1RZKH

Hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
229
structure length
229
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
total genus 41
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rzkH01
3MRCB 5JHDA 4ELKB 4L4VD 2NW2B 4FQ2L 4LPCA 4LPWA 3B9KA 5ESAA 3ZL4L 3AS2A 1K2DB 1EEYA 3CVHA 2NYYC 1M4KA 4Y5YB 1CF8L 5DQ9B 3WLWD 1KCSL 5C0AB 3UDWA 1VFAB 2GJJA 2IC2A 3D39B 4Z7VB 1F42A 2A73A 2DF3A 3ARDC 4U6HA 2EEDA 1F02I 4ORGB 4MB5A 3O4LA 3D2UD 5FGSA 4OD1H 3V8OA 5IV2B 2D9CA 3MRMB 2BFVH 5HY9A 2DWEA 4QHKI 1H3WM 4L9LC 1I1AB 1OTSD 3TCLB 3V6OC 3WN5C 2G75B 4OZGB 2JB5H 3ARFA 3BMWA 3TNMB 3BISA 1DQLH 1PKQA 5I74B 5GZOD 3JTSA 4M8QA 3V52L 4FFZL 1OQXA 5D72H 1UXSA 1AO7D 1LO0L 4YO0A 5L8LB 1T7XA 4OSUL 1QSEB 5GPRA 1A1OA 3O3BB 5AYUH 2F5BH 5IUSA 5SWSA 1F6AB 1R3JB 4DTGH 4X6EB 4AL8H 3VFRA 1J8KA 5ITFB 4X6CF 3R4DA 4OGXL 4WW1A 2E7HA 4QTIH 4GRWH 1UC6A 1Y6KR 3S37L 2VXUL 1KB9J 3SGDI 4PJDF 3LDBC 1TZIB 1K3ZA 3DUUB 3WDHA 2VABB 2NCMA 2BNUA 4XP4H 3X3FH 5I8OL 1L6XA 3MNZA 4JO3H 1U93A 1ZT7B 12E8H 3GM8A 1EO5A 4JO1L 2BVEA 4KUCF 1A4JA 1CR9H 2OL3H 5CEYB 3GNMH 5HI4C 1BM3H 2XZAH 5CLTA 4LCUB 5TDOA 2EDHA 3WCYA 3L5XH 2DBJA 3GGWB 1S7WA 2Y36L 2NXZC 4QNPF 1YPZB 2XACC 1RUAL 2YUXA 3TIEB 4JO1H 5DEGB 3GUTA 1IGCH 1S3KH 3RNQB 4L8SC 5BXFB 1QKZH 3MFFB 1J0KA 3FTGB 3C09C 4WV1B 3LKNA 4IMKA 1NFDB 3QQ4B 4XX1G 5IMMB 1KG0A 5IHUL 5LWYL 2AGJH 2DQJL 4WTWA 2EDBA 2ID5A 4AL8L 2HG5B 2IH1A 1NEUA 5J0BA 4OGXH 4X0KA 3R0NA 1FV1B 2A77H 5IJVA 2FX9H 4ZSOB 4KKBC 5SX4H 1RZJH 4KI5F 2L4OA 5D1XB 3ZE1E 3AREA 2V2XB 1HSBA 2X4RA 4OAWA 2J4WL 1U8HB 1R24A 3HPJB 3PHQA 2YZ8A 4P4KC 4KAQL 4F8TA 3ULUD 3UBXG 5DI8B 1YC8A 2HKFH 4NUGH 2N1KA 4JKWA 1PEZA 3P4NA 5DQDL 3WJLA 2BNQB 4KI1A 3CNKA 1VKXA 1PYWB 4JFQA 5ANMB 1YJDC 3SOBL 3FO1A 3WXVH 1DTUA 3RIFF 4O02H 4LCCC 1NCWH 1JWSB 1PZ5A 1UWXK 4FABL 4KJQD 4E9LA 4XP5L 2HT4D 1FN4B 3UTTE 5KTEL 2E7MA 3U2SB 3U0TB 3MRBA 3O3EB 2ZNWA 3P77A 5I73B 1A6UL 3RBGA 3S3SA 1S7TA 1YUHB 3TH2T 4ZXBD 3GI9H 1MCEA 2XZQH 1T2QH 3OSKA 2I07B 4P23A 3IDGB 1QACA 5KTEH 4YR6A 1LD9A 3MV8A 1G6RA 1J0IA 1J1OL 3DUSA 3PWLB 2PXYB 1FCCA 2MHAB 1IFHL 2IFFH 3G5VA 1G7QA 4YHMH 2EDTA 3QHZH 5LCVH 4LRIA 4RQQB 1NEZA 4HWNA 3FO0L 1W72B 2CKBL 2DD8H 2MCG1 5GS0D 2Y06L 3W81A 5H2BA 5CSZB 4P2OA 3HCVB 1XMWA 1L9NA 2QADD 3RI5F 1FYTB 2XZCL 3CXHK 1J0YA 4KHXL 4Q2ZB 1IC1A 2B4CH 4HUKB 5EOTB 3REVB 4OLVL 1H8NA 3JWDL 1AJ7L 1FVEB 4JE4B 4X6FA 3PWJB 2ZNXA 4LQ1A 3UJJL 1I9RH 1DFBH 3TA3C 3TBWA 5DJ0A 4JHBA 1JYNA 5E03A 1CICA 1OVZA 2WBWB 1U8OB 2YN3A 1JHTA 4PGBA 3IFNH 2YWYA 1JMZA 2KDGA 3IF1A 3C6LB 3EFFB 3ROLA 4KRMB 3GSXB 5I1JL 1G6VK 5DMKA 4HUWB 1XIWC 1TVHB 5I8CA 2OTUA 5C2UB 3BKYH 3ULSA 2I9TB 3C6LC 3D3VE 4H8WH 3W5NA 1N5AA 5I1DA 4LP4A 2R0ZL 3MGTB 1SBBA 5H35B 1T0NA 2BNQD 5INCB 3OKEB 3MROA 2OI9B 1RZ8B 4HC1H 2ARJB 5BRZB 4DN4H 4QYOA 1CXLA 3G5ZB 3NFNA 4NC2B 3ARVA 3U48A 1IM9A 1UM5L 1RUKH 1UGNA 5I15L 3M45A 4U7KA 3HI5H 1D6VL 2IADB 5I15H 2F58H 5GGTH 4OCWL 4LAJH 2D7QA 1DUZB 4HUUA 1UG9A 3IKKA 4N8CH 5FXCH 3NA4A 3U4AA 3SEPA 3DPBA 2D9QB 5EO9B 1XF4A 2UVEA 1FNHA 1RJYA 2FYYA 1MHEA 3KPRA 5IR1A 3ARDD 4OZHE 3S34L 5BV7L 3SJVE 1EHLL 4NO5A 4EN3A 5KJRH 2I5YH 1IZKA 2OP4L 3P30H 4ELMF 4YHYB 1T1XB 4JVPA 4ZOBA 1CD9B 5C86A 3GB7B 1N7MH 5IBLC 1KPVB 2DLHA 2V9RA 5GSRB 2XYCA 3P0VL 4OZHB 4YPGA 2EE6A 3U82B 4QRTB 5HDQL 4NO0B 3TIDB 4IRJB 3L6FA 4X5WA 5EG6C 3SE9L 1WSST 4H20H 5EBMA 2PETA 1AD0B 1RZGA 1OGTB 1KB5A 2X9XA 5FYKD 4UTAH 3MRIA 1TMCB 5FK9A 5K59E 3MTRA 3CX5K 5DLML 3CU7A 3NFPB 4ZAKD 3VXMD 3C87A 3UZEA 3FJTA 1NQBA 5FOBB 4JKLA 3PV7A 1BGXL 4NKIL 1I9EA 4YLQT 2A6KB 3WFHB 4IIQC 1U8IB 2KL6A 3F7PC 3BPCB 4WTZG 4KXZH 3H9SB 2BVUA 5IFAH 3SO5A 1KPRB 4C55A 2DB8A 4HFWA 3W0WD 1KPUB 3QPXH 2B2XH 3RIAF 1VFMA 2AJUH 2EDXA 1YMMA 3GSWA 4XPGH 1ZHBA 2MPAH 4U3XA 1BQUA 1SEBA 5JORB 4K2UL 2VLKA 5HGGS 1WLHA 2XFXB 2IQ9H 3VH8A 3ZDXF 5KJRL 1UCTA 2NY5H 4LKCB 4Y4KA 4U1IB 3MJ7B 3RDTA 2IMMA 5CP7A 4BKLA 4G9DA 3FT3A 3NPZB 5INDB 5JXAH 1MCDA 1JGLL 3OG4B 1LNUB 1MFBL 4YX2H 4DGYH 3SKOB 4I3RL 4HIEB 3MRLA 1G6RH 4NRZA 5E1AA 4JFDB 3VXPA 5H94B 2O5XH 4G8EA 2YRZA 3T0ED 5E9DB 1I4FA 3O9WB 4HMCA 3RP1A 3GSVB 5CEZL 3VH8B 4RIRB 1TVBA 3V7AG 4KZEL 4HXBH 3WHE1 4OV5A 3LKOA 1JGLH 3K8KA 5IHZA 1CT8A 3HZMA 5IG7B 3UAJC 5AZ2H 1KPUA 5HTSA 1R3KA 5F9WB 5D1ZD 1I1FA 4RMVA 5IW1B 2J7LA 3H9SA 5DGQA 3IXTA 3IFLL 3KLHD 1MEXH 4QF1B 2A6KA 2HTKC 3SJVD 2B39A 2Z31D 1QLRB 3ESUF 4D9LL 4JO3L 5JW4Q 3SCMA 4ALAL 3RUGE 3LMJH 4LEOB 4PLOB 2N7AA 1RZGB 2Q86A 4NDMA 5GIRA 4AIZB 1EO8L 2DWDB 2ZG2A 1CXFA 4OLXL 4FQHB 1LO3H 4U1NA 3I6KB 3AS1A 5DDHA 4Z7WF 4ZTPL 4NQEB 3FN0L 5FKPB 4XCNA 4PJ9C 4C56A 4Z0BH 2FECI 1CL7H 1FORH 1EO8H 1IL1A 2WAHA 3OF6A 5F9JA 3HC0A 3DMMC 2HT2C 2QV2A 4GG8B 1G1CA 2D0GA 5SX5H 3HAEB 4XZUA 5T1KB 4XWOD 4KJQC 1J0HA 5E00B 1BREA 2X4TB 3GMPA 5K33A 1RHFA 2YD5A 1OY3B 5CINL 2L0DA 4GRWE 1DUZA 4HUUB 3V6BR 3WUZA 3B8YA 1BZ7A 3EJZC 1LE9A 1CFVH 3CSPA 9CGTA 3BIBX 4F7PB 3L5WB 2VE6B 5TDPA 3BZFA 2YUVA 5DURD 3NFNB 5GJSL 1NJ9B 3MCKB 1YC7A 3K4AA 5DFVC 2YBRA 2CXKA 5BRZA 4POZD 4H5SA 3QDJE 4HGKC 5DD3L 4LGRB 3KPSB 2HMID 3OKEA 2HRPH 3DGGA 5C9KA 1V3KA 5CMAB 4CDGC 3PIQA 3I75B 2F8OA 3NCJL 2GK2A 2A6JA 1WBYB 4HLJA 1BQSA 3JUZA 5GRYA 3ULSB 3ZT5A 1HYRC 2R39A 5E6IC 3QYCA 3X13A 4HUWA 4QXGH 5EU5A 1XGUB 4H25B 4K3JL 2RAMA 5GS0C 3B2UC 2R0ZH 4GXVH 4BQCA 4WGVB 4NKMA 5HDOA 4KAQH 2D03L 2VQ1A 4NN7B 4WV1C 4TVSa 2ZJSH 2FD6H 2IG2H 3QG7H 1KLUA 4XP4L 3X3FL 4MJ6A 1X4YA 1JUFA 2DMKA 2NZIA 1YEKL 3BMVA 4WNQB 2NX5E 2LABA 3TPUB 1UYWL 4C59B 4LSTH 4XNQA 1IKNA 1KTDB 1DBKL 4X6FB 5DJ6B 3RU8H 1AFVH 4GMTH 4MWFA 1C12A 4TTDD 4X7SL 4E41B 4MAYD 4OCYH 1J7VR 3L7EA 3P9MA 4EIZC 4EVNB 5TE4L 1DR9A 1K8IB 2HKFL 3WNOA 1A3LH 5ANME 1AGCB 3OJVC 2R1YA 4XP1L 1FVCB 4QHUB 5D5MF 3HCVA 4JFZH 4CVWA 5A43C 2WK2A 4M1CD 2C3VA 4KI5D 4NZJA 1YMHB 3STLA 3VG9B 4M6NL 1ZE3C 4MSWB 5DQJB 2GFBA 3FRPA 5GS2D 2CMRL 3RGVC 2E7LA 3UZVB 4JDVB 1X4ZA 3GIVA 1G7QB 2YWZA 3ULVC 3SDXE 5DMIH 3QEQA 3PWLA 2CDFB 4GKZB 4OFDA 1LD9B 1QR4A 1CD0A 4PGJA 1G1YA 4ZFGH 3LKSB 4XPFH 1CFSA 3WKNA 3O6KH 1G7MA 1RMFL 1VEPA 3ILPB 3LQAC 2JB6A 3O8XB 4QHMB 5GS2H 1OTTD 2PYED 3EHBD 1CFQA 4KC3B 5DJCA 1KIPA 3V5KB 4UZGA 3U9UA 1MSPA 1U8PB 1GIGL 3LV3B 2HH0L 1INEH 2MJWA 3G04B 2JCCB 1RHHA 4NQVA 4OZIF 2E5EA 2HJKA 4G8FA 1QSFE 3H9HB 1O0VA 1KBGH 4HQQH 5IVXE 2IQ9L 3MRKB 4Q97A 1DBBH 5IHLB 1I7RA 1CFVL 3FO1B 4S0SD 5ANMA 3LKRB 3OR7A 3F7RA 4G8GB 4YHPB 2VRAA 5I74C 1VACB 2LU3A 5J56B 5MENE 4P2RB 4M7LH 1GPOH 4AENA 1E4XH 5FA4A 1NKRA 2DRUA 1EH9A 3FB5B 5I16A 2ZUTA 1NANI 2CLVB 1W0YT 2C1OB 2VJXA 4M5ZL 2P47B 1OB1A 5E2WL 1VDGA 3H6JA 3F6LA 5CILH 4NBYB 5HHXH 5I1IH 5J7CC 4LLQA 3TZVD 1XF5A 3MNWA 5C0ND 4RISL 1Q94A 3MR9A 4HPOH 1KXTB 4W70A 1Q94B 3LMJL 3MR9B 4GQ9L 4PJEE 3LQAL 5J06A 2P49B 1A0QL 1VENA 1JPTH 5E4EB 3JWOC 3MLYH 3QJHB 4X0KB 5J1AB 4KKLD 4XVUD 1A6TA 4X5LA 2P24B 3MODL 1XIWB 2C1OA 4LMQI 2UV3A 1MHPL 1NFDA 3QQ4A 5I16B 3S34H 5BV7H 1BP3B 5FA4B 3IJSA 1OWWA 4O2FA 3L3OA 4LQFL 5FYKE 5DEGA 1EJ6A 2NY1B 2W9EH 3U7YL 4N8CL 4RFOH 1YPZA 3EYSL 4ODXA 4P46D 1JPST 3AM8C 4S1SH 1F2QA 2XICA 2QQLL 3S88L 1JK8A 4Z0XA 1PX4A 3GGWA 3LZFH 3BZ4A 1S3KL 2BXYA 1RHHB 2UZYB 4Q74A 3ZO0A 4EN3D 1CDHA 4U2YA 3BGFC 4GS7B 2AJXL 1S7RB 2EO9A 3ARZA 1NL0L 3SDDC 3U9UB 2X4SB 4U6YA 3UTQA 2J6EA 1MCBA 5L88L 3NH7L 1B90A 2N4IA 1CXEA 4TUKH 3DUUA 1FNEA 3BGAA 1J5OH 4PRPE 5F3BA 5HD8D 2GW5A 3VFVA 4KRPB 3N0PB 4WW1B 2IPKA 2CDFA 1XGYH 2F15A 4Y2DB 4J8RB 1SQ2N 4K9EL 3GIVB 5JW3H 4OLEA 3AU1B 5TQ0H 3I3EA 4XAWL 5J3HC 4BQ8A 2GFBB 4AIOA 3TJEH 2QTEA 1WWCA 3STLB 1DN2A 5L9DL 4LCCA 2BNQE 2C3VB 5JZ7D 2BNRA 4PRPD 4QXUH 2MTPA 5L0QB 4XI5C 5D93B 1BQLL 4KROC 4I5BA 1NGWB 4OZGA 1RZJC 1FVCA 2DLFL 3H9SE 3G6JF 4PJFF 3OKDB 1XF2A 1K3IA 4I4WB 1C08A 2LAGB 2DM2A 3LEVL 2JKXA 3P9MB 3WSQL 3QEHB 5AWNH 1UJTA 3MV7A 1W0VA 2OR8A 4YDVA 4DUWA 2D7TH 5BJTA 1FG2B 3FQUB 4YWGH 4O51A 4XWOC 5DJ6A 5J11B 2EYSA 5DRNA 1HINH 4PJ8D 5E5MA 5EIVA 1KBGL 3TPUA 4WNQA 1WFOA 4ZG1A 1HIMH 1R3HB 3DX9B 1CLOH 1K2DA 3RVWC 2X1XR 5FO9B 4ZYKB 2WIIA 3B9KB 3ARQA 1WUNT 1NCAH 2JJSC 4NKMB 2APVA 2NW2A 1FBIL 1JNHA 2LTQB 5E95B 1UWXH 1IGFH 4DKFH 1S7UA 4V2BA 5JW3L 1ETZA 4RNRB 4POZC 1BIIA 3VA2C 6CGTA 1SEQH 5JPMA 1T0MB 1T5WA 5E2VL 1WBYA 1X5HA 2VXUH 1BQHB 3FQXA 2ED8A 3BP4A 3VRLE 3WS6C 5DK2A 4PJ5D 5AEAA 5HGAB 4JB9H 3WNNA 4K8RD 2XRAL 2GJZB 1EGJA 2CIIB 2O5YH 4FXLA 2FEEL 3L1OH 2BK8A 1CCZA 2YBRB 4M8VA 1S78D 4MX7B 3TBVB 5CEXB 5DJYA 4MJID 2HFEB 3BZFB 1Q9OA 1X6NA 2XA8L 5F9OL 4YXLH 2F53B 2C9AA 4WUKH 2XTJD 1DUYB 1UEYA 1YEEH 5GS0H 4S1SL 3MBXL 4TSCH 5E08H 4ZS7L 4I3RH 1JGDA 3MV11 2P44B 5T33L 4Y7MA 1IC4H 4LLWA 1T21B 2C1PA 5E00A 4LHUG 4NJ9H 3P0YH 2NXYC 1VHPA 2UY7A 3PGDA 5HHOA 5B39B 4Z7VF 2VLKD 1FAIL 5C0FA 3I84A 3WLBB 4L4TD 1LHZA 3O3AA 5FYKU 4BK5A 3EO1A 5EO1A 1EMTL 1EFXB 5IF0B 2R2CA 3AUVA 4URTB 3V6FA 3RDTD 1BJ1J 3VXUE 4DCQB 3FT4A 4NQEA 3SO3C 1GAFL 4YEEA 4YJZL 2WM0A 1HILB 2OJZL 3B43A 4M1CC 3DXAE 4MQ7A 1T66C 5T1KD 2FECL 1TJHH 2A0LD 4ODWB 3HI1A 3HE6B 1VFBB 3QFJB 3BGMA 2DWDA 3E6FB 4AIZA 2Q86B 5C6PB 2DQUL 1PEWA 5CUSL 5IOPA 3FOMA 1IM3B 2OI9C 3EOTL 2NY6C 2BVQB 4O58H 1MLCB 4LF3A 2IGFH 3G08A 4QF1A 4K3DH 5E0QA 3IXTB 4M6OH 1P7QA 1UM6H 4ZOCA 3RWEA 4POUB 4JM2A 2C5DC 1T22B 4MMXC 3SGEI 5C70A 2G60L 4JLRB 4Z7VE 2BCKB 4X99B 2Z93A 3C6LD 5IG7A 1WWWX 3FQRB 3DX8A 2FZ3A 2EE9A 3ECBA 2ICES 5TF1L 5KVDH 4AQOA 4M9PA 3S5LA 3GSVA 5CWSB 3RWGB 4Y2DC 4F3FB 4G8EB 4ODBD 1DBAH 2VZOA 4PJGF 4X4ZA 2FIKB 1DP0A 2V7NB 1DN0A 4X4XA 5DVLA 5HDLA 3MCLH 4KY1L 1H8SA 2ZSWA 3GEWB 5GGRB 2DM4A 4FMFA 3QNZB 4HLZG 5J13B 1FBIH 2FO4B 4UIMB 3S36L 4MQTB 2NX5B 4YE4L 1BGXH 4PJAE 4F37F 2XKUA 4KVCL 3DARA 4PYGA 1AGFB 2QADB 4GSDL 3BO8A 3EFDH 3VFPA 2A6IB 3PGFL 1LDSA 1WZ1H 5L6YH 3BPLC 2OR9L 4HX1A 4LSUL 4ODTL 4GW5B 5F8RC 3FQTA 3TN0B 4QRPE 1P4LB 1X5AA 1E28B 3PWVB 1AHWC 3RWJB 1UENA 2GEEA 3S97C 5F88B 1HKLH 5JOPD 3DHMA 5I1HH 3ZT6A 2XXCB 3IFLH 1OGAB 5KVEL 3P9WB 3JXAA 5D8JL 3IDIB 3KPSE 3MOBH 1QEWA 4C54A 3WIHA 1A64A 4NHCL 5HYJB 3U1SH 3SBWC 2DQHH 4JAMB 2ZCKH 1WIPA 4Y1AB 5EC2B 1QSVA 4X7SH 4EXPX 5EZOL 3WJJC 2XY2A 5KG9A 4Z7WB 5EORL 3O11B 2EEAA 3MLVL 3BYTA 3RY5A 3SDCD 4WVRA 1AHWB 3RBSA 4DGYL 4QHKJ 2QQKL 2R2BB 1FO0H 5K93A 2VN7A 4Z7WE 1ZVYA 2DAVA 4LSUH 3HMXH 5I6XC 2HFTA 3SDDD 4PJXE 1NGZB 2BVOB 1JGUH 2BHUA 4G6FB 5DF0A 2VDNH 4ZNEE 1AP2B 4RMQA 5CINH 2ZG3A 3MRJB 4K3HA 1F13A 2D7PA 5JA9A 2AABH 4QCIA 3MROB 2X05A 3VRIA 2LAAA 4G9FE 1QLEL 4J3XA 5JIHA 3MGTA 4Q9CA 5JNYB 3QDJD 3QUXD 5C07B 4EUPB 4GG6F 1JPGA 4LLYA 3T1WA 5J3HD 2HJLB 1FFQA 3O2DH 1TVHA 4AMKL 2O5ZL 2FLBT 3DV6A 1FRGL 3CPLA 1EEQA 4Z78B 1FYHB 3EFFA 4PJ5B 3VXSA 4OD3L 3L3IB 1I8IA 5E6IB 1JHTB 3H7LA 4PGBB 5EFIA 5F72S 1ZMYA 4FQIL 5A2IH 1U8OA 1YDPB 3DMMA 3C5ZC 4NKDB 1CE6A 5I18H 3CSBA 3F6IA 3KPQA 3P4MA 1ZWIB 4K8RL 1AR2A 1MQKL 2C3GA 1FVEA 3U30B 3RVXC 4HKJA 1RUQH 4XNXH 5IWLA 3OKLB 3VU2A 4DVBB 3DYOA 3GFUA 1NDGB 1XR9B 2I25N 4JANB 4Z76A 1RIVH 5KS9F 2A83A 3HZVB 2D4DA 5F1KC 4E42A 3TWCL 5D93C 3K3QA 5HGDA 4XCEA 4OGYH 3LKQB 4P2OB 1TQBB 3DV4A 5H2BB 1E4XL 4Q9QL 3VMNA 2PF6A 5KS9A 1NEZB 3DVNB 4RQQA 1NCCL 3C60A 2WNGA 3EIFA 4D8PB 2I27N 3KPNB 5ENWB 5C08D 5BQ7A 3QIBC 3D0LB 5CP3H 2VLKE 4JM2D 4X6DB 1ZANL 2DIAA 4QGYA 1BJMA 5LGJA 3LN5B 1YEFL 4TYUA 4MA3B 2FX7H 4R26L 2V5SA 3UPAA 2I07A 2X42A 3RVTD 1BAFH 2HTLD 4ZSOE 4FZEL 5ICZA 4RCAA 5ISZE 5F7EL 5C92A 4L9LB 1UM6L 1NMCC 2HN7A 5EUKB 3O3EA 5EOQH 3MRBB 1KJ2L 1LEKA 1TTUA 1FNAA 1FYTD 1RMFH 2EIZB 2IALA 5EH1A 1FN4A 4JRYB 5KS9B 3CJJA 5GRJL 3RY4A 3W9EB 1HIML 1JV5A 3HNTH 5JPNA 1ZS8A 5TJWK 3LS4H 2R1XB 2IF7A 4YWGL 5KSAC 4NKOB 5E99L 2K3TA 3FFCE 1BFOA 5IBTL 3QSKB 3WD5L 3MRQB 1R5WA 1JI1A 3P4NB 4M43H 1DJSA 2B20A 5LXGL 1KXVC 3RKDD 5D1QD 3B6SB 1ZT1B 3QCTL 3WXWH 1ZHLB 4X7DC 3PHQB 4I77L 1WCBA 5TE4H 4JRXD 4OM1H 3TH3T 1A3LL 3P4OB 1AKJA 1QQDB 3EFDL 1YDPA 1CXIA 3KPRE 1OP5K 3U4EB 4Z6AT 3GZKA 1N4XH 1LK2B 1B6DA 1YJDH 2C4FU 3EAKA 1PG7H 4K7PX 4PJ5A 3VXSB 1WBZB 4R0LC 3CPLB 4Z78A 2AP2A 3DV6B 3CFBA 3H7BB 5C2BH 5LKNA 5FCUH 2VQUA 3IT8D 1JPGB 5CFHA 4QRUA 4XB7A 3K0WA 4EUPA 3N1MC 1F45A 5IMMA 3LKNB 4Y4FC 5JXED 2XPGB 4LP5A 4UV7H 1KT2B 4NJAH 7FABL 2EDJA 3RNQA 1I8KB 5GS1B 2IWGA 2HA1A 5KSAB 1X4XA 1INEL 1CQYA 1ZA6B 4UAOB 12E8L 4JFEE 3IU4L 5F1IA 1ZT4A 1OAUH 5KW9H 5E24E 3PDDA 2XOTA 3QUZD 4KHTH 3NZHL 4LGPB 3CFCH 5DMJB 1NCAL 2NQCA 3LPFA 1S7QB 3S8WA 5EORH 5IB2B 5A3ID 4EI5B 2RJMA 3SPVA 1EXUB 3L3HB 4P57A 1ADQA 4HFUL 1MCPH 3EOAB 5J9PA 1G9EA 2VL4A 2IH3A 3V4VH 1IAKA 1MCIA 3QI9B 4YQXL 2BNUB 2CLZA 3CVIH 3CDGB 3IDJB 3L3DA 4NGHL 3MQIA 1ZEAL 3SDDB 3N1QC 2E7CA 3L95B 4LLUB 3UTPD 2AK4E 3MODH 3V9FA 4R90H 3A6OA 3UX9B 3JV4A 5C2BL 4B0MM 5BS0D 4X6EA 2IPUG 1KIRA 3ZTNL 2D7MA 1N2RB 1CBVH 4CJ1A 3IAQA 3D6GA 2VLRD 3BIKB 3MLYL 3FKUS 4MNGA 3BX7C 4OJFH 3O4OB 2QR0A 3MGAA 1FL5B 1IJ9A 1ZLWK 4YK4B 3BP6A 1QSEA 2A38A 4K7PY 4XP9L 1HNFA 5I17A 1S9YB 3WFCH 5F88A 3S35X 4PJBE 1PKQB 1CDYA 3TNMA 3H42H 1BX2A 1AGBB 5T5NF 3QHFH 2MKWA 3CX2A 1WT5C 3GI8L 4OLXH 4WO4C 4X5XB 5DUPL 3D85A 3FQTB 1FFNB 4L9DA 4KTDH 3TN0A 5I8KH 1F4XH 3RZCC 4UT9L 1B0RB 2K9UA 3S96B 4XMLH 5ACLA 5HI3D 1AR1C 4BFIB 5J8OA 1N7ML 3QXUA 4MAUH 5IBTH 5SX5K 1LEGB 1IGTA 3EJYC 5C0CA 5TE6H 2A73B 3GIZL 3ZKNC 2RFXB 1VFAA 3QDGA 3BRGC 1BZ9A 3KWWB 4MCYA 4JVWA 4UTBH 2DQDH 1SMAA 3LS4L 3MLSH 2CK2A 4DGVL 2VH5L 3RWHA 3GSRA 3OJ2C 1E0OB 1SY6H 3ZKSD 1DEEA 4KTEH 5C09E 4M6MH 4ZUUB 5KVMC 4LEXH 3C2AH 3MRCA 5I75B 4HIHA 1LO2H 4GRLC 1QKZL 1CICD 1D9KD 1XF3B 2B1AL 4LU5L 5GJTH 3FO9A 2GUOB 4XPBL 1DANU 3DX8B 1YEFH 4P2RD 2FWOB 1K8DA 3PV6A 4M6ML 5CD5C 5E8DH 2BOBA 1Q72H 4J1UB 1GZPA 4NZDA 1YYLH 3D2UB 3MV9B 4JM2B 3RWEB 4Q0XL 3U36B 1P7QB 3T09A 4ZO8A 1JFQL 4HCRL 3MO1A 5IMKA 2DDQL 1G7JB 1IKFH 5IROA 1U91A 4K2UH 5KSVA 3BD5A 4L8CA 3ARGD 4PRNA 4GKSA 4PG9B 1QNZH 5IOPB 2R0WL 4XNMA 3VDCA 3QFJA 5CJOL 3MRHA 3S37X 4U4BA 4PJIB 1CXHA 1QUNA 5MEPA 3D9AH 5E2JA 2NNAA 4JN2A 1HCFX 1KIQB 3U0PB 2VXSL 2AEIT 3PGCA 4RGMB 2VLJA 3HS0B 3O6FD 4H20L 3UTTA 3EO1B 5EO1B 1OPGL 1X5KA 3KJ4B 3K2UH 4Y4HD 4LAQL 3QEQE 5TGBB 4U1MB 3PWPA 4KROB 4D9LH 4JZNA 3RNKA 1F8TL 2JK5A 2NW3B 1NGPH 4YK4C 1XGRB 4HH8A 2H45A 1AXSA 4LCWB 2E27H 3M1BB 3WO4C 4CVUA 3TJHD 3VGBA 2BZDA 5DVNA 3WN5B 1DEDA 2DN7A 4JM2C 1K6QH 2OSLB 3KXFE 5GQBA 5ACMA 4A2LA 4JPVH 4QWWC 5EZIH 3FB8B 5C7XL 3R8BB 1AXIB 5CEXA 4BZ1H 1DE4B 4J23A 3CFEA 3UMTA 1NLBL 1IC4L 1JRHH 2PYEA 1GXEA 4K3EH 3QQ9C 1N6VA 2P8MA 3BW9B 1SJHA 2EDRA 3DSFH 4XCCL 3VXRA 1NGQH 5D70H 2YSSB 3X12B 4LCIH 5JW4R 3SDAD 4R7NA 1MIEL 4XI5D 3V0WL 4RFOL 4YXLL 4QO1A 4YX2L 4BUGA 1NSNL 2Z91B 4D0DB 5JR1L 1IT9H 2GSGA 1MJUL 4G6JH 4JJ5A 4NN7C 4C56D 3T4YA 3V8CA 3WNKA 3QDAA 1S7UB 3GNML 4PJAB 2ICEA 1E6JH 3RHWK 5KN5A 1H3TA 1M6OA 5TF1H 2BERA 3WIFA 4NZRH 4GG6E 5EU3A 5MI0B 1JGVH 3V0WH 5I1LB 3ARFD 4MAUL 1NGPL 2ATKA 3TNNB 1EERB 2UYLA 3D39E 1ZHNB 1X44A 2R56H 4MMZC 5DRNB 1NBVH 4NOBA 4WFFD 4Z0BL 4NFCA 1HQ4B 4JPIB 4O51B 3RKDC 3T0EE 3IJHB 5BJTB 2ENYA 4IBLT 1CG9B 2EDEA 5HHXL 3QEHA 3D3VA 5TDNA 4MXWH 2HT4C 1N8ZB 3OAUH 5IB4B 4L3EA 1XF2B 3B9VA 1TETL 1A6ZB 2DBLL 2QSCL 2YPLD 3VFMA 4XPTH 1DCLA 1XZ0A 3RL1B 2BRRL 4BSWA 2FH8A 1U8NA 4I5BB 4WEMB 4ZXBC 2GITA 4W68A 4I1NB 3P9LA 4GW1B 4LCCB 2WLYA 1MI5B 3LDBB 2EH7L 3WNLA 1K5NB 3FAXA 4CNIA 1DLHA 5HHMD 3BP5A 5DRXB 1JI2A 4Z95H 3HLAA 5C0RH 1YYML 4Y2DA 4HS3B 1WK0A 4FS0A 4NN5C 1MLBB 2WP3T 2ICWJ 3ROOA 3UTSD 1C7SA 5A2KH 1Q9KB 3HMWH 1YEJH 5I8EA 3VFVB 1OAZH 1J8HE 3DVGA 1AXTH 1OD9A 2H1PL 1T1WA 2VITA 3GRWL 5FUCC 3AB0C 3RWDB 3HI5L 3NIFF 1Z5LB 2Z92B 1G7PB 4Y5XC 3TT3H 4U6YB 5EWIH 1KNOB 3SDXF 25C8L 1S7RA 4MS8D 1YEJL 1RZKC 4OF0A 2FL5B 2DYPD 4S1QL 4WWID 3BZ4B 1G7PA 3O0RH 4TUJB 2BNRE 1IAII 1NAKL 2PO6A 2CRIA 4WFGE 3BYYA 4UU9A 2GAZA 1JZ4A 4HIXL 4WW2A 1ULVA 2NY1C 5D2NA 1GC1H 4I0CC 1A7PH 3LN9A 43C9B 4NP4L 2CJUH 1M7DA 5CZVL 4LIQL 5FM5O 3ROOB 1MLBA 1AKJD 5I1CL 4PJ7F 1T04B 4XP1H 4ZO6A 5GZNC 1GRWA 3IDYC 3G6DH 3T0EB 5F7NC 2P24A 3ARWA 1NUFA 3PE9A 1XIWD 3BKJH 3C60D 3CK0H 1WBXA 3PDGA 3DBXA 4LLDA 5C08A 1LMKA 3U1SL 2A74B 4M1DH 1MWAH 2GITB 2A1WH 4HHAA 1U8NB 3G5XA 1XF5B 1MCWW 4Y16D 4TULL 3T2OA 1N0XL 4ZTOL 5AAWA 4WUKL 3T2NL 1K4CA 2OXGA 4P4KB 4NQCD 1OB1B 1CG9A 5HI3C 1FNLA 4OUOA 3NIGF 1HDMB 3ARRA 4L4TE 5E2TH 1WAAA 3WE6B 1NBYA 2BSTA 1ZVSA 4KMQA 3NZ8A 1WAAE 4AIXA 4HULB 1ZLVK 4LSRH 4HFUH 1J86A 4MAYA 5TH2B 3IFOA 1G6RL 3WFEH 1OWRM 2HJKB 3DVFA 4IMLA 3HNSL 4OCNC 3FFCB 2Y9RT 5JW5B 2WQRA 3LV3A 4MD0A 5D7LB 4R90L 1S7VB 2PXYC 2EDDA 1U8PA 4PJBB 4JZJC 3EO9H 1IQWH 5BS0A 3X12A 5D96C 4PTUB 2W0FA 1SJHB 4MJIA 1QFHA 5FAAA 4XWGH 4QNPE 1CFSB 4P9HH 4OCSH 2LU7A 2MNUA 5KSUB 1MIEH 3V5HB 1A7NH 4N0YL 5HHOE 2LTQC 1CVRA 1DL7L 1SJEB 2ENSA 5BW7C 3WJLC 1WIOA 4HAGA 5BZDA 1FORL 2PW2A 4PJEB 1OAUL 5KW9L 5DHVA 5FDYA 4XP6L 2R29H 5ISZD 1XGRA 3ZYOA 2OMNA 2NY0D 4L4TA 3RNKB 4O9HH 4MJ2A 2PN5A 1PSKH 3ZTJH 4QRPD 4PRHA 4KJPC 5C0CD 4NQED 3ETBF 1DBKH 3RU8L 1NBVL 5DR5H 5GGVL 1NGYB 1CL7I 1RU9H 1E4WL 3L7EB 2NNAB 2XWJA 1E4WH 1V3MA 2CDGA 4BJLA 3WD5H 1EIBA 1KTDA 2BY3A 4FQJH 1MCSA 3O2DA 2ZKHH 4G6MH 4XNQB 5ITBL 1MCOH 5HPMB 2DTSA 3BQUA 3EJZD 5H8DA 3T1FA 4X9HA 3QQ3A 5FFLA 4EI5C 3F12A 5D7LD 4BYHA 3MLXL 2VDKL 4QWWD 5C09A 2X4NB 3CD4A 3VG0L 4F58L 4GRLB 3MO1B 4XP9H 3QIUB 1HHHA 2AJVL 4YDIL 3ULUE 3QA3A 4FZEH 4HV8A 2E9WA 3QIUC 3O6LL 5IBUG 1T20B 1C16A 4IDLA 4OZFH 4BH8A 3I75A 4PJIF 4RDQF 1G7IB 3PIQB 2GQHA 5ACZB 3IRZA 1L7IL 4DZ8A 1B88A 3KYNA 2GUOA 2XTJB 4Z7OE 4PP2B 1ORSA 5GRWA 1OSPL 4FQQB 3ULVF 2WIMA 5KVDL 3VXTA 3HE7C 2D2OA 4DZBA 1P53A 3VWJA 4Z7UB 3RVXD 4RRPA 3KPMA 3P4LA 1UKSA 3ARFC 1KCVH 4HBQA 4WO4B 4EOWH 3BDYL 4WU7A 4PR5B 1LE9B 4J4PC 2Z8SA 1G0YR 4HS8L 1H0DB 4HJ0C 3QDGB 3WKMH 3CUPB 4PJIE 3GMPB 5EOCL 4EUPG 3QIWB 1HSAB 5EU6B 4GH7B 4BQ9A 1IGTB 3HAEA 3MSPA 4BQ6A 4FG6D 3WS3B 1N6UA 4WJ5B 5HBBA 4OM1L 1U3ZA 2EE2A 5ICYB 3S96A 2JJVA 3WDJA 3GJEB 3H9ZA 5LGHH 4HJGA 4F9LC 4XCYA 3D85B 3SE4A 3TBSB 4ETQB 1P4IL 4CMHC 1QR1B 1S8DA 1AGBA 5D72L 3G6JE 5I1HL 3ZE0E 5MEQA 3I6KA 4IEFB 1JWUA 5T1LD 1D9KA 2QR0B 4MXVF 2EIEA 3P0YL 4ELMB 1KIRB 5KANI 3OKMA 1AO7B 3FFDB 2H41A 2UZIL 1KJVA 5T3ZH 4OM0L 1I1FB 5IW1A 4JPKH 3VFTB 3JV6A 4WI7A 4P2QB 3IDJA 2FGWH 2FNBA 3MRRA 2IH3B 2UVFA 1NCTA 3ESVF 4OV5B 2P5WE 4KI5E 4P57B 2YMXH 3MLPA 4R2GB 1TVBB 4D0CA 3T8XA 2HLAB 2G5RA 5IB2A 2PNDA 3K80A 3QFJE 3O9WA 1S7QA 3DSNA 1U95A 1F3JA 3QXDA 3SGDH 3B5HA 4OF5A 4NRZB 5E1AB 2GHWB 4K94L 1IT9L 5DTFB 5HGBA 4XMPL 5D1ZA 1UH3A 4LPTA 3MRDB 1JNLL 1TXKA 2ESVB 3AY4C 2FO1A 1T3FA 2I24N 4G9DB 2CSPA 4BKLB 2CK0H 5HJ3A 1BD2B 1UQSA 4N9GB 3MJ7A 3QCVH 1I8KA 3V0AC 5IMLA 2HWZH 2CLRA 3F7VA 1S5IL 2CPCA 4HMEA 4Y4HA 1NLBH 4AYFA 2XNAA 4Y16B 4XPTL 1A6AA 4PV8A 1BAFL 2IGFL 4KI5C 3ARED 1YMMB 3PQYD 4YIQA 4K23L 4TNWF 1FVDB 4HC1L 3TO4B 4TVPD 5SX4I 2F5BL 4CVXA 5GGQL 4ZUVB 4WEBL 4DTGL 5FV2A 3OX8B 4YXKH 3TP4A 2R9HD 3GIZH 1FLTX 3VFSA 1QQDA 5JHLH 1X5IA 5IFHL 3NFPA 5DUBB 1A5FH 1RK1B 1J11A 3VW3H 1JGVL 5HDBE 2ITDA 3KHQA 5IMOA 1S7SB 3K8LA 5F71A 2VZ1A 4TQEH 5I30L 5FYLD 4IRJA 4QRTA 2H6PB 4YPGB 5AD0B 5IM7A 4PUBL 4JFOA 1D5BB 4PUBH 1HOCB 3T0WA 4YBLB 43CAB 4GJTB 3RZCD 1EVTC 4LCWE 2P5ED 3HZKA 1ZGLP 4NKOA 4HH9A 3RZWA 3LIZL 5JPNB 2WANA 1RUAH 1UT9A 1JV5B 1XF4B 3MV01 5ICXB 4EN3C 3K2MC 4JRYA 2RQ8A 4HIXH 4L8BA 1LE5A 2LV4A 4OZIE 5DWUL 2Y6SC 3M17B 2DKUA 1FE8H 1U42A 2P5EE 5IESH 3QWRA 4XNUH 5T1MB 3QEUA 3ARDB 3F7YB 4JFED 1BFTA 2E27L 3BRFA 2AVGA 5HVFB 2EKSB 4GRLD 3O2WH 3QPXL 1RZ8A 3V6ZA 1KCSH 1AD9B 1PQZA 2Y72A 2W9DH 4NQXA 3PWUB 3BH9A 4Y19A 3I2CL 1KCRL 1JRHL 1S5HB 3IKCA 4X80L 2DQEL 1KENH 3MFGB 1YMME 3HG1B 1KJ2A 2DQTH 3BH8A 4ZOAA 5CJQL 3DX6B 1S7XA 4MVBC 3BKCL 3C6LA 4JHAL 3D9AL 5JZ7C 1RJLB 4F7CB 1GC1C 3NFSL 1OP3K 5HGDB 4BELD 2DQGH 3KLSA 5A16B 4R3SB 3TBWB 3OKYA 4KWUA 4I13B 3Q2CA 1OPGH 4NSKA 4N0UB 1N0XH 4L5FH 4QHLA 5AZEL 4U0RC 1PBYA 3QXTA 3SE8H 4UUJA 5FYJD 5BW7A 4DGIL 1DQDH 5EU6D 1VPOH 3O6FC 5GGSY 3C5SA 3GBNH 5IKCA 4LNVA 5HHNB 1Q9WA 4V2CB 2EXWC 4OB5L 4G43A 1KTLA 1MAJA 1SJXA 3MOBL 3N9GH 1VSCA 2MFNA 2N7BA 5CZVH 5I0DA 2CQVA 1TQCB 2PO6D 1W72A 3ZTNH 3OAYK 5D7KE 3FT2A 2EKJA 4NQTA 5EZJA 5K9QG 2NY4B 2HJLA 4DK6A 4P9HL 3WEXB 5GGVY 3EOYG 2NY2B 3GSQA 3G5VB 4Y89A 5D7SH 5HSFA 5HYSB 3L5XL 3R0MA 2PXYA 4HMDA 4J2XA 5T3XD 2M1KA 4WIQA 3MRNB 4JR9H 4LDLB 1NSNH 4NJ9L 1MVUB 1TNNA 4YHIB 2HP4A 3AMLA 4R7DA 3UYRL 4MCZA 4JG0H 2E6QA 5FKAA 1JP5A 1OM3L 4JG0L 5HHQB 4U0RB 3F8UB 5EUOF 1AXTL 1P2CA 3U2SA 3LOWA 1T6VN 3IU4H 3MJ6A 1IMHC 1DQQA 3WL9A 1XCTB 2LU4A 1MF2L 4HLZH 5K9OA 1MFCH 1I8LC 2EYTB 2NXYD 4KXZI 1AHWA 5DVMA 4G42B 5MERB 3DRQB 2KQNA 1TIUA 4NOFA 2NY3C 4NPYB 2PTVA 4P2OC 1NC4B 1U3HB 5E56A 1ORQA 1ONQA 4FQJL 4UDTB 4Y1AD 3HB3C 3VD9A 4RX4D 1U8JB 4W6WB 1GOHA 4C83B 5CKGA 1GH7A 3P0GB 3QAZC 2AEQH 3QCUH 5DI8A 3WUWB 2ESVD 5ERWB 1D5ZB 5I2IA 4KZDL 1RY7B 3H9SD 4NT6A 1N6QH 5T3XH 2VC2H 3RL2B 1EDQA 4CN4A 5CGYD 3AREB 5D1XA 4H8WC 2J8OA 3TN0D 5CIPB 3EUUA 4TRPH 2WBKA 4UQ2B 5IK3B 3SDAC 2MKLC 2B5IC 2NX5D 3T3PE 1O7VA 2D7TL 4GW5A 4DN3L 4U3CA 1DL7H 4KZDH 5EUOB 4EOWL 1VCAA 1UYWH 5DO2D 1WCQA 4KPHL 1QFOA 4PV9A 2Q3ZA 4PY8J 5I1GH 3KYKL 5FYKL 3BDBA 4LHJB 5EIQA 1EHLH 3UTPE 1HHIB 1KG0B 2XNAB 1M7XA 4UIMA 1XGQB 2FO4A 4O9HL 2CLRB 2HJFB 2AK4B 1XCQB 3QDJB 5GGRA 1BD2A 1N26A 1UQSB 3BSZL 5T1LB 1ND0B 5ETUA 4GMSL 1CLYL 1NMBL 4DFHA 1TTGA 2V7NA 2NZ9D 1OP5H 3WV0A 5K9QI 1A8JH 5D1ZB 2X41A 4KMTL 3FRUA 4H0GA 3RWFB 3BT2H 4MS8C 4QRRE 1U95B 3RWGA 3QZWA 1TZGL 3T8XB 1F4AA 3KPOA 5DD3H 4GRWF 2DS4A 3JBG7 3B9KC 1PG7W 3MUHL 1J5OL 4XGZA 1ZT7A 4GMSH 3AREC 4HT1H 3PP4H 4FQ1H 2VABA 5D7SL 1QFWI 4JLRA 4RBPK 5F6IC 1KJVB 1QSZA 4M1GH 1EAJA 3QEGH 3RGVD 4Z77A 3G08B 5ITFA 1P84K 2R9HC 2GY7B 5I1GL 4LSPL 4LL9A 2O61B 4CMHB 3RWCB 3K46A 3UTZA 3MPCA 4W6YB 4MD5B 1SY6A 4O02L 3BDXA 3MLVH 3MJ8A 1YEIH 4X7TB 1YJDL 5C0IA 1IILE 3DROB 2UZIH 2VDLH 2HAZA 1FIGH 4HKXA 4UB0H 4KKNA 3A67L 5MEQB 3G9AB 5BV7B 4CN6A 4TTGA 4M5ZH 3ARFB 4M7JL 5IB5A 4ETQA 1BD2E 5IVZA 4L3EE 2KZ1B 3TCLA 4HJGB 1MQKH 1RSFA 4FFYL 1I1AA 4NRYA 3GJEA 4RAVB 5F7WC 2DWEB 4WTXA 1RUQL 4OF6A 4XNXL 4YZFF 3KXFA 4DW2L 4F57H 5CIPH 1FSKC 1RZFH 3V52H 3IS1X 3LQAH 5EU6A 3QIWA 4G6KL 1OGAE 4MXQC 4NM4L 5FIEA 5B3NA 4P23C 3NA9H 4Y5YA 3CVHB 4DWHA 2XQBL 3NVQA 4KDTC 4XBEL 2H9GB 2D31A 3PF2A 4XVJH 1G7LA 4D9RD 3SKJL 5F6HI 4YHKH 3WBDA 3O2DL 1FIEA 1IAOA 4IOFD 4EKXA 5C0AD 1IFHH 2IFFL 4UOJA 1RIHH 3BEVA 1A7NL 1FP5A 4N0YH 3NOIA 5IIEB 3KAAA 3FQXB 4X6DE 1QLFB 4KRLB 4U1KA 4PJHE 3E6HB 4L3CB 4M9OA 1C16B 5GGTA 5IIEA 1NPUA 3QWOA 5FYLH 5EU7C 1T5WB 3PP3H 4D9QD 1U92B 4XMKH 1F4YL 4RFEA 1BIIB 3KVQA 3DI3B 4O2EA 1SVZA 1LP9B 1I7ZA 5CZXC 2G2RB 3RI5K 2H9GA 3O81A 1ZHKB 2HFFA 4PJCF 5D2LB 5BZWA 2XKSA 4BA8A 3LRSA 2OJZH 1XEDA 2WQ8A 1HXYB 4FP8L 2AXGA 3LCYA 1AQKL 4RWYH 5IEHA 3BQUB 3VGHA 5E5MB 1YNTB 4RGNE 1B0GA 4GAJH 1MFNA 1KIUA 1UACH 4S10A 1U8QB 1H3XA 3CXDL 5E94B 3JUYA 4X4ME 3QUZA 4LMQE 1CIUA 5AUMB 1Y18B 1W0VB 2V6HA 4UOW0 2A77L 4P59L 1MCOL 2EDFA 2XG4A 2E9JA 4RAVA 1KEGL 5EB9A 3ZLQC 5E8NB 3SO3B 2DJUA 1F00I 2YK1H 3QJFB 4GUPB 3QCTH 1H3UA 5IVZB 3MNVB 2CRYA 3U79A 1REIA 1GGBH 1NFDF 2CJUL 3V5DB 4MDIA 5GZOC 2H2SC 1HEZA 1EFQA 2LVEA 1DQTA 4M00A 1VESA 2ORBH 1I85A 1BIHA 4QRQB 1WITA 5D1XD 2Q76B 4RAUB 4WY7H 3BEWB 2MWCA 4JM4H 5F7KC 1WFNA 1HK6A 2YD6A 1NFIB 2W38A 1CE1H 3QULB 5I1KL 3UJIH 2DTMH 1D6EA 3EYVA 3IRPX 1L7IH 4JGUA 3D48R 4U1JB 4PJCB 2K7QA 4NQCB 3RJDA 2W0FB 2WMPA 1NFDE 1QRNA 1TQCC 3L7FB 3RUGF 2ZJSL 4IOIB 4JZOA 4MNQB 1PW3A 5F9AC 3KPPA 1GGIH 5B38G 3QH3B 5D7JB 4PB9H 5BVPH 3GMQA 4JDTH 4S2SB 3PUCA 2E3VA 1ROWA 4IMLB 3KJ6L 3RWFA 1II4E 4ZUTA 3RUGA 2OJEA 3KGRA 5BS0E 3LB6D 1JK8B 5DC4B 2NY3D 3N50A 1LP9E 4Z9KB 4M61B 2Q3AA 1MWAA 4XP5H 5JQ6L 4LSSH 3C5ZB 4JCLA 2VIRB 4OCRL 3L3OB 3HHRB 4F7TB 4O2FB 2HJFA 3CCHA 2RCSL 1YZZA 1HDMA 4MDJB 3OB8A 4Y5VC 4R8WL 1N4XL 4F15C 4ODTH 2HVKA 1DDHA 4P4KA 4JRYD 4XC1H 4JR9L 3QJHA 3IB4A 1RK0B 3PQYE 5DMIL 4XPHL 3QI9D 2R29L 4ZODA 4OJFL 3W9DA 2EDNA 3NCBB 5CIPA 5KVEH 5JOPE 2XN9E 4LLQB 3K74B 2BVYA 5MI0C 4EDWL 2YKLH 4XPAH 5E7BA 2X89D 3QEGL 5CJXA 1MAMH 4NNPH 4OGZA 3V4PH 3SDYH 1EJOH 4EXKA 5I8KL 4OGAC 3QFDA 1F2XK 1T04A 3OQ3B 1JL8A 5GISL 4PJDA 3FB5A 5KSAD 2JIXA 3I85A 1C5CH 4MXWL 4WTZA 3CXDH 4YGAB 1EV2E 3KXFD 3OHXB 4U6TA 3SGKA 3LEXA 1ORQB 2W91A 2X4UA 2VO5A 2YR3A 1ZLVH 2GAZB 1ADQL 2NZ9C 1QVOB 2OQJB 1WC7A 1X5JA 2AV1B 3MRKA 3QUYD 4JY6A 1EAPB 4U33A 3EW3B 2EYTA 3CH1B 2JCCA 4NQVB 3D3VD 2JELL 1DBMH 2PYFA 2XI9A 4LSRL 5GJSH 4I2XA 5L8KB 2D3VA 3O45B 4AQ1B 1XGTB 5HHQA 4XMPH 4TPRL 1Z5LA 3RWDA 5EO0A 5FKAB 1A21A 2VB5A 3NGBC 2JB6B 3O8XA 3NA9L 4R7DB 1EPFA 1T1ZA 5HYQB 4MA8H 3VI4E 2XRAH 1BHGA 1G9ML 1MVUA 1FYTE 4YPJA 3EDEA 3OXSB 3WIHL 4GKZA 1EHXA 3MRPA 4FFWD 5ILTH 1A0QH 4HS3A 3A6BL 1BJ8A 2V5TA 1WZLA 3GSQB 3ARBB 4JDVA 3WEXA 4UT9H 5GRZA 3BZEA 2AERT 4M6OL 4OFYA 5E1HB 2J5LC 3V79C 5DQJA 3BIAX 2ITCA 2A6DA 5D9SB 3GMMA 4TUOB 1CGTA 2MCPL 1LILA 3MXWH 3P9LB 4PJGA 1AFVL 1NCNA 2Z8RA 2ZUSA 3CH8A 1KB5L 3MOAH 4WO4D 4Z95L 1BMGA 3RL1A 1WFTA 1AGCA 1EVUA 5HHNA 3TT1L 5DHYA 4KK5C 2JJUA 3C5SB 5IKCB 2JTDA 1JHLH 4DOHB 3V4UH 3V4UL 1ZSDA 1IGYB 1EA9C 4UUJB 1LDPL 5SWSE 5ABDE 2AJSL 1JWMB 3AB0B 5IT2L 1OSZB 1KB5H 3KYMA 1KEGH 5CS7A 4P23D 3GSUB 4JM2F 2OR9H 5F7HA 2I5YL 4P5KB 3LEYH 5C09D 3VFGH 4CDHA 5KZCB 2ZPKL 2KZWA 3VI3F 1N3NA 4N9OB 3I2CH 2P46B 2E6JA 2CUMA 4JDZA 4F7CA 3MLRH 4PJAA 1I7UA 1LO2L 4OKDA 3U6RA 1NAMH 5EU5B 5DGRA 3GSOA 4D0DA 3NAAL 2YPLA 3N1PC 1IKFL 1XGYL 4ISVA 2D0FA 1OAZL 1JFQH 1I9IL 4NO3A 4Y19B 3PWUA 4W6XB 2DL2A 4IDJH 2AJ3B 1AD9A 3QISA 3KPSA 1TJGH 4WW2C 2FGZA 1PGRB 4OLUH 3CFEB 3MCKA 2EDYA 1AR1D 4YBHA 3MYJA 5C8JB 1AQDA 4DW2H 1JBJA 5CSGA 4OCLC 3WFEL 4BSJA 4Z5RB 3B9AA 3DTXB 4PRPB 4XXDA 2FX8L 5ECJE 1QP1A 3I6LD 2CKNA 3E3QC 4CN1A 4XZUB 5T1KA 4XBEH 4PRBB 2ZUYA 5F1NA 3SE8L 1UH4A 4X9IA 2DIJA 3QEQD 3UTTB 4NM4H 2VLJB 1LGVA 1TJHL 5C07D 3NBNA 1OOAA 5C0EB 2QEJA 5A2JH 1I1CA 4OUUB 5IM7B 3T0XA 4Y1AE 1NBZA 3QDMA 4XB8A 1IC7L 5SWZA 3WJJA 3LPGA 2BP3A 2A1WL 1INDL 5D1XC 2C3XA 2ITDB 2YC1A 5D96B 4PG9A 1RK1A 1JZ5A 4Y8DC 1G9NH 2M2DA 2HVJA 5DUBA 3SE3C 5KS9E 5L2KD 3U0WL 2HTKD 5KSVB 4PJ7A 1G7JA 2P5WA 3FCTA 5FUOH 1LP9F 5L7XL 5HVHC 1IEBB 3D2UA 1BF8A 1D6VH 1NCDH 4GBXA 4PRIE 4CGTA 4J1UA 5I76B 2B5IB 1JJUA 1W8OA 4YIQB 1C7TA 1BF2A 4KROD 2CGRL 3EYSH 2ICWB 4M7LL 1A6AB 4Y16A 4PJEF 4QT5B 4U6XA 4Y4KD 2VWEE 4Y4HB 4RIRA 1SYVB 5IMLB 5E9DA 3BP7A 4HIHB 5HJ3B 3FN3A 3H8NA 3LN4A 3LB6C 4Q6IA 4XMKL 5DJXA 3K4ZA 4AEHH 8CGTA 2HT2D 4HXBL 4JFPA 3CXHJ 4NC1E 5SWSD 4PREA 2Z8VC 1OM3H 2FR4B 3FT3B 5ESQB 1U9KA 5JOEA 4V1DB 4G8GE 1P7HL 3RVWD 3VCLB 1BZ9B 3QXVA 4MCYB 4N0RA 1I8MB 4TRPL 4X98B 1AI1L 4LSVL 1OGAD 1OLLA 1QSED 2ATPB 4LOUC 3RVVC 3MRRB 5DLMH 4GRMA 5JMRA 4JGMA 4QLRA 2IPUK 2VC2L 3FQWA 2X7LB 4OZGF 1CTNA 4EZMA 4I3SH 5T3ZE 4XVSL 3VMOA 5FYJU 1WZMA 2Z31A 3X3GL 4M3KB 5DD0L 3MUY1 3OG6B 1BPVA 3WFHA 2HKHL 4JFFD 2AW2A 3AMKA 2OBGA 2DYPB 4P3DB 2JF1A 1R5VB 4OFYD 2FJGA 3RTQD 5E6ID 1MRFH 2XKNB 5GGUA 2C4FT 1FH5H 1UWGL 1FSKB 2ZCLL 3CFDA 4ODVL 2RIKA 4RGNC 2XKNA 3QHFL 2HTLC 3TIDA 5HHVH 2Q8AL 4X8JA 4P49A 1OF2A 1S9VA 1KPVA 4ZNCD 4GS7C 3CC5A 4WFEE 1IGIH 3TBSA 4KVCH 2VDLL 4APQB 4PRIB 3S36H 3ALWA 1H5BC 3I9GL 1IAIL 2IBZY 2MSPA 1ACYH 2EDOA 2H26B 4FP8H 4JZJA 4KJWD 1J1OH 2RCSH 3T0BA 4GRMB 3WS3A 5ID1B 3QUYC 2V5MA 4PRHD 3KPRB 4JPWL 5HVGB 1A7PL 3EOAA 5J9PB 4D94A 4X98A 3TPKA 3SPVB 2XWTB 4LPUA 4BSVA 1H0DA 3RDTC 3NCYP 2BSSA 1J1XL 2UUDH 1J1PH 4PJXB 4HXAL 1FNSH 3KJ4C 1J1PL 1CGUA 1BWWA 3PDOB 4JDTL 2Y06H 1H3PL 1YPZF 2F53E 4PREB 1IM9B 5HHPA 2EDKA 4JFPB 4MLSA 5F9DC 5F1IB 5DWUH 1CDIA 4K3GA 4Q6IB 1NAML 3MLWL 4G3YH 1JYXA 4I48B 1ORSB 5K9JL 4N68A 1RIUH 4G80B 5CBAB 1TZGH 2ZUQC 4XCFH 1A9EA 1SYVA 3AC0A 4PPTA 3ARGA 3S5LG 4DKAA 4YHKL 1TJIL 1CYGA 4OD2A 4GLRI 3LVEA 5GISH 2OTUB 4UIKH 5HI5C 4JRXB 4NHCH 4IIQB 1NUNB 2V2WB 4D0BA 1LEIA 3HE7B 5E5UB 2Y07H 5DS8B 4G5ZH 2QQKH 4S1RL 5MHSD 4K8RH 5C09B 3Q6GH 5FF6A 4OI9A 1AKJB 3WFZA 3EYQD 3PWNB 3P4OA 1KLGB 4FN0A 4PGEB 2YC1B 3V7MA 2QBWA 2AS5M 3U83A 1QSFD 3UBXA 2CDGB 3BVNA 2F5AL 5SWZB 2YD8A 4YXHL 4RSVA 2GYSA 1LQSR 4IRJC 4LHUD 5MEOB 3OJDB 3PXHA 1OT1A 2GTZB 3GDBA 2BSRB 2PR4L 4N8VG 4AZ8A 4LRNL 1EUTA 1MCRA 3KPLB 1N6QL 5F1NB 2DI8A 1RZIA 3S4SA 1MNUH 2HRPL 2CD0A 1R3LB 5CJ8A 3MGOB 5A1AA 3O8XD 2HKHH 3X11B 1MEXL 3DXAD 3QPQD 5IEKB 2PXYD 4MD4A 4Y5XA 3V6OA 5JUEH 3E3QE 1I1YA 2O5YL 5JDJA 1DBAL 2JCCE 5EPMB 4L9LA 5JR1H 1BBJB 1AQDB 1V05A 5C8JA 3WFDH 3MYJB 1G6RB 2BXZA 2I26N 3MC0A 5KSUA 4DEPB 4KU1A 1I3RA 4GKNA 3C8KB 5F3HA 5LGJB 5BMFL 3GKZA 4Y2OA 1FO0B 1RQ5A 4FTVE 5BS0B 3L9RA 5T3XE 1IAIH 1CL7L 4F7EA 3MBED 2ARJQ 4KKLC 3TBTB 4QRPB 4TVPH 2NY0C 1SY6L 4IJ3B 1BOGA 5D1QA 8FABA 4G6ML 4MAYB 4JDZB 1LO5A 3TO4C 5ALBL 4RX4A 4E0RB 2X6MA 4I18C 1N3NB 4JFQB 1KGCE 4E42B 3L5IA 1ZVSB 4XX1E 1RU9L 4JPWH 1MCCA 1Z9MA 4AK1A 2CR6A 3AM8A 4HIIB 1NAMB 3VXUB 3SDXA 3OKLA 3NCEB 2Y5TA 2G9HA 5IBUB 1H5BB 4OIBA 4JQVA 4RDQG 5LGHL 1MWAL 4ZS6D 2VZUA 1ZSDB 1K4CB 4HKZB 3HPJA 4L4VA 3H3KA 1RURL 1RVFL 3RGHA 3UTSA 4Z7UF 4H1LA 1FGVL 1YEIL 4KRPD 3VFWA 3G5XB 4CW1A 1ZK9A 4BH7B 4HUVB 3IDMB 3TBYA 5KSBF 1OP3H 2A74A 3L3IA 3DBXB 5ILTL 1WBXB 4OF3A 5IJVB 3S98A 5IFHH 4HEME 1KYOK 3QUMH 1XH3A 2HG5A 3BZEB 3OAZH 1F3RB 1IQDA 4LVHC 4PB0H 3D85D 5ALBH 4S1QH 3ZTJG 4R96B 3MFFA 2G5BB 1GZQA 1T4KA 1J8HD 2ZP0T 3ARGC 4PBXA 4U7SA 2W0LA 5D2NB 4M48L 2WWKT 2YD9A 5T1DH 5EN2A 4H88L 3HE7D 1B4JL 2R23B 5F7UA 3QUMA 2BDNL 4H1LH 1S9XB 1KCVL 3QDGD 3RZCA 4J7RA 1DVFD 2CUHA 4WGWB 2CRZA 4XVJL 3CAFA 4LFHG 4LEXL 1AY1H 3O6ML 3O45A 1CLYH 4M93C 2VLRB 5IHBA 1FL6A 5T5FL 2PYFB 2FHCA 2EDWA 3GJFK 4N1EA 1CLOL 4DAGL 2YD7A 4XWGL 3MJ9H 4M5YH 4ONHB 3T2QA 4JY6B 3RGVB 1U93B 4Y4HC 3U0WH 4FZ8H 2OQJA 3G6AA 1QVOA 3EGSA 5IVXF 1M05B 3O11A 4NO0D 2H2PD 1KFAL 4Z7WA 1INDH 2VZVA 1T1YA 3E0GA 3AROA 5F44A 3TJHC 5C6TH 2JIXB 1IVLA 3VFRB 3QWRD 5C9JB 3P11H 4KRNA 1OHQA 4WI3A 1R3JA 4FQIH 3HLAB 2LQRA 2CKBA 3QIBA 4EI6A 1ZTXH 1SYSA 3R06A 1TITA 1Z9OA 5J13C 1S78C 2VZ3A 3QI9C 5J6HA 1B0WA 2VKXA 3UO1L 3UJJH 5EU6E 4ZMAT 3D39D 2RHEA 1JZ3A 4G9FA 1A6ZA 5EBWB 5GS0L 3SKUD 2UY6A 2R56L 1FC1A 4NQCE 3OZ9L 2GK0B 3Q0HA 4JJHA 4TSAH 5DR5L 3O4LB 1PJ9A 1DDHB 5KANG 5JIPA 3K2UL 3VFPB 3IJHA 4PY7B 4FQCH 3T3PF 2XWBB 4X6DF 4HS6A 1XFPA 3QNZA 4Y4FA 1ES0B 2VIRA 5AZ2L 3C5ZA 5I66B 3QWQB 1D7FA 4U05A 3I50H 4K7PH 1RFDL 4F8QA 1FDLH 1EEUA 1W72L 5I1LA 3X17A 4WU5A 4JKPL 4X4XB 3OV6A 4M61A 4PJHA 4FG6C 2W9LA 2ICEB 1J87A 3NCJH 2B1AH 3QHZL 3VGDA 4IJ3C 1D5MA 3L3GB 2XIDA 1Y0LA 3MUGB 4OF8A 3ZHKA 4P5MB 3W0WB 4YDIH 2HWZL 1CK0L 1RPQA 5DJ8A 3STZB 4K3EL 3DLQR 4OF7A 3IU3B 5B8CC 3ECBB 1Q9LB 2FZ3B 1SBSH 2W9EL 5E8EA 4QXWA 1S9KC 2X4PB 3HC4H 4K8RC 4MNQD 3HC3L 4PB0L 3DETD 1T22A 3CGTA 1F90L 3VH8G 5MENA 4HCRA 3HRZB 4NNYA 3GSNB 4U1JA 3MYZA 4OLVH 1F5WA 4LNRA 4PJ7E 5D7JD 3KYKH 5HVWA 5CJ5A 3EYVB 4P5TA 2BVQA 1D3CA 3EYQC 4LHUB 2XTJC 2VXTL 2VAJA 3WIIL 1L7TH 3TT1H 1RJCA 2OCFD 3EYOB 4PG2A 3QNYB 2Q76A 4RAUA 3E6FA 4W4NA 3GMOA 3PL6D 2VKWA 3QRFM 1U2HA 2NW3A 4ODWA 5KVFH 1RIVL 5GGRY 2MCPH 3V5DA 4GW4B 1W72H 2FEEI 4WDIA 4U3HA 4HWUA 2VDML 3MNVA 3VFGL 2DQDL 3PG2A 3VJ6A 2EYRB 3PNWA 2IPTH 1UVQA 4OZFB 1I7TA 1J88A 1EFXA 5JA8B 3O3AB 3PGCB 1AGEB 1NLDH 4LSSL 2VAAA 2J4WH 1FZOB 5HHOB 5MEPB 4WDIB 5BCAA 5DD0H 3AXLB 2Z0BA 2X10A 3T77A 4HWEL 1YNTA 3O8XC 2E7BA 3HC3H 3HUJA 1KLFA 3EYOA 4PRNB 1DUYA 3RIFK 3TC9A 3S4SG 2HFFB 4PBWD 4U1LA 2DLIA 2HT3D 3GJFA 2F53A 3R1GH 4ZFFA 1G0DA 2DQTL 1HWGB 1M1SA 5DJYB 3I02A 1HHGB 2CXGA 2YA1A 3SCMC 3MV9A 5B4MD 3CFCL 3VDBA 2F19H 4RFEB 3CZJA 1HHJB 2B1HL 3ZYIA 1YEKH 3HE6D 4E5XB 2X4PA 3QWOB 1WZKA 3ZKMD 1K8DB 4XXCA 3GRWH 5E8EB 1U8LA 2F74A 3MUJA 1N0LA 3EOBA 1Q9LA 4HKBB 3BEVB 3IU3A 4KV5E 1T0MA 3MBEC 1XF3A 1A6UH 4AJ0A 3NMEA 5A40E 3MUGA 3I3BA 5CKAA 3DRTA 1MCPL 4PB9L 1X7QA 3K81A 3OZ9H 4F9PA 2ZOLB 5LGKA 1QBML 1Z3GH 2R2EA 1R3HA 4L3ED 4ZDHA 4QGTA 5I66A 1MRCL 4FFYH 4HC1A 5F6HJ 4RISH 1IGFL 5DUMH 3SKJH 2AQ3A 4M62H 2XQYK 5B3JF 4HK0B 2P8LB 1W8NA 4O58L 4JREC 1GCFA 3STBA 1JTTA 1B0RA 2Y6SD 1OTSC 1CU4H 4G9FB 2GSIB 3H2WA 3FZUD 4ZAKC 4X5XA 5E08L 3F58L 4EDWH 1IKNC 4UAOC 3MZTA 5I18L 1S9YA 1WTGT 1SYSB 4RGNB 5JHLL 1VEOA 5FM4A 3MJ8B 4X7TA 2Z4QA 4NZRL 3KPTA 3BRDA 3QIBB 5F21B 2UWEB 4J3SA 3Q5TA 1EMTH 3C8HA 2J2ZA 1N2RA 4NRXB 5J57B 3C5JA 1V7ML 2IPKB 1MJUH 4G6JL 3FB7B 3UTSE 1ACZA 3JV4B 3MA7B 3V6OE 3VWKC 1QSEE 1T1YB 1YY9C 5F3BB 4LLUA 4RRPG 4NCC2 3QO0B 2AK1L 3LQZA 3MLUL 2KBGA 3WIIH 3MLUH 4P48A 5L8JB 1IAKB 3NPSC 1UZ6E 4Y4KC 4ONHA 2VDNL 4CJ0A 2X4SA 3C5ZD 3L3HA 4QXTB 3DHJA 2VLLA 3KPOB 2X1PA 2HRLA 4EI5A 4TNVF 5HYJE 4Z7QF 4LVHB 5DMYA 2R2HB 3IFPB 4HDIA 3DI2B 3ARSA 1BLNA 1F4WL 1YN7B 4U0QB 1T6WA 3N85L 3C08L 4PJGE 1K85A 4TVPL 3QUMB 3T65A 2PO6C 4UT6L 3EO9L 3IJYA 4X6BA 4ODXB 1NUGA 5ETUB 1ND0A 1ZA6A 5D2NC 2VR9A 3CFKB 1A6PA 1XCQA 2OL3A 3B2VL 3QDJA 3SGKC 1QBBA 4JY4B 3IJSB 4HUXA 2ERJC 2Q8BL 2QSVA 3GBLA 3QUKB 2DKSA 1V7MH 1YECL 1F58L 1UH2A 5I71C 4PV9B 3E2HC 5J1AA 3Q5YA 2P48B 4Y0GA 1C8PA 1WBZA 2NY5L 4P3CH 1LK2A 3WO3B 5IK3A 4UQ2A 3BPNC 3VRLF 3MNWB 3P0VH 4HUMB 1I3GH 5BO1H 2R1WA 1H9VA 4CU8A 2DQCH 2MQ3A 4KPHH 4NN5B 3B2UD 3HPLB 1WCBB 5GGVH 1CQKA 2IBGA 4G5ZL 4CKVX 1H5BA 2G9HB 3B6SA 2C3HA 1UJ3B 1R5IA 5DJZA 2IPTL 1A7QL 4LCYB 3WO4B 4AENB 4XBPA 5I6XB 3MRQA 4JEGB 4YHPA 4M62L 3OR7B 1MQ8A 5T5FH 1NC4A 1U3HA 1BWMA 3EYFB 5EOCH 3G6DL 3DURB 4G42A 4MAYC 3HUJF 4I3GA 1MRCH 1RZ7L 2A9ML 4KMTH 5D1QB 3TLRA 3F5WB 8FABB 1GOGA 4DQOL 3G04A 4HCRH 3W9EA 4JRXE 2FX7L 4R26H 2IALB 3LHPH 1WVZA 4KKCC 5L2KE 2QKIA 3V5KA 1H3PH 4XTRD 4UV7L 1R6VA 1FO0A 2YMXL 3T0AA 1N64H 3ILPA 3DETC 4GKNB 1PD6A 4UIKL 5E9DE 4HW6A 1E4XI 4JN1L 1KCRH 1A4KA 2AKRB 1QFPA 4Q58C 5FM8A 3NZHH 3IDNA 3D0LA 5EPMA 5FO8B 2AK1H 4YBQC 1I1YB 4Y5XB 2GJ6D 4QHNA 2V17H 3VFOB 3DVNA 2EZ0C 3FT2B 2HLFD 1YMHA 3X14A 1T03H 3EHBC 2IBZX 3MGOA 1R3LA 1HE7A 2F5AH 3O3UN 5C71A 3RY6A 5JDSB 3SDYL 1RZIB 2QADC 3QR2A 4M7ZB 5FHBH 4G43B 4FQCL 3KPLA 2Z35B 4Q7DA 5FV1L 1RUML 5A3IC 2CMRH 2GTZA 3MRGA 3DYMA 4Q9BA 4JANA 4EVNA 2ADGB 4YHOH 1RZFL 1FC2D 4N0UE 2P45B 4P46B 5JLZB 3X3GH 3BVNB 4NQSB 1P5VA 2BC4B 3B4NA 4RFNC 1UKTA 4N0UA 4ONGL 3VXNB 4NSKB 5L2KA 1J12A 4HG4K 3WFCL 1JUFB 3PWNA 3DIFB 2DIBA 1PY9A 1O7SA 4NKDA 5A16A 5T3XL 2YRLA 4XBGA 5H37G 4C4KT 3MRFA 5GZND 1ZAGA 3BUTA 4I0PB 3T3ME 3O6FB 3EJJX 4K7FA 2F58L 1A3RH 5C0JB 1MCHA 3LSOA 1Y6MR 4D0BB 2XA8H 2LFGA 2P8PA 5D6CA 3D25B 1O5DT 2FD6L 2IG2L 1YEDA 3HG1A 5C1MB 3X13B 4B5EA 1IGJA 4QY8A 1S5HA 2AEPL 3EDJA 1UZ8A 3IKCB 4LLYB 5JTWA 3VFUB 1MJ7H 4GKOA 1IM9D 4WHDA 4YXKL 2VXVH 1EGJL 4B41A 3WFDL 4N1CA 2J8UA 2BX5A 2NY6B 3ARGB 3NN8A 1P5UA 1JVKA 1V3LA 3VRIB 3V6ZB 2WZPD 4G80A 2FJHA 3ARYA 4H5SB 4XH2B 3MRJA 1B9ZA 3VDAA 3B3IB 1AP2A 2JLLA 3MCG1 5HHPB 1EHNA 3ARDA 5T1MA 2BVOA 4FNLH 4IOSD 3HA0A 3MLRL 3PDOA 4FNLL 1FFOB 1A6VL 4G9FD 4PJFE 2PTTA 5F96L 3HZYA 3M17A 3BHBA 4H88H 4WUUA 4X9GA 1NCBL 4L8BB 2IANA 2X4TA 4YFEA 4ELME 4UNUA 1VADA 4GG8A 4K7PL 1FNSL 1ZVHA 4PS4L 4JZJB 2DQFB 2F8XC 1A3QA 3TZVA 3ELAT 4FQPA 5IGXL 3EZJB 4HWEH 4C56B 3RA7L 4JM4L 1KN2H 1JCKA 3WDIA 3ZDYF 4XPGL 2YEZA 3GMNA 1G7HB 4H1LG 4OT1L 3T2PA 4S1DC 4C4KO 4X8JB 2FEDC 2DQGL 4XHJC 5IB3A 1UFUA 4U1NB 2QQQA 3SQOH 1F4XL 5IMOB 2W60B 1C5DA 5I1AB 5T5NG 5GGUB 3BKCH 4I9WD 2PUQT 3OPZL 2FJGB 1OP9A 2OLDA 2KQMA 4QXUL 4ZPTA 4EDXA 4P3DA 2V17L 5B8CB 5D2NE 1FIGL 1DSFL 3MA9H 3PABB 4YFDB 2ZSVB 1ZXQA 2ZCLH 4ODVH 1P4LA 5DD1H 4N8VB 1I8LA 5BVJA 4LASL 4GMTL 1JE6A 1RJZB 1QNZL 3AAZB 3ZKQD 5LXGH 4KHTL 5I9QB 2APWA 3HFMH 2WWKO 1FVDA 5DJDB 4ZAKA 3VXMA 3KG5A 5E99H 5IHZB 4P2QE 1KEML 3VGEA 2VSDA 3F7VB 3ZYJA 4YEFA 5CBEB 2WINB 4ZFOA 1NAKH 4M5YL 4NGHH 1DLFL 1V7NH 3GI9L 4LPYA 4I2XE 3CFJA 3WLWC 3VXPB 2FR4A 4MLIA 3SKOA 5LCVL 1LVEA 1YMMD 3PQYB 3Q3GB 2OM5A 4NFBA 2WLZA 5FCUL 3PQYA 4JY5H 3ES6B 2X1WL 3RDTB 4ODUB 4F3FA 1KCUL 1F97A 1NGQL 4PG2C 3U9PH 3WFBL 1W0WB 2FATL 1A3RL 5DRZA 2BVPB 3KYOA 2VLKB 4RA0C 3MLWH 4G3YL 3SJVB 2D0HA 1ZHBB 3UAJD 3O6KL 5HGHB 5EZIL 5DJDA 4ZAKB 4X99A 3TVMC 3VXMB 1EEZB 2BCKA 3VFTA 1A14H 2J1KA 5J6GB 32C2B 3H3PH 4IDJL 4WHYH 3AAZA 3V4PL 1QPPA 4NNXA 4U1HA 5C0BB 1JF6A 4FXGA 5IROC 5FOBA 4BZYA 4XMLL 5B8CA 3O41A 1UXWA 5EC1A 3MV7E 3KPSD 2HVJB 1NANH 2YKLL 4F57L 5FK9B 2BJML 3VI4F 3KLAB 1D9KB 1V5JA 1AD0A 1HZHL 3TYGH 2W60A 3IFNL 3OF6D 4LLVB 3HE6A 1IBGH 3LD8B 3L6FB 4X5WB 1FZJA 2OMBA 3B9DA 3FL7A 1G84A 5GSRA 3BN3B 5ADOL 5C0EA 1QR1A 4PRAB 1DFBL 2OS7A 4UQ3A 2M8XA 4X83A 4KTYA 3V6FB 1JIBA 1S5IH 4F9PC 5ALCH 1T1XA 1HZHH 3TYGL 3WLBA 1LO0H 2AEQL 2VDOL 4WJ5A 1LO4H 3NACH 5IR1B 5EO9A 4FRWA 1JF1A 4HSQA 3F58H 5ESVB 4WUUB 1U58B 5FECA 4WI2A 4N5ED 4XVSH 4Z5RA 3VWKB 4GOSA 4OQTA 3H3BC 4JFXB 4DZBB 5DT1H 1UB5B 3VXTB 4IM8A 1FZKB 5GHWL 3HG1D 3TBVA 1U8KA 3MX0A 4QYOB 2VUYA 3SGJC 3QFJD 4GBXC 4XH2A 1GGIL 3QDGE 3T0VA 4Q9RH 1U36A 4PP2A 2GJZA 1IC5H 5INCA 3QUXB 3NN8B 3PXJA 5HGAA 4DZ8B 3CU1A 4JHWL 3BP4B 3SOBH 4NO3B 3HI6H 4M48H 3VFUA 4OLUL 3MMEB 4M7KH 1BVKA 4Y8AA 1ZV5A 4K71B 5I8CB 5JPMB 4HWZA 3D69B 1IRAY 4HV8B 2UUDK 1QSFB 2Q7NA 5D6CB 3IF1B 1JNHB 2AJSH 4UNVA 4HAFA 4K71C 3QIUA 4L1HA 4ERSH 1U0QA 5DEFB 3ULUC 3ARTA 4XBGB 2WIIB 1DBJH 3MJGX 4J3TA 3DX9A 5E9DD 3DIFA 4UMGA 3T1FB 4JFDD 1HXMA 5L2KB 1KJMA 1VGKB 1JNJA 2P42B 2BMKB 3INUH 4G6AC 2BC4A 1ZA3A 4YGVB 4P2CG 1JWMA 1ACYL 1QBAA 4KK8C 5L9DH 3QQNA 4QOKE 2XWJB 5DFTA 1IGYA 4J3UA 4ZOEA 3VG0H 4F58H 1K6QL 5I1EL 3MRGB 1NGYA 4KV5F 4PJXF 4L4JA 2ZUXA 4XVTH 2ZCKL 3EDDA 4K9EH 1CD1A 5DUML 2Q6WA 2NY6D 3U7AA 5I1CH 1QHPA 5JDSA 1MH5B 4I18B 1I85C 5GGTL 3VD7A 1IZJA 3CLFL 3GMMB 4TUOA 3VD4A 2A6DB 5D9SA 3X14B 3VGFA 1I9JL 1KOAA 3QG7L 1U8MA 3VFOA 4QHNB 5DHVB 3I6GB 3ISWA 4NYLB 3K4DA 3V7AE 4M4RA 1A14L 3ULVD 5D7JC 2NTFA 4NIKB 3RTQA 1GGUA 2XN9B 4RMWA 2W07A 3MV8B 1MOEA 2W0PA 1KXQE 3HR5A 4KK5D 4KK6D 4ZFZB 1F3DJ 1T1ZB 5HYQA 3HE6C 1FNEB 1CFBA 1CVSC 2AXJA 4KUZH 5HYIA 3O4LD 5EO0B 1ADQH 1YUHA 3UTOA 3UTQB 1JNLH 3B5GA 2QKIB 4JG1L 5E2UL 2EEBA 1S7VA 4JPVL 4MZ2A 4AEHL 2ZG1A 5C7XH 1WEJL 3NABL 4X9FA 3UP1A 4P99A 3L1OL 3H0TA 5IW3A 1T2QL 3K8MA 1RZKL 2J3SA 1X3DA 1JWSA 1JYVA 1RZKH 2FRGP 4AT6A 1CGXA 1GJIA 1KELH 1C5BL 2AV1A 3EYFA 4NQUA 3ZT7A 35C8L 3TVMA 3GMRB 2X4UB 3F65A 2NY7L 4JFEB 3NACL 3OHXA 4M6AA 4PJCE 3EDFA 1XR8B 5IJKC 3N9GL 1RUMH 1R5IB 3QFDB 2IQAB 4M02A 4CL7A 2F54E 4G6FD 1XIWA 1JN6A 2JJWA 4MNQE 5DK0B 4KTDL 2W0KA 4FQXA 1ITCA 3ORJA 1U8HA 1HSBB 2X4RB 2V2XA 3B9EA 4CMMA 2QLVB 4TQEL 1MRFL 4HHAB 3W9DB 4OFVA 4QTHB 5T33H 4N8PA 4LLDB 2XG5A 4PJFB 4KQ4H 4YC2C 4RGMC 1NC2A 3F62A 4MVBD 4FQXB 4NKQB 1JN6B 3T0EA 3QRGL 3SDCC 2R0LL 3RHWF 4MDJA 2QSCH 5DJAA 4TUKL 2UZXB 1XF1A 1QPXA 1C5BH 1KELL 5E8DL 2WV3A 1KYOJ 4JY4A 2L7UA 4J6RH 3KR3L 4F7TA 3JV0A 5HI4D 4G8GA 3QXWA 4WW2B 1TZHB 2ZUWA 1OARH 3IJYB 4OCXL 3T65B 1UACL 4P46C 1OAKH 2CR3A 3AS3A 4AT6B 1YN7A 4YDLC 1OLZA 4KGLA 4OLYH 4G8FB 4HJJH 5C3LD 1NUDA 3B83A 4QKXB 2FL5A 4U31A 1YQVL 3KLDA 4WWKC 1CGVA 5KOMC 3FZUC 3MLZH 3GMLB 3W39A 4MNQA 4IOIA 1KIPB 3MNZB 1CFQB 5DJCB 2KUTA 2XTLA 1QRNB 1MHPH 4X7CC 5DZNA 2IJ0C 1MELA 1YYMH 5J4MA 3QUML 3MA7A 1ERNA 2P5EA 1I9JH 2VUOA 3RTQB 3C5JB 4FABH 3QEQB 4ESKA 4XRCA 4D3CH 3I9GH 1NMAH 3O3BA 3BEWA 1NMBH 2Z4QB 5EA0L 3RVTC 2AJYL 2LVCA 1U8MB 3ZE2F 2OX5A 3OGOE 3GJFH 1K5NA 4M7JH 3QIUD 1HEZB 3GBNL 4Z7NE 3JTSB 4H26A 2ERJB 3KNBA 5DYOB 4ZUSB 3TFKC 4JVUA 3UPRB 4I18A 4L8SB 2J5LB 1UA6L 4QHUA 2G75A 4GAFB 2R4RL 2Q6WB 2I60H 4GUPA 5ITBH 1K8IA 4L3EB 4P4RA 4M43L 5D71L 1YEHH 4M93B 1IAMA 4ORGA 1PKQE 4MB3A 4E41A 1ZA3B 4MWFB 4YGVA 3LRGA 1D5IL 4MGXA 2GT9B 1KJMB 4Y19D 3VG9C 1F6LL 1HXMB 3HB3D 5C0AA 4PJAF 1KJ3H 3NGBB 1J05B 2AXGB 1Q72L 1H15A 1WFUA 1HXYA 1OTUD 3VE0B 5IEHB 4MJ6B 1EEYB 1KLUB 1RURH 4WW2F 1UB6B 1ZHKA 1TENA 4YNYA 3DMMD 3D87B 1M71B 3WIFB 1DANT 1HI6B 1IGML 5DEFA 2YS4A 3OB0K 3ZHLA 4DAGH 5KN5B 1JMXA 5HPOA 1RIHL 4R8WH 4D3CL 3BN9C 4ONOA 4ELKA 3MBXH 4TSCL 4AH2B 5JHDB 4UDUB 4APQD 5DMGC 4JJ5B 3IXAA 3D69A 2GSGB 4HWZB 4RGND 4KKCD 1UWEL 1EHAA 3E6HA 4L3CA 4WENB 1QLFA 4U1KB 5T1DL 3JTTA 1MFAH 2OZ4L 2YSSA 1CDGA 4HBCH 4A6YA 1HHJA 3BAEH 3WMSA 3BW9A 3RY6C 1QRNE 3FHAA 3VWJD 5AYQA 1IAOB 5C0DB 3VRJA 2HMIC 1QG3A 2EE3A 4EIGB 3I02B 4PJDE 5CSBA 4OSUH 4H0IA 1B4RA 2FGWL 3OL2A 1WGOA 4JG1H 5E2UH 4JFXA 4F7MB 4ZFFB 4L29B 3SDAB 3T3MF 4EQ3A 4F7PA 4POYA 2P7TA 1L6ZA 5D6DC 4M7LT 5DJ2B 4DKFL 3HUJB 1U58A 2BSED 1TETH 2DBLH 4HJ0D 3MLTB 5ALCL 3JWOH 1JPFA 4JKPH 4JZNB 4LFHD 4NBZB 4LCWD 4N0CC 2EXYC 3QUZC 5ID0B 4OFPA 5I1IL 5CILL 5BOZG 4OBRA 5F9JB 3VFNA 4NRYB 5F89A 1UVQB 4OZFA 3VXUD 2E8ZA 5DRWB 2Q7YA 4ALAH 4OKVA 1R3IH 1T5XB 4UQ3B 4AEIH 5JQHC 1KIQA 2B4CC 4TTDC 2MQ0A 1GGYA 3ZZ1A 3I6LE 5J1SC 1L0XA 1B2WH 5FYLE 3DX7B 3PP3K 4R6UA 2YUZA 1YY8B 4Y88A 1P9MC 2X70A 5GGQH 1N59A 4MD5A 3SCMB 4L8CB 3BPOC 3A6CL 3UTZB 1QLRA 4OD1L 4P5TB 4FXGB 5CAYB 3KDMA 4DUXA 4NNXB 1E6OH 4KK6C 3C6SA 3MACH 1P1ZA 4GAJL 2DQJH 2ADIA 4X6CB 1MHHB 1OD7A 2AAVA 1R3KB 4FFVC 1EEZA 2O26U 2Q1EA 3PV6B 1CT8B 3HZMB 3C2AL 5HGHA 5B38B 4XGZB 3LKOB 3KYOB 2BVPA 1KV3A 1I1RA 3FO9B 5DJ8B 5GGSA 3STZA 4GO6B 1W0WA 5D7IE 4KMLB 1F4WH 3GBMH 3VGAC 4RMRA 3C08H 3L3GA 4LBEA 3FRUB 4JFDA 4ZUUA 5FGCE 2M26A 3U7WH 4PJHB 1DEEB 1CLZH 1NCCH 4WU5B 1AE6H 3O2VL 3GSRB 5T1LA 4WFFE 3D0VA 5IFAL 3CFJB 4NQEE 5CP7B 4U1IA 2B2XL 4UBDC 4LU5H 5GJTL 4Y4FB 3D5OF 4HS6B 4NCDA 2XFXA 4UILH 2XWBA 4CU6A 2OTWB 2YHGA 4WHCA 1HHIA 5LAXB 1PFCA 5DD1L 5CGMA 4WHTA 4QOKA 2B0SL 5KBNC 2CUIA 2Y1VA 4Z7NF 3GSWB 1FHGA 4UINL 1QTYT 2YPVL 2FH6A 3L3KB 4HFWB 5HHVL 2Q8AH 2EECA 5FB8A 3FMGH 1FFNA 4IRSC 1HINL 3P73A