1RZQA

Crystal structure of c-terminal despentapeptide nitrite reductase from achromobacter cycloclastes at ph5.0
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
328
structure length
328
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title pH-profile crystal structure studies of C-terminal despentapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 84
structure length 328
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA02
3FQ2A 3X1NA 1AACA 2RACA 3DKHA 4M3HA 2BW4A 3ABKB 2MTAA 3D12B 1KDJA 2JFCA 1X9RA 1BQ5A 1L9TA 3EH3B 2A3TA 2QPDB 1JXFA 2TSBA 1AZBA 4G7QB 1NPJA 2ZWNA 2AFNA 4Q8BA 3UGEA 1NWOA 3HEIB 5PAZA 4YSUA 1BYOA 5ANHA 4TXVB 3S8FB 1PMYA 1GS6X 2BHFA 3T71A 4KNUA 3SQRA 1YLBB 3ERXA 4ENZA 1SFDA 3EHBB 4G72B 2AANA 2Q9OA 3DIVA 1BEXA 2VW7A 2FT6A 5E9NA 4GP4B 1GY2A 4A2GA 4RH4A 3FU9A 4GP5B 1L9OA 3L45A 1QLEB 3WIAA 3ZDWA 2R7EA 1A8ZA 1J9QA 3X2QB 4DPAX 3EH4B 3T6VA 1JVOA 4A68A 1IBYA 1JZHA 1ASQA 3ABLB 2PCYA 4M4RB 1OF0A 2Q5BA 1CYWA 3SBPA 2GC4C 4DP1X 3NJIA 1CYXA 3OMNB 1SHWA 4HHWA 1IC0A 4NB7A 3S3CB 1NIAA 4G7RB 3N55A 3FSVA 2PLTA 2XX1A 3NP4A 2XLLA 1NZRA 4NAJA 4DP6X 3BQVA 3H4FA 3ZX1A 3AY2A 4W1TA 3AW5A 4E9VA 2CBPA 4X4KA 2EIJB 2VN3A 2WO2B 5F7AA 3NSCA 4KO5A 1AZNA 1OCOB 2EIKB 1VLXA 1W6WA 3FPXA 3NSFA 5I5JA 2CUAA 1EHKB 8PAZA 2B08A 1ZV2A 2W8CA 3X1FA 2YQBA 1JVLA 1ZDQA 3OQRA 2XWZA 4DPCX 4YL4A 4AZUA 3PAZA 1MG2C 1KDIA 2CJ3A 1ADWA 4A2EA 5I6PA 1ZIBA 3IN2A 1FWXA 2FTAA 2HX7A 2H47C 4JHUA 1URIA 1XB3A 5B1JA 1KV7A 3MX0B 4DP8X 2J5WA 1T5KA 4A66A 1RZQA 1GSKA 1PLAA 2XVBA 2WO3B 2PCFA 3H4HA 1PF3A 1KBVA 2IDTA 3EF4A 3NJNA 4E9SA 1DYZA 3U25A 3UAAA 1WAEA 2HRGA 3G5WA 1N68A 1NWPA 1ET8A 1KCBA 3NJHA 4E9QA 1J5CA 1NTDA 2XU9A 3CZUB 3TBBA 2IDUA 4DP4X 2ZXWB 2UXGA 1I53A 4YSAA 6PCYA 2PP9A 2DWTA 4E9TA 4KO9A 3SBRA 2XYBA 1NICA 2UX6A 2UXVA 1ZDSA 3PXLA 3FSZA 1AG0A 2PP8A 1BYPA 2IAAC 5TK2A 5I6OA 4G7SB 1WA0X 3QPKA 3ZBMA 4KO6A 1XB8A 1BQKA 1JERA 3OMIB 2VM4A 2YXVA 3QJRB 3X1GA 1AS7A 4A2DA 4YSTA 2PPAA 1BQRA 2YAOA 3CDZA 1OE2A 3FU7B 2IH8A 2BZCA 2J56A 3NP3A 2XUWA 3TA4D 3TU6A 4UF7C 2CALA 4F2EA 3V9CA 1NPNA 1KYAA 3T6WA 3KW7A 1A4CA 1KCWA 5A7EA 5B1AB 1UATA 1EZLA 5I5MA 1M57B 2I7OA 1WA2X 2QDWA 4W9ZA 4HHGA 5I6NA 2JXMA 2HZHA 4K9JA 4G70B 2BP0B 1OV8A 3UAEA 2HX8A 1SDDA 1NIDA 1RCYA 2VSMB 3BVDB 5B7FA 3NJGA 4E9WA 1RZPA 7PCYA 1ET5A 2X87A 2FNWA 1PNDA 2XXGA 3AG1B 2VW6A 3ASNB 4BWUA 4DP2X 3ABGA 2AZUA 4GP8B 1ASPA 3T6ZA 2IWKA 4EF3A 5B7MA 3SBQA 1OCRB 1TEGA 2IDSA 4JHVA 4P5SA 1ETJA 4DP7X 1AANA 1OCCB 1AIZA 1JZJA 4AX3A 3FYEB 2Y69B 2DYSB 4A2HA 3DTUB 1JOIA 2PP7A 2I7SA 1L9QA 4BDVA 3FU8A 1E5ZA 1QHQA 4DP9X 2FT7A 3FT0A 5EHFA 4YVUA 1PLCA 3NSYA 1J9RA 3IE9A 1A4BA 1OCZB 1NIEA 1PY0A 1L9RA 3JT2A 2BWDA 5I6LA 2YARA 3JTBA 3AG2B 5PCYA 1GR7A 3CVBA 3ABMB 1A3ZA 2H5UA 5B7EA 3V9EA 3WKQA 3H56A 3NJLA 2OCCB 5I26A 1ZIAA 4YSEA 3GDCA 2IWEA 3WNJA 4MFHA 1AZCA 2XXFA 2AVFA 2LLNA 1KBWA 5I6MA 3CDZB 2J55A 5LDUA 2PPCA 4UANA 1HFUA 3UADA 1ZPUA 2GB2A 4AKQA 1BAWA 3OM3B 1IKOP 4YSCA 2IDQA 3PAUA 1J9SA 1NIBA 3QJQB 4A67A 2CCWA 4YSPA 2R7EB 5D4JA 2FQDA 3WI9A 1A65A 4AKPA 2DY2A 3MBWB 4KNSA 1SDDB 2DWSA 3QJTB 5I5IA 2XV2A 5IY5B 4AKOA 3ZIYA 1QNIA 1V10A 2BZ7A 1R1CA 3S3DB 4QLWA 2IWFA 4Q89A 4WKXA 3FSWA 2E86A 2P80D 2XX0A 2BP8A 4F2FA 1AOZA 2GIMA 1TKWA 2FWLB 4HALA 4WTQA 1AQ8A 1M56B 2IDFA 4BWWA 1AS6A 1FFTB 4HAKA 1WS7A 4BXVA 4CSZA 1MZZA 1W6LA 1KGYE 4KOBA 4L0PB 4FA7B 1OE3A 1V54B 5TK4A 3QJSB 2VM3A 4UAHA 3WKPA 4JKNA 1OE1A 4CSPA 1F56A 4YSDA 3C75A 2IH9A 1PNCA 3X1BA 3FQ1A 2XV0A 4DP0X 3X1EA 4YSSA 1A4AA 1V55B 2UX7A 2FQFA 2VW4A 5B1BB 1HAWA 1M9WA 3OMAB 1AAJA 1E5YA 1TU2A 3PCYA 5D4IA 2PPDA 2FJSA 1JZGA 1J5DA 3CG8A 1IBZA 2P80A 2H3XC 3NJFA 2EILB 4P5RA 3CVDA 2X88A 1PZCA 1CURA 2XV3A 3FSAA 1RKRA 4PCYA 4F7KA 7PAZA 1BXUA 2GHZA 1SHXA 1CC3A 5I28A 1DZ0A 4PAZA 2ZONA 2MRYA 1GS7A 2FQEA 1PZBA 2BO0A 1B3IA 1SJMA 1GS8A 1TEFA 3IBOA 4FAAB 3UACA 1J9TA 1GYCA 3WG7B 3AG3B 2YAMA 3QQXA 4BWTA 1SF5A 4BK5C 1JZEA 4GXFA 3FYIB 3QJVB 1ILUA 5AZUA 3CVCA 4N8UA 2EINB 1JZFA 2UXFA 4HCFA 1GY1A 2YAFA 4ZK8A 3NYKA 2B3IA 1JXGA 1AS8A 4HCIA 5B3SB 4YSQA 2UXTA 1JXDA 1JZIA 4G71B 1AZUA 1GW0A 2EIMB 3IEAA 3HB3B 3IN0A 1W8EA 3NJJA 5FC9A 1SF3A 1MG3C 3FQYA 2BP8B 1NINA 3KW8A 2Y1AA 3UABA 1NIFA 3T6XA 4GY4A 3NJMA 2I85A 4NERA 1OOWA 2PPFA 4KO7A 4YSOA 1XMEB 2WSDA 4AI7A 1ASOA 2QT6A 1PZAA 3TASA 3WNIA 1E30A 2NRDA 1SFHA 1BXVA 4E9RA 2PPEA 3EH5B 5B1JC 2BW5A 2VMJA 4E9YA 4BXSV 1FA4A 3AZUA 3NJKA 2N0MA 3FU7A 1MDAA 2HXAA 4HCGA 2AZAA 2DV6A 4GYBA 1L9PA 2FQGA 5AFAA 3QJUB 2BWIA 5AKRA 4YVNA 3FS9A 3PPSA 4HIPA 2J57A 6PAZA 4N4YB 2HRHA 3S3BB 1IUZA 1PAZA 2W88A 2HX9A 1HAUA 5D4HA 3TBCA 1ILSA 1NDTA 2YAPA 2GC7C 4YSRA 4E9XA 3S8GB 1E67A 5B1KA 1MZYA 2DYRB 2OV0A 1WA1X 3GXUB 2YAEA 2BP0A 2YXWA 3PLYA 2QPEB 2HLEB 4QKTA 1L9SA 2FT8A 2TSAA 2YAHA 3NT0A 4KOCA 1AR1B 1CUOA 1AG6A 1SNRA 3NSDA 5F7BA 2YAQA 3FPYA 1WS8A 4A2FA 3OD3A 4DPBX 1PCSA 4HZ1A 4KNTA 2ZOOA 3GYRA 1N70A 3PAVA 3AG4B 1ET7A 2VSKB 1AZRA 1BXAA 4DP5X 2GSMB 5I6KA 2JKWA 2GI0A 1X9UA 3ASOB 3N2JA 2QDVA 3T9WA 1ID2A 9PCYA 1PLBA 2OJ1A 3RYMA 2GBAA 1XB6A 2CAKA 1E65A 4BDVB
chains in the Genus database with same CATH superfamily
5IR1B 3ARFB 2VABA 4V1DB 2ZWZA 3VFSB 1Q9LB 3ABKB 3W0WD 1NDGB 2F5BH 3V6OE 1NBQA 1NGWA 4XP4L 1M1XA 5T1KB 4EN2A 4ZX3A 1X9RA 2A3TA 1QSEB 3SBWA 3VWKB 3CFKB 4AEIH 1DUYA 4KRLB 2VRAA 3HI5H 1IAII 3BEWB 3RX8A 1NGXA 4FQHA 3NCYP 3IKCA 1FAIH 2BHFA 4N86A 3OPZL 4IRJA 1XGYL 5ALBL 3QIUD 1IKNC 1FNSH 1WVZA 4HBCH 4KY1H 2DLGA 3VSVA 4ENZA 2AJ3A 3QEQA 4I48B 1NCUA 2Y1VA 4G72B 1JG9A 4MBRA 5CCKL 4IEFB 2VMCA 3OR7B 3ECQA 1JL8A 4DAGH 1WIUA 2F7QA 3HE6A 3P9WB 4BFOA 2IANB 2M1KA 4RH4A 5AWNH 3NUKA 1JBJA 1JYWA 1J1OH 1XEDA 1A7BA 2I32A 3OJVC 4M1GH 3TJPA 1Q9WB 2VMFA 1IJNA 1HWWA 3JV5A 4I8DA 5B4MC 4IJ3B 1QSFD 3QWOA 2FL5B 2R29A 2OL3L 3JV4A 4HIXL 5F1SA 3AB0C 5GISH 2AS5M 1JHLL 2HKAA 3GRWH 1QQDB 1PFOA 3CVIH 3DSFH 1PG7W 1LEIB 4PS7A 4C8XA 4OCWH 1WBXA 2XZCL 3X12A 1ETZB 1FNLA 2GTWA 2QHRL 5L2JB 1N6QL 4JFED 5AVWB 2J2ZA 3WDJA 3A67L 4Z76B 1MCKA 4HJ0C 4ZUUB 5CILL 1U6AH 5CKAA 1TQVA 4ZMWA 3OLIA 3EJZC 1PW3A 4WHDA 4L8CB 3EO0B 4WWKC 4IHBA 4P57B 2CGYA 4K73A 4KK9D 5E1AB 5AYQA 2GCYB 4LHUD 3V6ZA 3R0NA 3K4AA 3RWJB 4M93B 3L4UA 4E9VA 1D3CA 4PRID 2VN3A 5ECGA 5CEZE 2AEQL 1CE6A 3NSCA 1U8NA 4I77L 2YD2A 3OMZA 3WTVA 5EWIH 4EI0A 2J8HA 2BNRA 1PG7L 3GSXB 4PYGA 5DD0H 4OJFH 5C0AB 1RJLB 5LBVA 3IJHA 1HE7A 3TPUA 3CD4A 1RJYA 4JN2A 1NKRA 4DPCX 2VDKL 4GW1B 1IIKA 3AC0A 4PJHA 4LCWE 4M56A 2DQTL 4QAWA 3OKKA 4U6YA 5IFJA 4TUJB 2AJVL 1AJ7H 4APQB 4M7ZC 4ZFFA 4HF5H 1JGLH 3BLBA 3VD2A 2LHAA 1GSKA 4MXQC 5E2TH 5SWZD 3QI9B 4WI2A 4KK8C 4WDIB 4A7GF 5C6TL 3WJMB 1JPEA 2YZ1A 4FNUA 1A6AB 5KSBA 2XN1A 5CZRA 2NCEA 1XVSA 2WJ5A 3DX8A 3QEUB 3QUZB 3RB5A 4TVPE 4CDGC 4KRNA 5ESQA 1ORSA 2R4SH 1AXTL 4C57C 3BSHA 2ZOKA 3FQTB 2A9CA 3OKLA 2BCMA 4KH9A 3FUIA 3HNVH 3QT2A 4RA0C 3P9MB 3ZKND 2M2DA 4YHLH 3CZFA 3L5WB 3GHEH 2ZUUA 4HUVB 3U30B 2ZG1A 3D3VE 5DEGB 4F92B 2YA0A 2NMSA 2WUBL 4LHJB 5MEOA 2VLRB 2O1AA 3N85L 3VFUA 4JX0A 3VGGA 1BQSA 3WEAA 1RVFH 3F12A 2QVKA 4CNIB 3PNRB 5ISZA 4MXWL 5IKCA 1QWNA 3MGAA 3RVTD 3Q48A 4GSXA 5AVTB 2MHAA 3RPIB 4ABVA 4NM8H 4PJ7E 2NTSP 4PCSA 4KVCH 4HGWB 3ECBB 9CGTA 3JWNH 2KERA 5JQHC 1FUNA 5DFAA 5CZXD 2IBBA 3A3YB 1TFPA 1E7UA 3TA3C 2IADB 1PFCA 4J3TA 3N04A 3NFPA 5A6MA 4ZUWA 2JTDA 4EVNB 1PDKB 2X70A 3U1QA 1UFUA 4HUMB 1EZLA 1EIBA 1KB5B 2Z31C 1MLCB 4AWJC 1AGBA 5T3XD 1OP5H 5C6WH 4JUTA 3GS4A 6FABL 1UM5L 2FEDC 4GQZA 3IDUA 4HQQH 1CVSC 1VF5C 3PWUA 2ZX6A 3EGXA 2WV3A 3VXSE 5HVHC 5C09B 3N1PC 5EZLB 4NN6B 4MJ5B 2G3ZA 1G7HA 2APWA 1HHJA 4GMSH 1BFVH 3OKOB 4PLKD 4DO5A 2VT0A 5DTFA 4O02B 5EC2B 2ZSWB 2JJVA 4I3SL 3BUTA 3IGFA 1OO2A 2EABA 2F1BA 3I85A 3QWQB 1N26A 1P4LB 1ZV5A 4F7MA 5K39B 4P9HC 4X4MA 4PSPA 2B7DT 5EA0L 3TEZA 4L5FH 3TIEB 1WGOA 1ZE3C 2E9WA 1OCRB 2XWEA 3LJ3A 3C6LD 3P1VA 4P5SA 4X6EA 3UXFA 3VXUE 3P2TA 3RRQA 1USQA 2R56H 3MODH 3H3BC 4MNQD 4FQ1H 4NO2A 5TDPA 2XTJC 2CKBB 5ABDE 5DUMH 1D5XA 1D9KA 1WZ1H 1T1WB 2C4FU 5ELIA 1VFOA 4UTBA 3CLWA 2HLFC 3IRCA 4JPKL 4P8QA 3ZZ1A 5IJVB 4G8GD 3SD2A 5LXGH 1BSIA 5LO7A 2AMGA 2Q8AL 4Z3HA 3LN5B 1OOAA 5F9OL 3KPSD 3GSNH 1Z9MA 2A0LC 2N1TE 4LCUB 4LL9A 1TNNA 2ICEB 3LIZL 3W56A 2X2IA 4JHWH 5JORA 2IWEA 2CH8A 1SXZA 3ZTJG 4L8SB 1A7QL 1JXKA 4G7YL 2V2WA 5J3HD 1P5VA 1UOWA 5AVUB 1OGTB 3J7HA 1X7TA 2E27H 3LDBB 4HZLB 2NXZB 4ELKA 4KZEH 2EYRB 4Z7WB 5D96B 1MI5D 2Y7QA 5E1QA 2FYVA 4Z0XB 5A6LA 1T1YB 3G6JE 3WFBH 4RISL 5E00B 3HS0B 4J3VA 3T0DA 4F58H 2BY0A 3STLB 1BAWA 3EO9L 1T1XB 5AZ2L 4YS4A 5D7KD 3PAUA 5LNDA 5DEJA 3QJXA 3FRUA 2JCWA 3QFJD 4Z7OB 2DQUH 3QVAA 4CJ0A 3BLPX 2BIOA 5D1XA 5KJRL 4HWUA 2BNUA 3K6SB 1KTDA 4JGUA 1SJHB 1K4CA 3PP3K 4L4TD 3TH3T 3QORA 4RFNB 5DCCA 4GNKB 5KBNC 3KR3L 1NFIB 2NX5B 4L1DA 4TNWF 3FU6A 2YK1H 3G6JF 1KIRA 1TPXB 2HLAA 2NNXA 4B9FA 3T2QA 4PBXA 4UV7H 4J6RL 5C0JA 1UZ8A 5EU5B 1BFSA 1MAJA 1TQTA 4U7SA 3N40F 5I16B 2V7HB 3MRGA 5KBKA 1FNEA 3K1KC 2MSPA 2YEQA 5B21A 3CHRA 3MCKB 2X1OA 3SYCA 3WKPA 1JF1B 2NZIA 4JRXE 4BZ2L 1EHXA 3W1ZA 1UT1A 4N2OA 3C75A 4LL1A 2FB4H 4X6BA 1TCRB 1YEEH 5I19H 4OZFG 2ATKB 3MROA 3BWUC 3MV7E 3RA7H 1HL4A 3H7BB 4N9GB 5KUKA 5JXAL 3CN4A 2X4PB 1LE5A 3GHPA 3U9WA 3MDJA 2A9BA 3MRFA 4F80A 3FSAA 4XX1G 4PCYA 1CJYA 3IFPB 2OK0H 1T2QH 4LOEA 1JDCA 4UQ9A 3JWOH 1ZVHA 3UJJL 2XQBL 3JWDC 4PTUB 4NEHB 3HC0A 1QATA 1BMWA 2JQZA 5CKGA 1IT9L 2AEOA 1IAIL 4FA6A 3WFDL 4Z6AT 2VLKD 4H1LG 5HDOA 3V52H 3L3JB 1WTLA 3S7GA 4G3YH 2IAMD 4O2CB 4XNUL 4FOMA 3WFHB 4E41A 1BVZA 4HDIB 3MSPA 4F91B 3QPQD 2XT1B 5HJDA 2CRMA 4HAFA 3ZYZA 3BLKA 1YEHH 4Q9BA 3ILPB 5E2UH 4B9KC 3KPOA 5CP7B 1G1OA 1E0OB 2OTWA 3QUYD 5IB5A 1UJ3B 2A6KA 1PKQA 3FFDA 4LSUL 3L7EB 5HHOB 2RQ8A 4MKTA 1UCBH 4I3RH 3NIDB 3TWYA 2YMOA 5IT2H 2E7DA 1DQJA 1JXGA 2PYFA 3HR6A 3D34A 2ICWB 1KULA 1GKEA 4XPGL 1JZ7A 2J8UB 3MA7B 2EIMB 3MRQB 5F7DA 4GQ9L 5DD3H 1HVXA 1W8EA 2VITB 3L13A 3U4AA 1D5BB 2X7LB 5F3BB 2CXGA 2BP8B 3HPJB 4NXKA 1NIFA 3VRIA 1FYTE 3UG3A 3W2DL 1T0NB 4ODUA 5AW4B 3ESNA 1OCWL 1JRHI 1WUNT 4X6CA 4EI5A 4GEIA 4I1RA 5F71A 1BZ7A 5A40E 5I30H 2CUHA 2NRDA 2IFFH 1OPGH 3NA9H 3EH5B 2NY4D 5AG9A 2PW2A 2PYEB 1R3IL 4LOUC 4DGVH 3ZRFC 4Z7AA 3AZUA 1E8YA 2X4NA 1DBML 3IMVA 2JKLA 4H13C 4PRHA 1FRGL 4OFKA 3KDMA 1GGUA 5DJXA 2F7PA 5HYFA 4R96A 2CLVA 3ESVF 4NQDA 1JPTH 1TMCB 4ESKA 3OKEA 5I24A 4JY6B 4TULL 1V8HA 4LLDA 5B1KA 1A9BA 1U2HA 1KELH 3P0YH 4YEEA 5HHPA 2XN9A 4NHCL 1B88A 5FUZL 1NEUA 1NAMB 4J3OD 4U1GC 3PLYA 3ZZQA 2VCOA 3NIGF 4UNIA 3CXDH 2FJUB 3LKRA 3VRLE 2CGRH 4K3JH 1J0KA 5C70A 3DI3B 1L9SA 2FT8A 1DLFH 1ZWIA 2QKIB 3PGCA 1P6AB 4G59C 4TQ8A 3LRKA 3SPGA 4JHZA 2Y3NA 2DEWX 1OKEA 5FS5A 1A7RL 2AQRA 3D0LB 1N70A 4OM1H 1OB0A 3ECUA 4ZMQA 2J73A 3BKJL 4JY4B 3VCLB 3B34A 1T03L 4XMLL 5DK0A 4IRJD 4L1BA 3VFOA 3WS6C 4UTAL 4BINA 1YAZA 1M42A 3QEQD 3M6DA 2VTFA 1A6WH 4B96A 5F0PB 3VRLF 1NSNL 1ID2A 2HCZX 4OD1H 3U82B 1KCUL 4TUUA 5F3HB 3IMTA 1KPVB 2VDNH 4UINH 4RAVA 1AKJA 1QRNE 4G2AA 3BHBA 4BUQA 3L6FB 3X1NA 1G84A 1BX2A 4UCFA 4GKZB 4M3HA 1T20A 2ZXEB 4PJDF 2GY5A 3EO1B 4QD2E 5LJYH 4ETQB 1XH3A 2QPDB 2WWNA 3US9A 1RK1B 1JDAA 4RAHA 3VYPA 2XTJE 3OAZK 5PAZA 2VR3A 3RUGF 4KTEL 3TWCL 1BQHA 1A4JB 3KWWB 4A6YH 4AUJA 4KNUA 1H6FA 4IOIB 2K6WA 1TITA 4XO9A 3WFZA 1ZLSL 3MNVB 3TIDA 1HYRC 1MJUL 3MRBB 2F74B 3QH3A 4XTRD 4Y4HB 3ZTNL 1IJ9A 1QP1A 5D93B 1GC1C 3LNIA 3ZKMC 4IMKC 4DCQA 1YYCA 2VE6A 1XSKA 3FQWA 2A74A 3L16A 1E8ZA 3FU9A 3GSWB 3HAEB 5C07B 2V9QA 3U1SL 2XZAH 3NRFA 4ILDA 2YXFA 3UBXA 1YJDL 2V17L 4Z7UF 3O11A 4HIJA 4DNLA 1BD2B 1H8LA 4Y9EA 1NEPA 3SEPA 1BF2A 1N7ML 3MLYL 4N6RA 3ZRSA 3HHMA 1YC8A 3OSVA 5BOJA 4KZDL 2Q76B 1MIEH 1F11A 3SBPA 5GZNA 3DDFA 3QG6B 1OT4A 3OWRA 3EFFA 1RJCA 1IC0A 3CPLA 4KJYA 1VPOH 5IB2A 2WOYA 4PP1D 2WKGA 3H0TA 3K4ZA 2V3DA 2KI6A 5FFGA 2OXHA 3IS1X 3B2VH 4TSBH 1DVFB 4NFDA 2BP5M 2V7NB 5H37G 4OD2B 4QNPE 1WFOA 1OW0C 1H3WM 1E6JL 3TFBA 5F7AA 3HZYA 1VDGA 3IMRA 4FQIH 4Y9CA 3HJEA 3M17A 5AVSB 3CZJA 4LSPH 4ZQKB 4Q4EA 3BUDA 4KVNL 3ZUCA 2GJ6A 5HYQB 1UQSB 1ROCA 5DD5L 1BFOA 4RIRA 1E5BA 4X8CA 4PJXE 3ZDYB 4QNPF 5HYEA 2YRBA 1SGKA 15C8H 5I74B 2MJWA 1GYUA 1SHMA 2VXTL 2EZ0D 5FGCE 4F7TB 3DMMC 4P4RB 4YOKA 2JCCB 3NFNB 2C3VA 1OAZH 1MCDA 2LT9A 3VXQB 2XA8H 5D55A 2VR8A 3WL9A 1BMGA 1NCTA 3QDMD 4S1QH 3DX6A 1B4RA 4FMVA 5ISZD 1BREA 4G5ZL 3UAAA 4PJXF 1FFNB 1WAEA 5ID1A 3GKZA 3HFML 2DM2A 5DDHA 4AYBA 3D50A 2DJMA 4GAGH 2YUXA 4LQFH 5KJ7E 1AO7A 1PD0A 3DJTA 3IU3A 1RUPL 4K8RD 4LZKA 4HIEB 3CLEL 2W65B 3NDZE 1RJZB 3CVHA 4M7KL 3VFMB 2Y25A 2AXFB 1BAGA 1SYVB 2HT2D 2JKXA 3QZNA 5ECJE 4YEFA 2E4TA 2ENYA 5CJBA 1KNOB 1J1PH 3QP3A 1A47A 1KJ2A 3D9AH 4R7VA 4PRBB 4PUBL 1XB8A 3FHEA 1U8JA 4GW5B 4AQ8A 1CR9L 4CN6A 3S5YA 4P46A 1QMUA 3MRKA 4JO2H 3OMIB 3LKNA 4CSTA 4KTYA 1MCWM 4HSAC 4YSTA 4ZMPA 3MV8B 2DAVA 2J6EL 2VDLB 3P77A 1K5NA 3B7YA 1NKOA 3LVEA 4WF7A 2W0KA 4LCYB 2HVJB 1A6VL 4AYSA 3H2WA 2MQ3A 2GSIB 4JO1L 1RUAH 3T6WA 3FT4B 3MRHA 1KCWA 3A4FA 1DQML 4KI5D 2FYYA 4XNQA 2R2CA 4JFXB 1MAMH 1G0DA 2LFGA 4NC1E 4L37A 4AG4L 1DVSA 4AQEA 1LK3H 2PXYB 1D9KD 3A6CH 3D2UA 3FTXA 4PJGF 4QT5B 1YECH 3QHFL 2UWEA 3WY3A 3NJGA 3EFOB 1A7PL 3EDFA 4Z7QB 4ZZKA 2RBLA 3LQZB 4ZG1A 4M48H 2R1YA 3GSNA 1W8NA 1Y6KR 5E9DD 4LE8A 3FB8B 3OHXB 2P26A 4TQIA 1OZTG 3S36X 2Q3AA 3I9PA 4JFDA 2LLLA 4U1LA 3LH2L 5EF2A 4PY7B 5I17A 4XP4H 1JK8B 3SDAA 1R3JA 3H9SE 1AANA 2OZ4A 1OCCB 1NBZA 3VI4E 3UJIL 3V4VH 4PJAE 1U3YA 4TM9A 4HUXB 1GIGL 3G6AB 2P5WA 1XIWB 3OPZH 5JOPD 1DEEA 3I3DA 3G5VA 1EJFA 5ALBH 4UV4L 5AOKA 5ALCH 1K2DB 4ZQTA 2Y7MA 3L17A 1HSBB 1GW6A 5FGBC 2VNCA 5CIPB 2WPGA 3CXFA 5CCKH 4HFUH 1L0YA 1JNNH 4BFGA 3QORD 4PV8A 3DTXA 3BRFA 3VI4F 1G1KA 4PJAF 2IBGA 1JRHL 2H9GA 2P24B 3HCVB 4S1DD 2NNAA 2Q6WB 3QIBB 1U2CA 4F33A 3MTRA 4UANA 2YPVL 4HIXH 4IK6A 4YE0A 4AKQA 1P5UB 3KGTA 4JAMA 1M7DB 2Q7YB 1CCZA 4Q52A 1ZHKA 2CDFB 4P2RA 3POCA 4NQCA 3RVVC 5HYIA 4NO0B 4WW2A 4F2FA 1J9SA 1I3RA 4QRAA 2XZCH 1DN0A 3FH5A 4O9HL 3WUWB 3T4AA 3UL4A 2Z0BA 4U1KA 3QDJA 4DPRA 1N59A 3A67H 2FNBA 3FUMA 1S7XA 5CILH 2ADJB 4FQQA 4LVHC 1JAEA 1XGUA 5HPMA 2YRZA 4CVXB 3E1F1 4DN3L 4NPKA 3QJTB 1MVUB 4EO5A 3VQ2C 2XIBA 1MFAL 4HIIA 4WENB 4HK3J 4WK2B 3RTQB 4FFZA 4PJ8C 4PMFA 1O9ZA 4JM2B 1GVIA 1IBHA 2X9YA 4P3WA 1S78D 4S0HA 4I77H 1AIFA 1MWAA 1MFEL 3HRPA 4LIQH 5IUSA 3RGVD 1WZLA 1OPOA 2HTLC 3VGFA 4Y8DC 1LJMA 1PG7H 5LDSA 3MMEB 1XAUA 1OE3A 1JS4A 5DR5L 3HLKA 3NEOA 4Z3EA 3MNDA 1LDPL 1X5HA 4DOHB 2VDKH 1YY9D 4QMEA 5DZVA 4Y19D 3IE4A 2OMUB 2E8ZA 1U8KB 4EQ3A 4JQXA 4PGCB 3BDYL 5EEWA 2DQTH 4AEHH 3WNLA 2JJSC 4LLMA 5IJKC 5AVRB 3E6HA 2H6OA 3OMAB 2WCGA 4JE4B 2HT4D 3HE7D 1NGPL 2Q3XA 1JPST 4BFFA 4XCFL 4P9HL 1EEYB 3FCGA 1XBRA 3NSJA 3WIHL 5C6TH 2XV3A 3NEXA 4PJ7B 4PB0L 5J6GA 1F0LA 4GBXB 2P4AB 4PY8I 2QGCA 3OVUB 1UEYA 3U7AA 3B5GA 3MUY1 1AXTH 2R2EB 1N4XH 3LQAC 3NFSL 4Q2ZB 3B9EA 4BHUI 3O6LL 4AEEA 4KROD 4TVPL 2BO0A 1OANA 4Y5XA 5D2NE 2AQTA 4JM0A 2DL9A 1WQVT 4EI5D 1YEFL 3VACA 4GUOA 3VFVA 4OR1A 5JA8B 4G43B 1GYCA 1UM6L 2BIIA 4QF1A 2WUBH 5ICXB 3K4DA 2X3AA 4WNQB 5E5MB 3RDTC 2DQJL 3VXSB 4GEJA 3BAEL 4PRHD 2ZP8A 1OTTD 2EINB 2JLLA 5C7XH 2Q8BL 4MJIE 4PJBE 2FVNA 4KH2A 4JRYB 2L7EA 3ARTA 4MXWH 1TFHA 5IHBA 2MQCA 4NQDD 2PO6D 4ABUA 3HI6H 2NOYA 2H3NA 4QR7A 3QXAA 3O3DA 3FQYA 2DQCL 2GYSA 4JFHD 1ZLWH 4ZW5A 1P9MC 3UTOA 3PL6C 2BVYA 3C87A 3IVKA 4RAUA 3VXUB 1EHAA 3QNYB 3ARVA 2XN9D 4JFYB 1AYOA 5C0DA 4D9QD 3DURB 4QUOA 4WZ9A 4MGXA 5C0BA 4HFWB 4MA8L 3L1FA 3QRBA 4PJBF 2BOCB 3D85D 4ZYKA 3HVDA 2GUOB 4HUNB 4P5MB 5EOQL 5GSVB 1JF6A 1BWMA 1T22A 4HJGB 4MNGA 4GRLB 6FABH 2WWMC 4GRMA 4HIQA 5I1IL 4ZDHA 3KWTA 5C3IA 1HHKA 1ZLDA 3ZO0A 5D4HA 3GSQA 5IFHL 5T3ZE 4H8WL 3INUL 4QXTB 4XT1C 1JNLL 2OMYB 1X5YA 2OSLA 2ZOLB 4I3SH 1HOEA 2ZYSA 2Y4SA 2ZUQC 2LABA 4NQXB 2ZTBA 1V3LA 3ZZLA 1JD9A 3JVFC 5EA0H 1AKJD 3E9UA 3WKML 3K71A 4NT6A 3H53A 4X7FC 1AY1H 1YQ2A 3II1A 2HKHL 3GS0A 4QXVA 4X6DF 4E36A 4GUQA 1NQBA 2XG5B 5IHZA 1H0DA 3APFA 5AOIA 1BYNA 4OLXL 1IIIA 3QA3B 1T6VN 4N3TA 4NM4H 3TBYA 2X89A 3RY6A 1ET7A 1A1OA 2GJZA 2LOEA 1DBJH 2VZSA 1KLUB 5C0GB 4HLZG 4JG9A 2JKWA 4HIHB 5FA3B 4BFNA 3WU1A 1HL5A 1KBGH 1MCOH 4ONOA 5E23A 2GVYA 4MKMA 3TP4A 2Q8AH 2GT9A 4BZ1H 2FJGA 2A4EA 3BUBA 1QZ1A 4XI5D 1WUZA 5F9OH 3IDGB 4X8JA 1IQDB 2JKNA 3KPMB 4W9EC 4ENEC 2J3SA 4U1NA 2DQFA 4BFBD 1B6DA 3LIZH 1PKOA 4LEBA 2VJXA 4YBQD 2K8MA 5GGRY 1A7QH 3AB0B 4L3CA 4HKXA 1QSFE 2KH2B 4U49A 4GLRI 4W9HC 3D12B 2QBWA 1WIPA 3QZWA 3UDWC 3ZMRA 3B83A 1T7WA 3TVMC 4O02H 4RISH 3OR6A 3HG1B 2IBZX 5JYMA 3BW9B 4XCYB 2ZWNA 2Y5EA 3EO9H 5K9QG 4EDWL 3CFCH 5AZ2H 2XWBA 2AABL 4XN2A 3BPCB 4WK0B 4R7NB 3GXDA 2YUVA 3QNZA 3SE8L 1B4LA 4JFEE 4P2QA 3OXSA 1E3XA 5GZND 4M02A 4WWKB 1S9KC 3W81A 4LGRB 1Q9OB 5KJRH 4LLAA 5F7KC 3TT1L 3SGKC 3U48A 4PWFA 1U8LB 1XGPB 1BVOA 4OI7A 5HGGS 3KR3H 2B39A 1QW9A 5SX4H 1RMFH 1OAUL 1RIHH 3TGXA 5A2FA 1ULVA 4PRIE 4DZ8A 1RY7B 1S7TA 4GRWE 3R8QA 3L45A 5DS1A 5BRZB 1QLEB 5I8CB 4J6RH 5KBDA 1O7VA 5F7MC 4XMPL 2XN0A 4LNRA 4G42B 4TQPA 3U36A 1M1SA 3L3GB 3R1GL 4LLWA 5CINL 5DJ2A 1OXYA 1CG9B 2GC4C 4GQPH 1IEBA 1BZ9B 2GJ6D 3CE1A 3DXAA 4NUJB 3NCMA 2NQDA 3CFEA 4N26A 3RWEA 2YPLA 3EDEA 2WBJA 4NOBA 1VACA 4M7ZB 2VXQL 5I0XA 1A0QL 1ACXA 1CU4L 4GRWF 3CSFA 1QUPA 4MAYA 2FBJL 5FUCE 4LEOB 3ROLB 1JPSL 1KB3A 1HCZA 4NOFA 5JXAH 1RIVL 5LG6A 5SWZE 2EDXA 3KPPB 3LV3A 2H45A 4K9EC 2EXTA 3DUUB 3TNMB 3HRZC 1DQKA 1UWYA 5ESAA 3RNQA 4OGZA 1QI4A 2WOBA 4ELMA 4PVNA 3WYRA 4ZFOB 2EIJB 5E7FA 2DH2A 4XAWL 1VEMA 4MVBD 1A25A 4AV5A 2BJML 3UJJH 2XQBH 2OR7A 4XNZC 5E1GA 5IOPB 2BINA 2P52A 5D2LB 1TOXA 3LEYH 2X4RA 4Y16C 1IT9H 2VLLA 1IAIH 3WFDH 4L48A 4N2MA 3BPLC 1KTBA 3QARA 3PAZA 4XNUH 1EEQA 3LB6C 5EPMB 1FV1A 4I3GA 1E43A 2NY4C 3T2OA 1DDHB 1ADWA 3I9GL 5BZDA 4FNTA 1YC7A 1AO7D 5E6RB 1ORQB 2O61B 1V5JA 3C60C 5BJTB 1DTUA 2OA9A 3I84A 2QMJA 5IVXE 1YNTA 4CMMA 4IU2B 5KVMC 2RCSL 3QISA 4U6HA 5T1JA 4FYSA 3Q8CA 4G9FB 4ZUTB 5KN5A 3I74A 2HH0L 3GJFA 4QXUL 1MFVA 4YDKL 2PUQT 5H35B 3DI2B 4XNDA 4Y4FA 4XPGH 1CGTA 3TZVC 1EUTA 3EADA 4JANA 4GQ9H 4XP6H 4WU5B 4MD0B 3VX0A 2GITB 5GRYA 4P49A 3TA3B 4ZMZA 4RFOL 2O6FA 4E9QA 4P5KB 4PJEB 2ALWA 1H3PL 2OMXA 3B8YA 5IVXF 4IBZA 3I6SA 4PRDA 3VRJB 2H0PA 1WWCA 2I60L 2Z8RA 2JKJA 5T5FA 3PGFL 5I76A 4WNJA 3GO1L 4ZFGL 1S7UA 3II3A 2Z7UA 2XACC 1G7QA 3SBWC 5T3XE 4I7ZC 5E1HB 1C5CH 1DBMH 4FG4A 5AD0A 3F58H 1FRGH 4X4XB 5HVHB 3AGVA 4XC1H 1R3LA 5I6OA 4G7SB 5IBTH 1CF8H 4I2XB 4M61B 3PWNA 3FTGA 3FB6A 3M1BB 4CILA 1LQSR 2QTVA 4YHPA 3D2UD 1QEWB 1D5ZA 2XWCA 2BSSB 3ILQC 3MRIB 4JO4L 5J06A 4XWOD 4HJJL 1AQMA 3U7YL 1JNHA 4CVUA 1Z66A 5CWSB 5AW3B 3HE6C 2AQPA 1AGEB 1UWXK 4NHCH 5BVPL 1FFOB 3F7KA 2UVEA 2LTQC 1QTPA 4NP9A 5DWUH 5FHAL 4I0PD 4LFHD 3KEHA 3PFUA 4JFDD 4TPRL 5IZ7A 4LLUA 2WB7A 2XTJB 1JIBA 1TTUA 3DRTA 1KYAA 4CGTA 3KW7A 1EZVX 3SDAD 3G04B 3V4VA 2BP3A 4DZBA 3GUFA 1A7RH 1S7QA 4ZMOA 5HI4C 4G8GE 2P5WD 4PJIE 3D0AA 1I3GL 3AXHA 4N2LA 4RGMC 2ROXA 1CDHA 4N0UB 4PU2A 3EG9B 3KPSE 1OHZA 2APSA 3L4WA 3V0VB 4E9WA 7PCYA 4HGMA 4X0KA 1CT8A 1YHPA 4NNPL 2CRZA 1UWXH 3L54A 3ZDZE 1MI5E 1LO2L 4OSUH 3VDCA 4MJJA 1TZHA 4XMXA 1NH6A 1P7QD 1QO3B 1D7FA 4DP7X 1YNLH 3ES6A 1AIZA 4GG6E 4AE1A 5I2IA 2DYSB 1WFUA 2FD6L 5D7KE 2BC4A 2ZD0A 2WLIB 3QFJE 4KY2A 3SODB 3TWCH 2OTPA 4P2RD 3ARFA 4V1DA 3VFSA 1NBYB 4ZSOA 1Q9LA 3FONA 1NDGA 4NQCD 3WAKA 3B2DC 4L4TE 3EOAB 5T1KA 1PY0A 1QSEA 2VZTA 1ZLSH 2D73A 3VWKA 1I8IB 3CFKA 5AW6B 3ZDZF 4G11A 4R5XA 1MRDH 5F72S 4HKJB 3ABMB 1JGEB 4XVUC 1XH2A 4KGJA 5LGYA 3H56A 4V2BA 3IDNB 4GG6F 1GTFA 2UV3A 3U1SH 1KT2A 3AT8A 3ZT6A 3FQRA 2LLNA 1KBWA 3ATFA 1YJDH 2V17H 3MUJA 2UUDK 4I48A 4U7KA 2CO1A 2X1PA 4XMZA 1N7MH 2CBOA 4LVNC 2GB2A 4IOSD 3KPRA 4XCEB 3SGDI 5BQDA 3BGFC 4WKZB 5JQIB 3O4OC 1FFQA 4YSCA 4H8HA 5ES4B 3KHOA 1D7BA 2EJ1A 5LGHL 4P2YA 2ZUXA 3KPTA 1Q9WA 5HJ3A 3GXMA 4OZIE 1J7VR 4M6AA 1CS6A 4HP5A 1BJ8A 4WUKL 5JIHA 2FL5A 2WLZA 4WWPA 3ZMNA 1F4WL 2A73B 3SIKA 4K4KA 2N59A 1U4EA 3V0GA 1LEIA 1N5AB 4ZW3A 4JRLA 4KKZA 1OGSA 1CI3M 1ETZA 1UH3A 3MRPA 4FXGB 4LU5L 4RGNC 4Q6IC 3ZKXC 1AQ8A 4Z76A 3L4TA 2IDFA 2UUDH 4QHPA 1RHHB 1TQCC 4ZUUA 3GSUB 4HK3N 3D4GA 5ETUB 4L8CA 1XT5A 3EO0A 3FOMB 4EXKA 4KVNH 4P57A 2VLKE 4LSRL 4P05A 4RRPM 4GAAA 3GMMB 3QCTH 5GRUL 3MLRL 3O2DH 4XN9A 5EO0B 3RWJA 3VAEA 5DD5H 4V33A 1TDQA 2F1EA 5FLUA 2OYKA 3H3PL 4W93A 3DO3A 3KL5A 1K72A 3HA0A 4XN4A 3NCEB 3IGLA 2EVIA 4PWIA 2VXTH 1JV2B 5AAWA 3GSXA 4PBVC 2A9NL 5C0AA 4JKPL 4EZMA 3AQDA 4MJ2A 3IYLW 2ZQKA 2ZKXA 4HC1H 5KZCD 5DWPA 3CDYA 4K3GA 2FEJA 3MXVL 3MLZH 4AYDC 2NT1A 3EFDL 2VMEA 4GW1A 5F0LB 4MJ4A 4MZ2A 1PZCA 3K74B 3T09A 1WFTA 3BT2H 4TLKA 1CGSL 3F7LA 4X9IA 1T0OA 5EBWA 4ZTPL 5KYWB 4DK6A 4G5ZH 4TUJA 4FS0A 1C1EL 5F2FA 3ZDXE 3J8F7 4EDXB 4JKKA 3VXRB 1WHOA 3BUIA 3HFMH 3P54A 5HHXL 3JWDL 2F8XC 2Y06L 3QI9A 1BP3B 4WDIA 1RQ5A 4DKEH 4U2YA 4G82A 1FVCB 1A6AA 3P30L 4M43L 4ODHL 4WHYG 2LVEA 3QUZA 1J0YA 3CLEH 5SX5K 5I18L 2EKSB 4OZHE 5C0BD 3QQXA 3QJVB 3T0XA 4PVMA 3LY6A 3MBXL 3HPLB 1I4FA 2FBOJ 4NAMA 2RTTA 1SN0A 3B7TA 1COBA 4LPXA 4PUBH 2AJYL 2WZ6A 4DVRL 3WS3B 1CR9H 4X5XB 2AEIT 3L5WA 5DRWB 1IGTB 1JZIA 4HUVA 5I1GL 5DEGA 5GS0H 2VO8A 4U1GB 4PGBB 3NJJA 2RJMA 5I1CL 3RIAK 2QQNL 2QADC 5AEAA 2COVD 2J6EH 5KSUB 4N5EC 1DSFL 1W72L 4NI3A 2NW3B 2FWSA 4OZHF 1W0YT 3ESUF 4NERA 3EJPA 4KO7A 4CNIA 3AXIA 6TAAA 3TASA 3GD1C 5IV2A 4N2AA 4JO1H 1M2VB 2ROYA 5SX5H 4E9YA 1JI1A 3V0EA 2N0MA 3M07A 4FFYL 5BO0D 4HGWA 2QR0B 3ECBA 4GKLA 4LCIL 1LK2B 3KL3A 4QWWD 1C08B 3VXOB 4J3OF 2X89D 4GAYA 4HSQA 3COOA 4NZ8A 3QEQE 5D1XC 3EXLA 3SJVA 1E50A 4EVNA 1PDKA 4B9ZA 5E2JA 1KB5A 1MLCA 3PWLA 4RWYL 1E5CA 3IDMB 4ANUA 2D8KA 1XL4A 4TNGA 1SOSA 3GXUB 1VKXB 1MUJA 4J3OG 4CAGA 1L6XA 3LH2H 4YXLL 5KVDE 5CJQL 5C09A 4H25B 4BSWB 4L4VD 5JW5A 4GXUM 2EDOA 4OIFA 3NT0A 2QZQA 5HDWA 3OKOA 4ODBD 2YAQA 4FTVD 1BECA 4UOW0 5EC2A 2YXMA 3FPYA 5F7BA 3SE3A 3TOPA 3UJIH 1PSKL 1DVYA 1LWJA 4NKDB 3T08A 3B9KD 1GIGH 1P4LA 2ZOOA 2C9SA 5K39A 3RIKA 4DERA 2JIXB 4UV4H 2Y1YA 3D1MC 2XY2A 2FX9L 2H2SD 2PETA 2Y5TB 3H55A 1YQVL 4CSSA 3QSKB 4XO5A 4R6UA 1HXKA 4IYKA 2X05A 3I75B 3DV4B 2CKBA 5L4IA 3GGWB 1T1WA 2IALB 3IB4A 3TBTB 1OHQA 5HGAB 3LEXB 3GLDA 4BGDA 2X9XA 2DWDB 5GGQL 5JHLA 1K3IA 5IJVA 4MMZC 5CS7A 2VRKA 2D0HA 5IOKA 4XO3A 1SN2A 2CCVA 3LN5A 2BS8A 2AFNA 4LCUA 1NWOA 3WEMA 4YSUA 2LW3A 2XRAL 1P0SE 4L8SA 4KMLB 4W6WB 1JHKL 5FK9A 1OGTA 1KC5L 1SY6A 2HFGL 4I85A 2HTKC 4O9HH 4H0IA 3DXAD 4HZLA 4PJHE 4UWQB 4CU8A 2EYRA 4Z7WA 2YPLD 5FCSH 4Z0XA 4OFQA 1T1YA 2WAQA 2AANA 5E00A 1S5HB 4MAYD 3STLA 1OTUD 4LSTL 4DN3H 2CK0L 2YD8A 3JZ7A 1MFAH 2VDRL 2FRGP 2KLTA 1KTRL 2IH1A 3HVNA 2DQHL 3AS0A 3MREA 2AW2A 4L9LA 4FNLL 2QSCL 1SJHA 2RQEA 4NZUL 5CIPH 5KSBE 3IDXL 1KZQA 4OVUA 4PJHF 4YDIH 1NFIA 4A68A 5CEZH 1ZHBB 5DR5H 3GT6A 1I75A 3DJSA 3FFCD 1NEZG 2W07B 1CTNA 3WBDA 3W5MA 1PZUB 1NFDB 4HHWA 1Y6NR 4XP1L 5EU5A 3DMMB 4N8VA 1ZGLP 2Q10A 4KKAC 5I16A 2UY6B 2V7HA 5KVGE 5K59E 2YGOA 1KJMB 2ZKMX 4MX7B 4S1SL 5GZOA 5JZ7C 1ITBB 1IFRA 2ZXDA 4NCDA 1PEWA 2XLLA 1NZRA 1JF1A 1Z32X 4K94C 1QLFB 4UQCA 3QDME 3U9UB 4X9BA 4DP6X 4P9HH 1T89C 1ADQH 5ISZE 3WIHH 2WYTA 2G9HA 5DLLA 4PB0H 2ATKA 2CR3A 1UD5A 2YSSA 4FFWD 4G6FD 1OCOB 4K2UL 4N9GA 1ZRUA 1NDMB 1W6WA 3FPXA 4Z0BH 2X4PA 2WBWB 3NFSH 1XH1A 1ZV2A 4WO4B 5K59F 2HB0A 3O6LH 1ZGLA 1EGJL 1YEJL 3PXJA 5EBLB 2DDQL 3O6FC 5IQMA 4X5QA 2P3YA 3ZXAC 3IFPA 1YEFH 3QQ9C 1KOAA 1J11A 2NY0C 1BOGB 1FSKC 1UM6H 4PTUA 2CU9A 1L9MA 3CXHK 4L1LA 1AGFB 5IFAH 1F3RB 2NR6A 4NZTH 4JNXA 3T04D 3DC0A 2DQJH 1EFXB 1G7JA 2R23B 1GZHA 3QNFA 3BAEH 4IOFC 1T5KA 2EDBA 4OZ4B 3L3JA 3US1A 2Q8BH 3FRPG 3PHOA 4O2CA 3FW6A 5DJDB 5AW7B 3WFHA 3H4HA 1WO2A 5CNHA 3ARSA 3GI8L 4KI1A 3N9GH 2IDTA 1YRKA 1DYZA 1BGXL 1KIUB 3CDGB 4F37K 1J0JA 1ED3B 5CP7A 3C12A 1HT6A 1UJ3A 3H85A 2XU9A 5HHOA 1MQKL 3C6EA 4AENB 1C16B 4DEPC 3CZUB 4X4ME 1Q72L 3S37X 2IDUA 4MB3A 2WVTA 2ICWA 5TF1H 4FXTA 2J8UA 4XO8A 4ADIA 3MA7A 3MRQA 2VITA 5F3BA 2NQCA 3MJ7A 2X7LA 4BCXA 1DP0A 1NICA 5DGQA 1TVHA 4YXHL 4TQEL 1G9HA 5TH2B 4HV8A 4Y2DC 1E9QB 5FCUL 5E8EB 2EAEA 2NY2B 4R4FL 3NCBB 1O9VA 3B3BA 4JDTL 3B7RL 5LQBL 2AGJH 4B9JA 3AMKA 4U1MB 4NCC2 2OMWB 2PYEA 1FC2D 1HWHB 4AIZB 5M7QA 4H8WH 3INUH 3N06B 2WLKA 3QJRB 1AS7A 5E9DE 4D3CL 4KI5F 4OFYA 5CLXA 1ND0B 2A74C 4FQCL 1KIQB 3O3AB 2J56A 4HJ1A 4Y0GA 5EO9A 5HDLA 2QV2A 5T3ZL 1S9YA 2CNYA 5K33A 1CICA 1S7WB 3TEUA 4Z3IA 4NLAA 4XMVA 4PBDA 2K45A 2MH4A 2EXSA 5LBSA 3LN4B 5IEHB 4JY6A 5I1KL 1S9XA 5F8QC 4TNWK 2C3GA 1WA2X 3PU7A 2JTYA 2MNWA 4OLXH 4W9ZA 4XOEA 3MV9B 4HHGA 5EIIB 5GGTA 1NAMA 3VGBA 3D25B 4JPVH 1EMTL 4PW3A 1OARL 2IWGA 3ULUC 5DQJA 3FT3B 3ARFD 4TLUA 4V1DD 1PVHA 4ORGB 2R2BB 3RNKB 1YMMB 3BVDB 2JJWA 5T1KD 3HZ3A 4N25A 1ET5A 1W8OA 3LH8A 1QSED 2NTFB 4MZIA 3VWKD 2ZWYA 3VXTB 2FIKB 4HEPA 5F0JB 1R4XA 3DO7B 3LZFL 1AMYA 4JY4A 3QQNA 3VCLA 4HD5A 4EF3A 2GTQA 1YYLH 3FUFA 5DURB 4I13B 4ODSL 3HC3H 3BUYA 1DEDA 3IAGC 1U30A 4YC2C 2C1OB 5K69A 4AX3A 3CNKA 2W80C 1IGIH 2WQVA 5L7XL 4RQQB 1F6LL 2ZUWA 5F3HA 4AITA 1KPVA 5F9AC 1CBJA 1T4KB 2IAND 5F89B 3SE8H 4PG2A 2YGVA 1WT5A 1U8CA 1ZEAL 3IE9A 4UQEA 3EO1A 4OJEH 3M7FB 4ETQA 1CLYL 1W0WB 2YARA 3JTBA 3MUZ1 2VZVA 1RK1A 4PJ8B 3TJHC 4QXGH 1JE6A 2RFXB 1OAUH 3CMOL 3OX8B 1PIFA 5I1HL 5BV7L 2HWZL 3MNMA 2XXFA 3HR5B 4IOIA 1PZ3A 4APXB 3BAXA 1DQDL 3MNVA 3VYNA 2A9DA 3MRBA 4XMPH 4Y4HA 2FBRA 4JCMA 4MASA 5M94B 4OJCA 3PG2A 5IK3B 4H26B 2VUOA 1OGPA 1E4HA 2ZPKL 5J11C 3S3PA 4HG4J 1TQBC 4ZPVA 4E5XB 1FVEA 2EYTA 3GSWA 1PS3A 2CDEB 2WXMA 3DGCR 3HAEA 3BSZA 5LAPA 1F3JA 3K1DA 5CMAB 1FI8C 5EZPA 3C6SB 1I85C 1YAIA 1BD2A 1O7DC 1CU4H 4JFPB 4ZO7A 5DO2C 3QUMA 2FBJH 1P69B 3LPFA 4MYPA 3U1PA 4YUEH 3E80A 4QTIL 2ZCLL 3QNXB 2Q76A 4GI6A 1PKQE 4ONGL 2VQ1A 5C0AD 3QG6A 1QPPA 1E4KA 4HC1A 4HWEL 1LXMA 4QLWA 3SCMA 4AQ8C 4XAWH 1G7PA 1SEQL 4P46C 2BJMH 1U95A 3HG5A 2A5UA 1FGNL 1DVFA 1WS7A 2EDYA 3N1MC 4H4NA 3AAZB 5DHXB 2IBZY 2ORBL 4OD2A 4APQD 1CTOA 3BCFA 3DX0A 4CSPA 1QLEH 2WK2A 4X6CE 4CL7A 4LRIA 3QI9D 3RDTB 4F7EB 1Y1UA 2CHZA 5JDSB 1DBKL 3PABA 4Z3TA 3WKYA 4GS7C 4GAFB 3IAQA 1KCLA 2X12A 2YPKA 3QUZD 4PN6A 5DGRA 2VR9A 1VGEL 4PRHE 2GFBA 5DLMH 3T2LA 2RCSH 2C9QA 4YDJB 4M7LT 2ED6A 5IHUH 5HYQA 1JDDA 3PV6A 2E6JA 4XXDB 1JCVA 1MLBB 2YMXL 3PPEA 4YDKH 4KNQA 4BKSC 3FQNB 1FL6A 3ISYA 4NQDE 3PL6B 4X6CF 4MD5B 4RZCB 1YEKL 3DO4A 4J12A 4JFHE 4PI2A 4X7CC 2CHXA 5E95B 4YWGL 1NCOA 5I28A 3DOSB 2I25N 4F7TA 1E9OB 3KLLA 3WE6A 4P4RA 4WJKB 2AXHA 2QPUA 3CQFA 3S88H 2JCCA 2VLRD 2XN9E 3NFNA 4JCWA 4PPTA 5I66B 3BRDA 2VOTA 3VXQA 4D9QE 1PZBA 1KCSL 2H1LM 3GKWL 5KOMC 1JPFB 4HT1H 3QZOA 3ZE0B 2PW1B 3IBOA 4OCMC 5FFOA 3CFDB 4ZFGH 3GO1H 1MWOA 4PCTA 3WMSA 2OR9L 2ENJA 3P9LA 2EEBA 5IQNA 2R0ZL 1TVDA 4PJIB 2FJHB 2BVEA 4FNRA 5T3XL 1SEBB 2JI1A 3UO1L 3B2UD 5JOEA 2ZUQB 4HIEA 1GW0A 2W65A 5H4ZA 3FB7B 4ZZFA 4AMXA 3IEAA 4Y2OB 2H32B 3IN0A 2AXFA 3VFMA 1Y07A 4JFFA 2IGTA 1NINA 5EOCH 1OGAB 5AVXB 4ZW6A 1ZLVH 3W5NA 1KNOA 2YD7A 2XQ0A 3VFWB 1CD0A 4PRBA 3X3FL 5LWYL 5FHAH 5C0ND 4GW5A 2OLDA 3DETC 4LP5A 2E6PA 1TJIL 2A6IB 5C09D 4LCVA 4EOWL 5IQ7L 1Q0YL 2XPYA 1E40A 5CUSL 3TJEL 3NJKA 4DJMA 3ULSB 1F02I 4QEGA 1D5IH 5AVQB 4RMVA 1INEL 2D7PA 4LCYA 2HVJA 4EKJA 3P3UA 1I3GH 1VFAB 1IAIM 2J1ZA 3FS9A 3PPSA 3WFCL 3BMWA 2GIYA 4JZOA 1VFBB 2EKJA 1IUZA 2GSIA 2N1KA 2FATH 1EFQA 4MB4A 3MPCA 2VZ1A 4UZGA 4JFXA 3BX7C 4IHOB 1G6RB 2VDPB 4GINA 3U4EB 3UPCA 3TVMB 2JXMB 1EHLL 5DFVD 5D1QA 2PXYA 1IM3B 4UOQA 1LO2H 2R0LL 1F6FB 3O6KL 3VA6A 1KEML 2ITFA 3IFLL 5E6ZA 3PV7A 4NQQA 2YAHA 3MJGX 3NSDA 2J1WA 3LQZA 2BVOB 5KBLA 1WS8A 4J3BA 1KFAL 5HI5D 1OM9A 5ACMA 3UTZB 4FYRA 4ODTL 1TO4A 2F0CA 5B8CC 2CO6B 3MFGB 2E47A 1TZIB 2D7OA 3R4RA 1BQHG 1GL4B 1JK8A 2NNCA 5I6KA 3JT0A 3MUUA 3TTYA 2SODB 4JQXC 4HZAA 2NXZD 1ZKAA 3A6OA 4JVWA 4I9WD 4K5PA 1FO0L 1XIWA 1E65A 1G6VK 3IDYC 5JMOC 3UP1A 1UT9A 1K2DA 2E59A 3V4PB 2PTTB 3G9AB 1KDJA 3ZHDA 1GGYA 3NQKA 4WUUA 4UT9L 4GT7A 4X7DC 4H8VA 3FJTA 4AC2A 2IG2L 2IPUG 4Q8BA 4IBSA 2GJ6E 3L5XL 2NX5D 5ANHA 3S8FB 2N7BA 3MC0A 2P24A 1USZA 4BSJA 2B3RA 2Q6WA 3MXWH 3QIBA 3OBAA 1QNZL 4WUKH 2D3VA 3HRZB 5FFLA 5GGUB 3BISA 1ZTXH 1F4WH 3UMNA 4RESB 4Q9QL 3TBVA 1IAKB 1P5UA 1M7DA 3CSTA 4YJZL 4KGLA 3VTMA 2CDFA 3X3GH 5GZOD 4RMBA 3WHE1 1RXLA 4Y4KC 3FAXA 4XNZB 4LU5H 2G5BB 3WUWA 4UAOC 2QQLL 4Y16B 3ROOB 4MQXC 4EAEA 1SXSA 4LEXL 5AAPA 5CD3B 2F9BT 3BPLB 4CVXA 1ASQA 4LSRH 3RVWD 3RTQA 1CQYA 2E7LC 5F6HI 1HXMA 1OF0A 2Q5BA 3MJWA 5C0CB 3VFNB 3TFKD 3C60B 4JM2A 4RDQF 4FJYA 2X6UA 1AO7E 1O7DE 4MSWB 4JFSA 4XMKL 3H3PH 3L5HA 4NKIL 1OWRM 2XTLA 1U41A 4OU3A 2GSGB 2W9DL 4EPSA 2A9NH 2B1HL 3B9DA 4JKPH 1A6PA 2AITA 4RNRB 5DD6A 4PRAB 4QGYA 4LAQL 4NAJA 3TZVB 3T3ME 4OFVA 4AYID 4KAQL 4ZOCA 1Z0NA 3QZLA 3H4FA 4RDQG 4KJWC 1G9NC 2OMUA 4X4KA 1B9KA 1U8KA 4GLRH 1GPOL 5EUOB 3ZKQD 1CGSH 3AU1B 4PGCA 4F93B 3WJJC 3LRSB 1N8ZB 4ZTPH 4YHYC 4KX8A 1C1EH 1MW2A 2WYZA 5AB1A 2VDQB 3IBEA 1VGKB 1FLTX 4KK5D 1ZJAA 4A55A 1VRSA 5HHXH 3JWDH 2ZXBA 3X1FA 4HG4K 1JYVA 1EEYA 2Y06H 1U4FA 1B9ZA 5HHOD 5EUKB 2NZ9D 5HHVL 4HUKB 4L5FE 5FHBL 3T3MF 4ODHH 2CO2A 4KHXL 5F7EL 5EBMB 3IKCB 5I18H 5D72L 1GTNA 3MLTA 5IF0B 1CLVA 1NLDL 1XF3A 5CJXC 1LNUA 3LAFA 4Q2ZA 2BHZA 2AJ3B 3QWRA 5DU7A 1UD4A 4XBPB 4PIRF 2YJQA 4KKCD 1HKLH 2AJYH 2BSBA 4P4KA 4QTFA 3WY1A 2O5XL 3MQIA 4DVRH 2AI0L 3HE6B 5HYJA 5HDBF 2UWEE 4G43A 1PD6A 1JWSB 1GRWA 2FDBP 3LD8C 3NJNA 4G6AD 5I1GH 2LTQB 1TSRA 5I1CH 2DQGH 2QQNH 1ET8A 2PYED 2E8YA 4YHOL 5DA0B 5E5MA 2WNWA 2EUXA 4JK0D 1FDLL 1Z9NA 1W72H 4XWGH 4H5SB 1BG9A 3SDCC 4B9GA 4OFYD 4JFDE 4JRYA 4XH2B 2JJTC 4R5TA 4R4BA 1SJXA 3BKML 4PV9B 4BFRA 1DSWA 2WLLB 4J1UA 4TSCH 4E9TA 5ICYB 5MI0C 4E9LA 2UX6A 3X12B 3APNA 1B0WA 4RGMB 2GTWB 4LCIH 3SD5A 2IAAC 2E3VA 2P5WE 1AR2A 5CJ5A 2LE9A 5GXBB 1HDMB 3QNYA 2DWEA 4U4BA 4JLRB 3DURA 2DEXX 4HETA 3WN5C 3HG4A 4KRPC 2BOCA 1BQKA 3ALPA 2PR4H 3LCYA 3DVNB 3G08B 2AC0A 4P5MA 4K07A 3CBJB 5GSVA 4OGYL 4RWYH 2O72A 1THCA 4GRLA 1A5FL 1CE6B 1HE8A 1U8NB 4XX5A 1K6QH 1N64L 4YXLH 1B2WH 5CJQH 5E6UB 2BNRB 5E4OA 2ENPA 1QHOA 4LVOC 4LFHG 3IJHB 4HLEA 4Z7VF 5F7WC 1UD3A 4QXTA 5KVDL 4JN2B 5A7EA 2ZOLA 2ZXGA 1PSKH 2ZKWA 5EF1A 2YHGA 2M8XA 4NQXA 4P2RE 3V5DB 1BPLB 2R29L 4FQJL 3GIZL 4NQCE 1TLMA 3OZKA 5E5RB 1HZLA 2BFGA 3FUKA 3WENA 3UZQB 4U6YB 5IFJB 2M83A 3KYNB 3VSQA 2HX8A 2CJTA 2WBJC 3QDJE 4WI0B 1S4IA 4FLSA 3H42H 2G4GA 5IB1A 2P5EA 1R9FA 4OKDA 1OAKH 4OCLC 1YQVH 5BRPA 3MOBL 4NDMB 2XG5A 1FL5B 1EV2E 2NDGA 2FNWA 5FYLE 3SQBB 1HNGA 4MCMA 1KXHA 3A0OA 2L7UA 4WFFD 5B3JF 4ANWA 3DX8B 5B39B 1TJGL 1KLUA 1Z0MA 1NM4A 4KBPA 3BGFB 3OF6A 2X3BA 5GGQH 4WW2F 3AJ7A 3O4OB 3MYZA 4YDVB 4HUCA 3HHSB 3QXWA 2YUWA 3ENEA 1IQDA 2AAVA 1GGBL 4Y4HD 3RVXD 3MR9B 3T1FB 5KWYC 4UM8A 1FHGA 4ORZC 1L9QA 3R0MA 4DO6A 1JHKH 3U0WL 2HFGH 1KC5H 5E8DL 2X2HA 3FT0A 5C07D 3T0EC 4DVBB 1PLCA 3CX5J 4KJQD 2FH6A 2V8LA 1IAOB 1F3DJ 2MNUA 1FG2B 5AVYB 1XF1A 1BD2D 5CU9A 3HG1A 3Q6GL 4N6QA 2IGFL 3LZRA 3NZ8A 3Q5YA 4RGNB 3F12B 4LSTH 4Q6IB 4XCYA 5MENB 1G9EA 1A3ZA 1Q94B 3HC2A 2CK0H 4HPYL 4PD4J 3ZKXB 5LKNA 5IKCB 1BF8A 3X13B 3FTZA 3BPCA 4X2UA 4R7NA 5CSZB 1TQCB 1CL7H 5DZLA 3TURA 5E8NA 2CIKB 3MLSH 4WWKA 2KC0A 5GJTH 1Q9OA 2DQHH 4HXAH 1FYHB 5J1AB 3N91A 2QSCH 1U8LA 1XGPA 2ZP9A 4NZUH 4Y4FC 1WSST 3L5IA 3KLHC 4Q7DA 4OZFB 1DVFD 5AENA 3EYSL 5CSGA 4ZUWB 5KEZA 3VTTA 4I4WB 1OP9A 3T77A 1UYWL 3I6LE 5BRZA 1HKFA 5I8CA 3QJQB 4XP1H 4K7PX 2V2XB 3IDIA 3EYOB 2R0WL 4G42A 3A4EA 3V6FB 5MEPB 1X5GA 2XA3A 3MBWB 3EGXB 3L3GA 1AQKL 2V8MA 3RVUD 1A1MA 3A4AA 1YNKL 2ED7A 4O58L 2FO4B 3EYUL 4PH8A 1BZ9A 3ZY7A 1MHPL 1F90L 1G7HB 1LO0L 2HMID 1V7ML 5DTFB 2H26A 3K2UL 5EV7A 4OAWB 1I1CA 1CMOA 3SPVA 4H1LB 4K2UH 1W6LA 5FV1L 1QTSA 3TNMA 3KPPA 5GS0D 3DUUA 2Y6SC 4IM8A 5E9AA 3GMNA 4X6EB 4ZFQA 1BIIB 2Y36L 1EGJH 1YEJH 5AW8B 1ONQB 2UZIH 2DDQH 2J5LC 3P73B 4A39A 4ZFOA 3TM6A 4LASL 3TBSB 2B59A 5C0BE 4DGYH 5ACZA 1Z3GH 5IOPA 3UBXI 4FC3E 5D2LA 4K8RL 3KM1A 4HA1A 3ZE2E 4DFHA 5TQ0L 4MNGE 2A6DA 5FX3A 3OXRA 2LGNA 2WM0A 4XE5B 3Q6FB 5EPMA 2QADB 2VDMB 4JGJA 1EX0A 3DBXB 4GO6B 3GI8H 3DX4A 4L2YA 3DPBB 1INDH 1ORQA 2O61A 4MS8C 5BJTA 3VQ1C 2V2WB 1RZKL 5A3ID 3SGDH 3MJ8B 4FMFA 1GS7A 1D5MB 3D4ZA 4G9FA 4EZJA 3VNZA 1UZ6F 1Q72H 5DRXB 4XR8C 2WP3O 5H35A 3SE4A 3OJ2C 3UTTB 3EJYD 3LXBA 1ZPLA 1XTMA 2UZYA 3Q8BA 4WU5A 4MD0A 5FDWB 2GITA 4F2MB 2WYIA 5KSAC 2EXYC 1II4E 1OAXL 4YXHH 5D1XB 4PJEA 1RUKH 1ILUA 4KWUA 4MJHA 2BNUB 2ZUSA 3MV8D 1KTDB 5FCUH 1C5DB 1K4CB 3DROB 2CDGA 2YAFA 4R4FH 1RSYA 4BQ8A 4JDTH 5B3SB 3FO9A 3HUJA 2DEYX 3TF7C 5FECB 3BVWA 3IWVA 1CFTB 2Z8SA 4BSVB 4UTBL 5FC9A 1EEZB 2IPTH 4D3CH 4X4XA 5DHYB 4KU1A 4WEBH 4RRPG 1UZ8B 1NCDL 4AM0Q 4F8NA 2AKRB 2J1YA 5ICZB 3PWJB 5GS1C 1IQWH 1MCWW 2NT0A 3FMGH 4I2XA 4Y1AA 4M61A 4L4VE 4U6VL 3R4DA 1BM3L 2A77L 2QT6A 3M1BA 2PXYD 4FTVE 1QEWA 1FNFA 4ZBJA 2BSSA 3K80A 3MRIA 2BERA 3NIGB 2KPWA 3OKYA 1U8QB 4JDZA 2NY3C 5CWSA 1RLBA 2Y07L 1H6UA 1AGEA 2N3JA 1FFOA 4FLHA 3QAQA 3QJUB 4XPFH 1OARH 5AKRA 1CLOH 3Q8EA 3HC4L 4IKJA 3S3BB 5M95B 4LSSH 3R06A 4CA4A 4OLEA 4N0YL 1NCBL 3G04A 5DD1L 3B7UX 4JRWA 4YSRA 3VXPB 4QHKI 4MMZB 3MLXL 1GXEA 2F5AL 3ARXA 3L5JA 2YXWA 1QYGH 2ZX7A 3AUWB 1XIWD 2QHLA 1MCLA 3HC0B 1MCFA 1DL7L 1RZFL 1ZVNA 4N0UA 3S0PA 1KCRL 2R15A 2QPEB 2FHFA 3BAKA 3EG9A 4ODSH 3ATAA 1SNRA 3QZWG 1QWHA 4WUUD 3ZSSA 5L7XH 4PJDB 3FQXB 4DPBX 4IBLT 4DN4H 4E41B 3S36L 4B9YA 5JXEA 3DXAE 5CEZD 3Q05A 5CEXB 1IEAB 2YPLE 2K78A 1AZRA 4BKLB 3EJTA 3N0PB 3UYOD 2EO1A 3RUGB 2C4FT 1QO3A 3FH7A 1GZPB 3QIBD 4JR9L 1UXSB 4M8QA 1SVZA 1DQJB 2QDVA 3NACL 3CMOH 1M9SA 4ZMXA 1TG8A 1PLGL 4ELME 1NBYA 5BV7H 2HWZH 3NG5A 4NO0D 5BO1L 1BEYL 3EOAA 2WTOA 3BUPA 2DL2A 3PJSB 4KQ3L 5DQDH 5A2CA 1DQDH 1I8IA 5LCVH 4ADGA 1LYQA 5BZXA 2BDNL 4GRWH 2EADA 1LDSA 3JVGC 4HKJA 4AL8C 3LZOA 2WXHA 3QXDB 3HZKB 4Z7UB 1AZZC 1BCIA 3IDNA 5IBLD 3FCUB 1NMAH 2DI7A 2G3XA 3RTQD 2H0JA 2X4NB 4MBOA 2A7BA 4JM2D 3ERXA 4ELMF 3LS4L 5J89A 4YFLF 1K3ZA 1IGCL 3QUKB 4HYTB 5DJXB 2ADGB 3I02B 3BWSA 4QTIH 2VW7A 2ZCLH 4WKZA 2V2TA 4ONGH 4M5SA 4XOAA 4HWEH 4N1HB 4V2CB 5CFAA 2ZYIA 4LLDB 3KJ4C 1BZOA 5FUOL 4JFOB 2WCSA 3RHWF 4H40A 5AZEL 2JJUA 2HJKB 3QCVL 2A73A 3KWUA 1CE1H 4X5RA 1FGNH 3BKYL 5T1DL 3JQOB 2WXJA 1EVTC 3O6FB 2ZP0T 4DETA 2GG1A 1IBYA 2EDHA 4QRPB 2OL3A 2ORBH 3LKRB 3WN6A 2PCYA 2NY0B 3L9RA 1I3VA 1FSKB 2B4CL 2BIQA 1ZWIB 1EAPB 4FXGA 4M5ZH 3AABA 1ZAGA 2NY1C 3DV6A 3D0VB 1T5WA 2EEAA 3QUGA 5DMYA 3CX5K 1N6UA 3GSUA 3N55A 5KVFE 3ULVC 3FSVA 4GBXD 3FOMA 4KKPA 1VGEH 1H3TA 3P0VH 3GMMA 3BD4A 5CCHE 4PD4K 1XF2B 1M4KA 4PYHA 3QWRD 1OEZW 1CGWA 1FZOB 2YMXH 3AW5A 3VXNB 4EN3C 2AV1B 2B14A 5I8EB 4DEPB 5DHEA 4YWGH 1JV2A 4RAVB 1GMIA 3BHBB 4CW1A 1GCFA 5J7CC 4EUPB 1HZKA 1IB5A 3VXSD 3BEVB 4IKIA 1XH3B 4MCNA 2FAUA 4BIKA 1KCSH 2XKSA 4HS3A 4UIKL 3SDDC 3VMOA 4AE0A 2IEPA 2QTEA 4JRYD 4NN6C 4Y2DB 2H0EA 3V0WL 3II2A 4EDXA 1H19A 2KZBA 3VXRA 4R2GC 1I9IL 6CGTA 4JPQA 3UIYA 4ISVA 3VX1A 1IE5A 5T3XH 1ZSDB 4AEIL 1THAA 2FSEB 4N5UA 1N3NB 1OQOA 1FVCA 3HI5L 3UO1H 5E7BA 3K2MC 4KMQA 2A74B 2H2PC 1D7DA 2UY7B 3S3JA 1FAIL 2EKSA 3O45B 1X5MA 2F53B 4XZ4A 1NCAH 5F6IC 3SKMB 4B5EA 2F58L 1GH7A 5ANMB 4GRLD 1UZGA 2C3XA 4WW1B 4AGLA 4N6RB 4P99A 1TZAA 3A24A 5DMJB 3WS3A 4X5XA 4YLCA 1VSCA 2QPSA 5DRWA 4C47A 5DMKB 1I53A 4Y2LA 5AWNL 1N0XL 1J1OL 2CJSA 4PGBA 2DTMH 3RGHA 1Q0YH 4WEUD 5CUSH 5B1CA 4M1GL 3FN3A 3AITA 5KSUA 1ZV9A 3TJEH 1INEH 3KZ8A 3QO0B 1SXAA 5TE6L 4L8SC 4V1DE 2OXHB 5GISL 1B0IA 1CD9B 1WAAA 3JYCA 5IGXH 1PX8A 1QSEE 2XFGB 1M2VA 1A02N 4PJGB 4M6NL 2QR0A 3KPLA 1U3HC 3IK2A 4GFTB 1OE2A 2WO4A 4PIBA 3VXMB 2Z1KA 3RWDA 1LK2A 4YC2B 1X5JA 1EHLH 3VXOA 1ID5I 2Q0ZX 2VWEE 2VR6A 1MFNA 3OB8A 4O2FB 3HMXA 4NQVA 3TONA 1K8DA 3D18B 3ZRCC 4B53A 3VFPB 3HG3A 4YBLC 3MV11 4L9LC 4NIYE 1I1FA 2ZT9C 3BZ4A 4LIQE 5AW1B 1UATA 1U33A 1KFAH 1M57B 2F8VA 4FX5A 4KKQA 4ODTH 1QW8A 4DWHA 4LQ1A 2Q2EB 1G7MB 5B4MD 3QFGA 1VKXA 1X4ZA 5C08B 3QJOA 2MQ0A 5ITFB 2AJXL 4H25A 3FQUB 5DD0L 2D3NA 4OJFL 4BSWA 2ZCKL 1WFIA 4QOKB 2C3VB 5HI3C 4MB5A 4TS6A 3CHOA 4X9YA 1YN6A 4NKDA 3HG1D 4DTGL 2XXGA 5HGDB 2FX7L 1FO0H 3ASNB 4XP9H 1VZHA 4Z78A 2JIXA 4F7PB 5AAMA 1ASPA 4HJ0D 4IMKA 1AJ7L 4NC0B 2XKNB 1HCFX 3DUHA 3EJZD 1S2EA 5J11B 1TQBB 5MERA 4WWKD 2JQMA 1SJEB 2AAAA 3QQ4B 4HF5L 5BOZG 1CDIA 2VR5A 1FIEA 4M00A 2X2UA 5IB4B 5DDHB 4UBDC 2VDPH 2XQYA 3I75A 1UWGL 1JOIA 3DV4A 3GSVB 3I9AA 3GGWA 2IALA 4KXDA 2VXSH 5DJ8B 5FA4A 5HGAA 2X4TB 3FU8A 1QHQA 5B38A 2VM9A 3CVHB 4LOVA 2DWDA 2R4SL 3C8DA 3ALXA 1QNZH 4MHHG 1WRFA 5BRZD 4BM7A 1LD9B 3HNVL 3SY0B 4Q9QH 3ALWA 3AG2B 5C0AE 3FU0A 2NR6C 4LPUA 1AZVA 4IBYA 1IARB 4P46B 1GZHC 3GHEL 1U9KA 3U9PL 3GDCA 1EA9C 1KGJA 3DX1A 4LSQH 5FYJD 3X17A 8FABA 1BZEA 3LKNB 5CM1A 3EGDB 2QQLH 5F21B 1MOEA 4N20A 5CJ8A 3P77B 2DBJA 1OW0A 4LEXH 4NQEA 1S5HA 2NY6C 4MXQD 4UDTB 5ACLA 5F6HJ 3U4BL 4KK8D 2IH3A 2HYMA 4GS7B 5JHDB 2F54B 1M6UA 3RE0A 4KVCL 4TTGA 4OV6F 1HEJC 4NKIH 1ROWA 3IMSA 3LKOB 4JFUA 2P44B 1Z5HA 3P4MB 3WIFA 3GIVA 2N4IA 4L37B 1G0XA 5D4JA 1AMXA 2W9DH 3SN6N 4AQEB 1ZHBA 4FYQA 4IKKA 1KF9B 1UG9A 4LAQH 2W07A 4OV5A 2FZ3B 1NFDA 3VSUA 4K9EH 4UI2A 3DMMA 2XX0A 2P5PA 2DN7A 2WVUA 4KXZI 4R83A 3ZE1F 3KYMB 3LKQB 4HS8H 1KJ2L 1WFMA 1EO8L 3NCFB 4BXVA 4MX7A 1KJMA 2VLRE 4GSDH 5FGSA 4YHNB 2CBTA 5LN4A 1ZT7A 2JB6B 4KV5E 1KJ3L 3U9UA 4BQ9A 4F7CB 1MJ8L 3FUEA 5AL0A 5KSVB 4G9FD 5HHVH 1CICC 4GPVA 3SZKC 5FHBH 4BZ2A 3AREC 4KHXH 3AVEA 4KQ4L 5F7EH 4U33A 1WK0A 2X6AA 4GI9A 3CHSA 4GH7B 1WPCA 3GM0A 3LNDA 1NDMA 3BN3B 3G5VB 1NM9A 4LBEB 5HJBA 1HAWA 4L5FL 3SDXA 1NLDH 1M9WA 2NNFA 5EU7E 3TA3D 4OM0L 4WO4A 4YLBA 4H7VA 1M71A 5IESH 2HP4A 1F97A 1N12A 2W0PA 5FWQA 1DQVA 3C5ZC 4WV1C 2R56L 2O5XH 3MODL 4WI9A 5LB1A 1BOGA 3SJVE 1PZ5B 1FPTL 2ZOUA 3L3DB 5DUML 1WZ1L 4RBPK 1FF5A 2FEDD 2NZ1A 4X83A 3ZGHA 3RFRA 1IM9B 1MFMA 3CDCA 4YHOH 4E68A 1EFXA 2R23A 2V0AA 2JB5L 1V3MA 1FDLH 2ZONA 5F7YC 4OZ4A 4UNTA 4OF6A 3VYOA 2EXWC 5DJDA 3GSNL 1SJMA 5C09E 4FAAB 3BKMH 3ZTEA 1IZJA 4JHWL 3SOBH 1A9VA 1KIUA 3BP4A 4H2AA 3W9DA 5FAAA 3WEBA 3CDGA 3IT8D 1OB1B 2O6DA 1DN0B 4NSKB 2IMMA 1JZEA 3CFNA 3FYIB 5D7SH 2D7MA 4RMWA 4U1KB 3W57A 3QDJB 2OZ4L 2PWEA 1C16A 5DZNA 4AENA 4LXFA 4TLTA 3WFBL 1V05A 5GGVL 3HLAA 2WWKO 4Y2NA 2YD0A 1OSZA 2MOGA 5LAXB 2XTJD 4RBPH 5LUMA 4M1CC 1MDTA 4JBSA 3E0GA 4OGYH 5TH2A 3MZTA 2HLFD 4X50A 1QR1B 1A5FH 1E9QA 2OW7A 3UYPB 5I0DA 2A4CA 2X4UB 3HIZA 1CN4A 5E8EA 2KZKA 3NJMA 1AIFB 1MWAB 4NFBA 1N64H 4U1HA 1OOWA 4HU2A 4R90L 3P4LA 4L1SA 4OZGA 5D5MB 3ZT5A 3B56A 4I88A 4AI7A 2YK1L 5E0FA 1MCSA 2A0LD 1JN6A 2OMWA 2E7MA 1R5IA 2FCBA 4OTXH 4AIZA 3JV6B 5B8CB 5KVDH 5C3LD 5AYUH 3RVXC 3DHJA 4NO3B 5AOZA 4XC3L 5BMFL 4N0FB 2R29H 4FQJH 3GIZH 5E6IC 2FR4A 2ZOWA 2WKOA 1S7WA 4Z3JA 5JXED 3F01A 4HIPA 4Z7WE 3VG0H 4HK0B 1VZGA 1CXFA 5SWQA 3IDYB 3LN4A 5IEHA 4R84A 2DI9A 2YD5A 4Q9RH 1NDTA 2VJ0A 3MNZA 3FU5A 3S8GB 1BG1A 5EIIA 5I19L 5FGBA 3LNFA 3MV9A 3QZMA 3WEXB 4J2XA 3R7RA 3H54A 3S3SA 4Z7NB 3D25A 3CC1A 3WE1A 4Z7OE 2YAEA 3STBA 2WMPA 1TJGH 1CXIA 5FYLL 4N2IA 1AP2B 3SCMC 2R2BA 3BH4A 1YMMA 3ZW3A 4FFZL 2NTFA 1I1AA 1EDYA 3KVPA 4Z7WF 1DVFC 1GGBH 2E0PA 2FIKA 4FHKA 1NC2B 1UEMA 2EIDA 3DO7A 2OK0L 4WJ5B 1MWAL 1T2QL 2A1WL 3JXAA 1XAKA 3QS3A 1QOKA 1T21B 5E8DH 2VSKB 5IQ9B 2ZYHA 2XZQH 3DRQB 1LHZA 5AB0A 4KKRA 4Y4KB 3V52L 1F1AA 2IGFH 2WZAA 3N2JA 5D7IB 5EFIB 4UAOB 4FI7A 4UTAA 4HPYH 2FUQA 1M7UA 4Z8FL 4QRBA 5AW2B 4FI6A 1FCGA 1T4KA 2GIXA 5F89A 2X6BA 2W81C 4B3VA 3IJEA 1MKFA 2CR6A 4BDVB 2GJJA 3MUHL 2APBA 2H3NB 3QXAB 2NYYC 2WSPA 1W0WA 3EOTH 5DHVA 3IVKB 3PWVA 3QHTC 1UCBL 4I3RL 3S6CA 5IT2L 2RFXA 4YMPA 2AJZB 3MVSA 3OX8A 5A2BA 2G60H 3I6KA 1T0MB 2VSCA 4B97A 1CGYA 2D3LA 4L8DB 4ZYKB 5GSRB 4BGLA 1EEUA 1RL1A 3HR5A 1X9QA 2XPGA 3OAWA 4APXA 2VL4A 1F2QA 5F44A 2QGBA 2XBTA 3MX0A 1OAQH 4ZT1A 5J0BA 4KX9A 5IK3A 4H26A 4L3EB 4OCRL 3V0AC 3NJVA 4AVHA 5I30L 1ES0B 3QB7C 1AQKH 2FT6A 2OMTB 2IFFL 5E9NA 4YHYB 2CDEA 3NA9L 1X6NA 1K9TA 5IJKA 5KVGH 3PDDA 1MHPH 1F90H 4W4OA 4W9IC 5CMAA 1LO0H 3FTSA 3C6SA 3UEZA 2OSLB 4JFPA 3WJLC 1IX2A 3K2UH 1SQ2N 1ICTA 1J9QA 3X2QB 1SHSA 4HWBA 3EH4B 2GW5A 4NN7C 2FWUA 3ABLB 4HCRA 5HHOE 3VD9A 4AUUA 3NIDE 4XCCH 2CQVA 2Y36H 2BXYA 3OMNB 2ZKHL 2AK4B 1I8LC 4XCNA 4CRPA 3SPJA 2J8UE 3FC8A 4LASH 4URKA 3TN0A 4M7JL 3TBYB 4BV1A 3IPFA 3AAZA 4U2ZA 3VGDA 1A1OB 2I27N 5TQ0H 2E6QA 5CCJA 2WZPA 3FUDA 4HX1B 4ZFZB 3VXRD 2KKQA 3EHBC 1HHGB 2YBGA 4UYQA 4LOUD 4OF3A 2QGEA 4XVSL 3RDTA 5CEYB 4F7EA 5JDSA 2BX5A 3NIDF 4MHHI 2DQFB 4WTZA 3SDCB 2PYEE 4ZUSB 3BVVA 4NLHA 1VZIA 4HXBL 2J8UF 4HKXB 3NZSA 1RZKH 3REVB 4YDJA 2D2OA 4PGZA 3UPRB 2ATPB 1J9CT 5DJAB 5MI0B 1JJUA 1XO8A 3OQRA 4CADB 3NBNA 5D1QC 3RILA 4ATTA 2Z6FA 7FABH 1MG2C 3JWNC 3PL6A 3DSNB 3L2LA 2DQEL 4N2BA 2VDNL 3LPOA 4UINL 3QNZB 4PLJC 4S2SA 3DOSA 3NABH 4U1SA 1MEXH 4WWID 3UG4A 1E9OA 1OAXH 3IN2A 3OHMB 4P2QB 3WTYA 1FWXA 5G5DA 3WN5B 5I66A 4KRPB 4MXVE 5GGRA 4KX7A 3A4DA 4R7XA 1JPFA 1RV6X 2PW1A 4LCCC 3CFDA 3H9YA 5DRNB 1PF3A 3NMEA 3GBMH 1WZMA 4A6YL 4DZ8B 4YXKL 1S7RA 3U4KA 4BEIA 3U6RB 1NFKA 5INDB 4ZOBA 4Q9CA 2FJHA 4LVOB 1RERA 2Y7SA 1NCDH 5LGKA 2YFNA 3WMQA 3BH9B 2X1WL 3IJ8A 4LNRB 3VM7A 2CO7B 5FW7A 4PM1A 4U6VH 3SOTA 1LGVA 4DGUA 3L9YA 5T33L 1NPUA 4CMHC 5HTSA 1LO5B 4JFQA 2G0LA 3FB7A 5EN3A 2F7RA 1D6VL 1Q4NX 2H32A 2PP9A 3MJ9A 1IEBB 4Q14A 5I0VA 3CFEB 3C09C 1OGAA 2WBJB 4WFEE 3QYMA 1FFRA 2Y07H 3VWJB 1JZ4A 1F1GA 3WKNA 3GTVA 4JGMA 3VFWA 1QD0A 4FULA 2WXGA 4CC4C 1KN2H 4IDLA 4BZYA 5KYYB 1GOFA 3EBIA 3HC4H 2BNQB 2OQJA 4U3HA 5HHQB 2LU4A 4QHKJ 5DD1H 4WFFE 2FWOB 4M5YL 1NBCA 1BJ1J 2MMXA 1VPOL 2IH8A 1I31A 1CXKA 1VESA 4P9ML 3B2VL 4ZXBC 1VFAA 2YJLA 2JIXD 1VFBA 1KCRH 2VLLB 3ZKMD 3CCHA 2NUTB 4P48A 4JO8A 3E3QC 2O30A 3KPQB 2YOAA 3T0EB 4CKVX 1Q90A 3D06A 4IHOA 5I5MA 1G6RA 3PAYA 4FQIL 3S36H 3CFQA 1FQ9C 2DLEA 3TVMA 1BQUA 2JXMA 1IVTA 1PY4A 1IM3A 1J1XH 2DLFL 3AQYA 3TYGL