1RZQA

Crystal structure of c-terminal despentapeptide nitrite reductase from achromobacter cycloclastes at ph5.0
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
328
structure length
328
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Achromobacter cycloclastes
publication title pH-profile crystal structure studies of C-terminal despentapeptide nitrite reductase from Achromobacter cycloclastes
pubmed doi rcsb
total genus 84
structure length 328
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rzqA02
2BZ7A 5B1KA 2XLLA 1KDIA 3N2JA 3AG3B 4AI7A 4F2FA 3JTBA 2GB2A 3NJLA 3EH5B 4GYBA 5I5JA 1F56A 1PAZA 1R1CA 4E9WA 2TSAA 3QJQB 1BXAA 1SNRA 4GY4A 2UXGA 3QQXA 4AZUA 3SQRA 3AG1B 3WKPA 4GXFA 4QKTA 4KNSA 1WA1X 2YAHA 4HAKA 1BQKA 2OJ1A 2XXFA 4BXVA 1FWXA 3H56A 2JFCA 1OCRB 1FA4A 1L9SA 1TEGA 2HZHA 1XB8A 3CG8A 1GYCA 1ADWA 4YSDA 4P5RA 1MZZA 1AR1B 3GYRA 2HX7A 1UATA 4DP8X 2WO2B 3ABKB 4FAAB 2B08A 1NINA 4KOCA 3UADA 1BEXA 1HAUA 1AAJA 2VM4A 4W9ZA 2CAKA 3DIVA 5B7MA 2FQDA 3N55A 2CALA 2W88A 3NSDA 3WI9A 4KO6A 4DP6X 3ASNB 3NJFA 1GW0A 2CBPA 1AOZA 2MTAA 2AZUA 1AG0A 3TU6A 1HAWA 1NIDA 3MX0B 2PCYA 4HCFA 2VW7A 1A8ZA 1MDAA 3NSFA 4YSUA 2WO3B 2FQEA 4W1TA 3CZUB 2EILB 3FT0A 3U25A 2VSMB 1NDTA 2ZOOA 4HCIA 2VM3A 3IN2A 3QJTB 4KNTA 5B7FA 2BW4A 4JHVA 2IDSA 4N4YB 2DYRB 1HFUA 4A66A 3ZDWA 1NIFA 2XYBA 4YSTA 1KV7A 2QDWA 1FFTB 2DYSB 1M56B 1DZ0A 2GC7C 1QHQA 2XV2A 4BK5C 5I6NA 2BP8B 1W6WA 3DTUB 4E9QA 2J57A 4F2EA 3PXLA 1RKRA 2BP0B 1E65A 1AIZA 2BP0A 1KBVA 2IDFA 2FQFA 3TA4D 4AKPA 1OE3A 4Q8BA 2ZONA 2PPAA 2VN3A 1CYWA 1JXDA 2VMJA 3GDCA 4NERA 2GSMB 4HHGA 3HB3B 9PCYA 1PCSA 3PAZA 1NPJA 2GIMA 4E9TA 3EF4A 1ZPUA 2GI0A 2I85A 1BAWA 1A65A 4KNUA 4L0PB 1GY1A 1W8EA 1PLCA 5AZUA 4DP4X 1RCYA 3X1EA 3X1GA 2XWZA 3FS9A 2EIJB 2PP7A 2XV3A 1A4BA 3NJJA 4PAZA 1A3ZA 4G72B 2IWKA 3T9WA 1EHKB 5ANHA 2PP8A 3FU8A 3UACA 1ET8A 4YVNA 3KW7A 3S3CB 3WKQA 4E9VA 2AZAA 3X1NA 1V55B 4HIPA 4YVUA 1IBYA 1KCWA 1V54B 1JOIA 4A2HA 4JHUA 1PZAA 2IDTA 2DWTA 2PPDA 1NWPA 5I6LA 1NIBA 1GSKA 1N70A 1SF3A 3X1FA 2BWIA 4GP4B 1JZIA 2FT7A 4DPCX 2A3TA 3MBWB 3NJGA 2YAFA 2J55A 2DWSA 1JZGA 2Y69B 1PNCA 2BW5A 2IDUA 5FC9A 3KW8A 1IBZA 3SBRA 2B3IA 2R7EA 5TK4A 5I6OA 5A7EA 1SDDB 2JKWA 4HHWA 4YSAA 1JZHA 1SHWA 4DPBX 1JERA 5B7EA 1A4AA 1CURA 1AS8A 3FSAA 1ASQA 1L9PA 2YAMA 4BXSV 5I5MA 2IDQA 2IWEA 4YSSA 4BDVA 5I6MA 4KOBA 4Q89A 1IUZA 2QDVA 5I28A 1EZLA 4AKQA 1PLBA 1WA0X 3WNJA 1E5YA 7PCYA 2I7SA 1DYZA 3PAUA 3QJVB 3TBCA 1PZBA 2PPEA 4E9XA 2PLTA 3CVBA 3FQ1A 4JKNA 1GR7A 3NP4A 2H5UA 1XB3A 2EINB 2HXAA 1OF0A 2PCFA 1ET5A 3JT2A 2GBAA 4DP2X 2PP9A 1NPNA 1YLBB 1AZBA 1SDDA 4G70B 1JVLA 2QT6A 1NTDA 5EHFA 1KCBA 3D12B 2PPCA 2FTAA 4A67A 4EF3A 5AFAA 2VW6A 3GXUB 3OM3B 1CC3A 3ZIYA 3X2QB 5I6KA 1ID2A 3ERXA 1AZNA 5I6PA 2TSBA 3AG2B 1RZQA 2X87A 2P80D 3FSZA 4NAJA 2XX0A 4ZK8A 4A2GA 1WA2X 2BZCA 3UAEA 1WAEA 3ABMB 2EIMB 2VSKB 3FPXA 2EIKB 3QPKA 2BWDA 2CUAA 2GHZA 1AZUA 1SFHA 2VW4A 4GP5B 1GS6X 4YSOA 2QPEB 2IH8A 1T5KA 2YQBA 1JZEA 1JZFA 1AZRA 2J56A 3NJIA 2DV6A 1BXVA 1NICA 5D4JA 3T6VA 4HZ1A 3OQRA 1L9TA 4A2FA 2E86A 1KBWA 1ZDSA 4E9SA 4RH4A 4G71B 1I53A 3NJNA 2AANA 4G7SB 4AX3A 4BDVB 6PAZA 3EH4B 3EH3B 1AG6A 3ASOB 2R7EB 2XU9A 3HEIB 3S3DB 1IKOP 3SBPA 1B3IA 2UX6A 3FQ2A 3FU7A 3S8GB 4WTQA 3PCYA 1NIAA 4QLWA 1ILUA 4BWWA 3PLYA 1PZCA 5AKRA 1NZRA 5D4HA 1ASPA 1MG2C 2YXWA 1BQ5A 2HLEB 4HCGA 1PMYA 3AZUA 3NJMA 4YSRA 1SHXA 3TBBA 6PCYA 4YSPA 2ZXWB 1X9RA 1ETJA 4G7RB 4PCYA 1AS7A 3QJSB 4GP8B 3NYKA 3FSWA 4DP1X 3OMAB 2XVBA 1GS8A 4E9YA 3ABLB 1ZIBA 4K9JA 3SBQA 1L9OA 2UX7A 4A68A 1IC0A 2WSDA 1AQ8A 5B1BB 3OMIB 4UANA 1OCOB 2OCCB 5PCYA 3T6ZA 1VLXA 2FNWA 2UXTA 2XV0A 2Q5BA 1JXGA 4HALA 1OE2A 5E9NA 3FU7B 1J9TA 4TXVB 1ASOA 2QPDB 3V9CA 3QJUB 4M4RB 3IN0A 3CDZA 3FQYA 4KO7A 1OOWA 2AFNA 3DKHA 3X1BA 3NP3A 2BHFA 1M57B 2Y1AA 4YL4A 3L45A 4E9RA 2DY2A 1E30A 2YARA 1TU2A 5B3SB 3WNIA 1NIEA 2HRHA 2IAAC 3OD3A 3NT0A 2FWLB 4KO5A 1A4CA 1WS7A 1J5DA 1MG3C 2UXVA 1KYAA 3FYEB 1PF3A 4X4KA 1RZPA 3PPSA 3FPYA 3C75A 3CVDA 1E5ZA 1L9RA 1OE1A 2HX8A 4WKXA 4ENZA 2HRGA 3PAVA 1XB6A 3UABA 4DP5X 4CSZA 3NSCA 4N8UA 2FJSA 4MFHA 3S8FB 1SF5A 4YSCA 3AG4B 3H4FA 1AZCA 2PPFA 2MRYA 4DP0X 2YAQA 3ZBMA 2AVFA 3FYIB 3WIAA 3RYMA 1OCZB 2JXMA 2XX1A 2YAPA 1L9QA 4BWTA 1URIA 3V9EA 5I26A 4YSEA 4AKOA 3NJHA 1BYOA 1M9WA 2W8CA 4P5SA 1AS6A 3T6WA 3FSVA 3UAAA 5TK2A 4BWUA 5PAZA 3TASA 4UAHA 2ZWNA 1MZYA 1ILSA 4KO9A 4G7QB 5F7BA 1SJMA 5D4IA 2LLNA 3UGEA 2GC4C 1JVOA 1V10A 5I5IA 2X88A 1ZIAA 1KDJA 1ZV2A 3FU9A 5IY5B 1OV8A 1QLEB 2YAOA 3ABGA 1J5CA 1BYPA 3EHBB 3QJRB 1TKWA 1W6LA 4YSQA 2XXGA 1XMEB 5B1JA 1PY0A 3H4HA 1KGYE 3BVDB 1AANA 4A2EA 8PAZA 1ZDQA 4A2DA 7PAZA 2HX9A 4CSPA 3IBOA 2I7OA 4F7KA 4NB7A 2J5WA 3IEAA 3BQVA 2H47C 3G5WA 2YXVA 5F7AA 2OV0A 1J9RA 2BP8A 1OCCB 2XUWA 1NWOA 1J9QA 2CCWA 2YAEA 3AW5A 4FA7B 2Q9OA 3AY2A 2FT6A 2IH9A 4UF7C 3IE9A 3T71A 4DP7X 1WS8A 1PLAA 1GS7A 1J9SA 1X9UA 3ZX1A 1GY2A 2FT8A 1CUOA 1SFDA 1BXUA 3NJKA 4DPAX 1N68A 1E67A 2UXFA 1JXFA 1TEFA 3S3BB 3OMNB 3T6XA 2NRDA 1BQRA 2CJ3A 2P80A 2FQGA 5B1JC 4DP9X 1QNIA 3NSYA 5B1AB 1AACA 1PNDA 3CDZB 2N0MA 1ET7A 2RACA 3CVCA 5LDUA 2BO0A 3WG7B 2H3XC 2IWFA 1CYXA 4M3HA 1JZJA
chains in the Genus database with same CATH superfamily
1HHKB 4UM8A 3DETD 4ANWA 5B1KA 4OCRH 2JI3A 1CQKA 1I4FA 2YA2A 1UJ3B 3IFOA 5DYOB 5AAMC 1EVTC 3BESR 1Z1WA 2J8OA 5D6CB 2QV2A 4H1LA 4JDVB 1BZ8A 3T0WA 1QSEA 1AQKH 4MQTB 1R1CA 4IRZL 2TSAA 4M1CD 2BIPA 3GIZH 5AUMA 2Q20A 5HJ3A 3MGAA 3OB0K 1OGAD 4HIQA 5B22A 3SQRA 4YNYB 4GXFA 1EAPB 1FO0H 1E5UI 3O3DA 3D33A 4P2OA 3WSQL 5B4MC 1KJVA 3GRGA 2YAHA 3IKCA 4LVEA 4P4KD 1E28A 1DL7L 1GYVA 1T6WA 4OB5H 3EFOA 5C0IB 1F00I 2XXFA 1RZGA 3PABB 3Q8EA 1J7VR 5DJDB 4XPGH 2CLRB 5DJXB 4KPHL 1ZVNA 3BP7A 2EXWC 4JAMA 2O5NA 3OGCA 2W9EH 1A7QL 1ADWA 2X7LB 2Y2YA 4P5RA 1HINH 1DCEA 5KSBE 5IVZB 3T8MA 4PGZA 4R26L 1RQ5A 3JV6B 4J28A 1FQ9C 5SV4A 3BOVA 1FN4B 3S34L 5C07D 4AUJA 5IMOB 1YMMB 1BIIA 1MJ7L 2C7UA 2OA9A 3P73A 5IJCC 2VM4A 5FIEA 1F1AA 2HFEB 1A6WL 4K07A 3VI3A 3IJHB 5SX4H 5BNXD 4B7IA 4FYQA 5DRNB 5AW3B 1UZ8B 4X8CA 4N86A 4L1BA 4LSDA 5E70A 3KPRE 3EYUL 5IEKA 3VG0L 3DDGA 1HEZA 1I3GH 4ODHL 3MOBH 3SDXF 4JHAH 4QTHA 1PDKA 2ADIA 2CU9A 4WAFA 3ZE2B 4KTEL 3E38A 5D7LA 3NSFA 5C0ND 3MR9A 5D7LB 3M45A 3N9GL 5I76B 1UM5L 3UBGA 3K71B 3AWFA 2CKBL 4F33B 1WPCA 2F54D 3AY4A 3E6FA 3QCUL 3GSRA 2VXSH 4KNTA 1JHLL 3A21A 2FH6A 1WFIA 3QNZA 4RGND 3G5YA 4H13C 2VXUL 1ACZA 4AZ8B 1VFAA 3A4EA 1VFAB 1M56B 1Q9OA 3LEXB 3BUYA 3W81A 4PLNC 4RFNB 3VFUB 3L16A 1J1PH 3EGDA 4O4YH 3UTOA 3NQKA 2F5BL 1MI5A 3WJLA 3FT4B 4KDTA 1AGFB 4QRPE 4EI6A 4NZFA 4WWKB 1QW9A 1J8HA 2WWMD 1RIUL 3CC5A 4XBEH 4YQXH 4EVNA 4QYOA 1DQQB 3VVVA 4NQXA 4PP2B 2Z0UA 1YYLH 1S8DA 4D8OA 2H32A 1JTOA 3D39E 1CYWA 3S37L 3HE7C 4UV4L 5EOCJ 4QO1B 2CIIB 1EO7A 2FBJH 2GJZA 5INDB 1KB3A 4MGXA 4XPFH 4GINA 3UMTA 1CR9H 2DKUA 2FECI 1MW1A 1MCBA 1EHNA 3D3VD 3MRQB 5C07A 3LRHA 5AENA 3O6LH 1N0XH 5F1SA 3TH2T 3VXMA 2I5YL 2EE6A 1MCQA 4HIHB 5F1OB 3GMMB 5DC4B 4LHQB 3ETBJ 4DZ8B 1PG7X 2FYYA 3IJSB 1UB6B 4Y19A 2YUWA 1QR1B 4O9HH 5HVFB 4LB8A 3NJJA 5ADOL 2ENJA 1YA5A 5E8DH 2AW2A 2WINA 3DK0A 4JAMB 3EIFA 5GRWA 2WINB 1BREA 3S3CB 2XQYG 2WPGA 2WIMA 1SOQA 2P5EB 5TH2B 4YE0A 2XN9A 4HIPA 2BSTA 2CRZA 3ROOA 2IBZY 5D1XC 3BSZH 4NPYB 1KCVL 2OMZA 1YMMA 4UNTA 5ICYA 1DQTA 4UQ3B 1NIBA 3U9PH 1P84K 5DEJA 1GSKA 2BM3A 3WYRA 4B0MB 2WYHA 4F8TA 3BN3B 4ABVA 2QELA 4YDLB 2XVLA 1RPKA 1ZLVK 1TJGL 1LO0H 5JLZB 4O2FB 2PWGA 3RHWF 5BXFA 2W81C 2IDUA 4WK0B 4HULB 4OJFL 3QUYB 4XWGL 1BG9A 3ZK0A 5TK4A 4IBVA 2NY5C 3GKZA 3MYJB 4HDIB 4JM0A 3QO1A 1SHWA 5T1DH 3D2UA 5I1DB 5MENA 5HI3D 4JNXA 3WS3B 4W9IC 1PW3A 3KAAA 1SHMA 2BSRB 2KT6A 2MMXA 3DHPA 4UQ2A 2N59A 4J1UA 5D71L 2ED8A 1HI6A 1MHHA 4I87A 3WNJA 1MHHB 2KLSA 1TJMA 3I50H 4W4OA 5IR1B 5IQOA 3NEXA 3QORA 1RK1A 4NI6A 3V0WH 1LO3H 4YDJB 2K45A 1KJMB 1KPUA 1BFSA 1CLYL 1A1MA 4A2GA 4AL8C 2IWGA 2ROXA 4JKNA 4NQXB 3KLAB 1P1ZB 4P3CL 2G2PA 3BLBA 4NNXB 4U6TA 4OD3L 3VXRD 4G8EA 2QTVA 1JPSL 2GBAA 4MA3A 4MJIE 5CIPA 2J4WH 3A4DA 5GGTA 1CFSA 2MNJB 3B5HA 3MCLL 3TF7C 1QFHA 1BOGB 4A6YA 5DEGB 1EGJL 1NTDA 5EHFA 1RU9H 1I82A 1EFXD 3RWGA 1VZGA 2LTQC 1CE6A 2GTZA 4QHUB 1AKJB 3CHRA 4G9FB 3LCYA 4FJ6A 1FIGL 3FB8A 4HJSA 5I1AB 4EKJA 1U36A 4YR6A 3MLVL 3BPOC 1A1NB 4QHLB 4BFRA 2VLRD 2UZIH 3N3EA 1PD0A 2ZT9C 1D5ZA 3LDBB 1RZ7H 3F05A 4BCXA 43CAB 4ZK8A 3RPIA 3D4ZA 1OSZB 4C47A 1EJ8A 3D2UD 2DQHH 3IJEA 2BSED 5D93C 3HC3H 3L9RB 4OFDA 3TP4A 3TBTB 2ESVD 1BM3H 1VZIA 3ZRCC 2JKXA 1AZRA 4EI0A 3WE6B 5D4JA 1AY1L 2NOYA 3NFNA 5D70H 1Z5YD 2H45A 2DTML 4HGWB 1Z3GL 5GS0H 5AVUB 4RH4A 4E9SA 5I5RA 3TO4B 3VFMB 3PGDA 1QPXA 4LPVA 4F8OA 4NQDD 3B2XA 4NKIH 1JGLH 2R1XB 2J25A 2XWCA 1A66A 2AJUH 3SGKA 1CFTA 3T2OA 4UDTB 1UKSA 4L2YA 4PJBF 3Q7JA 2ICEA 5LUMA 2H6PB 4P4KB 1RURL 5EU6B 4C56B 4DZBB 1RK0A 3EOAB 3RTQA 3BEWB 4U3XA 1RD6A 1A8JH 1OB1A 4TSCH 4DK5A 4IRZH 4TNVK 2QR0B 1SHXA 3BE1L 3PP4L 5DMKB 4P46A 1KUMA 2NY1C 4YIQB 5DTFA 1DVZA 1HI6B 5FLVA 2IBBA 1BDYA 1JI2A 3BSZA 3C5JB 3U2SA 3U2SB 2LHAA 1PTZA 2BIMA 3LZFL 1A3RH 4XCYB 4Z7QF 2P24A 3UG4A 3T6QC 2ICWI 4KJWC 3OJMB 4XBMA 2ZUVA 2O6DA 4DSYA 1P1ZA 3OMIB 1MCRA 4QOKA 5PCYA 3QDME 1T83A 1YN6B 2Q10A 2F5AL 4M00A 5GGSY 1INEH 4P5TD 3ARRA 2VC2L 4ZD3L 4U3CA 1SN2A 4Y5YA 1CICD 4O5LL 5IW1B 1C08B 3VI3B 3G04B 1AMYA 5CGTA 2WCGA 2BHFA 2DQUL 2QSCH 3WFDL 1K2DA 5AQ0A 3O81A 4Q6IC 1T03H 4F92B 3KGTA 5INCA 3MLYL 2YGVA 4F9PA 4KRPD 2W94A 2FB4L 4Q6IB 3JTSB 1E9QB 1SDAB 2IAAC 1IM3A 3GNML 4ZG1A 4P2RA 3NIFB 1BVKB 5F0MB 3U46A 1U8LB 4XI5C 3FUDA 1BFVL 3OPUA 5KBLA 3CJJA 1Q90A 2AQRA 2MKWA 3CFJB 1IBGH 3HE7A 4KX8A 4L0ZA 2XCMC 5E08L 1HL4A 2P8LB 3STLA 4L1TA 1YO4A 3NRFA 4S1DC 5C0BA 2BVOA 4J4PC 2XA8H 5HI5D 5F0LB 1B0IA 1MI5B 2ADFL 2XWRA 5HHOE 1AZCA 3FW6A 4P2QA 1PKQB 4L29B 3VFWB 3D3VB 1S7TA 4FFVC 4KHXL 4XC3H 5MP6H 4G59C 1PPIA 3LMJH 5GJSL 4LLUB 1S8DB 2YPLE 4JFXB 2Z8WC 3V2AR 2VR7A 3MV11 4KAQL 1M9WA 4FYTA 3FC8A 4MXQC 3MXWL 5F7DB 3T6WA 1BMWA 3B56A 4XCNB 4IYKA 3SOBH 3OL2A 1XCTB 1P5UC 4TQIA 4XGZB 4S0HA 4JCMA 4PG9A 3D39D 3CFCH 4N5UA 2JKSA 2WCPA 2JELH 1SYSA 5EOCL 5TE4L 3UYPB 5BRZB 4K8RH 2YK1L 2Y06H 2ZPKL 3ES6A 1DCLA 4HMCA 3F7VB 4PJ8D 4XVTH 2WUBH 4WWID 5AYQA 5GZOD 4U3HA 1JF5A 1OV8A 4PN6A 4GRWF 4GT7A 3ML9A 4V1DA 3RVVC 1JPGB 1XMEB 1NEPA 5I2IA 3RURA 3D6GA 5C0FB 5KJ4A 4K0OA 1LO2L 3UDWC 2VUYA 2DJ4A 3H2PA 1P5VA 1LO0L 1NCWL 4F15B 4MXWH 4PGBB 3TEWA 4JM2D 3L3KA 3TJEH 4BZ1A 1GJIA 1LXMA 5EUOB 3JYCA 5A6MA 1KPVB 2H4EA 3TO4C 1M1XB 4MJ6B 2FT6A 1AKJD 1JUFA 3HI5H 1G9ML 2VGLM 3FT3A 1UVQA 1TMCB 2NY4D 1AO7E 2RR3A 3GSVA 1GGCH 4PBVC 3MREB 4K9EH 5CR8A 1JXFA 4WY7L 4F1SA 3R19A 4X5QA 3RB5A 3KPMA 4OQTH 1Q9WA 2P80A 1U8IB 4AXWA 3DRTA 3FF8A 1J11A 4LKCA 4LRIA 5SX5H 1WC7A 1AI1L 4YDLC 1TTCA 3TH4T 4PLOB 4GLRI 3JWNG 3FDWA 1P7QB 2HT4D 2GT9A 4PJ8C 2C9UA 3SGDH 4R3SB 3O0RL 2NZIA 4HWEH 1FZOA 2WQWA 5T1KB 3KZ8A 2ZD0A 5CJBA 5D71H 5K9KB 2J73A 1EANA 1EEYA 2DIEA 2P8MA 1KF9B 4FG2A 4HPYL 1Y6KR 2Z8VC 5J9PB 3K2UL 3K80A 1WV7T 3NJLA 4FQXD 2JJVA 1LO3L 4ONFL 3GKWL 4GRWH 4YHIB 3QQXA 2BVTA 2JQZA 4HWBH 4Y0GA 2G9HA 3JBG7 4JM2C 2YGPA 3D18B 4X83A 5KVDH 2BZDA 1UGNA 1S9YB 3T77A 3BX7C 1SMAA 4OUUB 2DI7A 3QARA 4FRWA 4GKZA 3CGTA 4MKTA 1L7TL 4YK4C 1GJUA 5F7DA 2OP4L 3V0IA 5KSVA 3A6BL 3PWPB 2J4WL 3P9MB 1PY9A 1DJZA 1T2XA 4LBEB 4QRPA 5DR5L 4UTAL 3JUYA 4X99A 4N20A 4P59H 2QVFB 4I3SH 3VGFA 3GGWB 1AKJA 4LDEB 4WDIA 1TQTA 2J6EA 2ARJA 3B7SA 4CU7A 4F58L 4AEHH 2DJUA 3RWFB 4TSAL 2K1MA 1VACB 4OM0L 4KOCA 1ZJBA 3EGDB 5T8IA 1CU4L 2F61A 2A77H 1T1XB 2LAAA 3Q2CA 4AEIL 2FQDA 3QA3A 1RZ7L 2FX7L 4C4KT 1B4TA 5DVKA 3QI9B 1RY7B 2CKBA 4OFYD 1H3PL 2R0WH 4K3DL 5D1QC 3L3KB 4ZW5A 4X6DA 1D7CA 4NQCE 3OKOA 1XH3A 2AABH 4FHKA 1MW3A 3Q3GA 2LGNA 3M1BA 3SQBB 3UG5A 3WKNA 5L8JB 1RIVH 1HXYA 4XMTA 5J6HA 2AJSH 1OAZL 4KJYA 1FYTD 3FONB 5JHLL 5B7FA 5ALCH 2X1OA 3BT2L 3OKMB 3U2JA 1NGXA 4NUGL 2ZWYA 3HPLA 3HVDA 4NKOB 1AP2A 4BFNA 3CPLB 1MJUH 4NQTA 4ERSH 4NLHA 5HHNA 2ZCHH 4M8VA 3IU4H 1D9KD 3FOLB 4UOJA 5H4YA 3HC0B 1CFVH 3INOA 3BHBA 1IC4H 3L3DB 5E5MB 1ZAGA 3WJMA 2EC8A 2FO4A 1B6UA 2QHRH 3C2AL 2ZKWA 2VITA 4LVHB 2WV3A 1H19A 4H1LG 4ZSOA 4N8VG 1IQWL 4IOSA 2IG2H 3H7LA 2FSEB 4Z23A 1FI8C 3C5JA 1ROCA 1HE7A 3EYOB 3W39B 5J89A 3L3HB 2ZP8A 3QUXD 1WYJA 3GSQA 4IKJA 4LASL 3KNBA 4AQ1B 3T2NH 1A65A 1OLLA 3VQLA 4QUOA 4TRPL 3L7FB 4UT7L 1FZKA 5CINH 4XTRD 3OF6A 3QULA 1A4BA 4MS8D 5LKNA 1CK0L 4K3GA 4WHCA 2IWKA 4Z3TA 4PLKC 1EXGA 4ZAKD 1U2HA 5LGYA 4WTXA 1A0QH 2OR9H 1S7XA 3VRIB 3UJJH 3MOQA 2GW5A 3MPCA 4ONHA 1A7BA 4FNPA 4OD2A 1KTBA 4AYID 1J8KA 5TE6H 3QUXB 5IB3A 3Q8FA 1A7PL 4Z3HA 4HX1B 2JK5A 1ZOXA 1SF3A 3AQDA 3MRJB 4OVUA 3FBQA 1E3FA 3K8LA 2C9QA 1WF5A 3CU1A 2Z93B 4PVBA 1MCNA 5LAPA 4DKEL 3N06B 4OJCA 25C8H 3HNVH 5DJ0A 1A2YA 1D7DA 1ETA1 1KPRA 2P8LA 3A4FA 5DJ0B 3OGOE 3STLB 2AV7B 5E08H 2VQ1A 4WJG3 1U58B 4M5ZL 5ESVA 5HYFA 5IMLB 1JXKA 1D9KB 2B59B 3LH8A 1IJNA 3B2VH 4D0DA 1JNNH 1NCJA 1MPAH 3L1FA 1CURA 1MFVA 1NOFA 1JF1A 3GK8H 4POZC 4Y5VC 2CO4A 5LLIC 3CFCL 2XWJB 2FGZA 3I6KB 3W9DA 1IAIH 1VIWA 2GTWA 4XTRC 1JRHL 3SKJH 3CPLA 4R9HA 3T8XA 2XWBB 2GUOA 4MA1B 2GVYA 3LIZH 4WHYH 3MLTA 4PRNA 3DXAE 5FKAA 2VWEE 2YEZB 1L6PA 3I9GL 4F57H 2DMCA 4Z7OF 3OKDA 4X5WA 3IPFA 4HPOL 1P9MC 4NQQA 2P52A 2CRYA 1FFPB 5KSUB 2XWEA 2EINB 5CGBA 4CC4A 4E0RB 2VE6B 4OGXH 2FDBP 1V8HA 4FKHA 4PRAA 4IEFB 3FCBA 5EZOL 3EJQA 5ID0B 3OAYH 4F37K 4ODWA 5FA3B 1G9NL 2FTAA 4LU5L 4ODWB 4G7VH 2D7TL 2DQJH 2AERT 4OLVH 3ILDA 3X2QB 2BP3A 5ERWA 4AGMA 3DGDA 5K9JH 1G1KA 1TZIB 2DI9A 2H1PH 3OBAA 2NTFB 3R4RA 3CDCA 5SWZA 1CZ8H 2PF6A 3FQRA 4G6KH 4TQEH 3IFPB 3SY6A 4BE6A 3FSZA 3LKNB 1WTLA 4JG1L 1KIUA 4NAJA 3VWKA 2YIHA 4K7PY 2AAAA 3I9IA 1N12A 3FH8A 1JZ2A 2XN0A 4P9MH 5C6TL 2AEOA 1OB1B 3QWNA 8CGTA 3QAQA 3D48R 2BIIA 3M46A 2R0KH 1U95A 3VSUA 1NJ9A 2EO7A 2X0VA 3BCFA 4JLRB 1KBPA 4RNRA 2N1KA 4WV1A 3LQAH 2IBGA 4YC2B 4N2EA 3VX0A 5SWQA 2X4OA 5F6IC 2QPEB 5FO8B 1NCAH 1B2YA 4WY7H 1SMOA 1JZFA 4JZOA 1LM8V 2ZAHA 1KJ2H 3LKSB 2K8MA 2MCPL 1J1OH 3DXAA 1NC4B 1UWFA 3ARPA 4HD9A 2P5EA 3V0JA 5DK3A 1P2CA 5E4IA 1WZKA 3O6FC 1GOHA 2H0FA 3HAEG 4PJEB 5BOJA 2XWTB 1RZFH 1SY6H 2Y0SA 4X5RA 3TZVB 5FUOL 2XPGB 5CLYA 2AXJA 1I8IA 1KJ2B 1RIHL 2VDKL 3AXIA 1DLFL 5CILH 4PJIF 3MUZ1 3P30L 5C0CD 5KVFE 2B8OT 2H2PD 5CBEB 5AB2A 3FN9A 2HRPL 3JWDH 5L2KA 4U49A 3QJSB 1M6OB 1TG8A 1JYXA 1HH6A 1G9EA 4UZGA 5HHPB 2P8PB 2Z4QB 4NQEB 4TSAH 1ZIBA 2FD6H 3MYJA 5FYLH 1I7UB 4I2XA 1NGWA 1DDHA 2ZAIA 5EDXA 4TVSa 6FABH 4JG9A 4QYAA 5T33H 3UAJD 3BP6A 4U6VL 1KT2B 3CZLA 3L9EA 1RUKL 2VLME 2CCLA 2P28B 1OCOB 2A7BA 4LK4A 2J43A 2J8UB 2XQBL 2HT3D 4NO3B 1A5FH 5HI4C 3NCJL 4TXVB 2BHZA 3F8UB 3F5WB 2F19H 3V9CA 4OM0H 5HYJB 3M86A 12E8L 3WNLA 2BHYA 1I8AA 4X6BB 5FA3A 5D7JD 4GO6B 3U36A 3FFCD 4P5MB 1KJMA 1KPUB 1NUGA 1KB5A 2Y1AA 2XN1A 3KPRA 2DY2A 2FJGA 3O4OB 4WNSA 4CBZA 3OJVC 3O6FD 1EXUB 3IDXH 3LKPA 4NENB 4UV7H 5DRXA 2DQDH 2E59A 5IB1B 2XJLA 3EDEA 5H35B 4GBXC 3CH1B 3FQXA 5EF0A 2B4CL 4JRXB 4HK0A 4QO1A 1Z66A 1DQIA 3F58H 3BMWA 3RL2B 3HLAA 3TN0A 1OAZH 3HG1A 2CLVA 1H6FA 3ZE0B 4ZSOE 1GXEA 1FNSH 4PJXA 5CHNA 1NGZA 5CZXC 4BFBD 2EDFA 4HIHA 1FPTH 2B16A 1X7SA 3CXHK 3LN5A 4KXAA 4TS6A 3ZDYE 3WV0A 1Z9NA 1BJ1J 1AQDB 1GHFH 1YSOA 5JQ6L 1TKWB 4NUQA 4G11A 5TTRA 1CPUA 3BH9B 3KWVA 3MU3A 1L0QA 3DMMB 4BH8B 1U91A 3FYIB 1BEYL 1BFOA 3DX9B 1OK8A 2UZPA 2EDOA 5D1QA 1W8OA 2BSTB 5C0CE 4FABL 4YDVA 4GMTH 4BINA 2DQIL 4ZXBB 2W8CA 4BH7A 1INQB 5KSAB 4N0UB 1MLBB 4MQXC 4DGIH 1ILSA 3ARDA 4DWHA 4FADA 5HHMB 1ZSHA 2E27H 4XAWL 3CMOH 4YFLF 5F6HI 5IJDC 2J2ZB 5AVVB 4Z7OE 1XV8A 1X5LA 5D4QA 4RAVB 1Q8MA 2YMOA 2UZYB 3ARGD 5DMYA 5I19H 3ABGA 3OR6B 3RE0A 2YQGA 4NFDA 1M2VB 1R3LB 3W9EB 3VFNB 1JF6A 5LGJA 3QUMA 2P45B 1I8KB 4XNZB 1WFTA 1AANA 1ZDQA 2LLGA 2XKNA 2WZAA 4L05A 2AHIA 4LAQL 4F27A 3IK2A 3MV9B 5MEOB 5IVXB 5CGYD 4OCMC 1F4WH 4BQ6A 1E5CA 3OAUL 5DC2A 1E0OB 1CL7L 1NFDE 4BK5A 4PJIB 2R4RH 2ROYA 1HCYA 4Z3GA 3MUGA 2QGDA 1HIML 3L4YA 4MJ5A 4PJ9C 5EZIH 5AVTB 5GRUH 2F74B 3KEHA 1LK2A 4I2XE 1AO7A 5I8OL 1SM3L 4OCWL 5CFAA 3I6LD 4Z18A 4XNXH 2CZNA 1J1PL 3WFEL 2JI2A 5TDOB 1X9UA 5CWSB 4RA3A 5DDHA 3KH4A 1CF8H 2ZXEB 4IM8A 4Y4KB 5T5NF 2XIBA 2YQ3A 4FDWA 3QO0B 4J3VA 1SOXA 3GXDA 4U6XA 4RX4A 1SYVA 3PL6C 2AMGA 1RZGB 3VQ2C 1IMHC 4LBEA 4N24A 1KG0A 4OF3A 4QRPB 1LTXA 1X5XA 3DTDA 3G6AA 5DEGA 3RZCD 3UMNA 3I9GH 3PWUA 4F57L 2APVA 1NGZB 3AB0B 2AXHA 1Q72H 4RRPA 1GIGH 2PO6A 3BKML 4B60A 3IU3B 1R5VA 1ES0B 5KN5B 2XLLA 3DSFH 1IAIL 2PTTB 2PYEB 2XPZA 1XSJA 4RAUA 5IB4B 2ADJA 1ECYA 2UY7A 3MRRA 4PJEF 5I82A 4Z3FA 1PL3A 1DVFB 3CLFL 3MNVB 3BAWA 5D1ZD 5SWSD 4E5XA 5ISZD 4P2YA 2FHBA 1C16B 4PJFF 1KTLB 1PAZA 4HKJA 1LDPH 2K6WA 3PV6B 1ERNA 3K2IA 2BWQA 1GKEA 3WKPA 4FP8L 4G5ZH 1UCBL 3QG6B 2OL3B 4HAKA 4P23B 3UDWA 4W93A 2ZE0A 1BQKA 4BXVA 1MREH 4DFIA 3U82B 1EWHA 1FG2A 3CFKB 1B90A 2X1XR 1XB8A 3BP5B 1K9TA 3B7TA 1KY7A 1NGPH 2X89A 2XQYA 3HE6B 4IGBC 4J3XA 4IKLA 1CGWA 1AHKA 3GYRA 2NUPB 4TOYL 2XG5B 1T80A 3BIKA 3U30C 1E4JA 3GHEL 4D8PB 3AXLB 3EYFB 3OSVA 1Q9OB 1S7UB 3LEXA 3UADA 3D85B 1AAJA 2E6QA 3DYMA 2MEJB 4ABQA 4HIEA 3TONA 5HJ3B 3WKML 3I02B 4BYHA 4Z7NE 5C6TH 5ECGA 5B39A 3GPSA 4JY4B 1U3YA 2XSKA 1O6SA 1HAWA 2X12A 3MUGB 4H5SA 3C08L 2VW7A 4JY6B 1B4JL 4NJAL 1NC2D 2JH2A 2PO6D 2E7DA 1SJVA 1A6ZB 1IC5L 2VSMB 3O9WC 4Y9GA 4GRMA 3HG0A 4NFCA 1X44A 5CWSA 2ZJSH 2IDSA 1WTGT 5DVMA 4YDNA 4M62H 1QSED 2YPLA 4ZXBC 5BRQA 3P54A 2BH0A 2A1WL 2FYYB 3FTZA 3IJSA 2EDWA 3JV4A 3P30H 4HCRL 1DO5A 1RZIA 4WNJA 3RVUD 4YFEA 1DZ0A 1N2RB 1QRNE 4TUJB 2PN5A 1BIIB 1OM9A 4N2FA 4ZYKB 1JJUA 5DUMH 3ZXAC 3RI5F 5DC0A 3O3BB 1EDQA 3I84A 4MDIA 3VWJD 2IH1A 3JUZA 4XCEB 4PBWD 3MRNA 3AAZA 1KBVA 3AAZB 1FJ1A 3NACL 2VZ1A 3GO1H 1NCTA 4N28A 3W0WE 2X89D 3MVSA 4WJ5B 4DESA 1TYRA 5D6DA 3U7YH 5K59F 2R83A 2XZCL 5CJQH 1WT5C 1UXSA 2HKFL 2GSMB 4HCRA 5DD3L 4JO5A 4LLVA 1PCSA 4OKDA 4JMNA 2VXQL 3D2TA 5J1AA 2HLAA 1H8NA 3QNZB 3K4DA 3BDXA 3IDUA 1YPZA 1NCDL 4PJAF 2XETA 3CFJA 1K5WA 2YKLH 4IOIA 3MRHA 5F3HB 4LVNB 4JHZA 5DMGC 4OKVA 4E42B 3PUCA 4O9HL 2JJWA 2BOCB 4OJAA 5HYQA 4GSQA 1I1AA 2X42A 3T3PF 1NBQA 1E2WA 3KW7A 4JQXC 3F04A 1QRNB 1AGEB 1ZLDA 5F2FA 2VRKA 4CNIB 1JIBA 1PQZB 3EUUA 1OPGH 1OHZA 3HUJA 4JFXA 1MEXH 5B8CA 4LLUA 4BFFA 1PZAA 2YPLD 3UZQB 5JIMA 1B4RA 1ZE3H 4GSUA 4KTGA 1WIPA 4P2QD 4TTDC 3HS0C 3VXSB 4OCYL 3AJ7A 4ZNCD 1ZK5A 5J8OA 4M6ML 1TJGH 1NL0H 1RURH 4PJXB 5CHNB 3E9TA 1SJHA 5JHAA 3JWNH 1WHPA 3MRCB 2Q7NA 1OZTG 5F7UA 5ABDE 2IALB 4WI8A 2AQSA 1K8IB 1G6RA 2APFA 3QEHB 1X7QA 1YMHB 3RNQA 4FQIL 5H8DA 1TQUA 2PNDA 3GINA 4Y5XA 2W1NA 3BKYH 3A6CH 2CH8A 3KLHD 1IU1A 1P5VB 2QMKA 4FQCL 1FDLL 4R4FH 4BIKA 2KUTA 3JT0A 3LZRA 3QP3A 1DSFL 3VX1A 3EJJX 2Y5TA 2R9HD 3GLDA 1SUHA 4G6JH 4K71C 4L8BA 3PJNA 1N2RA 4NPYA 4P5KA 4TMPA 4KK8D 1NGQH 1EBAA 4TUJA 1KXVA 2OSWA 2W91A 4NQCA 3K5SA 1KPVA 4I89A 4H8UA 1QYGL 2WLZA 1WDAA 1PZBA 4RGOL 4JDVA 4YBQC 5EN2B 4U1KB 1K4DA 2PLTA 4R7NB 1DO6A 2R23A 2H5UA 2X4RA 4XN8A 4OI9A 2YD8A 4X6CF 3HNSL 4PV9B 5CCHE 1MAMH 4M6OL 5F7FA 5E9DB 3EADA 4HPHA 2PP9A 2QLYA 2B9AA 3GM0A 4KV5F 3VWJB 3D0LA 5ILTL 1XL6A 3DSNA 1JVLA 4AXWB 3NJVA 3WD5H 1YMMD 1C1EL 4P2CG 4RWYL 3D12B 3LKSA 1EGJH 2WAQA 2BSRA 4NZRH 4UTAA 3BKJH 1OGAA 2AV1A 3V79C 1QLEH 1PYWB 4JKWA 5GGTL 2WNGA 2Q8BH 4LNRA 5I6PA 1S9VB 4F3FB 3QEGL 1H5BC 4EQ3A 3ZE2F 3CFDA 4FMVA 1PFOA 3I3BA 2VDLH 5T1LA 3WN5A 2H6PA 3MLVH 4P4KA 1KCRH 3DPDA 2VLJA 1MCWM 1X3DA 3W11D 1IBGL 1RK0B 3EOAA 3SB3A 3NIGB 4HOWA 1OWWA 3DRQB 3O3AB 3HMXH 5FYLE 3GI8H 2EIMB 2UWEA 3ESNA 4NIKB 1IILE 3H0TA 4XP4H 3SKOB 2CUIA 5EU3A 5DK2A 2BERA 1KC5H 1S9YA 3HI6L 5FHBL 3T77B 3IKCB 5HHOB 3TA3C 4U1SA 1JZEA 5GJSH 4NQEA 5AVQB 3DHMA 2MOVA 3ARXA 3JYBA 4IBZA 3T0VA 4JDZA 3V5DB 5DZPA 3S0PA 4ELMA 5LAXB 2CWRA 1D5IH 1IBDA 4APQC 1J5HA 4G71B 2FECL 3CDGB 2WYIA 3CX2A 3NTCH 5I75C 3ZE1E 5KVEH 4UWQB 5DMIL 3DV4A 4EDWH 4Y4KC 3DV4B 1Z2KA 3ZKND 4JFSA 2XPYA 4FP8H 1NIAA 2VDNL 5D7LD 1U8QA 4QLWA 5JTWA 3LNFA 5EZPA 3MGTB 4KDVA 4MAYA 4NS0A 5IK3B 3HFMH 3BO8A 5AZ2H 4K2UH 1BQ5A 4R96B 5HYSB 3EOYG 3NFSH 3ARSA 3RWEB 1NPUA 3PWPE 5T5NG 3ULVC 4ADIA 4NDMA 4XH2A 4LSVL 5INCB 4AV5A 4ZW8A 4GUOA 3FUFA 5FW6A 1PX3A 5I1KH 1G7QB 3V6OC 5I1JH 1DVFD 2DEXX 2X6MA 2YC1A 4FYRA 2WC7A 6TAAA 1AR1C 5DK0B 4WJKB 3UXFA 4IBUA 1ORQB 4WQOA 1UJ3C 4HJGA 3QRBA 4LCUB 5F21B 4ESKA 3KBFA 4LCVA 4X7SL 1TUPA 2EVIA 4ZUUB 3BZFA 2V6HA 4XNQA 4YXKH 5E9NA 3FF7A 2TRHA 3EYVB 3HAEH 4HKXB 2VMFA 5ACZB 2WBXA 3PUUA 4PJ5B 1TYJA 1FL6B 5GGSB 3H42L 3NA9H 3ZTNL 2ZX7A 3QPXL 3ZKSD 2ESVA 4H0IA 4HXBL 4KK5D 5EORH 2AJVH 4FJYA 2JIXD 2DQUH 3WFDH 4GT0A 3I6SA 3L45A 1KLGA 3QPQC 5D5MA 5L6YL 2OJEA 3QH3B 2GEQA 1TJHL 4H0LC 3VMPA 1TQCB 4XXDA 2EDEA 1BZEA 3C08H 3WFCH 2GCYB 3ROLA 1KYAA 1CYGA 3QJHB 3KJ4C 2DRUA 1TVHA 3PPSA 1QR4A 1DJSA 1IC5H 4K71B 4PU2A 3RU8H 1A4JB 4AE1A 2CK0L 3Q44A 5BMFH 3KXFD 3ULVD 1G43A 3SGDI 1GGUA 3K0WA 3M17A 3WFHA 2CHDA 3G5VA 4HLZG 3M07A 4DUWA 5F8QC 2HRGA 2D3JA 3SE8H 8FABB 3B2PA 2VRAA 3ULSB 3IDMB 1DANU 1ZT4A 5SWZB 3D7PA 3VFNA 3JV5A 3OKLA 4P48A 4WU5A 5ID1B 3DROB 5ETUB 2G3XA 5J6GB 4WSGA 5C6WH 2OMWB 3GPEA 3VWKC 1OCZB 3OKYA 1S7XB 4JPQA 4HJ0D 3VRIA 2J8UF 3UPRA 3UROR 3WY3A 1NBCA 1BYOA 5CJ8A 5J7CC 1FLTX 5EUOA 5FM4A 4KI1A 5JNYA 1QSFD 4YDIH 1MZYA 3II2A 4G8FB 5CJQL 1OP3K 5JNYB 3MLZH 5MEND 2Z93A 3S35X 3F2LA 3T2LA 1HOEA 3Q43A 3X12B 4BZ2H 4OZHB 4RFEB 5AVSB 1MJ8L 2L04A 2IV9A 5CJOL 5AW4B 3ISWA 1OPGL 4MAUH 1HU8A 4NZUL 3CLEL 3B83A 1Q0YL 1XR9B 4KXCA 1I7RB 5IG7A 3NUKA 3W38A 4Q14A 5IJKA 3CWGA 2DQFB 7PAZA 3CZKA 4J1UB 2I7OA 3VXUD 1KACB 1KN2H 2CK2A 4XE5B 3MRDB 5LGHH 2LQRA 2VLKE 2DL9A 2ZCKH 3MACL 5DHVB 4X6FB 1MCPL 5IGXH 3HE7D 4FQPA 4NN6B 4APQB 5I74C 4RZCA 4U2YA 3AGVA 3IRCA 2WKOA 2IC2A 3MV9E 2C4XA 3QFDB 4YBLC 1CBVH 3WIHH 5HYSG 5BS0D 4JFDB 2FR4A 4PRPE 4FJZA 5E99H 2NNAA 2WO4A 3Q5TA 2D4FA 3QRFM 1UACH 4KPHH 3OKNA 3T6XA 4ALAH 1BQRA 2CJ3A 5HYJA 1I3RB 5ICUA 1P7BA 5KUMA 3VSTA 4DEPC 3WNKA 2MCAA 4X99B 1X5ZA 1DBBL 2FX8H 3K6FA 2RACA 3CVCA 1QX1A 2A6KB 3THMH 3V4VL 3ZYZA 2L7JA 5G4OA 3F6LA 1ZWIB 4YEEA 3FB6A 1QLRB 1JNLH 4KVPA 1NAMA 3DDFA 3P3YA 4R5VA 3SYCA 2EUVA 4H1LB 4UBDD 3PDGA 5I16B 1T66C 4G1MA 4Z0XA 5C07B 4ODTL 5I16A 5JDSB 2WUCL 3O8XA 3C6EA 3FN0H 1JPEA 2DDQH 4F37F 4KNSA 4JANA 4JDTL 1A6PA 4OLYH 1W0YT 5E9DA 4WV1B 1F4XH 3T3MF 1Q9WB 1PVHA 3M1BB 4JM2A 2R2CA 2Y07L 3GHPA 1MHCB 2V8LA 2VDLL 4LKCB 4U3SA 1JAEA 5A1AA 4KH9A 4OVVA 3V5KB 3VRLF 1UJTA 2BCMA 1QRKA 1A3LL 4MA7H 4OZFA 3EYSH 3GSWA 3WEOA 3TN0C 2EICA 3MV7A 3RX8A 4IW4C 1S46A 5E7FA 2W88A 3BWAB 4KO6A 2Z65C 4OIIL 3NIGE 4XWOD 2A83B 5I71C 4PHXA 3BAJA 5AZEL 4BHUA 5CBEA 4N2BA 2VDQH 2KMWA 1NBZB 3F7PC 1ZT7B 1LEGB 1WT5A 4ZS6C 3N1FC 1MDAA 5JA8B 3S36H 2P49B 3QIWB 2VDML 4K15A 1U42A 4Y1AA 3Q1EA 3FT0A 3HR5B 4PJ7B 1C8QA 4LOUC 4RDQG 3SKJL 4U6YA 1F1GA 5E2TH 5BUPA 5EBLA 4HZLB 5HDLA 4AITA 1Y0LB 2CCVA 2IOMA 3ZKXB 4ZUTA 3DI3B 3T0EC 1ZEAL 1YY8B 5DUBB 4M5YH 4KRPB 2G60L 3NFSL 3ARGB 1M4KA 4OCXL 1SLXA 1OF2B 1MJJA 3VCLA 3ESVF 4LOVA 1YQ2A 2MNUA 2IQAA 1E50A 2BOCA 1WGOA 3QR1A 3CSGA 4FC3E 4HQQH 3K4AA 3QJXA 1NFAA 2J1KA 2J57A 5CD3B 3ULAB 1UC6A 4RRPG 3RWEA 5FUZL 1TXKA 3KBEA 5C0EA 1LWJA 3DX3A 4KXZH 4HJTA 1YRKA 3GEFA 1CFQB 4F5CA 3ZSSA 2UUDK 1XGTA 1OB0A 1R3JB 2HPOA 4JFUA 4YXLH 4JFDE 3GMQB 5FB8B 2QVMA 3W56A 1Q94B 3BAIA 5BQ7B 2DICA 5D6DC 5M7QA 2MSPA 3IXAB 1G5AA 1G7HA 1CGSL 2EYRB 3DPBA 4MNQE 3C5ZC 2EYRA 4X6EA 4WUKH 1CZ8L 5DEFB 5FUCC 3MNMA 4DOHB 3BUTA 1EGJA 4AK2A 2DM7A 4R7LA 1SYSB 1CQYA 1NLDL 4JFWA 4M6NL 3S88H 1DQJB 3QUKA 4FLHA 2K0RA 3NMEA 1W16A 5FWQA 5AZUA 1QVOB 1CVSC 5EOQL 5JIDA 1K8IA 3RNQB 3KYOB 3AT0A 5KTEH 2GUYA 4PAZA 1C9SA 5IMLA 2QPSA 4AEFA 2YJQA 4XP1H 4EN3D 4WO0A 1EXHA 1E90A 2ODIA 4ADJA 4OBRA 2CRMA 3MLRL 1T7XA 2MPAH 3KJ6H 3N9GH 3GIVB 4KI5E 2HSIA 3NZUA 1XGRA 4LLWB 3O9WA 3GWJA 1G87A 3BFWA 4ZMYA 5FECB 1J0YA 2RQ8A 3QZWA 1YY9D 4OLXH 4AYMC 3QZWB 2WNWA 2CSPA 1R5IA 1XGQB 5EZJA 5I18L 4JREB 2F54B 2V33A 5D93B 2E9BA 4Y4FA 1L7IH 4UM9B 1THCA 2J2ZA 1VF5C 1FVDA 4DN3H 2QKIC 5IT2L 3TBYB 2O61A 4X7TB 3IT8D 3L5JA 4AYFB 3CIQA 2B3IA 2P46B 3NFPB 2WSPA 1FVEB 1CG9B 3SKNA 3WUWB 4LHUB 3QFJB 1A4AA 4JGNA 1KFAH 1I8KA 2B2XL 1P5UA 2WLKA 3MJ9H 2IIJA 4WRLA 5I5MA 2FBJL 4ZUTB 1KXTA 3ZDZF 1LO5B 4P23D 4LLQA 4GXVH 4L8SB 3ARGA 4LLQB 3FT2A 3SO5A 1NMCC 3N44B 1UM6L 1KYDA 3D34A 4MCMA 4BSJA 1CB4A 2VZTA 3S36X 2EQDA 3JTTA 5JA9A 4M4RA 5HGDA 1ZXKA 3OAZH 1AHWC 3WGUB 2ATPA 4GEJA 5ITFA 4KTEH 4U0RC 4ZO8A 5D6CA 3MDJA 5FYJE 4Q97A 3O4LE 5JUEL 4YHLL 1LEKB 2YRZA 1T7WA 3KLAA 2F58L 3ULUL 4EN3A 1QZ1A 1VGKB 1XB3A 2HXAA 4O58H 3MMEB 1BJ1H 3IDNA 1WRFA 4LGSB 3QBTB 1HVXA 2YA1A 1HESA 2BHUA 3STBA 3JT2A 1M7DB 5FYKE 3QEQB 1AZBA 3IDYC 3LVTA 5FLUA 2K8QA 1DFBH 2JB6A 2Z0BA 1MCDA 2LV4A 3BXNB 5JDJA 1KCBA 5I9QB 5GS2H 4KRNA 4HIXL 3MOAL 1IAII 1KTKE 3QQNA 1NKGA 4ELMB 2OMNA 4EF3A 3QZNA 2X4QA 1AYOA 1YEIH 1ZHNA 3DOIA 3F83A 4YK4B 3WS6C 4D9QD 4HUCA 1MNUH 2OJZL 3X14A 5AOZA 2EE0A 1KN2L 4ZTPH 1ECZA 3RWFA 5E2UL 2PTTA 4XO5A 5D9SA 3VVWA 1G9MC 1IAOB 3AC0A 1C08A 4JG0L 3S37H 3CDYA 1FNAA 2FZ3A 3IKKA 3LZLA 3RPIB 3EOBA 2F7RA 1TO5A 2R2BA 3UBHA 1MFDH 5JW5B 2CO7B 3DMMC 5E9DE 1CE1L 3NCMA 4Y5YC 1MHPH 1GOGA 2VSKB 2EIKB 1AOHA 5DD5L 1N6VA 5T1DL 1N0XL 4LVNC 2V2WA 1COBA 4YX2H 4HJJH 3L5WA 4P23A 4DGVL 2ITCA 1BZQK 4KK9C 2AXFB 1ZA6A 1DSYA 2DV6A 1JNLL 3QZMA 3KDMA 32C2A 4NCC1 4ALAL 4A2FA 1CFBA 2VUOA 5FR3A 2HT4C 1MH5A 3FONA 3CBJB 1S7QB 2KI6A 1ADQA 4B7LA 3BGFB 3ESMA 3K6OA 1A9BB 4HIJA 4CVUA 3OKMA 4FE9A 4DGIL 1NAML 1EHAA 1ZWIA 1FH5H 2R7EB 3DO3A 4EOWH 1E7VA 4O5LH 1MCCA 1FVCA 3RAJL 1HSAB 5EU6A 4BWWA 4C56A 4MVBC 1R5WA 3O2VH 5TF1H 3DGGB 1ZT1A 2KKQA 2O6CA 2A9NL 4LSSL 4K5NA 3TBBA 3GJFK 5GSVA 5B39B 4F93B 5F97E 2ITFA 1BVLB 5BUGA 2A5UA 2X4NA 5HSFA 3DJZA 4G6AD 4NENA 3F7VA 4LAQH 5G5DA 3RFZA 4OLYL 2Z7ZA 4TVPH 5FCUL 2PW2B 2HP4A 3DUHA 1NOLA 1N4XH 4G80B 1S9KC 3ZU8A 3IJ7A 2X3CA 1FC2D 1JTTA 4PG9B 1CJYA 4LCWB 1VRSA 1LLAA 3MBEC 4LCWE 1KGJA 3LHPL 2NR6C 5E6SB 2IXQA 3DVFA 2DZEA 2FNWA 3BQUB 4PGDB 5BJTB 3FTGA 1II4E 3KYMA 4PSPA 1UXLA 3TPKA 5ESQB 3WFEH 2E3VA 3N0AA 3KM1A 3BPNC 3C8DA 5ENWB 3IN0A 4NQCB 5F88A 3GF8A 4MDIB 3NP3A 1OAUL 2W07B 1W72H 5CS7A 4IGBD 2E47A 4NOFA 1WWBX 3EYQC 5H37A 3H1ZA 2DMHA 2WLIA 1FORL 3WNIA 3KPNB 4AIEA 4PYGA 4KKPA 1WS7A 1CLOL 4JL1A 4UI2A 2IOOA 4U1MB 2BNUB 5FUCE 1R9FA 1GZHA 2HTKC 4A37A 3O2DA 4MBRA 1KWKA 3HZ3A 4QCIA 1GC1H 2WXQA 1JNHA 2YKKA 3WTWA 1CGVA 4L0YA 3T4AA 1LDPL 3WN6A 3M1OA 3V4VA 3OR6A 4H8VA 2FJSA 1XGZA 4NBXB 1ULVA 5KVDE 1LNUB 1S9WA 1LNUA 1S9WB 1YQVL 4PJ8B 5TE7H 2CGRL 1Z6JT 4K7FA 1PSKH 2BCKB 1H6UA 2EEXA 1BA9A 1PQZA 4MLIA 4JQVA 1BZ9A 3BUIA 3MLPA 3FT9A 4BWTA 2R4SH 4PWHA 4AKOA 2HJFA 3FFDA 3HC3L 2YEVB 4PJAA 2VN7A 1D3CA 4UAHA 1A6UH 2ZWNA 3V0EA 3R4DA 4FFZH 3P9MA 2EXYD 2F5AH 4HYTB 3BJLA 1WITA 5D4IA 1SUJA 3UGEA 3LKOA 5D70L 5BQDA 3QUMH 3IMTA 4KQ3L 1KDJA 4OUUA 1EUUA 2NY5H 5G5DB 3E1ZA 1HEHC 1I7ZB 3IGAB 3NIDF 2ZOLA 4Z7NB 4JB9H 1ETZA 4YSQA 4Z5RA 3O6FA 1IGCL 5CZRA 5K33A 4A6YB 1PY0A 2Q7YA 4FQLH 4WZ9A 5ADPH 1O9WA 1NOAA 4NJAH 5A2AA 4ZX5A 1WQVT 5EWIL 4KMTH 4N9GA 4MMZB 1S5IH 4OGAC 3GIVA 3AADB 3UGUA 1O0VA 3IEAA 5IEKB 3BPLB 1OSYA 2BXYA 3PP4H 4RBPK 5MHSD 1IFHL 3ELQA 1PDKB 3BWUF 1FO0B 4UB0H 3ZKMD 1INQA 2GHWB 4YZFE 1OCCB 5KSAA 4UT6L 5D2NA 2V2XB 5F72S 1U3HC 2W92A 1L5GB 2CR0A 2PWEA 4ES9A 1A6AB 1XCQA 2ZKXA 1LWRA 3HZMB 4HGMA 1HZLA 1L7IL 1INDL 5A2CA 5DC9B 4YC2C 1OVZA 2UZYA 1CF8L 2F53D 4PEEA 1CXIA 5AB1A 3LQMA 3S3BB 5DR5H 4NM4H 1NCCL 4DP9X 3NSYA 5DRZA 3FTYA 2YFOA 4QRAA 4JFEA 4WNQA 3EO1B 4JFEB 1JBJA 4EI6B 2BO0A 1HNYA 3H54A 1HHGA 1CI5A 2OSXA 2OMXB 1KGXA 4H2CA 2A73B 3L4VA 1REIA 5HHNB 4TPRL 4YXHL 4N3TA 4AJWA 2GK2A 2Z64C 2NY7L 4QPEA 5JW4R 5M95B 4ATTA 3VD5A 5F9DC 1UXMA 5D2NC 3EYOA 4FQHA 3K74B 1H3VA 1VFUA 3G08A 4Y1SA 2NLJB 4L18A 4PJHE 1NBVH 2MQGA 3PL6A 3RY6C 3G5VB 3GHBL 1ZSDB 1WAAE 2OZ4A 3V5HA 5L4FA 1A6VL 2E7BA 4GAGH 4A55A 3ME0B 3PABA 3QRGL 3APDA 4I0PC 3DHJA 2XICA 1OAKL 4PD4K 3BDBA 4PJCA 4CBPA 1EBPA 2WD0A 3DX7B 1D5XA 5KVGE 1AYRA 5IHWA 3P69A 5IBTL 3BT2H 1K8DB 3BPCB 1S4IA 4IU2A 5F89A 3CDGA 3FK3A 5CGMA 3T2QA 1KENH 1U3JA 1XCXA 2CR3A 4GJTB 2BFVH 4MNQB 2QSQA 1VPOH 1U8PB 1LD9B 4JPVH 5CSGA 5L2KD 4OD2B 3IU4L 1TTAA 2DEYX 4M4PA 4F8QA 1G7IB 3O6FB 4YS4A 1GGBH 2HFEA 1Q0XH 3ARBD 3N85H 3QZPA 4I0PB 4I5BA 2V5RA 1FE8H 1PIFA 5A2BA 5D8JL 2Y3NA 3QGVA 1HQ4B 4MCZA 1FL3A 3V0VB 1E9PB 3HS8A 2VDOL 1XH1A 1UASA 2XWDA 3RGVC 1WAAF 1CFNA 2IQ9H 2DLHA 3FOMB 1DBJH 1A2YB 4YX2L 4IRZA 1I8UA 3I6GB 5MEQA 1X4ZA 2EO1A 3L95B 4QRBA 2NZ9C 1ORQA 4G9FD 3NN8B 5JW3H 3RL2A 4LCUA 2FCBA 3C6LD 4OLZL 5I30L 4HJGB 3WIHA 5J1AB 1OP4A 2BW4A 3ARDC 4R7XA 3LS5H 3MRBA 5FM5O 3CZGA 1XQ4A 3R0MA 3SBWC 3WEBA 2GJ6A 2P26A 4AZ8A 1N0LA 1XZ0A 3CQQA 4FYSA 2C9XA 2VKWA 5JZ7C 4U4BA 2CRIA 1WWWX 3BPNB 2GUOB 2WLYA 2BLFA 3MZGB 2K6YA 3FQUB 3RTLA 3FCGA 1U8MB 3DX2A 4AL8H 2J1ZA 4E9QA 3BHBB 1GPOH 4F8PA 3UJJL 2JB5H 2X1PA 4LVHC 4IRSD 4CNIA 5ILTH 3KWWA 3LNGA 3N04A 4JM4H 3TYGL 1R0AH 1E5BA 2ZF8A 2H32B 1N7MH 2X2JA 5TFSL 3MO1B 4P46C 2VN3A 4GUPA 4J2XA 2ERJB 4PRIA 4TUUA 3LHPH 4ZUVB 2WN2A 4P9HC 3UZQA 1PLGH 2I26N 1FBIL 3TPUB 3W39A 4N2HA 1NCBH 2MNWA 1YJDL 3S97C 3CZFB 5ALBH 4BJLA 5IIEB 3BAEH 2J72A 4PRIE 4MRBA 3ARBA 5IF0A 2CD0A 2GI0A 2IMMA 1HILB 1UOKA 3BLKA 1FNGA 1LE9A 5IESH 3F6IA 3GSUA 1JHKH 1PLCA 3ZGIA 4PJIE 2Y2WA 3RKDD 1F8TH 1N59B 4HBCH 1UT9A 3AXHA 3B3IA 4X7EC 3EJZC 3QFJA 4X4ME 4S1SH 3DI2B 4QTFA 3ARDD 3B6SA 3SBWA 1CDBA 3QI9D 3VXRA 4HUXA 3QHTC 2WK2A 4G5AA 5FYJH 2DBJA 4IK7A 4L1HA 4K73A 3QQ3A 4XX1E 4YVUA 4QRRB 3FT2B 1V54B 2NTFA 5CKGA 3VXPA 4D7BA 3V4UH 3IFOB 1P4BL 3IFPA 4HHAB 5DYOA 5DURD 4Y9BA 2QQQA 5CUSH 4JRYA 3BAYA 2MWCA 4X0KA 4PJDB 5AWNH 4HUWB 3OPZL 1CI3M 4CVZA 4HOMA 3MLWL 3RGVA 2YFNA 3ZYJA 4MCYB 4UNUA 1Z9LA 5FAAA 2VDNH 5TF0A 5J57B 2EE3A 3QCVH 4TLSA 5KG9B 4ABUA 4EQ2A 5SWZE 3QZBA 1CFVL 1IBZA 1F4AA 4RGNC 1CD0A 1DL7H 3SBRA 2X0WA 3VFGL 3E80A 5A7EA 4WFGE 2BSCA 3F01A 3QIUB 2P48B 2V5TA 5I0WA 3ARWA 3BP7B 5I1KL 3L1EA 2D7TH 4OU3A 1FF5A 3GUFA 3IJHA 1UWXH 3GBEA 2PETA 4XHJC 3BWAA 1ZVSA 4QRSB 4BXSV 3CFEB 2Y7OA 1IB5A 1MVUA 1RP8A 4J3OG 4BSWA 3KPSE 4FLQA 4N3UA 4YIQA 3HHMA 3T8XB 3ZDYB 5K9OA 3CVHB 3TT3H 4MNHB 5K9OB 2F74A 4MQXD 1R3IH 4XXCA 2G0KA 1XR8B 2X2IA 2D7QA 4J6IA 3VG9B 1AHWA 2PPEA 4JB9L 4W9JC 1QTYT 2XFXA 4XCCL 5JW5A 3EH2A 3VG0H 1AQMA 4JHAL 5EOTA 2DM4A 3ARGC 3FAWA 5EOTB 4XP9H 3KGSA 3MX0A 1FHGA 1WUZA 5CSZB 1RHHA 4NRZB 4OCSH 5CZKA 3BRFA 3FRPA 4I18A 5I24A 1NPNA 3CFUA 4M6OH 3BZEB 4U1GC 1MJJB 2ZIDA 1KJ2L 1UA3A 2VDKB 3K0YA 4NYLA 4ZAKC 5JO5A 5LXGH 3ZQWA 4DCQA 2X09A 1S7RB 1TNMA 5EBGA 1UKTA 3WD5L 5CGYC 5JW4N 2VISB 2ZZUT 3OG6B 1JYVA 4FQJH 3H6AA 2IVFC 5HYJE 5E1QA 4KV5E 4G9DA 3GMOB 1QFWM 4M43H 4G9DB 4OZFH 2PYEA 1ID2A 2XG5A 5I6KA 4AMKH 4PJDE 2CJUH 4JFEE 3IFNH 4HEPA 1JHLH 3S48A 5INDA 3WEMA 1RJLA 4H8WH 1OT2A 4QRRE 2XX0A 1DQDL 1B9ZA 5EEWA 4KQ4L 2Z7WA 4M5ZH 1OEZW 4JY4A 3S4SA 1DJGA 1Q1PA 4G42B 3TVMC 4AQEB 4WI5A 2WYTA 2JCCF 3MRFA 3MNWB 2E7MA 4FL4B 4PY7A 3RZCC 3MNWA 2HKAA 5AW7B 4OJYA 3OHXC 3WFBL 4F7MA 2PYFB 1YYLL 3MRMB 5D55A 4NP9A 4PW9A 4CVWA 2VDPB 4NKDA 4YDIL 4A7UA 4JFFA 4IGBB 2A73A 1CFTB 1HSBB 4KZ0A 2XZQL 3HA0A 5GIRA 5DMIH 2I07A 4FG6D 1KULA 4YDVB 4WFEE 4DK6A 4AYBA 3S35L 5C2UB 3NZHH 4I77L 4XOBA 1N5YH 3TL5A 1JZ5A 4B97A 1A6TB 1ASPA 1KYOK 1EH9A 2A83A 2F54A 1OAKH 3N43F 3PP3K 4HCGA 1QWHA 1JWUB 5EU5B 1X5JA 2J5LC 1KCVH 5BRZA 1QSZA 4XN4A 2IH3A 3LKQA 2YD1A 3GHBH 5ICYB 1KELL 3LKQB 1JMZA 4PJ5E 1F2QA 4Q74A 1TQBB 3UEQA 2IPUG 2MKLC 1MFAL 1PKOA 5IJVB 2YUZA 5DVLA 5FCSH 3LQZB 1KY6A 2Q6WA 3D25B 4WGKA 5EBLB 3SBQA 4AJVA 4PMEA 2BIHA 2AK1L 4DQOL 4DT2A 5EEUA 3G5ZA 4QRQB 2OTPA 2QKSA 1NEZG 2BJMH 3SDCA 5HHXL 2FBRA 2VLJD 2QHLA 5MEOA 3QDJE 1I8MB 2UXTA 5DA0B 2YPKB 3W82A 1BZOA 4J4PA 4PG2A 1UTDA 2RCSH 1FFNA 3L7EB 2NY2B 5FHAH 2QGBA 3QJUB 5IQMA 4K3EH 3OKLB 4A63A 1Q0XL 3DKHA 4WLCA 3X1BA 3RWIB 3BYTA 5EF1A 1KB5B 4RQQB 1IE5A 1MRFL 5IUSA 5KBPA 4G1EA 3GMOA 4WFFD 2LFEA 2X3BA 1MFUA 1CICB 1MHEA 4XP5H 4F7CB 5E8DL 4LCYB 3NT0A 2IQ9L 4PRPB 3TV3H 4P57A 1Q94A 2UXVA 4Y19D 4N6QA 1W0WA 4PHZA 4GS7B 5JXAH 3U0WL 4A7TA 2Y5QA 1CLYH 4Y1AE 1H6EA 4HWUA 5JOPD 1G1CA 1XAKA 4OLZH 4RA0C 3C60C 3AGWA 3EUDA 2HX8A 3I50L 1SY6L 3WEXB 1G9NH 4O02A 4ZQKA 5GGUB 3W2DL 4LLMB 1KNOB 3T0EA 3CHPA 3VM7A 4U6XB 1CICC 4CSZA 1QVOA 5JHDE 3EO9L 2EVGA 1BV8A 2ED9A 5IHUH 3OG4B 3P40A 4H7VA 4P2QB 1DVFA 2XY2A 2C3VB 3MNVA 5I73B 4TQEL 1P4LB 3RWCA 4U0QB 2Y4SA 2DQEL 2IEPA 3KEDA 4LLYA 1A21A 2JXMA 5JMRA 7CGTA 4MD4B 2YAPA 3QQ9D 4J8RB 5C3TA 3MO1A 3N44F 5CNHA 1DQLH 2KDGA 4AM0A 3V9EA 4WUUD 1BLIA 1SY6A 4UAOB 4P5SA 4U2ZA 1D5ZB 1NAKH 1TJIL 5JYMA 3MBXH 3EBAA 1FBIH 1R34A 3HOGA 3F12A 2XQBH 4FI7A 4KO9A 5EV7A 5GGRY 4YHPA 3D51A 3MJ6A 2KPNA 4L37B 1AH1A 4FHJA 4JPKL 3TBTA 1DUZB 1WK0A 2GSGB 1KFGA 4KRMB 2H8PA 3NABL 4L4VD 4ZFOL 5ID0A 3QORD 4W6WB 4GPVA 3BVDB 3ULVH 3O6ML 5HGBA 4PS8A 1PZ2A 2CHZA 3VGEA 5HVGB 1FLRL 3AFLA 4RIRA 3SQOH 2V5SA 5LWYH 4F7KA 1HHGB 3UO1H 2NUPA 1YEDA 2DS4A 2B4CC 4U05A 2G4EA 2ZWZA 5F7KC 2D7OA 3O8XC 3EOTH 4PMFA 4KRPC 2DBLH 4NC1C 5DUPH 2R1YB 3BP4A 1CGTA 4AVKA 1FZMB 4D0CB 1MFCH 1XIWB 4OIBA 1XF5B 3CU7A 3IE9A 3MJ7B 4RVBA 4MCYA 3VYPA 5AUMB 1KMGA 5ELIA 4U6HA 1BQLH 1JN6B 3P2DA 5GGQH 4W68A 3OJ2C 3QUZD 1AD9B 3UIZA 1YEHH 1BEYH 1MREL 3FKUS 5FO8A 3SZKC 1KTRL 1A3RL 2QSVA 4LARL 4GMSL 4M7ZB 3BZ5A 3VSVA 4XNBA 4PJXE 4U3SB 1JDCA 5EEZA 1JGEB 2HFGL 4HF5L 4KK8C 1TVBB 1IQDB 1CGSH 1U33A 4DUXA 4XB7A 4ZD3H 2X4SA 3TT3L 2DTMH 4XVUD 2FGWH 4AI7A 2QBWA 3WKMH 4N0RA 2E9GA 1S6NA 2OX5B 3JTBA 4LIQH 4WWKC 5GRXG 1F4YL 1TZ8A 3DX0A 1SNRA 4M7ZC 4TTGA 4NKMB 4Z77B 4QR7A 1FSKC 2EIDA 3EBGA 1I3UA 3AQYA 3HE6D 5AVYB 1WA1X 3QUYA 4M1DL 1L4IA 4NRXA 3O4LB 4ZFGH 3ZL4H 4JX0A 4M48L 4HFUL 3VXUA 1T4KB 5DI8A 3V52H 2JFCA 3SGEH 5IW6A 5LBSA 1L9SA 1TEGA 1F58H 2HZHA 3CK0H 2Y07H 2TRYA 4NLAA 4M3KB 4BA8A 4J8QA 4ZMXA 2OKMA 4QKXB 4K7FB 1WD8A 1YEGH 2YMXH 3LD8C 4YSDA 4IOSD 4FQJL 2X38A 5DZOA 1BZ9B 2D2CC 5D7SL 3TYFA 2KH2B 3E3QC 1A3LH 3GMLA 4BQ8A 3ZE1B 2XVGA 3QUXA 3JZ7A 4BKLA 4Z7AA 2YJLA 4P4RB 3W0WB 2K4AA 4JPIA 4G1MB 4Z0XB 4AQOA 1DQDH 4WHTA 2A4ZA 5AW6B 3ZYOA 5I17A 1NM4A 4MA8L 4J3OC 2IV8A 2E9IA 2XA8L 4PB9H 1KFAL 3TA3D 4S2SA 5HYEA 1I8LA 2CO6A 3DV6A 3O41B 3NCXA 3OX8A 2PYEE 4W9DC 1HOCA 1HOCB 2F54E 1QHOA 1WBYA 3DUSA 3WNMA 4Q9CA 4KHXH 4KJQC 3RPBA 3FO9A 1J0IA 4EJ1C 4F7MB 1E6OL 1ZVYA 5HY9B 3MCKB 5ITBH 3X13B 1CGXA 2EH8L 4N4YB 1N3NB 1Y18A 1KXQE 3IYLW 1RVFH 4Y4KD 4X2UA 1U92A 2Z1PA 4I48B 1I1FB 2G4GA 3I6KA 3W9DB 5D7EA 1SOKA 3BGMB 3GBMH 5FGCE 3RY6A 3KYMB 3Q2NA 4P9HL 3NCEB 1U3HB 4ZFZA 4P2QE 5ENWA 1B0GA 3BH9A 3NZHL 2WY3B 3BVNB 3PIQA 5F7EH 4EXKA 4HP5A 5TPWH 2KLTA 2I9LA 2BP0A 2DWDB 4Z0BL 1TVBA 1DJHA 1FFPA 4CMHC 4DGWC 2FRGP 3ARED 1LEGA 2ADFH 2WWOA 3C87A 1GMEA 2BNUA 2FJUB 2WBJB 3MRPA 4W9GC 4XMKH 3QJHA 4DOHE 3KPSB 4B9KC 4DUVA 3Q5OA 3QYMA 5F8RC 3TESA 3MV7D 4B96A 3PAZA 4RBPH 5FA4B 5E2UH 2NSXA 1A14L 2OCFD 4J3OD 1R3HB 3S3PA 1WFNA 3LTVA 2Y7MA 2WGXA 4OZHA 4RFEA 1GY1A 5AYUL 5DRWA 1GKOA 1OTUC 3LD8B 3X1GA 1ZLSL 4PCSA 1HHIA 4D0BB 3D2UB 4G72B 4JQVC 3IE4A 4L8CA 4PGCB 3BEWA 1FHNA 3UACA 4YVNA 2FIKA 2E7HA 2EZ0C 3DVNB 4BEIA 4Y1AD 2ISDA 3UL4A 4X9BA 4NWTH 2R2EB 5JPMC 4IQHA 3D18A 2AEIT 3Q8BA 1GMIA 4P2OB 1F18A 4K5MA 3WN5B 3TV3L 1NAMH 4MAYC 4P2OC 4LL4A 2BWIA 4HJIA 1G7HB 3VXSE 4GBXD 3EJCA 3WN5C 5I18H 1KBGH 5F9OH 1H5BA 1E27B 3RAJH 5BUAA 2WIIB 2HH0H 3GSNL 3ILPA 2WOBA 4E68A 1QI5A 1E8XA 4B5ZA 1DJWA 5FO9B 3W2DH 2OP4H 7TAAA 1DJXA 1G6RB 3BFOA 4NN5B 5LCVH 1Z9SB 4WEEA 4I3GA 1AFVL 3QEQE 4N1CA 1DQLL 1U3NA 2B59A 1DEEA 3ZHDA 3DIFA 3QNFA 2CJSA 4WW2C 4DN4L 3J2PA 1G0XA 3EXLA 1L9PA 2CJTA 5DRNA 3HG3A 3KL0A 3P9WB 1ZANH 5AW8B 4J6RH 1EZLA 4W6XB 2MH4A 4WSKA 4YMPA 2EC9T 3AQXA 2LFGA 2ZOUA 1IGJB 7PCYA 2ZUQC 4NAMA 2HG5B 1DYZA 1VZHA 1UH4A 3VDAA 1B4JH 1TJIH 3TBCA 5MEQB 1NFDB 5HYJD 5JXEC 2NY6B 2WVUA 1E2ZA 3RVVD 3Q6FA 43CAA 1ADQH 2WQXA 5AAWA 1MWOA 3KHOA 4FD0A 4N68A 4IRJC 4AEIH 3QG6A 4XNQB 3VFOA 1IAKB 1JK9B 2J8UE 4OT1L 1ZHLB 3V4PA 2A1WH 3EXJA 4GEIA 1RFDL 2EXYC 1MCKA 2AJSL 3HHSA 5T3XL 1M7IA 1ODAA 3NTCL 2VW6A 3GXUB 3PGFL 3VB8A 1J8SA 2O1AA 3F3HA 2GIYA 4DH2A 1G7JA 2F53A 5JQIB 1EEQA 4TTDD 2TSBA 3GRWH 1RZQA 5CXPA 3UIYA 2R1YA 3VRJA 3WS6A 3SCMD 5AZ2L 1XF5A 4OV5B 4OFIA 3SE4C 3SDYH 2AC0A 4LOFA 4QRPD 1UXWA 2J44A 4IDJH 4I9WD 2Z31C 5DJCB 3PWNA 2GPZA 2WXRA 1D6VL 2VXQH 4ZFQA 3L08A 4LP5A 1YMME 4GSXA 4PJDF 1KCLA 1W80A 4KXZI 5E00A 1FZKB 5BW7A 2MQ3A 4FQXB 4NZTH 1CTMA 5F0PB 1QR1A 4LGRB 2VOTA 5HPOA 3LQZA 4GQ9L 1E2VA 1OHQA 4NO5A 2NNXA 2JIXB 3GI9L 2FGWL 3Q1SH 2GJ6E 4G8AC 5ETUA 5LAXA 2CBQA 4JZJB 3MC0A 5J6GA 1IAMA 1ZDSA 4X7SH 2VLKB 5E8EB 2XQ0A 3K72A 5EU6E 3V5KA 4C56E 3NQIA 4HC1A 2FEDD 1QO3B 4WUUE 2WCSA 3BLPX 4BDVB 2DM3A 8FABA 4ODSL 4TQ8A 3F6JA 4JRXE 1QW8A 2WQRA 4EOWL 1MEXL 3H42H 3ECBB 4UBDC 4LASH 3E9UA 1T21A 1HHHA 4KHTL 4PJHB 2OR9L 4YDKL 5DWUL 2YXWA 2OMWA 2MQ0A 1PMYA 5CR1A 2OSLA 3CK0L 3UOAB 3II1A 2FATH 4OGZA 1SLWA 4TV3A 1FO0L 1TCRB 3WFCL 3NYKA 3TGXA 4KK6D 1YPZF 1D7FA 4N8PA 1T1ZB 4H44C 1WZMA 5C86A 2GY5A 1W72B 1C5CH 1BF2A 3BFQG 1I31A 4MMXA 5H94B 3VFPB 3ZE0F 2D8KA 2HYMA 2ATKA 2IG2L 1HINL 3T6ZA 1VLXA 1KNOA 3T0EB 3CFQA 2YLHA 3DUUA 1F1DA 3VCLB 3E6HA 4G6FB 1CXKA 4QD2E 3TV8A 1B0WA 1HSAA 4XBPB 1JNNL 4NUPA 1RP9A 3CDZA 1WAAA 1V7MH 3HI6H 4EBQL 1AGFA 1PKQA 3DBSA 4P5MA 4IHOB 5CLWA 1IO4C 3VFSB 1E6OH 1FCCA 3RVWC 4ZS6D 2WXPA 1L3WA 4XAKE 2H9GB 3HZVA 5AAPA 2HRHA 2FYVA 3U30B 4PRIB 1RVFL 2VN5A 1F6AB 1J5DA 3O2DH 3TPUA 1W91A 3FYEB 4D9LL 1MWAL 4PVNA 1AIFA 2VDRB 4Y4FC 3V4PH 3HLAB 3Q5YA 5T1KD 5I1GH 3R0NA 5DYFA 1AKPA 1T1WA 4WKXA 2IXQB 3WCYA 4PRID 1T22A 2ZSWA 3UABA 1XB6A 4NZRL 3BGMA 2APTA 4ZW7A 2X70A 1IZJA 3B37A 4JZJA 4XMKL 1AGDA 2N56A 4DNLA 4TLTA 1NEZB 5LXVA 3N50A 2V2TB 4KJWD 1LO5A 4HXAH 3B9KB 4CN6A 1TETH 1ZLUH 1LO4H 1XGYH 3RZCA 1YAIA 1LEIA 2EDQA 1AS6A 3MROB 3HS0B 4Z7OB 4UOW0 4XPFL 4LEOA 2AQTA 1FG2B 3CFKA 2FEEL 5CJXA 4Z8FL 5A2KH 2X4TB 4LOUD 3LEYL 3GTNA 3N5AA 4Z9KB 1BJMA 3P0YL 2KPWA 4MD5B 4IGBA 4NJ9L 1P69B 4H40A 4NWTL 3KYNB 4JO2L 4ICXA 4ZMLA 2VABA 1T2QL 1F42A 3ZZLA 1JV5B 3JXAA 3P11H 2W9LA 4PR5B 4PGCA 4ZZFA 5HVWA 4WI7A 4Y16D 2DL2A 1XF1A 2AGJH 2EDJA 3QXUA 3O6KL 1KJ2A 2MIZA 4XB8A 1CT8A 3G7TA 3L3OA 2ZNXA 4KMTL 3LRLA 4P49A 4K2UL 3BQVA 4YHNA 5LB1A 5T1KA 3AT8A 1MRDH 4JY6A 4OD3H 5EU4A 5TQ0H 4YGVA 5IFJB 5FUOH 2H3NB 4Y5VA 4G7VL 4LOEA 3SYQA 4U7SA 3AW5A 4LT7A 2FJFB 2WMPB 4LCCB 3UTZA 1AFVH 3B9VA 4TF4A 1I9IH 4WW2F 4L2LA 2VLLA 5EBMA 3KNBB 5AVXB 2QADC 4LL1A 4LPUA 3CIAA 2B77A 3NJKA 2VIRA 2XYCA 1JPSH 2O4EA 1OGTB 3CUPA 1ETB1 1GTFA 1NKOA 4NYLB 2NYKA 1XL4A 4IOFD 3LXCA 4JFZL 4OUOA 4Y5YB 6FABL 5IW6B 4WEBL 3ZQ9A 3VWKD 1PNDA 1D5XB 3GRWA 1JWMA 1KT2A 1UWEL 4HKBA 4BKSC 1OCWL 2BXZA 2DQGL 3GLZA 1CYXA 4JQIL 3BN9D 2FJGB 1DVUA 5J11B 5J13B 4F7CA 5CBAA 3GXMA 1T5WA 4ILDA 1E9QA 2MCPH 3AS0A 3O3EA 4FXLA 5H35A 4F2FA 4HZAA 1LMKA 3HBZA 4GOSA 2Q3AA 1X5KA 2FJHA 4JCLA 5GSRA 4B9YA 3GMRA 4OAWB 3QJQB 4B95C 2NY1B 4LSRL 4N0FB 4NQEE 1KB9K 4K5PA 3VXQB 5I1IL 5D7LE 1OP5H 3AG1B 1BVZA 5C09E 5FV1L 4HW6A 2QV4A 4PQXA 4U1HA 5FFOA 3VTTA 4FQ1H 4AQ8A 2OW6A 3CFMA 4U7KA 4HMDA 4OLWL 1CD8A 3HG2A 1WCBB 3UG3A 3Q3GB 3P1VA 2QPUA 4ZZKA 1RFDH 1MHCA 2D31A 2DN7A 4OZIF 4R4BB 4WNQB 1FGNH 1I1AB 2H0JA 2W0PA 2QPFA 5KSAD 5KWYC 4LCWA 4L4JA 2DH2A 1WUNT 4IMKC 5IV2A 3WDJA 4QXTB 5KYYA 5C0CA 4OW6A 1IE4A 2JXMB 4MBOA 5E4OA 3X3FH 4NIYE 1KBKA 4GAYA 4DP8X 5EIIA 2WO2B 5FYLL 3IGKA 2B08A 5D5MF 5D72L 1BM7A 2EDDA 2ED7A 5L4JA 5TGBA 2L7EA 3UBXG 3IVKB 3L3IA 4P04A 1BEXA 1HAUA 2CG9X 4NHUB 4NRYA 3SDAD 3IVKA 1QEWB 3C6SB 1MDTA 1OAQL 2A6IA 3DMMD 4I0CC 5E03A 3TC9A 4AJ0A 5L7XH 4MZRA 4GQ9H 1A5FL 3NJFA 5KVFH 2MTAA 5KSUA 2ITDB 3VGGA 1IM9B 1NIDA 1QAWA 4GI6A 1LK3L 1M7XA 4LZKA 2PCYA 4GUPB 1B3JA 5JHDA 3GJEA 4KK9D 3EFFA 2ZXAA 3JWDC 3DECA 2QADB 4S0TD 4ZO6A 1NCOA 3CZUB 3KWXA 1VENA 4GW5B 3CLEH 3WTVA 1EDHA 5EBWA 5EF2A 4HCIA 2QTEA 3QJTB 4UQAA 1OW0C 4DIXA 1A64A 4JPWL 3DK2A 4AOFA 4ACTA 4YSTA 3BD3A 3KWUA 4P99A 1J86A 1G7IA 5DJZB 1H3UA 1P84J 1QHQA 1EHLL 5JHLA 4LHUA 4L1LA 3ZSTA 1XSKA 4WU5B 1AO7B 4H25B 4AL8L 2H32H 3MRNB 4KZCA 4OV6F 1UA7A 4JFPA 2FQFA 1TLMA 1OARL 2ZUWA 2F68X 5EUOE 3IETA 2R0LL 3IETB 4ATWA 4PRPA 2I25N 4MJ5B 1BVKA 1IEBA 4QTIL 1RUML 3A22A 2OTUB 5F7NC 4N6RA 2ENQA 3L1GA 4DO5A 3UBFA 4KU1A 4XNXL 4XNDA 2E9WA 2H6OA 5JMOC 4OZGE 2ZG1A 2X1WL 3WU1A 1JNHB 2O5YL 4HS6B 3BI9X 3P77B 4LLMA 1DBBH 3FO2A 1JL8A 2GKIA 3WEXA 4E2OA 1FZOB 3BUBA 3QEQA 4LP8A 3X1EA 2XWZA 2EIJB 3GMPB 4PJBA 1HQRB 2XA3A 3VD9A 1J18A 5BRZE 2D31B 5LO7A 2ZQKA 2XT1B 5JHDD 2Q2LA 3FU5A 1EHKB 3F65A 5ANHA 3WHXB 4DO6A 3CN3A 4IJTA 4M02A 2DWYA 2W38A 1GIGL 2JJUA 3F7YA 1FRGH 5I1GL 5D2LA 4AM0B 3FUIA 1IL1B 2GTWB 4CILA 2D4DA 3VYNA 1XWVA 3GQFA 2OULB 3RG1C 2C1PB 2IDTA 2DWTA 3NZ8A 3SJVB 5C0JA 5C9JA 3L3IB 4B9GA 3IMBA 2Z35A 3OC5A 1MFBL 4FF9A 1KTLA 1T20A 3WY4A 4MB4A 2CKNA 1CD9B 3NJGA 2YAFA 3CSFA 2GK0B 1PKQE 4N22A 2ALWA 4QI3A 4A7SA 2AQ1A 4LHJB 4X7TA 1R33A 2YUVA 3L9RA 5JHDB 1PX4A 2IALA 2VJ8A 4GB9A 4XPAH 4IRSA 4YBHA 4A2LA 4HXAL 1M71B 5DMJB 1IC7H 4PRAB 4UINH 3OHXB 2XTJB 4BV1A 3LZNA 4PJCF 5AD0A 3OHXA 1TR7A 5CJXC 5B7EA 3C2SA 3LN9A 4CJ0A 3US0A 1DN0A 5F1NA 5AG9A 4C58B 4MS6A 3TO4A 1PBYA 1OZUA 2IDQA 3FJTA 4L8BB 3S2AA 5GSVB 2LOEA 3LEYH 5I28A 3SSGA 3PFUA 1VEMA 2AAVA 5EC2A 3FUJA 1BPLB 3B9AA 4HJ0C 3VTMA 3L2MA 4KAQH 1NSNL 4RX4D 4FFVD 3ZN6A 2PTVA 3BP4B 4GXUN 4CU6A 5C71A 1WHOA 3FO9B 1T2QH 1ZT1B 2ORBL 4OTXL 3MCKA 2PCPB 4PREA 3RY4A 1U95B 4RETB 1OM3H 3VTAA 1S3RA 1A1OA 4B41A 1HZHL 1G4RA 5E8OA 3O3DB 1T3FA 4BQ9A 2H7WA 1ET5A 4WTWA 2VABB 2UVFA 1N18A 4WWOA 2QT6A 3RX7A 1UG9A 4RWHA 2I32A 1ZCRA 2CDGA 3LKRB 1ZVSB 4QRSA 5A2LH 2K7QA 4E5XG 2W07A 1EJFA