNB 5GGUA 3TT1L 3VJ6A 1T6WA 3GMPA 4X7EC 4H20H 4G42A 3RPKA 4WGWB 5T3XH 5BJTB 2JJSC 3GSVA 5F9OH 5ISZA 5MHSD 1BAFH 4U3CA 5IFHL 5IB4B 1BQLH 1S9YA 4WVRA 1INEH 4KKCC 4UDUA 4Z0BL 3ZYZA 5IHUL 4P2RD 4FTVD 2IGFH 2Z31C 1F4YL 5D1XB 3BZFA 5DD0L 4NM8L 3KPRB 4QRPE 2NY3B 2DLTA 5GZOD 1E27B 1TTFA 1ETZA 4P2OD 5F3HA 3UTSB 4KHXH 4HJJL 5EU5A 3ARBC 2JELL 3M17B 4K3JL 4PJFB 3L6FB 4IRJC 1GGYA 4MNHB 3D18B 5CBEB 3V7AG 4X5WA 2FHFA 1G9MC 3LB6D 1JNLH 2YPVH 2Q6WB 4F33A 3RY4A 3PP3H 3VFRB 2W60B 3TN0B 4PJXB 1U3HC 4LIQE 5BOPA 2GKIA 1JRHL 4RGND 3FFDA 3WEXA 1L7IH 5DD1L 3B83A 3VGFA 1KG0A 2N7BA 4JY5L 2HG5B 5C0BA 3QIUC 2WZPD 1F4AA 4JO3H 4QF1A 1EGJA 3ULVH 1GSMA 3VI4F 1FQ9C 5ESQA 3B5TA 1WCBB 4MD5B 1G6RA 4V1DB 1S7QA 3QG6A 5D8JH 3U36B 4JHAH 3O2WH 4UU9B 2VLKB 4OKVA 2OM5A 3HRPA 4OV6F 2BSSA 4KJPD 5CLWA 3GO1L 5E8PA 4NZTH 4XNMB 4BSJA 3SDYH 5EUKA 4ONGL 3QRGL 3SGEI 1XGPA 4OQ1A 4MQ7A 1U8IA 4I0PD 1OGTA 4KWUA 5A1AA 2C9AA 3O2WL 3UPRB 5KSVB 4I9WE 5HHXL 1K4CA 3PWUB 1CGYA 3QHZL 4YHZL 4Q2ZB 4J3XA 3MLTA 5IW1B 3DARA 3TCXA 4LCYA 3NCJL 3DYOA 4JE4B 3ARDD 1AXTL 3EO0A 1NAMB 2J8UB 2X4SA 2GT9A 4NNYA 2HJKB 2X4TA 3HNVH 4MNQD 4HWBA 3LY6A 2F5AL 1U93A 4G3YL 4X83A 3SKNB 3WS3A 1A4KB 2XZCL 2FR4A 2VO5A 3ARDB 4LCIL 3VE0B 4M48H 4GQ9L 4UIKH 4OLVL 1Q0YL 1UCBL 3PWVA 4X4YB 2AJSH 3VFNA 1D6VL 2J88L 5DC4B 1EIBA 2VC2L 4X7DC 5EOCL 5D7IA 1ZEAL 4RSVA 3IDJA 1M05B 1P1ZB 1JNHB 1S7RA 4D0DA 3M45A 4DGYH 3O6FD 4LRNL 4TNVF 2XT1B 5D9SA 4OUOA 1FVEB 5K93A 5KSAC 3VFUB 4DGVH 3UTZB 1HZHH 3I3DA 3SDDC 2DM7A 4YDJB 3D2UB 5D2NE 4J3OC 2AV1B 2C1PA 4LKXA 5C2BL 3KXFE 2CMRH 2X10A 2OI9C 3QXUA 3L9RB 1FAIL 2VDPL 4G6JL 2IAMB 1YEDA 2DWEB 4K3HA 5HYEA 4BQCA 5L88H 1DANU 3OMZA 3SY0A 1NGPL 1ZHKB 5E5MB 4OGXL 3HI5L 1NUFA 4M8VA 2HKHL 2BY1A 1E4KC 4M6AA 3HI6H 4LAJH 3MV9D 3K2UL 2W9DH 4MDIA 4CGTA 3QUMA 1K2DB 4FFVC 3SGDH 3G5ZA 1RURH 4RGNE 1RU9H 2NY6C 1F58H 2Q20A 1OTUD 3TCLB 3TBWA 2CIIA 2DLFH 3H42L 4OZFA 2O5XH 1A1MA 1P7QB 1DBBH 2DJUA 4U1SB 1S5HA 1RJLA 4RGNC 4XMPL 5D1ZC 3RWHA 4JKKA 3PV7A 3FO0H 4JHBA 4NQXA 1CE6B 3W5NA 5I1CH 4EDWH 1AXSA 3BKML 3B8YA 2E7LA 1IGCH 3E6FB 2Z8RA 1OVZA 3BFOA 1FNEA 3VXNA 1JTPA 4WHTA 3EYUH 5GS2D 1PZ5A 3O8XD 5F6IB 2FBOJ 3EOAA 5E4EC 1A7PH 2R1XA 3PWPA 1YUHB 4P2YA 2CDFB 3IB4A 1BP3B 1LMKA 1H5BC 4RFOL 4E41D 2GJJA 1ACZA 1DLHB 3PDOB 5DS8B 4QTHB 3MUY1 3QFDA 3VXUD 2HFGH 5L88L 4WI7A 1XCQB 3HAEB 1KCSL 1AGDB 1SYSB 3TBTB 4JFFB 3T4AB 2OJEA 3HUJB 4ESKA 1FRGL 5J12C 3UTTB 4KROD 1LE5B 5IFAH 1SYVA 5HY9A 3QZWG 3QWOB 5FYJH 5ANME 1V3MA 2DLGA 4E42B 2XTJC 5T33L 3L5JA 3CDCA 2VZTA 5J4MA 4YQXH 5HVWA 1QHPA 3MRRA 3OR6A 1IEAB 5EO1A 4JVUA 4ZSOA 3VG9B 4ELMF 1JWSB 2F8VA 1WZLA 3ZL4H 4PJ8D 1ZEAH 2JF1A 4OZ4A 3IVKA 1DN2A 4EJ1C 1H3XA 4DUWA 4WU5A 2D7TH 1ACYH 4X9GA 1F6AA 4PV9A 3KPMB 5B8CC 3CVIH 5CS7A 3ULUH 3L5WB 4RGOL 4BZYA 1GGCH 2NY7L 5DJXA 5DMYA 1FO0L 3GIZH 3R06A 5FHBH 3NA9H 3QXAB 5GSRA 2QL1A 1QYGH 5I1CL 3O6LH 4QHLB 3HUJF 1R0AL 1VGEH 3NFSH 2BVQA 4UUJA 4PJHE 5JDJA 3PXJA 4LVNB 2DDQL 3MCG1 3LIZH 2YSSA 2NNAA 1OAKL 3X3FL 3VH8B 1MJ8H 4KZEL 3FRUB 1KEMH 4ZUWB 2ARJA 3GSXA 1N64L 3C87A 3LEXB 1U2HA 5IUSA 1ZLSH 4HXAL 1CFVH 3F5WA 4L3EE 1T2JA 3R8QA 1PQZB 4KVCH 3GI9L 3Q5YA 1CD8A 3T0DA 4UNUA 3S3JA 4JY4A 5F72S 2MHAA 5KS9B 5BVPH 3ULVC 4TULL 1KFAL 1T1ZA 1JPTH 4L29B 1S5IL 3W39B 1LGVA 4Q9RH 1B2WH 2W59A 2Y07L 4JQIL 1RULL 5DRWA 3RPIB 1FYHB 1QSZA 1A1NB 4U6YB 1CFSA 1HQRB 4QNPF 4NQSA 4LSUH 5LCVL 1GIGH 2FEDC 4OSUL 5J1TC 4XI5C 2OZ4A 4GW1B 4PB9L 3WO3B 1DVFD 3W9EB 2JCCF 3NPZB 4WTXA 4AL8H 1CICA 4PJEB 3TWCL 4DQOH 1RZKH 5HBBA 1G7JB 1HH9A 4L9LC 2YZ1A 2V2XB 3WNLA 4Y16C 5ICXA 4XNXL 5I76B 2FDBP 2FHBA 2Z91A 3VXUA 3KLAA 3L5XL 4XP5L 3UYRH 2XZAH 3VXSA 1OWWA 2CUIA 4HUKB 5JQ6L 1T1XB 4X8XA 5D2NC 3VGGA 4RX4D 1T7WA 5J6GA 4Y1AA 2NR6D 3ZKSD 5CBAA 3V0AC 1MLBB 4G8GB 5C9JB 1R5VB 4JKMA 1B88A 4N8VA 5DMGD 3KVQA 4L3EA 5SWQA 3NIFF 1KT2B 1I9JH 3FB5B 1EMTH 4LVEA 2G9HA 5C08E 3GSRB 3K7UA 2VDKL 1HKFA 5I74B 1FHGA 4OZIF 4LDOB 1DQML 3P9WB 4HXBH 1FBIL 4UV7H 4D0CB 4Z7UE 5K9OB 2PW2A 2VLRB 1OP3H 1FGNL 3CXDL 4YK4C 5D96B 1NEZG 5FHAH 4PV8A 2ADGA 2V5RA 3HHRB 5CEYA 2HJFB 2BVUA 3OAYH 2H6PA 1IZKA 4KJWC 4OCMC 3QDME 1H8OA 1PEWA 1UT9A 1LDPL 3SKUD 2EEBA 4KRLB 2Z92A 4F7EA 3OKDA 3TV3L 5L7XL 2A38A 5EOQL 4XZUA 4YDVB 4MJ5B 5IVXE 4F3FA 4CU6A 3GMNA 3VFTA 3QIUA 5HXMA 1ONQA 1NCBH 3DI3B