1RZQA

Crystal structure of c-terminal despentapeptide nitrite reductase from achromobacter cycloclastes at ph5.0
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
328
structure length
328
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title pH-profile crystal structure studies of C-terminal despentapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 84
structure length 328
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA02
3GDCA 3EF4A 4AX3A 5B7FA 2Q9OA 4ENZA 1RKRA 3PAZA 1SDDA 3IEAA 2XX1A 4BXSV 2XUWA 2PPAA 1ASOA 1N68A 1X9UA 5B1JC 3QJUB 3T6XA 2BP8B 3MX0B 3BVDB 3X1BA 4CSPA 2EILB 2Y69B 3FS9A 2HX9A 1QNIA 4E9SA 1XB3A 1SF5A 4HZ1A 2MRYA 3NYKA 3DKHA 1TU2A 3GYRA 5EHFA 2P80A 3NSYA 3CDZA 5D4IA 3JT2A 2ZONA 1NIDA 2GC7C 1AG6A 2IAAC 1KCWA 3ASNB 3KW7A 4N8UA 4GP8B 4YSDA 4YVUA 3PCYA 4BDVA 4BWUA 3UADA 3FSZA 3SBRA 3S3BB 1IUZA 4HIPA 2HX7A 2A3TA 4BK5C 5I5MA 2AVFA 3NJMA 4G70B 3NP4A 2OCCB 2GI0A 3PAVA 3UABA 2I7OA 2YQBA 3FU9A 1NIEA 3AG3B 4DPBX 2B08A 1CUOA 3WI9A 1JVLA 1RZPA 3IN0A 2OJ1A 4K9JA 1L9SA 1IC0A 3CVCA 1GY1A 1JZFA 1BQ5A 3T6ZA 3NSDA 2BZ7A 3FSAA 1BXAA 4DP8X 2EINB 3OD3A 4E9YA 3N2JA 1BXUA 3PAUA 1DZ0A 1OE1A 5FC9A 1B3IA 4YSOA 1HAUA 1AZRA 1MZYA 1SJMA 5I6PA 4JHUA 5I6KA 1WS8A 4YVNA 4GP4B 1ET8A 2B3IA 2CJ3A 2PPEA 3FQYA 1V10A 1WAEA 1SHXA 2BHFA 2ZWNA 3OQRA 1CYXA 1BAWA 1MG3C 4QLWA 4KO6A 3AZUA 3UGEA 2XU9A 2IDQA 1KBWA 1NIBA 5IY5B 1DYZA 2R7EA 5F7AA 3D12B 1KGYE 3X1NA 3CG8A 1E65A 1GW0A 2ZXWB 2XWZA 2YXWA 1AZBA 4YSPA 1I53A 2FWLB 2H47C 2QPEB 1AQ8A 4A2FA 1JZEA 2X88A 3QJVB 1SFDA 2FJSA 3N55A 3TU6A 1E30A 4YSUA 1OCRB 2FQFA 1SDDB 1AZUA 2CUAA 3PLYA 3WNJA 5LDUA 3FPYA 4A68A 1BXVA 3EHBB 2XYBA 2HRHA 1AIZA 1GY2A 4WTQA 5A7EA 2PP8A 1PY0A 3SBPA 1BQRA 9PCYA 2BP0A 1WA1X 4E9QA 4WKXA 3H56A 5B1AB 3FSVA 3HB3B 2XV2A 3ERXA 3FU7A 4UAHA 3X1FA 2W88A 4A2GA 3CDZB 2WO3B 4G71B 4DP6X 4HCGA 1NPNA 3ZBMA 1GR7A 2IDTA 3EH5B 4AKPA 4BDVB 1OCZB 2XLLA 3X1EA 3ABMB 3GXUB 4RH4A 1PNDA 2PP7A 4YSTA 2XV0A 2UXTA 2EIKB 2J55A 5I6MA 1L9RA 4BWWA 2GHZA 2N0MA 3CVBA 2Y1AA 4A2DA 1NICA 2TSBA 2UXVA 2YAFA 1PLCA 1WS7A 3QJRB 3KW8A 3T71A 1ZIAA 1ASPA 2VSKB 2FQEA 4P5SA 1AZNA 2GSMB 3TBBA 4GYBA 4KO9A 1AACA 2LLNA 3X2QB 1UATA 2FQDA 1PNCA 2WO2B 4YSAA 1NINA 2PPFA 4E9RA 2AANA 2YARA 3UACA 4E9VA 4Q89A 1OCOB 3NT0A 2BZCA 3NSCA 3EH4B 4N4YB 3CZUB 3NJHA 1ET5A 5D4HA 2FT8A 3NP3A 3NJJA 1A3ZA 2YXVA 1A8ZA 1ZDSA 3NJLA 3OMNB 3ABLB 1PLAA 4NERA 2VM3A 1JVOA 1ZIBA 2NRDA 2R7EB 3T9WA 5B7MA 4A2HA 2I7SA 1V55B 3TBCA 3WG7B 1KBVA 1L9OA 1V54B 5B1KA 1T5KA 4TXVB 2UX6A 4PCYA 3S3CB 4AI7A 3SBQA 2AZUA 4F2EA 2IH8A 4MFHA 3NJFA 4W1TA 4KNTA 4FA7B 5I28A 1GS8A 3JTBA 3U25A 4X4KA 4AKQA 4HCFA 1JERA 1AG0A 3TASA 4DP4X 1OF0A 3NSFA 2XXGA 1JXGA 2CALA 3AY2A 1GSKA 3FSWA 1FA4A 1L9TA 3ZX1A 1PZAA 4KOBA 1KV7A 2HRGA 2BP0B 2BWIA 3ASOB 2EIJB 3FU7B 1M9WA 2UX7A 1NIAA 3WKQA 2RACA 3FU8A 5I26A 1QHQA 5B1JA 1EZLA 4M3HA 1TKWA 4YSEA 2J5WA 1PF3A 4DP5X 1IBYA 4YSRA 6PCYA 1PZBA 2HZHA 2YAOA 4G7SB 1E5ZA 4EF3A 3NJKA 2VN3A 4GY4A 2IDFA 1NZRA 4M4RB 4KO5A 4DP9X 2DWTA 1JZGA 2CCWA 3S3DB 3T6WA 2DV6A 1GYCA 1ILSA 1HFUA 1L9QA 1R1CA 2FQGA 1HAWA 1W6WA 5F7BA 2UXGA 1E67A 1JXDA 2DWSA 2IWEA 2QDVA 2VSMB 2X87A 4PAZA 3DTUB 1PMYA 1N70A 1WA2X 2FT6A 4A67A 1J9QA 3X1GA 5AFAA 2J57A 3ABKB 4NB7A 1VLXA 3QJSB 3H4HA 1AOZA 3FYEB 4Q8BA 1RZQA 1TEFA 2XVBA 5B1BB 2CAKA 4KNSA 3UAAA 2AFNA 1NTDA 1AANA 1ID2A 2HLEB 2XV3A 1YLBB 1A4BA 3QQXA 4G7QB 4ZK8A 2XXFA 2YAEA 2JKWA 5TK2A 2VW4A 3PPSA 4BXVA 1SNRA 1PAZA 3CVDA 2IDUA 3FYIB 1OCCB 1A65A 1PLBA 5B3SB 1W6LA 1WA0X 1GS6X 1M57B 1AR1B 1A4AA 2FTAA 2VMJA 4YSQA 1AS7A 1W8EA 1JXFA 1F56A 7PCYA 1ADWA 2HXAA 2GC4C 1M56B 4CSZA 2MTAA 1J5DA 1OV8A 1XB8A 4F2FA 5I5IA 2PPDA 5I5JA 1XB6A 1JZIA 3OMAB 1ZDQA 2I85A 2PLTA 1KDIA 2YAPA 2GB2A 3IBOA 4L0PB 4P5RA 5D4JA 1NIFA 4YSSA 1MG2C 2OV0A 3OMIB 2BWDA 1FWXA 3FQ1A 3C75A 1X9RA 5I6LA 3V9CA 5E9NA 2PCYA 1AS6A 1SHWA 3DIVA 5PAZA 5AZUA 4G72B 1JZHA 4DP7X 3T6VA 2JXMA 3EH3B 5TK4A 4AZUA 4E9XA 1AAJA 2E86A 1QLEB 4HHGA 3UAEA 3QPKA 2QDWA 3ABGA 4HHWA 4JKNA 8PAZA 1BYPA 3V9EA 1NWPA 2Q5BA 4G7RB 4HAKA 1ZPUA 3NJIA 4YL4A 4GP5B 1PCSA 4UANA 3WKPA 1ILUA 4FAAB 3IE9A 2VW7A 3ZIYA 2BP8A 1AZCA 2BW5A 1J9RA 3QJTB 2AZAA 2YAHA 1IBZA 3IN2A 1TEGA 4KOCA 4F7KA 2BW4A 1GS7A 4DP0X 2P80D 1CURA 3FQ2A 2HX8A 1EHKB 2DY2A 3RYMA 2H3XC 2W8CA 2EIMB 1KCBA 2H5UA 2ZOOA 1BYOA 1ZV2A 1OOWA 2GBAA 3AW5A 3BQVA 4HCIA 4BWTA 1J9SA 2IWKA 1CC3A 2VW6A 3S8FB 1JZJA 3ZDWA 1OE2A 3HEIB 2YAQA 1J5CA 2WSDA 4E9WA 2QT6A 1JOIA 2UXFA 2BO0A 5PCYA 2IH9A 4AKOA 1NPJA 1CYWA 6PAZA 3SQRA 4DPCX 1RCYA 3QJQB 1J9TA 1ETJA 1PZCA 2YAMA 3S8GB 3WNIA 1IKOP 2IDSA 3AG1B 1KDJA 3WIAA 4UF7C 3AG2B 1BEXA 5AKRA 4W9ZA 2PPCA 1NDTA 1AS8A 2VM4A 5I6NA 3MBWB 1ET7A 4JHVA 2GIMA 1E5YA 2PCFA 3NJGA 1KYAA 1ASQA 1MDAA 1NWOA 2QPDB 2CBPA 3OM3B 4NAJA 4QKTA 4KO7A 4KNUA 2XX0A 1BQKA 2TSAA 2FNWA 2DYSB 2DYRB 4A66A 4DPAX 3PXLA 4GXFA 3AG4B 4YSCA 5I6OA 1SFHA 4DP1X 1MZZA 4DP2X 3L45A 1L9PA 3TA4D 3H4FA 1OE3A 1URIA 3FT0A 3FPXA 4A2EA 7PAZA 3NJNA 5ANHA 1SF3A 4E9TA 2IWFA 1FFTB 2PP9A 2J56A 1XMEB 3G5WA 5B7EA 4HALA 2JFCA 1A4CA 2FT7A
chains in the Genus database with same CATH superfamily
3LDBC 1F13A 3QO1A 2ZNWA 2FBOJ 4MHHI 5E2VL 4F7MB 2VDOL 4LEXL 1PZDA 3T0ED 3KXFA 4JPWL 3R4RA 1AGBA 3QIUB 4ELMA 5F9JB 1ZANL 5T33H 3MX0B 1CBJA 4ZXBA 1PLGL 4GUOA 4NBZB 4Z76A 2XN9E 5I66B 1H15A 2I25N 1M05B 3IGKA 2J25A 5I23A 1BEYH 1U8IA 1UADC 4G7VH 1AE6L 2KC0A 3CDZA 1E7VA 4YX2L 3U0TA 2IAND 2Z65C 3GHBL 4UV7L 4Y5YB 3ZMEA 2HLFD 4X4MA 3NH7L 1P2CA 3MLUH 2NY6D 4ZOBA 4ZSOE 3VMNA 1CXFA 1TQWA 1HIML 2G3NA 3NESA 3FSZA 2H2SD 2OSLB 3Q9PA 3TNNA 4FXGC 4L9LC 3KGUA 1RUPH 3H9HA 3BIKB 4ZFFB 1DFXA 4OZGA 4RMWA 1BQSA 4EI6A 3JWOC 1EK3A 4O4YL 4U1GC 3TTYA 4M03A 4A7TA 2YKKA 5D2LE 1T5XA 5I15L 5J6HA 3O6MH 4B9IA 4KTDL 3CBRA 4QRPB 1RIHL 3MLSH 2X70A 3IN0A 1Q9KA 2D4FA 1SJHA 1L9SA 4RQQB 3WFDH 4KZDL 3UIYA 5JQIB 1JZFA 1OTTD 2WTRA 5LBGA 4IBZA 1TQCB 3OXRA 4XMLL 2E7BA 1H3PH 4JFED 3TPUB 4M6ML 1WFNA 1SYVB 3SYOA 3CC5A 4X0KA 3TTSA 3MFFA 4HWEH 3EOTL 1SZNA 3QG6A 1HAUA 1UWEH 2VC2H 4DPRA 5LAXB 4B96A 5I17B 3KGSA 4WUKL 1A6TB 4D8PB 5B8CA 1VZHA 2A74B 2B3IA 4NKIL 3FQYA 4PLKD 5IJCC 1X5KA 1T0PB 2Y7OA 1TMQA 2PABA 4HZLB 2Z31A 2HRLA 1NIBA 2VSCA 4QTIL 4ZS7L 3O2DH 3N43B 2DBLL 5IVXE 1I7UA 1M6UA 4U2ZA 4ZUVB 1RPKA 3CG8A 5DI8A 4F3FA 5T8IA 4JR9H 4KAQH 2VZTA 5D7HA 5BQDA 4DNLA 1UD3A 3US1A 4X5QA 2HRPH 3KPQA 4XVSH 3FO1B 4ZW7A 4KHXH 3RE0A 2GY5A 1RZ7L 2IPKB 3HLKA 5IW1B 5HXMA 2E6QA 4EJ1C 5K9KA 4G9DB 1XFPA 2FJSA 2HTKC 4JKMA 3SDDC 4FQIH 5DRZB 2BIOA 1L0YA 4I13B 3WNJA 1TZGL 3FPYA 1G6VK 5MP6H 4UT6H 1CDUA 1P0SE 2A6KA 2AJYH 3K80A 5DEGB 1CTMA 4LHQB 5E6SB 4D0CA 4EZKA 3DOHA 1W0VB 2OLDA 1ZK9A 3GBML 1YMHB 2R39A 3HR5B 2X09A 3IB4A 3LHPL 5KBPA 4MA7L 4H1LB 2PR4H 4MQSB 1T20A 2W88A 1R3LA 4O58H 2O6PA 4JQIA 3FFCB 5EN3A 1ZHLA 2OMWA 3MJ9L 1JGDB 1V7MH 3FTSA 2AEWA 3EGDB 3BEWA 2OSYA 3AS3A 2F1AA 1A7OL 2ZF8A 2BSTA 1KACB 3OKDB 3WN5B 4NXSA 4N85A 4AKPA 4BDVB 1R46A 2VQ4A 4HUVB 1BZOA 3MCYA 1MJ7L 2AEQH 5I8EA 1Q1PA 4XNYL 3ZJAA 5KYXA 2NZ9C 1CD0A 4KRNA 5IJBC 4DEPC 3WCYA 1U95B 4XT1C 1IB5A 4XO3A 5CBEA 2ZPKH 3QE5A 5EIVA 1T83A 4XN8A 2JV6A 1NH6A 3JWDC 4LLYA 3ZY7A 4EI5C 2BVEA 2ADGB 4U3XA 5KW9H 2V5MA 3VVWA 4P5SA 3CX2A 2ZYSA 4YWGL 1OD9A 5GS1A 5M7QA 1SRDA 2G2RA 2WN3A 1RZJH 4L4JA 5I1LA 1AFVL 4U1NB 3U36B 5C8JB 1U8KB 3G5XB 1RK7A 5GIRA 4HYTB 2A7BA 2VH5H 5KVFH 4XAKE 2QKIA 1HESA 3NT0A 3LKNA 3R06B 2JE8A 2OMNA 2C34A 4KRPB 1JWMB 3T4AB 1J86A 4YGAB 4JFWA 4PGCA 5EUOB 1MVYA 5G2NA 2BIQA 4JHWL 4ZNCD 4I7ZC 1Z3RA 1AGDB 1AQDA 1EBAA 3P4LA 4HK3N 4PJBF 2G4EA 4PJ5E 2NUTA 2NRDA 5CGMA 5FW8A 2F74A 3O4LE 4BQCA 2P5EE 3L3HA 5DRWA 4WUUE 3MGOA 2CIKB 4DUXA 1T5KA 5CD3A 5MEND 1VFAB 4JJ5B 4H88L 2PO6B 3V6OA 5EZJB 1UZ6E 4MCZB 2KH2B 3L5WB 2R4SL 4HCFA 5GJSH 4YAQA 3QFJA 1XDTT 3NSFA 3Q9QA 2AK4D 3GMPA 3EFDL 3FHAA 2HJKA 4QXUL 3ZDZB 1XL6A 5I2IB 2DJUA 4MJ5A 4TM9A 1DQDH 1JPSL 4P5KA 3P73A 4AYGA 4DGYH 3CH1B 1GSKA 2Y5TA 5KYWB 2BDNH 4PS4H 5T1LD 4H1LH 1T1YA 3ZX1A 1WP6A 3GS7A 4QRSA 5FKAA 1OL0A 1B4JL 1CFSB 3D51A 1IM3D 3AGWA 3DV6A 4LCWE 3ZSSA 4RX4A 2AMUA 1UFUA 3UIZA 3B7YA 1XSKA 3C6SA 5BRZE 5D4QA 3HE7A 1UFGA 2QVFB 3DXAD 3HC3H 2NCMA 2CKBA 2OL3L 1AH1A 2AQQA 2J1WA 4EKXA 4DEUA 3ZE1B 4BUGA 3KR3L 3CVIL 5J6GA 3HFML 3B1TA 3QDGD 5CILH 4P07A 4OZFA 2FK9A 4UINH 3C12A 2IDFA 3CVHA 3L5XH 5DUBB 2Y2TA 3C6LD 3I6GA 5F70A 1FYTD 5HYFA 1F11B 1H5BA 3IVKB 1W6WA 5KS9B 2D3NA 4K7PY 3GTTA 3I74A 4YHNA 2A0LD 4BK5A 3M6DA 4JDVB 1PMYA 1DLHA 2CM5A 2F2HA 1YNLL 3TGXA 2VXSH 5AAMA 5JOEA 3QC5X 3X1GA 1M71B 1PG7H 2B16A 3CCHA 4XX1E 3DV4B 4OZIB 1K4CA 4Q8BA 4R3SA 1HSAB 2OR8A 2HH0L 1EEYB 5KN5B 4IOIB 2QPUA 1HYRC 2EDFA 2Y2YA 4TOYL 5DFWH 4BUQA 1I8UA 4Z3HA 3IDIA 5DWUL 4QRUB 4ZMXA 4XNMA 4KQ0A 3TXAA 4PJ8A 1TJXA 4G7YH 1EMTL 5C0CD 2L7UA 3BGFB 5HHPA 4CVXB 4NRXB 4W9DC 5L6YH 4P48A 3LSOB 3MRBB 1GS6X 1LMIA 5EORH 2PWGA 4GIPD 1YN6B 2P8PA 1MWAA 1KBPA 1S4IA 2D3VA 4JFXB 4XI5C 2EDRA 2HG0A 2X89A 4G1EB 4J1UA 5GSVB 3HA0A 2BH0A 2NY0D 1A9VA 4BBWA 2VOTA 5F9WC 1S3KL 4PJFF 2VIRB 2CLZB 5JHDA 4TSBH 1OGAB 4HFUH 2E8ZA 2R1WB 2FSEB 5BO1H 3RDTA 3MBWA 4UYQA 3D85B 3MCKA 3MV7A 1O7DC 4FFYA 1BVKA 3VI4F 3INUL 1RFDH 1ZT4A 3DMMD 2C1OB 2R2CA 3Q0HA 4JCWA 4LF3A 2PLTA 3U6XA 4NWTL 4CC4C 4B97A 5D4JA 1KMGA 3DURB 1KY7A 3EDJA 2ZQKA 3ARGC 3VI4E 4ZMNA 5JIIA 1IC5L 4P2OA 5BZXA 3IU3B 4U6HA 1E9OB 3FHQA 4KH9A 4FQXC 1FP5A 4JFOB 4TNWF 2NNCA 3W0WD 5CN1A 4A2MA 5HGHB 4J39A 4YDVB 2NZ1A 4ATWA 3T8XA 1H19A 1UJ3A 5I8CA 5JOFB 5I6XB 2VN6A 2W60A 2MQ0A 2ZUYA 3QZWB 1OCWH 4K3JH 3V6BR 2FHFA 4Y9GA 3G6JB 5IROA 4GUQA 5F21B 4K8RD 3IWVA 1S5IH 4AVIA 5AD0B 4ERSH 1BGXH 2F53A 5AW9B 4AY0A 2H0PA 2H32B 5F7DB 2A2QT 1XF5A 5TPWL 1JPTH 3PHQA 4NQDD 1YNTF 1EDYA 1I1YA 3MLWL 1FO0B 2PMZA 2KDYA 3PJSB 3RU8L 1IBZA 3IN2A 3MXWL 3ROLB 1JXJA 1KCSL 3QJOA 4KOCA 3Q2NA 4POZC 1UWGH 3KDMB 3OF6D 5A6LA 3TLRA 3DSNA 4QYAA 1YEHL 2HX8A 3G3LA 5D71L 25C8L 2R4RH 5AUMB 3ARRA 3FT3A 3TO4A 5CJBA 3OHXA 3QA3A 5DD5H 5KVMC 2ICWI 3ZRCC 4JN1L 1S9XB 1XCQA 4AL8H 2FWOA 4G6KH 1XTMA 4LCIH 4ONOA 3SDCB 3DX6A 5I5RA 1S78C 4BWTA 1NEPA 2MPAL 4P0DA 3UERA 4KITB 3CHQA 4JFZH 1JSYA 3F7RA 4HCRA 4AKOA 3E1F1 3CMOL 3ZE2B 2DWXA 4GW4A 1XF4B 4HG4J 5C0FA 2VR4A 2YAMA 2NXYD 4G9FB 4OGXL 5IEKB 1K5NB 1ZJAA 1S7QB 3RWDB 4V1DE 5CZXC 5CM1A 3O2WL 4XAWL 5DZJA 4UTAH 4M93C 4P06A 3ZTEA 3UEQA 5K9OA 4CMMA 1YEGH 1CLCA 2FDBP 2AHIA 1WUNT 1E3XA 1XWVA 3BSZH 3LQZA 2PYEB 1UOWA 4Z7UA 3KNBA 4LLMA 1MKFA 2P8LA 1QZ1A 3VFTA 2AV7B 2W9LA 4HIJA 1U3ZA 3GSQB 3QCUL 3UTQA 2EDEA 3P0YH 1HHHA 2DYSB 2R0KL 1W0WB 4ZPTB 1YAZA 2BY2A 4GXFA 2ZXGA 2DRUA 1KIPA 2H9GB 4N2DA 1A02N 3TH2T 4MWFA 4QHMA 2B20A 5E95B 3RX9A 1ACYH 4NENB 1MQ8A 4A2EA 4TNVK 4X4YA 3TYFB 1BQHA 1WZ1H 1D9KC 3MRLA 2NYYC 4E9TA 2P1YA 2CKNA 2PP9A 3G5WA 1HNFA 1KEML 4NNPL 1UWXH 4YHKL 5L8KB 3UBXA 4HPYH 1N2RA 2PYFA 2H32H 4JO3H 3CX5K 3FFOA 5F6IC 3LZPA 4JFVA 2ZCKH 4HAGA 2GTZB 5A43C 1TMCB 2X1QA 4DH2A 2XUWA 3QIWA 1X9UA 2EYTB 5DURB 3WO4B 1EFXD 4KKLD 1RIUH 1BIHA 1OGTB 1YC7A 3KPRD 3H42H 4FEMA 4MASA 1ZGLM 3OR7A 2EILB 2YPVL 3SQBB 3OB8A 1FH5L 5I1EL 43CAA 4UMGA 1TZIB 2ZJSL 4YHLL 4MNQA 3MACL 4HJJL 2WWMD 2EZ0D 5I1JL 1C8QA 5IMLB 4G80B 4RGNC 1TXKA 1AXSB 3QJHA 5JYLA 3BUBA 2WKLA 2BIPA 2PW2B 3KW7A 4LNRA 3VD0A 1NANI 2WY3B 5C0ND 3HBZA 4N86A 4NM8H 3CZEA 4NLAA 2C3XA 2D73A 3QWOA 4ZFZA 3NJMA 4OUUB 4MBRA 1B0RA 4F1SA 1UEMA 3NSJA 1NMAH 4LLQA 1LJMA 4FG6C 4A7VA 4IU2A 2ADYA 3HI6L 3B2VH 1XD1A 3ZR6A 3QPQC 4F1ZA 3BP5A 1BF8A 4MAYD 3HG1D 3VGHA 2HFGL 3VCLA 1YYML 2WMPA 3CVCA 3QNXB 4HFWB 4U3HA 1OZUA 4PREB 2QR0A 5DJDB 3L3OA 3MOQA 2XWTA 4NHUB 3V6ZB 3KHQA 1NFDA 4XC3L 4QXGH 4YDIL 4L4VB 1N5YH 1VZGA 4YSOA 2EQDA 3QRGL 4U1JB 3BVTA 4WWNA 1U8NA 4TSCL 4MA3B 4BSWA 4D8OA 3APDA 2A38A 2GVYA 2VLME 3I6LE 3BN9C 1KTCA 3F5WA 4AGPA 1Q9WA 1X5YA 4KO6A 2K78A 5CCHE 4BYHA 1MDTA 2NDFA 3RZCD 2OMUA 5EWIL 3RGHA 1ZVYA 2FX8H 3REVA 2BVOB 3VDCA 1I82A 1KC5L 3L54A 4P5MB 4U1IB 5JW4R 3LKQB 2RHEA 3WKNA 1XGRA 4QWWC 5D72H 5I16A 1BQLH 1NAMA 2X4PB 2CLRB 3A0OA 1MQKH 4AMWA 1DUYA 4KK9D 4HS3B 1SDYA 5FV2A 1QEXA 2YO3A 3W9DA 4EXKA 5FGCE 1YJDL 4S2SA 2BHZA 1E40A 1ZTXH 3IKCB 3LN9A 2GG1A 3PIQA 4A68A 2IIJA 3EUUA 3QHZH 1GY2A 1KCLA 1KGCE 4WTQA 3QDME 2PTTB 1QO3B 5F89B 5J1TC 1BQRA 5IT2L 1OAUH 2AEIT 1GYWA 4X6FA 3LZOA 2NMSA 1TU2B 4TQEH 4XMTA 3WN6A 3VXRE 1WAAE 1NGYB 4FYSA 2R1XA 2BIHA 3GSVA 4ZQKA 5TDNA 4CADA 4DZ8B 3EO0B 3L3IA 1KTLA 3GXDA 5IMOB 2ATKA 3CZFA 3L3GA 5E4OA 2VDKL 4JFFD 3EH5B 5EU4B 5EUOF 4MA1C 3JUZA 5GZOD 5FOBB 4M7ZB 3MRIA 3N42B 3EAKA 1ZLWK 3AY4A 1P5UB 4P59L 5C08D 1KFAL 3F62A 1SEBA 2AMGA 3IXAB 4L3EA 1FL6A 1QLRB 1TEYA 3FQNA 3ZHFA 2J1KA 3EJTA 4FLQA 3P77A 4JG1L 1ZGLA 5CU9A 5CZRA 2Y1AA 3GI8L 2UXVA 2KYIA 3MBEC 4WFGD 1XCTA 4D3CL 2WIIB 1OTSD 1P69B 3AMKA 3KW8A 3O0LA 2GJZA 5FO8A 3WUWA 5IJVA 3ZKND 1XBDA 5IQLA 2NR6A 1MCNA 2PWEA 3MJ8B 2AJSL 1OSZA 3IGAA 1MREL 2WO2B 1WBZA 4BFGA 5EBLA 5INCB 3ZDZF 2OZ4H 4NZTL 2I07B 1AOHA 3TC9A 3O8XB 4RWYL 3QUMB 2BZCA 2VITB 3ARBA 4MQXD 2ADIA 3QUYC 3KPTA 3BVVA 4MAUL 5C0AE 4QNPE 3QUXA 1G7JA 3IWUA 3WY4A 5GS0C 3NJJA 2DLHA 5BRPA 4JQVC 3N1PC 5C71A 4BFRA 3IFPA 1TPXB 3MRRA 5ICXA 2WXMA 4GW5B 5ITFA 3KYNA 4ONHB 1QSFE 5D1XD 1HDMB 1DE4B 1GGYA 3D2UD 4PGDB 6FABH 1JVOA 5DK2A 4NKOB 2Y72A 3FMGL 1WPCA 2AS5M 1CGTA 3RWEB 2AXGB 4OGQC 5E99H 2V37A 1AHWB 2QLVB 4XVUD 3H3BC 2X4QB 3ZE1F 4E0RB 2FJFA 3ULUE 3UYPB 4FNLH 3ZE0E 2X4SA 4AKQA 2ZX5A 4DP4X 1JNHB 2AJZB 4BFOA 5EEXA 2WYIA 1TQBC 4XXWA 4Y4HB 3PY9A 3F3HA 4APQC 5IFHL 1I4FB 5DVNA 3THML 4ETYA 2JVUA 3K1DA 5GZNA 1FA4A 4EE2A 3GF8A 5KS9F 1S7RB 3BKYL 3NIDE 4F9PA 2XWJB 3QXTA 1OTUD 1Q4NX 2Z7YA 5FS5A 2UWEA 3C5ZD 5EIQA 3RB7A 2ZCLH 5D1ZA 4FRWA 2A73A 4LGPB 2X7LA 3QZWG 2VERA 4OZIF 4PJXB 5B1JA 3D69A 3ROOA 1YECL 4GSDL 1NCOA 5JR1H 4FKKA 2X4RB 3A6CH 4X4ZA 1J8HE 1I1AC 2J5LC 4JY6B 2OTWA 1PF3A 3BT2L 4Z0XA 2WINA 6PCYA 1UD2A 1MEXL 3ES6A 3WEOA 4PD4J 4G7SB 5D6CA 4LEBA 5BQ7A 2ZD0A 3CN2A 1TITA 3CJJA 1UTDA 3S98A 3FUNA 1XAUA 4LLWB 2EH7L 4KO5A 4K0OA 4DP9X 1AJ7H 2FO4B 3S4SA 2AQ2A 5ECGA 3RTQC 2O5XH 1FNGA 5F7BA 1M1XB 3I50L 1SN5A 4IBYA 4WW2B 1ICTA 1G7PA 4YO0B 2OYPA 3MCG1 5AAWC 4X6DA 3QUMH 2GJRA 1TOXA 3RFZB 4MD4B 3MREB 4NZUH 3VWJB 4HHAB 5JMOC 2XKNA 4FTVE 2RJMA 2N01B 2P7TB 2IDCA 3SCMD 3LAFA 1XAKA 5DGRA 2GHWB 2YK1L 1EXHA 1YLBB 1MH5B 2NX5A 1I1FA 1IEAB 5HI3D 1AXIB 4APXB 2P28B 2R1YA 1NL0L 4BK4A 2QFRA 5T5NG 1H6FA 2IDUA 3FH7A 3MRNB 3VFGL 3K6SB 1N8ZB 1W6LA 5BVPH 3AU1A 5KUKA 1H3XA 1S7XB 3A47A 3GTVA 3BMWA 3S88L 4AYBA 4XRCB 3DJZA 3V8OA 2YD0A 3ARVA 1UURA 4IRJB 4H44C 3G6JF 4LOVA 1OALA 3EYQD 1TZAA 4M8VA 5ABAA 4R97B 1TJGL 3NTCH 1KN4H 2WQUA 1E28B 3NSXA 1S7WB 3BWZA 4QYOB 4MQTB 4ZAKD 4XPTH 2D8KA 5DWPA 1GGUA 1JZ2A 2I85A 1O9VA 4QAWA 3ECBA 1QFWM 3O6KL 3TJHD 5ADOL 3QQDB 4Y19E 1JGVH 2GB2A 3A4DA 3LDBB 3RBGA 2R15A 2DAVA 1BPLB 3ARDD 4PN6A 4YSSA 2WAHA 2CZNA 3WEBA 4WO4A 2VM9A 1I8AA 1L9MA 4PRAA 3UC0H 1KENL 2JQMA 2MNUA 3D4GA 4HW6A 5MERB 5HI5D 2V2XB 1I85C 1SHWA 3Q1SL 2NW2B 1P4UA 2COQA 2BFVL 4G72B 3DHPA 4A63A 2JXMA 2DQIH 4QLRA 1KXTA 1U4EA 4IK6A 3A67L 4YXKH 3UAEA 2VLJA 3K8MA 1D7BA 2DYPA 2QDWA 3I3DA 4HHWA 4QO1A 3MC0A 3PV6A 3RHWK 2J72A 2JELL 3V9EA 4OFVA 1TVBA 3HS8A 1IT9L 4R96A 1CFQA 3KBEA 3LIZL 3ZE2F 2L7JA 5FYJU 4POYA 3V4VH 4CSSA 5DJAB 2IXQA 5D7IF 5ICYB 3T1WA 3AS2A 5FCUL 4M56A 1C5BH 5C09E 4FXGB 5TFSH 1YMMB 2C3WA 2YRZA 4L9LB 3VXMA 5T5NF 3GSUA 3FCTB 3EZJB 1HWHB 4U1GB 5D7IE 4J7RA 2HVKB 4PLJC 3UAJC 1EJ6A 1W72L 2OYKA 4KX9A 3UZQB 2VUOA 5F7LB 3RYMA 2DQGL 3VYPA 1ECYA 1KELH 2EIMB 4KJWD 5A1AA 4KX8A 3NRFA 2R9HC 3AW5A 2VERN 3BQVA 3HE6A 4GKNB 5DA4A 1NCAH 5E9DD 4DW2H 3VXNB 3NCYS 3QIBD 2IAMC 3QNFA 2QZ5A 4HJTA 2GW5A 3HEIB 4YE0A 1DCLA 3L9YA 5BOZG 2E5EA 3L7FB 3B5GA 2L8AA 3PV7A 4E9WA 4U1MB 4EUPA 2O26U 4LCYB 2OP4H 1PG7X 4IS6B 1UD8A 1TTFA 5FM4A 1XT5A 1M1SA 4Z3FA 1NLDH 4IGBA 3FQXA 1D3CA 1J9TA 3S8GB 2DMBA 3WNIA 4Z95L 4YHYB 3STZB 3V7MA 2IDSA 5D7JA 4ZX6A 2G2PA 3F7YA 1IL1B 1XZ0B 4MDRA 4QOKD 3VXTA 5AKRA 3S37H 4W9ZA 1UASA 2E9BA 4HJSA 5DJCB 1BWMA 5AVQB 5I8KL 1JNNL 3Q7JA 3W2DL 2VM4A 3FFDB 1T3FB 2GTWB 4JKPL 4ZUWB 3BO8B 2OXHA 4HK0B 4M29A 5F7MC 1IGCH 3MRJA 4FLSA 5E00A 3BJLA 2WQWA 4N0UE 3FOLA 3K74B 1HN1A 4U6XA 3ZU8A 3D39E 2J73A 3SDDB 1Q94B 1IFGA 3GO1L 4F15C 2WQAA 1CLYH 1EO5A 1KYUA 1QEWB 3HUJB 1IEHA 4I1PA 4I0PC 3N1QC 1DVFA 3K7UA 1NBYB 4ONFL 4RGOL 3I6KA 4XCNA 3U46A 5E6RB 3D0LB 2EC9U 3K6IA 5DJ8B 3HG3A 2Z8SA 5TH2A 3UP6A 4ZMOA 5CN2A 1L7IH 2ICEA 2R29A 2BHYA 4TL4A 4YFLF 5I0DA 3PWNA 1PPIA 2CCVA 3JV5A 1QUNB 3JWOH 2JCCE 4U1LB 5CFHA 4U0QB 3TBVA 4M5ZL 4Y16C 2JB6A 3U4AA 1PZ2A 4UU9A 3X1BA 4DEPB 3FS9A 3V0VA 1QNIA 4DVBA 1X4ZA 1NAKL 4IBVA 4TPRL 3GYRA 3MTRA 4HUKB 4PRNB 3RNQB 3AQDA 3NAAH 4U7SA 4N2NA 1IIKA 3VGFA 4EI5B 5ALCH 2OW7A 4DCQA 2VLKB 2WWKT 2O61B 4C56A 4JZJC 3T0EC 5T33L 2AV1A 4L8SA 1CDHA 4YUEH 1IBFA 3MRQB 1O6VA 4AQEB 5BUAA 5IQ9B 1KCVH 1U93A 5I5MA 4F93B 1H6UA 1T7XA 2BMKB 1BEYL 4O02B 1A3RH 3ARPA 3FT2A 4N0FA 3GRGA 3QR1A 3FU9A 1IMHC 3HZYB 4XPAH 1CUOA 3IMTA 3LN5A 4D0DB 3OV6A 1J0IA 2GJ6D 5F0LB 1IILE 3ARFD 3GSWA 2J43A 4LEOB 4K8RH 4XN2A 1G0DA 3F12A 2E7LA 4X6CA 3UTOA 5EDSA 2IANE 3DX2A 2DMKA 4N0YH 1RUPL 2QQLH 3KWVA 5CLXA 3NSDA 2BZ7A 3EJQA 2Q3XA 3LRHA 3TVMD 3O6ML 3FUEA 2B77A 4IIQC 1NC2A 3T65B 4QXWA 2J6EA 3TBTA 1KB5H 3HBPA 1KNOB 1KIQB 4ZUUB 3VXUD 4EZLA 2JWYA 2CJ3A 3QI9A 2P5WE 2BSDA 2J3SA 4PJIA 3V5HA 1A14H 1H3PL 2FWSA 1EEUA 1LLAA 2R7EA 4FJ6A 4LEEA 1QHPA 4P9MH 5MEOA 4IHBA 3MV9D 4FQPA 4HWEL 3WENA 1E65A 1TTAA 1MI5D 1UWEL 1FZKB 4UCFA 3IJ8A 5LJYH 1MCJA 4FGMA 1U3HD 2QPEB 3N42F 4NQXA 2CBOA 4JX0A 4XP6H 2WLLB 4XO4A 1LDPL 1ZEAH 1P6AB 4H0HB 4U3CA 3O2DL 3Q3GB 3IMRA 4WSKA 2XVLA 2BNUA 2WC7A 1LO2L 3IDMA 2XA8H 4KAQL 4WK4B 5C0BB 4JM2A 4XPBH 2IG2L 4Q0XL 4X4XA 2N1KA 1O5PA 3K0WA 2HRPL 3JWDH 2CJSA 4KHXL 4KKPA 1ZRUA 1A8JH 3V2AR 2NY7H 2J21A 4DGIL 3ENEA 1HK6A 4FQQB 1EBPA 3BWAA 1E6JH 4L1DA 4UT6L 1KTDB 2VSDA 1UXSB 1ZLUH 2AJYL 4OIBA 3IAPA 4TNFA 3ECWA 5A2IH 4XNQB 3TJEH 2DM2A 2E7HA 2JJWA 3BKCH 1A4KB 3ABMB 2OULB 2W59A 4EDWL 3I9GH 1XR9B 5HDWA 2PR4L 1IQWH 1GCYA 4YSTA 3OPZH 2L7EA 2PWDA 5DS2A 2OQJA 3CSFA 3MNVA 4IKJA 3AT9A 1V7ML 2BS9A 2WLIA 5EZLB 4A2DA 1CFVL 2RQ8A 2EDNA 3CQPA 5B4MC 4P46D 3GSNH 3SZ6A 1V27A 2D4DA 2WUBH 3TN0C 4FX5A 3IMBA 2QTEA 3X3GH 3CDYA 3Q48A 2AEQL 1WFIA 1JDCA 1DQJA 2VMCA 3DRTA 4WHYH 1DQVA 1AACA 2B1HL 4PJDE 3FQUA 3SO5A 1T1XB 2B0SH 4GKSA 1GL4B 4W9EC 5SWSB 3V6FA 1TO4A 1MCKA 4WF7A 2ZPKL 1YEWA 3ZZQA 5CEXB 1W8OA 4M02A 2G9KA 2YRPA 5BPPA 1HJBC 4NQEB 3NFPA 2EUVA 3CZUB 5CAYB 2JIXA 5GRUL 1ML0A 1ET5A 3NP3A 4G8GD 4M9OA 1L5GA 4X6BB 5HSFA 4MXVF 2IFFL 2HT3D 1RZJL 4M7LH 5D5MB 4LKCA 5KSAA 4MZ3A 3OZLA 2Y7SA 4OCNC 3GMRB 1QWUA 3T9WA 1XGTA 1ZIBA 4J3OD 4PJXF 2VABA 5KVFL 1FVCB 4GO8A 3NJVA 4QHPA 1L9OA 4AE1A 3ARGB 2XRAH 4NHCH 2JH2A 5C07D 4XVJH 4ABWA 4RGMC 4Z7WB 4WRLA 4Z7OE 4FQXB 4KNTA 3RVWC 1A6ZA 1UKSA 4FXTA 3MV8B 3LNGA 5DUJA 5TF0A 4NCDA 1HS6A 3DTDA 3VGBA 2C3VB 1UJTA 3FSWA 1J1PH 4E5XB 3MV11 4MXQC 1FL3A 4JVWA 2BPBA 4U1SB 4WW2F 1MCIA 1J11A 1VEMA 1C8PA 4HUUA 1E2ZA 3WLBB 4KVCH 2BP3A 5GJSL 1M7IB 3D6GA 3DBSA 3PWLA 4TUKL 4X7SH 3RVUD 1X5ZA 2ITDA 4W6XB 4Z7VB 4YJZL 5MENE 4DGYL 4LPUA 3MCLH 3T3MF 4PS4L 2JB5H 4OSUL 1WC7A 1EZLA 1NSNL 1I9RL 4WJG3 1GCFA 1BMGA 4DP5X 1A1MA 1KJMA 4EIGB 3KPMB 3RY4A 3T3ME 1RUKH 2DWEB 1RY7B 3IFNH 4OJFL 4ZXBC 1R3HB 3PQYD 4WNSA 5HHNA 5GS3A 4Z3TA 2NXZD 3H54A 5ESAB 4KMTH 3RUGF 1BFOB 3F7PC 3B9DA 1CWVA 3SKOA 3T2NH 1R5VA 2ZWKA 5ANMB 3GM0A 1RJYB 3HC3L 1RJZB 2ZG3A 4OKVB 4ZRGA 5ESVA 1HZKA 4QRPA 5CNHA 3C8KA 1G1CA 4HMEA 3ZDYB 3RUGE 2X87A 2DWSA 4OGAC 3AT8A 2ODHA 1F0LA 5CILL 3CXHJ 5AVWB 3QCTH 3OAUL 3DXAE 4UINL 1A21A 1QRKA 3DWTA 3RBSA 5ALBH 3FO0H 3L5XL 3TPUA 1PKOA 4AV5A 1PZUB 1SYVA 1N6VA 1RHFA 3QFGA 3QDGE 3WKMH 3CLEL 2APVA 1G7LB 4KC3B 3SPHA 2EUWA 4OVVA 3UPCA 1PZ3A 5DEZA 2YR3A 2F54A 1DEDA 2H2PD 4M93B 4WZ9A 2BVQA 1UWYA 5L88H 2YD8A 3B8YA 4PRPB 5C6PB 1FYTE 3O3DB 4W9GC 4U33A 4BXVA 1XSIA 4F20A 1A3LH 4Z8FH 1PG7L 3TA3D 3MUHL 4IHOB 4Y2DA 3X12B 1M57B 4ZUVA 1NFIB 3VVVA 5DHMC 5GJTH 3EW3B 3GKWL 5BUGA 4R2GC 3WAKA 3BSHA 2HUHA 5DHDA 1XGZA 3KHOA 4XXDB 5HJGA 1MCCA 3FB7B 5CCKH 5B8CC 1NGPH 4G9DA 2YA1A 2CDFB 5ETUA 3VXSB 2XTJC 4AQOA 1D9KB 1M7DA 1AKJD 4X8JA 2QELA 3GDBA 3VD2A 2Z31C 4A38A 4N0CC 4GOSA 4WI8A 4PRIB 4O2EA 3W37A 4XMXA 3UTZA 1QW9A 4JRYD 5EF0A 3TEWA 1MOEA 3MOBH 4QTHA 4I3SH 2F08A 4PRHB 3D25B 5F6IB 1YMHA 5D1QD 2JJTA 3RFRA 1WICA 1HOCA 4RRPM 4TSBL 4HFUL 4C4BA 2OPCA 3DRQB 2QADD 3LHAA 1GZQB 4AE0A 2F5AH 2OJEA 2Q86B 5IFJB 4ZO8A 4CRPA 1AD0A 2WSKA 2ZX7A 1BLNB 4XBGA 5F9WB 3SYPA 5I6LA 2IGLA 1WISA 3NZUA 5IR1A 4NT6B 3OKDA 5TE4L 3D3VB 4H20H 4FFVD 3ILQC 1REIA 2Z34A 3BIBX 3GTNA 1NUFA 3QHFH 1FLTX 4HUVA 1XGQB 4RGNB 2DIJA 4ZTOH 3HFFA 2CNYA 3GD1C 4BHUI 1P4LA 1N5AB 4HAKA 3K4DA 1GHFH 3G9VA 1T80A 4PJ7F 4AVKA 1DJXA 3L2NA 4QXTB 2E9JA 1PY9A 2ENJA 5FYLD 3AAZA 1CFTA 4K3JL 3W0WE 2YGVA 5EU5B 1K2DA 1WFUA 4LGRB 4PJ7E 4PJAA 2J88H 2CJUH 1DVSA 4DP0X 2P80D 4NO3A 4Z23A 3RNKA 3I75B 4N2OA 1U8KA 1E9QB 3G5XA 2DY2A 4MJ6B 1D5MB 1BGXL 1VSCA 3FONB 1CT8B 4XVTH 4OCSL 1ZV2A 1T83C 1DQMH 1BOGB 1JWMA 5HGGS 2FD6H 1JPTL 2DKSA 5FWQA 2VW6A 4PGZA 4O2FB 4HP5A 2VMEA 3MRMA 4ELKB 1FV1B 1FIEA 2YSSB 1UWGL 5DRXB 2BO0A 2E75C 5GS1C 4UQCA 3HUJF 3OVUB 3JTTA 5E23A 2R4RL 3F83A 1WHPA 1CYWA 4NQDE 3DYPA 1ZHBA 5DD5L 1KLUB 5ACZA 4TSAH 4AL8L 4KROD 2QKIC 1BDYA 2CIKA 3AG1B 3UXFA 4WHYG 3GJEB 3AQYA 5DR5H 4MS8C 4PWEA 4NP4H 5LLIC 1JZ8A 5BS0A 2PPCA 3QEGL 1ES0A 3IJYB 1FNHA 2ZWLT 2KI6A 5T3XD 4E42B 5I2IA 4JPIA 4KMLB 1SXAA 3DECA 5KSBF 4G3YH 1FJ1B 1B9KA 1HVXA 1HQRB 5IB4B 1G7IA 4KO7A 4OJCA 2HKFL 2MKWA 3IJSB 2NXYC 4H25B 4DWHA 5KSBE 2JK5B 4PTTB 1JI1A 3HS9A 3TWCL 2Z1KA 3OAYK 3V6OC 2DICA 3BCDA 1L9PA 1YEGL 1SJEB 4OM0H 2XA3A 3BSZL 3JV6B 3N1GC 4AQAB 3U79A 2OSXA 4I2XE 4M8QB 3ZTJH 2HT4D 3FPXA 4LPXA 3FXIC 5JXAL 1UXMA 4HH9A 4HWNA 2NT0A 5IQNA 4Z0BL 5EN2A 1INEH 3P0YL 5JHMA 3WEXA 4KX7A 5GSRB 5JNYA 1H3VA 3D08A 4LQ1A 2Q6WB 4PJEA 3UG3A 3ULVC 1UB5B 4U6YA 3U6RB 1I8LC 2YFNA 4XWOD 2CBTA 3BPOC 3KWWB 2OK0H 5EUKB 4BSVB 4JG0H 4N90D 3FUFA 4MA1B 3SDXB 1BM3H 3HE7C 3N9GL 1DVXA 4RAVB 4RRPA 3ESUF 5SWZB 1R47A 3D2TA 3BVDB 4MNHB 1OB1B 3KYKH 1Z6JT 1NLBH 1XB3A 4GO6B 5FYJH 3C2SA 4URKA 1QRNA 2DEYX 4GQQA 3NPZB 3NYKA 5SX5H 4EDXB 4JO3L 4CVUA 5EHFA 3MBEB 4NQUA 2ZCKL 2YZ1A 1U4FA 3DV4A 4YFLI 5CLZA 2CHXA 1MW2A 1DBMH 1HSAA 2GC7C 3ASNB 1HXMA 4FG4A 3E3QC 3PNWB 4HIIB 4MDIB 2FO1A 1H5BC 3K1KC 1M7XA 5DUPL 1P84J 3N1MC 3NN8B 4BK5C 4OTXH 1IE5A 2EEBA 4G42A 1AQMA 1MLBA 3KPRE 3KLAA 1AQKH 3QUYB 4JLRB 5GRZA 3QUKB 5AAMC 3Q5TA 2D0HA 1IM9D 2HT2D 5I76B 5GGTH 3WFHB 1YN6A 1A9EB 1N0XH 2BSSA 2OJ1A 3RG1C 3DROB 5IK3B 4NM8L 2D2OA 2YJLA 4N2GA 2IBZY 4IQHA 1HH6B 1U36A 2JKLA 3DJ9A 3FRUA 1HL4A 5ICZB 1GMEA 1C5CH 4KJYB 1P53A 1G5GA 2ZXCA 3HKFA 4PJ8C 1IX2A 4HUNB 3B8SA 2YD5A 1NMAL 1YY8B 3D85A 3ZQXA 1HYSC 3GIZH 3BUYB 5JQ6H 2FVNA 4JM0A 2P24A 5IHUH 1A6UH 1WJ3A 3S3SA 1YYCA 4UMSA 3K91A 4ZMAT 2VXQA 4PGJA 3VSTA 3GT6A 3DURA 1BVZA 1TQBB 3S37X 4APQB 3V8CA 4CBPA 4JK0D 3IU3A 5DSCB 2V6HA 4AENB 2WWNA 1DYZA 1G5AA 1VADB 1LK2B 3HG1E 1Z0MA 3O41A 1KGYE 4QXGL 4JZNB 3RDTC 5L2KA 4Z1PA 5F1SA 3NEOA 3HAEB 3O3AB 4Y2NA 1A66A 1Z9SA 1R4XA 2YMXH 3NZHH 4A1RA 5INDA 1DBKH 4L5FH 2ESVA 2NY1C 3FQTB 5F7WC 4E5XG 5FGSA 3WHXB 5IMMA 1D5BA 4BKLB 1E27A 4P2OC 4RMTA 1E30A 2VLLB 3BP6A 1ZV9A 3H9SD 4YBHA 1I1AB 1U3YA 2J5LB 3VD4A 4UWQB 2QBWA 2NY4D 3HPJA 4NPKA 4P4RB 3ULAB 5IKCA 2FX8L 4Y7MA 1ZXQA 2QSCH 2R0ZH 4FULA 3ZPDA 1UJ3C 5ISZB 5C9JB 3APNA 5SWQA 3NZ8B 3HI1A 3H56A 1BQLL 5DK0A 1FO0A 5CBAB 1CS6A 1J8RA 3U1SH 4LLDA 1MPAH 1MQKL 5CIPB 2DLIA 4I3GA 3VJ6B 5IROC 2AXHA 1F1GA 3RTQB 1GOGA 2NDGA 3ECQA 3D09A 1SUJA 3QHZL 3W57A 1N4XH 2CDGA 5JORA 4WENB 1IKFL 1YHPA 3UTTB 5H2BB 2XLLA 4ZFQA 2H7WA 1MCSA 1OAUL 1VKXA 3HN8A 5D5MF 2P49B 5GS0H 2F61A 4P99A 4Z5RA 4MVBC 1C7TA 3G04B 3VNYA 4B0MB 2P8MB 4Y1AD 1EGJH 3QJFA 5CS7A 1QQDB 3FTWA 2OI9C 3PHOA 4G9FA 2V2WB 3OHXC 3TO4C 1MSPA 1F4YL 5B38A 1N59B 2H0JA 4WFED 4EOWH 4D9LL 2ZP0T 3KYMB 4ZZKA 1U8JB 2OL3A 4Z7WF 1F58H 2N7AA 4LRIA 2J1ZA 3ARYA 5DU7A 4CW1B 4U1HB 4JM4H 2A6JB 4JFFE 3WTSA 4Z7WE 2DQ6A 4JN2B 2HJFB 5TF1H 2X40A 3WE6B 1DZBA 2X41A 3MNZA 3P4MA 3T8VA 4OFDA 5C08E 1ZSDB 5D4HA 1R3IH 2ALWA 3EXJA 1A3ZA 1KOAA 1Z9PA 3B7UX 2ZSVB 3MNWA 3SE9H 4OLXH 3FAXA 3HAEH 4DN3L 1I8KA 5EEVA 1LNUB 1QHOA 2AJVH 3PWPB 4KZ0A 2OZ4L 3VXPB 4Z7VF 1ZA3A 2CR3A 3SGEH 4XZ4A 4XGZB 4WTZG 3TYFA 4F7EA 5MHSD 4AI7A 1JRHH 4I0CC 2Y3NA 4MFHA 2ZP9A 1OPGH 1GS8A 2FBJH 3V7AE 2YEZB 3B7RL 1SY6H 3FB6B 5HHOA 4MJIB 5AZEH 1OF0A 3ESVF 3OL2A 2BS71 1PDKA 4GI6A 2AQSA 4IDJH 3EYUH 1JUFB 1B90A 1MWOA 6FABL 1DJHA 3QQNA 4XPHH 1OT2A 15C8H 1BZEA 3ECUA 5E99L 3ZDYF 3II2A 3SBWA 4PW3A 1JPGB 2K7PA 4QHKI 1BG9A 1KYOK 3K3QA 5CIPH 5D1XE 4H5SB 1U8LB 5E6IA 5ANME 1A2YA 5EH1A 3LKPA 5AYQA 4FNLL 1TZIA 4PWJA 4K3HA 4MQ7A 1R6VA 2PKDA 4L8DB 3MKGA 5HHMB 2UX7A 3VFOB 1R5IA 4PJHB 4IDLA 3RQ3A 1B2YA 3ZTJG 2BNRA 2D7OA 4CA4A 1UC6A 3LX9A 2CA4A 4AZ8A 3QIWC 3Q1EA 1AD9A 2BIMA 1EHNA 3G5YA 3KLSA 1GAFH 2FLRT 5H37G 4LPYA 1KB3A 4EPSA 2NQDA 1E5ZA 4NGHH 3KYOA 4G6FB 2HTLD 3UPAA 4K94C 4TMPA 2VN3A 5JA9A 1O75A 2DM7A 1OTUC 3C5ZC 3GRWA 4YZFF 3QG7H 4PRPE 4UQAA 4BZ1H 3A6CL 3G6AA 2DTMH 3FU0A 4AG4H 1OP4A 5CSZA 2IAMB 4L8CB 4TVPH 2PXYD 2UXGA 1O7SA 2J12B 3COOA 3UGUA 4KGJA 4ODHH 3VW3L 3IDNA 3STLA 1N70A 3QNXA 3O9WA 5GS2D 3KLHD 1ULVA 5IFAH 4LHUB 3MRHA 2BOLA 3H4HA 4GS7C 1HJCA 1A0QH 2EICA 1J87A 3PXJA 1RP9A 4MD5B 3RVXC 1RZQA 1AJ7L 4OAWB 2Z4QB 3GMOA 2EYSB 2VDRB 5B1BB 4GJTB 1X9LA 2O5XL 3ILPB 4FN0A 1MW3A 2C7FA 3DO7B 3CDGA 4NYLA 4MA3A 5JTWA 2XXFA 4TQ8A 2X3AA 2EEAA 3CFBB 4HGWB 3G5VB 2FGWH 4H4NA 4NZUL 2HG5A 1CVSC 1WH0A 3HNVH 4FABL 1CLZL 3EDFA 1LWHA 5C3IA 4G82A 5HDBE 2XN0A 2YPLA 5HY9A 4W68A 4KZEH 2IADB 4F15B 5IF0A 2X0VA 5JPNA 2FB4H 2VO5A 4J12A 3VM5A 1A25A 2CLRA 1J5DA 3GEWB 3U4KA 3U4EA 5I73C 1MW1A 2R83A 4N5ED 5CEZH 2K3TA 2KZKA 3KCWA 3BI9X 2B59B 2WQXA 5IQOA 3GJFA 3TBWB 3QNZA 4F24A 1FG9C 1MN4A 3QORD 5FUZH 1INQB 3VFSB 2GK0B 2CQVA 4P5RA 5F89A 4I48B 3WSQL 4S10A 3V5DA 4Q9QH 5F2FA 1L3WA 3EJCA 3HLAB 3S2AA 2CK0H 4JPQA 4XBPB 1CICA 2E7DA 2QHLA 3R0NA 3TT1L 5LVEA 1JBJA 1KN4L 2JTDA 4AITA 1NGYA 2WIMA 3CSYB 1IAOB 2B2XH 4M61B 1D2OA 3MHZA 1DJYA 4LSTH 4XPTL 4Y16B 3V9CA 3TEZA 3OKKB 2J44A 1TKWB 1DBJL 3BQUD 3UTSB 1OAXH 1KGWA 5AOIA 2P4AB 5EU4A 4B6ZA 3L4TA 3W3BA 3LV3A 5TK4A 1A64A 1AAJA 2UVFA 3X13B 1TDQA 3NPSC 3T08A 4OF6A 2DQJH 3VFVA 3UC0L 3C5JB 5E1HB 5J7CC 4JZJB 1F3DJ 1PCSA 5AWNH 3T0EB 4B53A 1LEGB 3A24A 4HX1B 3TIEB 1YPZB 3VWKA 4BH8B 1HWGB 3KD4A 5JA8B 1JPST 4FEIA 2WKOA 3F7VA 4ALAC 1FFNA 1DVTA 5HDQH 4IRZA 4YXKL 3IE4A 4CMHC 5BZWA 4IBWA 2VDRH 2JNZA 3PFUA 1MCWM 1AGEB 1IGIH 3AY4C 1J1OL 4FNUA 1U8HA 4OQ1A 3W11D 1RK1B 5JDSB 3MQIA 2H3XC 5DFTA 3V4VL 2ARJA 3O8XA 4X5RA 2IALB 1C5BL 2NY6B 3UTPD 3LEYH 4QEGA 3S8FB 3WJJA 4M6AA 4V11A 5EZPA 1NCCH 4LK4A 3ZKXC 4FQJH 3BFOA 4K7FA 1PSKH 3FQ4A 4WWKD 3VGGA 2QT6A 1JOIA 2NR6C 2MHAB 2UXFA 5PCYA 2WZ0A 4ONHA 2YPVA 3BAYA 3K5SA 4L4TB 2QGEA 4IIQB 3NIGE 3HHMA 4PGDA 1AYOA 3OXSB 4MLIA 4BM7A 4HS6A 5FK9B 1KELL 5E0QA 5DMYA 1BZDA 2R23A 1EO8L 3QK0A 4OBSA 1XH2A 2WJ7A 4XN1A 4BA0A 2E76C 2BNQB 3ARBC 2HFTA 1LEIB 1LD9A 1P9MA 4JGMA 3QUXC 3VFMA 1BBDH 3GMQA 5D7LD 4AJWA 2QZQA 1JNHA 2AJZA 1JZ4A 5CKGA 2OP4L 2D7TL 5GXBB 2FYYB 4JFEB 4TF4A 4B9JA 1KJ2B 1QYGH 1QA9B 2Q3AA 2P9RA 1NLDL 4LASH 2DEWX 4MKTA 2D7MA 3SDXF 2OMYA 4L9DA 5ENWA 1IU1A 5F44A 3HCVA 1VDGA 3NEXA 4JY4B 1FBIL 4MMYA 2DYRB 3O6FA 1P1VA 2EYRA 2GBTA 1TNMA 5EC1A 3ZDXE 1OAKH 2IPUG 5IIEB 3ZKSD 3HAEG 7CGTA 1DJWA 3M7FB 1MZZA 1Y6MR 3H7BB 2KERA 3FRPB 1SBSL 4FNRA 4P5TD 5T1KA 5JW5B 3P4OA 1AIFB 5D9SA 4UM8B 1HI6B 4Y1TA 5CKAA 4XXWC 4QOKE 2X4RA 3T3PB 3EKCA 3AXLA 1IGCL 4WJ5A 5GZNC 1NCTA 3EJYC 3L5JA 5IM7B 4P57A 2PTUA 4UYPA 4O51B 1YEDB 4F9PC 2HFEA 1CLYL 3IETA 3DX1A 4HQQH 4LSSH 4ENZA 4TL5A 1OWRM 5D1ZC 5E94B 2NT1A 1Q1JH 2Y6SD 3L5HA 3FU5A 3DO4A 3DUUB 5B1JC 1RERA 2KZ1B 4PV8B 4FQ1H 4BFEA 1JF1A 4PJCA 2IGFH 2YHGA 4LLVB 2JF1A 3SJVB 1SF5A 4JPVH 2Q8AH 3LRSA 1U8PB 3CHXA 3KMDA 3P9MA 5BJTB 3VE0B 4NQVA 1SQMA 1VGEH 4KRMB 2DLFH 4JRXA 3TN0B 3TO2B 2B15A 5K1VA 2GIYA 4GRLA 3CLFH 4MZIA 5C0DA 3MJ7B 3TFBA 2SEBB 4F9LA 1WIUA 5KZCD 4MB1A 1WBXB 4JGNA 1KJ3H 1GZHA 1UCTA 5J4MA 3IJ9A 3QWRA 3MGAA 2N7SA 1MY7A 1Z5LA 3B2PA 3I9PA 4HKZA 4BKTC 1OO2A 3RWJA 2ZE0A 3C60D 3FJTA 3P4NB 4W9CC 5LHDA 2WO4A 1NC4D 1QSEA 3PWVB 2J7LA 1BD2A 4V33A 1FVEB 4ZW3A 2A77L 1J1XH 1O7VA 3GKZA 5E1AB 4QRFA 3L3DA 1G4RA 1KCVL 1GY1A 1T1ZA 4RFNC 4JO1H 1UYWL 4N2AA 1P7QD 1A3RL 2LFEA 3BKMH 3C08H 4I5BA 4DP8X 4Q97A 4JPSA 2L4OA 3N06B 4EO5A 1E28A 2NY3D 2EINB 3OJDA 4XPAL 4RIRB 1NBVH 5GISH 2BINA 2K7QA 3PAUA 1G4MA 4FFZH 1QBLH 4RGMB 1UKTA 1AGFB 3MUGB 3QQDA 4PP1D 4K8RL 5HJ3B 3TBYA 1DFBH 3PWUB 4N0YL 1SHXA 2QQLL 2BCMA 4MNGB 3QEQB 3AZUA 2V7NB 2VT0A 1XEUA 4X9IA 4GKZB 5F7AA 4AIEA 5E8DL 2Z1PA 2XN9A 4LU5L 2V2XA 1MLCA 3OGCB 4JZOA 3U30C 2YXWA 4Q4IA 1AZBA 3SDAA 3EYOA 1KB5L 3ZK0A 3FK3A 1G7MB 1E2VA 1BJ8A 3WIFA 5IVNA 1CF1A 2RB8A 3LKRB 2K9UA 3QO1B 3UP1A 4ZSOA 5JIQA 2A4EA 3U4BL 2AK4B 3QUZA 1AR2A 1RMFH 4GXUN 4ZQTA 4P9ML 3VXUE 3KXFB 5KAQG 1AGBB 3DJTA 3O6LL 4WO4C 4ELMB 1IE4A 1ND0B 2XYBA 2JCWA 4L3AA 5E56A 5A7EA 1J5OH 4ZXBB 1PY0A 3WJMA 2KUTA 5D2LA 2C4FT 4F27A 4Z76B 1HEZA 1H15B 5T3XH 4DGVH 3KGTA 2XIBA 3MV9E 1U8IB 4XP6L 2EDXA 4QRRD 4RBPK 3CDZB 5C0IA 5FDWA 4DP6X 3UZEA 1NPNA 1X4YA 4N6QA 1P2CB 1OXYA 1FNSH 2IDTA 3IMWA 4XPBL 5BUPA 4AT6A 1CI5A 4CGTA 1CXLA 5FAAA 5J1SC 1RZGA 4NWUL 2UV3A 2WBJA 3H9HB 3VFNA 4OZGB 5FKPA 1N7MH 2XV0A 4EI6B 3CDCA 4HLJA 2WXOA 5HVHC 3TJPA 4M8UA 2YD2A 1T5XB 5J6HB 3GFUA 2I60H 3DYMA 4LHUG 2X70B 2R0LH 1Q9KB 4PTUA 3TJEL 4OQTH 1SJHB 3QEHA 5IVXA 3HE6C 3I9GL 1PFOA 2W0KA 1UATA 1IQWL 2WTRB 1GJIA 1LVEA 3OXRB 3OPZL 3QDAA 1FGNH 2EE3A 5AW0B 3O2VL 8FABA 4Q89A 3L1GA 3W1ZA 3JZ7A 2VMDA 3CC5B 2C9VA 1NCNA 4X0KB 3K6NA 3MFFB 4R2GB 4B9PA 4OD3H 3GSNL 5EZOH 3QG6B 2WUBL 4IGBC 3X3GL 2J8UB 2VLRD 4P46C 1A8ZA 1ZDSA 5B8CB 5DD6A 4KJPD 2XTJB 4XB7A 5D7JC 5KAQF 2XIDA 4YL9A 1JFHA 5CJ5A 5C0CB 3HMXL 1LO0H 1QEWA 2Z31B 3EO9H 5F6HJ 3U1PA 1QMUA 1I7UB 3CFUA 2PUQT 1KBVA 5DI8B 5EBGA 4F3FB 2B7DT 5DS8A 4U4IA 2IEPA 3JTSA 2NY0B 2D03H 3D0LA 3KPQB 1SMOA 1AO7D 4I77H 4WI4A 3H3PH 5K9KB 4M3JA 3GZPA 1NBZA 2BVPA 3LRLA 2X0WA 1AKPA 1T6BX 3FN3A 3AXIA 4S1DD 4G8GE 3BDXA 1QZNA 4PB9H 3FZUC 1L9TA 1DVFC 5F0PB 4J3OC 2EEDA 2XRAL 3RA7H 4NHCL 4XHJC 5EPMA 4D0CB 3CFCL 4FI7A 4WFHD 3IYLW 3JBG7 1G87A 4WHDA 5IB1B 5EIIA 1T20B 3D87B 1R3LB 4PGEA 3QRBA 1LO5A 1ZHLB 2OMWB 1CK0H 2ICEC 2EEXA 5ERWA 2BSTB 1BCIA 3V52L 1J1PL 2ZYHA 3DHJA 4Z7QB 4X8XA 2YEQA 4XMPL 1PIFA 4DQAA 1PZBA 1GRWA 1WWWX 2HZHA 4X5XA 5I8EB 2DMGA 5KYXB 3MRQA 2LTQC 4AQEA 3M45A 1DO5A 4YBQD 4FYRA 4PBDA 5CBEB 4CVZA 4O02A 1X6NA 5AW3B 1XGYH 4X9GA 4N9OB 3KPLA 4X7SL 3O45A 2LOEA 4NS0A 2IBBA 3MCLL 3T6WA 2DV6A 2H6OA 1V5JA 3WIIL 1WTLA 4WI0A 4JAMA 5CEYB 1WCQA 1HAWA 4LLYB 2B3RA 4PJ5A 4DN4H 2QDVA 4NNYA 4E36A 2Y4SA 3QDJD 5GS1B 4W9FC 1RUKL 3K6OA 4L8SC 1ETZA 2G2RB 3QQ9C 4JRWA 3Q6GL 3O4LA 5I1LB 2P5EA 2VDMB 5AB1A 4LPTA 3I3BA 4WUUA 5SV4A 1T7WA 1OK8A 5GIRB 1K72A 3CN0A 3PDGA 4NO2A 5F1OB 3T2NL 4A7GA 4OR1A 2QKIB 3OSVA 2NXZC 4FMFA 3LKNB 5F3FA 1GMIA 3RWCB 3PQYE 3RL2A 4PGCB 2BS8A 4ZTEA 3LIZA 1L9NA 2HLEB 1RJLB 4ZUUA 1BVNT 3QCTL 1CDBA 4FC3E 1AQDB 2E7LC 3BH8A 4ANKA 5DQDH 1M3IA 2NUTB 3OKYA 4WEEA 2AQTA 2F74B 3LNFA 4LCWA 4UI2A 1W72A 2NXYB 3L3HB 5DRWB 3MGOB 4ZMWA 1RUML 5BRZA 1W15A 3PL6D 1MJUH 5D6DC 4G6AC 1G9NC 4F8OA 2H2PC 4YAQB 1A3LL 3GMPB 3QI9C 2HJKB 4Y4KA 2KL6A 4YLBA 4MJ5B 4HXAH 5D8JL 2MQ3A 4F2FA 4P5KB 3HPLA 2FAUA 3P73B 5J6SA 3RKDD 2Y5TB 2E3VA 2APWA 1VA9A 2X6VA 1YPZF 1T1YB 5GJTL 4QRSB 1DR9A 5FIEA 5FKAB 3G9AB 1Z2KA 3FRPG 3PDOA 3TZVD 4JQIH 5DRNA 2YAPA 5HTSA 4L0PB 5IWLA 2WLKA 3DV6B 3VRLE 5GGVL 3BPOB 4XR8C 4ZMPA 5CCKL 4F37K 2AEPH 1YCSA 5KBNC 3FCUB 4EN3D 4RSYA 3HE7B 3V4UH 3GXIA 4LRNH 2XZZA 2A9AA 2CKBB 5LBSA 5L0QC 2X2UA 2Y3AA 1ZLVK 4YXLH 1JPFA 2WXLA 1JMZA 3MOBL 4G8IA 4UT7H 1R19A 3C5XA 2APXA 4KI5C 1LWJA 4JM2C 1LK3H 2GY7B 4KKAC 4K5MA 4OZFB 4PV1C 1CGSH 3LYRA 4R26H 4XNZC 5LWYH 4KTEH 2DQDL 3QR2A 3ZQ9A 3CVHB 2F5AL 4JRYE 12E8H 1L6PA 4JG5A 3I6GB 3QGVA 4YL4A 1NOAA 3WKPA 2WWOA 3MLZH 2X4UA 5D1QE 1H5BB 3UFIA 5E1IA 1F1DA 2VDMH 1FYHB 4YHNB 3QHFL 2V3FA 2BOBA 1DLHB 1JJUA 1QTYT 5F1IA 4ZTOL 2QMJA 3V4PA 1CURA 5HYJE 4AMXA 1OY3B 2XFXA 1A7BA 3CCHB 1K4CB 3HRPA 1SPDA 4MJHA 1GHFL 3H55A 4PWHA 4XC1L 5CGYD 3DUSA 3OB0K 4MJ2A 5HYIA 5DMIL 1E9PA 3G6DH 5KBKA 3IDIB 4HCIA 4UV4H 2Z3FA 2N59A 1UOLA 3PP3K 4LP4A 1OE2A 4XNMB 5LGJA 1OHZA 4PJ8B 2YAQA 3ZT6A 5DD1H 1FHGA 1P7HL 4NPJA 2EVIA 1A7PH 1MRCL 5HHPB 2IH9A 5FYLE 3FT4B 32C2B 1KEGL 4HULB 3CN4A 3EJZD 1TETL 2PWHA 3OKNA 4R0LA 4XVTL 3SKJH 2P8PB 1MWAB 4GBXD 2WQVA 3T3PF 1DQML 1H8LA 4J1UB 2AAAA 4ENEC 2QQKL 1QX1A 3OLGA 3QUGA 4WDIA 2CR6A 1NCHA 3SOBH 1BEXA 3H2PA 4R5VA 4P23A 1T4KA 3RVVD 4GG6F 3D18A 5JHDB 2G60H 3VI3F 1BHGA 1PIGA 1NDTA 4EQ2A 2R59A 2LVEA 4P4KA 2EH8L 3MBWB 3RDTB 1P6WA 3MCKB 5DZLA 3MV7B 5KSAC 1E5YA 4GG8A 2IMNA 1DUZA 4JBSA 3ULVH 4GG6E 1BVKB 2QPDB 2AGJL 1B4TA 3F7KA 4ICXA 4WJKB 3VI3E 4TSAL 1ZT4B 5A2JH 3RX8A 4E5XA 1T7ZA 4LF3B 3WS3A 1UD5A 2NY1B 3KYAA 2WQSA 2XY2A 1Y1UA 4FFWC 4FOMA 1LILA 1XF1A 4P2OB 1KXVA 2CSPA 2CKBH 1A7RL 3WIHH 2DM3A 5EU6D 4F7CB 4U6HB 2F5BH 3K6DA 5I6OA 1UQSA 3L45A 4OCRL 2CU9A 4GINA 2CR0A 1F8TH 3T8XB 1UJ3B 4NNXA 3GNMH 4OZFH 4C58B 5IB2B 4G6MH 1CGWA 2PF6A 4Z3JA 2XDHA 3CVHH 2W60B 3J2PA 4FI8A 5CXPA 3IPBA 1XMEB 5T3XE 4XAKD 5C2BH 3SE3A 2FEDC 3KL0A 2A83B 4HLZH 1R3HA 1PX3A 2Q9OA 1V3KA 1MCBA 4OM0L 5T3ZH 2F53B 2NSMA 1WWCA 1XF5B 1ZD6A 1SXNA 3PHQB 1INEL 1S7UA 1I1YB 4N3TA 1QFUH 4PWKA 3EJJX 1CN4A 1FZMB 1M2OA 4JFDD 5DJXA 2ED8A 3DSNB 4P2QD 4YHIB 2BX5A 2OK0L 2OI9B 1BA9A 4P2RD 3FT3B 5D4IA 3TO4B 3OHXB 3QA3B 1OP5H 4JG0L 5I1GH 3B9KA 4G83A 4PP2A 1MFBL 4GP8B 1XCQB 3D9AL 2FWOB 4YSDA 5AKVA 3DX6B 3ESMA 1F6AA 4Y5VA 3KPSE 1NLBL 1E8YA 1IUZA 5DJYA 3VGDA 4N90E 4HEPA 1O6TA 1EWHA 5A2KH 3L1OH 4BFKA 3T4YA 2YA2A 5J0BA 4QUOA 3FUDA 4LE8A 4GW4B 3BWUC 5AW2B 5C0FB 1DBML 3TCLA 2X6UA 2EIBA 2YOCA 3NCEB 4KKBC 3L8QA 1JIBA 3FTGA 1CYGA 1E3FA 4FFYH 3ARED 4OTXL 5K9OB 3PGFH 4ANWA 1TFHA 1UEYA 3DI2B 3LQZB 1G6RB 1B4LA 1D9KA 2MCPH 3BAIA 3KNBB 4LLMB 2P8LB 4PV9A 2FIKB 4Z7UB 3WFBL 1OE1A 4ELMF 4F7PA 1SN2A 1WITA 3VFTB 4Y2DC 5C7XH 1DHKA 1Y0LA 1N0XL 3QQ4A 1X7QA 4HIJB 3LZNA 4JHUA 1HHHB 4YVNA 3QEUA 1P7BA 3PRZA 4K23H 1JZ6A 2FJHB 2BHFA 3OQRA 1BVOA 2ITFA 1KIPB 3NRQA 3ZQWA 4XNAA 1E4XI 1PQZA 2D3LA 1R24A 4MWFB 1JRHI 5B21A 5B22A 4FKHA 4QHMB 1AR1D 4M7JL 5JQ6L 4X4YB 1CGXA 3F6IA 5CWSA 1A6UL 1BQHB 3DJSA 5IHUL 4NT6A 4Y9BA 3MRLB 2A9DA 3OKMA 3ZO0A 3HNSH 5C6TH 4YSPA 1I53A 1BVLA 3REWA 3CE1A 3UBXB 1WGVA 3Q5OA 3RAJH 1JZEA 1N2RB 2PYFB 4YMPA 2NY5L 5LO7A 4OZGF 5CF3A 1FCCA 3GBNL 5AYUH 2JJTC 3BVWA 5CU5A 1DN0A 5H37A 3QIWB 4ZNEE 1U0QA 4P2AA 3VTMA 2BFGA 2BSRA 3F8UB 4LVEA 1TQSA 3V79C 3NZHL 3OR7B 3W39B 3L4YA 1WVZA 1DBKL 4QHNA 5D7SH 43CAB 3S2CA 3C5ZB 2EE2A 4MNQB 5J89A 4CVWA 4MKMA 4PJ9A 5HPOA 5EB9A 5ELIA 3QJHB 2E6PA 1U8OA 2G5BA 2QV4A 2WO3B 2X2IA 4TNVF 1O5DT 3BAEH 2Z64C 4LNRB 4K5NA 1JWUA 3HMWL 1IFRA 2Y23A 2QSCL 2R0ZL 4ABQA 4FKEA 2HVJB 1TYRA 4OCMC 4HCRH 3H9SE 3M86A 5HYEA 4DOHE 3E2HC 1HCFX 4ZMVA 3A22A 3QWOB 4GS7B 4ZFZB 3RILA 3U1SL 4ELKA 4HOMA 3L95A 1DEEA 1B0RB 3JSSA 4LLQB 3BPNC 4Y4FD 4EIZC 1KY6A 4IU2B 1SHMA 2LR4A 4WAFA 3DLQR 3FB8A 3ZRFC 2I24N 2H3KA 1NUDA 2VDNB 2VRAA 2C1PA 2VSKB 3BP5B 3SPVA 3VDAA 2DJMA 1Q72H 3VCLB 1MFNA 4LL9A 1VJSA 2XWTB 5GS0L 2FIRT 2EDKA 5I74C 3EFOA 1I9JL 4PHZA 3VQ1C 2WNXA 1MCEA 1EGJL 1MXGA 3Q01A 3NSCA 1NEZA 4N1EA 5FDYA 4KQ3H 4NXKA 2CLVA 1U8NB 3FO9A 3N0AA 1XHHA 1HQRA 4L1LA 4HK3J 2YQGA 3IJSA 2YXVA 4FXKA 4BSWB 2IQAA 4HKJA 2C9AA 5A3IC 2UVEA 5F97E 4Y1AE 2GJPA 3F5WB 1BZ7A 3NQIA 1CO1A 3QDMA 1PLAA 4X8GA 1Z5HA 4WFEE 3MKKA 4CL7A 5DO2C 2OMUB 3LH9A 2ZWZA 2NNXA 4M8QA 1PZ5B 4WTWA 4Z7QF 3REVB 2B1OA 5EFIA 3VXRA 5ITBL 1WAAA 4PCYA 1NCDH 4WW1B 5F9OH 4F2EA 1D5ZA 3FU6A 1MXDA 2XC8A 5I16B 3SYAA 1NAMB 4NFDA 4X4KA 4UBDD 5F1NA 3S36L 1UB5A 4OLXL 3EFFA 3QWQB 1DUYB 2AJVL 3JWNC 2GTQA 4N2BA 3VA6A 3KWWA 3OAZH 3W9DB 3IDGA 4S2SB 5F7HA 1UOVA 3PIQB 3AUWB 5DZAA 2M26A 4ZMZA 2PCXA 3TURA 2LU5A 5A2FA 2M2DA 5SWZA 3KL5A 1JRHL 3B9AA 4GAGH 4OZHE 3NPSB 3TH4T 4K5LA 5FM8A 4X6FB 1OPGL 1RZKL 2FBJL 3KPOA 4ABUA 5AZEL 4LNVA 4C47A 1E4WH 3LXCA 4RESB 2DI8A 4V1DD 4DO5A 2R1XB 2J4WH 4KK6D 1VZIA 3GSVB 15C8L 4OZFG 4WCYH 4XPHL 4ZQKB 5TDNB 4CADB 3L3IB 4F2ME 1KTLB 1JK9B 4GAJH 2ATKB 3CZFB 2E46A 1I3RA 3PNWA 4HIIA 4MDIA 4CMHB 5CN3A 2VN4A 2EAEA 1XO8A 3MRIB 1BSIA 2F9BT 2ZG2A 3BUDA 1MRDH 1SEBB 1FL6B 3FQNB 4LSPH 1C16A 3P77B 4JDZA 5C0AA 1ZGLB 2MPVA 3QIUD 3QUYA 3CFEA 4JLRA 4OD1H 1E2WA 2A5UA 1JZGA 1XCTB 5TD4A 1YEEH 5EBWA 1HFUA 3ZKXB 3D48R 5FO8B 1QSFA 2VXTL 4GSQA 2E7CA 5IJVB 5EOQH 3ZW3A 1GAFL 4LDOB 2X6CA 2G9HA 5E5LA 1OSZB 3NCCB 3JZYA 4BRJA 3IGAB 4PY8J 4Q7DA 1CDIA 3SPGA 2J57A 3LMJL 5EBLB 3IAGC 4NO0A 3ARUA 4NQCA 3V6OE 3QG7L 2VDPB 1TEFA 2N1TE 5DS1A 3TOPA 2X9XA 2Z4TA 5AAPA 2ADIB 1A7NL 3QFJE 5IBUB 4TVPL 2LHAA 3KH4A 1NTDA 1ID2A 4R8WH 4LVHC 3ULVF 4ODHL 2YAEA 2YKLH 3IFPB 3MRRB 5ICXB 3PPSA 5IFAL 3KYNB 1IZJA 2JQAA 3CVDA 1P4BH 2OM5A 4LO9A 5AOMA 2WXRA 1VADA 4S1QL 1MCHA 5E2JA 1MJ8H 1NAMH 1A4AA 4KUZH 1XIWA 3KS0H 3WXVH 1EEZA 1N9PA 1PEZA 2FJFB 4KKZA 3UEZA 4KK5D 4WI9A 2X4SB 4CSTA 3GBLA 4HSQA 1J8HA 3WHXA 4J4PD 4R90H 1IBGH 2FGWL 4A6YL 3VG9C 1E43A 1MFAH 3P54A 3GQFA 4HG4K 4Y5XB 2YBRA 2WXFA 3CHSA 4HSCX 3B7SA 4YZWA 1R17A 2UWEB 2FB4L 4KKCD 3WY3A 2BK8A 3ISRA 2HWZH 5D1ZB 5CBAA 1UH4A 2DQCH 2A73B 2C9UA 2X7LB 4WV1A 4X80H 4ALAH 5CP7A 2H6PA 3D69B 1IFHH 3UGXA 4MSWB 4FNQA 5E2TL 2M83A 1AS6A 1L0PA 2DIBA 2CK2A 5FUZL 1RSFA 2XN1A 4Z0XB 2WINB 2X9WA 4GQ9H 3PP4H 5TGBB 1JZHA 3ES6B 3MRKA 4FTVA 1OEZW 5BQ7B 3SY6A 1ODUA 3DETC 3TP4A 5DUMH 1GOFA 2Z91A 4RFOH 2CK0L 3L5IA 8PAZA 4RAUA 4FZEL 3T1FA 2EVGA 2B2XL 3NJIA 3WKYA 3S4SB 1KIUA 5EOTA 1R3JB 4NJAH 3WJLA 2WKGA 2VYRE 4A7QA 5E4IA 5GGRA 5IBLC 4PW9A 5J9PA 3GI9H 1P6FA 1G7PB 2VDPH 1KN2L 1NEUA 4X6DB 1V7NH 3FFCD 4J5VA 2Q7NA 3G5ZA 1PTZA 4ODVH 4CW1A 2DQJL 1TCRA 3FHEA 4RISH 1NCWL 5FV1L 3U2IA 3ZMNA 2XKNB 4OF8A 5AWNL 1ZJBA 2HJFA 2VDLB 4RMVA 1YEJL 4HH8A 2LVCA 3MDJA 3UC2A 3RGVA 2V3DA 1ZSDA 3ZDWA 5HYSG 1GH7A 2NX5B 3N3EA 1I1FB 4JRFA 4LKXB 2E7MA 1MY5A 2CG9X 1IAKB 1JGEA 4KK8C 2R1YB 2ZSVA 3WNLA 1IGIL 5A7BA 1KPVB 4M1GH 4Y19A 4OT1H 1LNUA 1NPJA 3LD8C 1QI4A 3LB6D 4LRIC 4PCSA 3AU1B 5DT1H 3K81A 1OGSA 2GJ6B 5B3JF 2CO1A 4DKDC 4M62H 4Z3GA 1FL5A 4FQJL 1LO3H 2AJXH 1N3NB 4MGXA 3ZO9A 5B3JE 1AS8A 4NOFA 1A1NA 3UTPE 1PCXA 2CE6A 1OQXA 2BRRH 5BMFH 3U30B 3NJGA 3AM8C 4KRPD 2QFPA 4FXLA 4FMKA 4FQLH 3ECBB 1HSBA 5HDOA 1BQKA 4LCUA 3RL1A 4NRYA 4M43L 4YHOH 3PXLA 1BQHG 3QYCA 1SFHA 3P1VA 4LMQE 2CUIA 4N87A 5C09A 2DQUH 1OAYH 2KMWA 3L4CA 4WO4B 4DP2X 4PRAB 1CMOA 2A1WH 3VFOA 1QYGL 3WLWC 2OCJA 4PJHA 5FUOL 4KTGA 2O5ZH 3UBXG 4AYDC 1ZGLP 2C9PA 4HV8A 1MI5B 5D7LE 1JZ7A 1G0YR 1XQ4A 2NY2C 2PO6D 2F8OA 2JXMB 3G08B 1KXTB 1U3HB 3SBWC 2JFCA 2VLJB 4X6EA 5CGBA 5LQBH 5I71C 5E6IC 2DYPB 4QO1B 1X4XA 5DHEA 5F9AC 3PV6B 1J0HA 1TVBB 4R96B 3CFJA 3ISYA 4H8HA 1VFOA 1CFQB 4NZRH 3IJ7A 4HIEA 1X5HA 1JK8A 2IXQB 5I1CH 3UJJH 5BCAA 2V3EA 2APSA 3VXMB 1JNLH 3F01A 1TVDA 3QPXH 4A04A 3LS4L 3CTTA 2XBZA 4HPOH 4NZDA 4YQXH 2AJ3A 5HVHB 2VDLH 1FIGH 1BF2A 1WSST 4LSSL 3SPIA 2X4NA 4LHUA 5CD5C 1Q1JL 3JT2A 1G1OA 4MD5A 3RWGA 2MWCA 4Z7UF 3MRPA 4OAWA 3V0EA 1MW0A 3KH3A 4N8UA 4FQ1L 1EAQA 3HE6B 4NPYA 2XZAL 2CPUA 2IGFL 3DO7A 1ZS8A 3P0VH 4OCXH 1ZAGA 4F8NA 2QHRL 1YQVH 4S1SH 1OF2A 1K3IA 1PKQB 3IGFA 4PMEA 5ACMA 4BFJA 4EUPB 4N0UA 3O9WC 4XWGH 1NIEA 4XMKH 2DLFL 1U9KA 2VAAA 4DPBX 2RMNA 3FQXB 4IGBB 4OV5A 1DQKA 3D39A 1EEQA 3NCJH 4HMCA 4P46B 3WI9A 3MLYL 5EEWA 1H3UA 5DYOB 3EOBA 5D7JB 1KJ3L 5JXED 3F7YB 3JV0A 2IADA 3E38A 1VENA 1EANA 1TJIH 1OGPA 3F00A 1JZ3A 1GYVA 1BVNP 2OXHB 4E41A 3IS1X 5J3HD 1J1XL 3TF7C 3MRJB 5E00B 1INQA 3SSGA 3PWJA 1S8DA 3LNHA 4U6XB 4GKOA 3OG6B 4I48A 4I18A 1LL1A 3A4AA 4F33B 3WBDA 1HEJC 4ZFOL 1Y07A 4JO1L 2HCZX 4M48H 2JCCA 2JKTM 4YFDB 1T7VA 3HLAA 5JPNC 3BKML 5DF0A 3C08L 1DVFB 1YC8A 4OFPA 5FYLL 1FCGA 3I6KB 3MXVL 1GW0A 1J18A 3I6SA 4XCNB 3ZGIA 3FB5B 3U46B 3LS5L 4N2KA 2FWLB 4ES8A 5C07B 1DFBL 5TH2B 1HC1A 1OGAD 1UM4H 2Q3ZA 2ICEB 1X5MA 5AKTA 4KTYA 3D85D 4YDZA 5D2NE 3R7QA 2EDHA 3AVEA 4OIIH 4N8VG 3PWNB 1CICC 2WLNA 3C5SA 3QR0A 1JDAA 3T0EA 2EXWD 2N56A 4HX1A 3TBVB 2LGNA 1M9SA 2LTQB 3BZFA 4LSQL 2JB6B 4F80A 4UU9B 3QAZC 3V0VB 5HD8D 2NTSP 4PM1A 3X3FH 2CRZA 4DVBB 1FFOA 4YLCA 4UOZA 1YY9C 4KXBA 2X3BA 1RMFL 4U7KA 1NFDF 4DKEH 5JDSA 4OJEH 4XP5L 3D5OF 5KJ7E 4UOJA 4G71B 4DCQB 4AMKH 2XNAA 2IANA 3US9A 4AEHH 1NMBH 4C56B 5JHAA 2AV1B 3DX7A 4MXWH 4L8SB 1OZTG 5J13C 1NFDE 3DI3B 5F3BA 2VQTA 3VWKC 4LSVH 3NIFB 4OCYH 1PX4A 1U93B 5T3XL 4DGVL 1A6WL 5FHBH 1NUGA 1CE6A 2C26A 5E8PA 2NXZB 2EIKB 2J55A 3FT2B 2Q2LA 1RZIA 4JQXC 4N0FB 5FXCH 1TZHB 4AW4A 3OXSA 4UQIM 5E51A 3LN5B 4IMKA 2YQ3A 3O8XC 4QRRE 1JHLH 3DSFH 1AZNA 3BEVA 4PD4K 3F12B 4UDTB 3TBBA 4X6CB 2NLJA 4KO9A 3DGDA 4K7PL 4CUCA 3VFUA 3WJJC 5IBUG 4C57C 5I1IH 1QTSA 1WZKA 4LPCA 2NCEA 1N7ML 3EBAA 2J2ZB 4QKXB 2AQNA 4JFEA 3UACA 4HOZA 1TPXC 2W9EH 3B5TA 3FUIA 2I60L 3EH4B 3SDCD 1NC2B 1M7UA 1UM5L 4ISVB 4WSGA 4XH2A 5CHNA 3TBTB 5E08H 1FC1A 1Q9OA 4QY8A 1K9TA 3AROA 4G8FA 1J05A 3QI9B 4PJIB 3V5HB 4IJ3C 1P9MC 3P3YA 3WTUA 1QVOA 2R7EB 2Z8WC 2NQ3A 2X6BA 3LRGA 5B7MA 2AXFA 4HXBH 4UM8A 4G9FD 3RP1A 1V55B 5MEOB 3V5KA 4OD3L 4EEEA 4YN3A 3TIDA 2R29H 2B39A