1S03G

The structure of a ribosomal protein s8/spc operon mrna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
b'DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 47-MER
publication title The structure of a ribosomal protein S8/spc operon mRNA complex.
pubmed doi rcsb
molecule tags Transcription/rna
total genus 29
structure length 126
sequence length 126
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1s03G01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s03G02
3JAMW 1FKAH 5LMUH 3RF2A 4LF8H 1SEIA 4B3MH 2UXDH 2UXBH 3J80W 1FJGH 4DR2H 1HNZH 4DUZH 4JI2H 5FLXW 4B3SH 4YY3H 4LFAH 4JYAH 1I6UA 3OTOH 4DV5H 4DR3H 4PDBA 1XMQH 4NXMH 4NXNH 4JI5H 1HNXH 4OX9H 5IWAH 2F4VH 1IBLH 4DV3H 3T1YH 4JI8H 4B3TH 4X64H 4LF5H 5LL6b 3J7AK 1N33H 5A2QW 4DR1H 4DV2H 4LF6H 4DR5H 1XMOH 4JI4H 4B3RH 4GKKH 4DR7H 4X62H 4JI3H 2VQFH 1IBKH 4DR4H 1HR0H 4DUYH 4K0KH 4LFBH 1S03G 2UUCH 4KHPH 2E5LH 4DV0H 4JI6H 3J81W 4X66H 1J5EH 4DV6H 1I94H 4LFCH 1N36H 4JI1H 2HHHH 2UU9H 4LF9H 4GKJH 4LF4H 4JV5H 3T1HH 2UUBH 5IT9W 5LMNH 4YHHH 1HNWH 2VQEH 2UUAH 1AN7A 4DV7H 4DV4H 4X65H 4DV1H 4DR6H 2UXCH 1XNQH 4LF7H 1XNRH 5BR8H 2ZM6H 1N34H 4AQYH 1IBMH 4JI0H 4JI7H 1N32H
chains in the Genus database with same CATH superfamily
3N8DA 1SCUB 1KJQA 4DL3A 2C00A 3KXYT 2RDJA 5IYZF 3RF2A 1V8CA 3R5FA 1TA8A 1WCMG 2R7LA 3NCVA 4I4TF 3G6XA 5D1PA 1Y1VA 1RYSA 1EUCB 1SEIA 3VPCA 4B3MH 1GSHA 4WANA 3KHRA 2M05A 2V58A 1PX2A 4QWDA 5DG7A 3PO3G 1CQIB 1FVIA 1M0WA 2I8CA 1FJGH 2VOBA 2AU0A 4OO1G 1JLLB 2CW7A 3BABA 3UFXB 1SYXB 2V59A 3HOWG 4TV9F 4BY1G 4JI2H 3N43B 3RGZA 3WO1A 4ECTA 4A93G 1E4FT 4APMA 4U7CA 2XC9A 2V4QA 5KT2A 1VBHA 2CTJA 2WDTA 3EPIA 1IOVA 2NVXA 1RK5A 1RK6A 2FJZA 4TUYF 2GPWA 3GTKA 4A3MG 3AYHB 4Q8EA 1XMQH 4I7HA 2Q2UA 4DL6A 4RAYA 3FKIG 2FMAA 4ED0A 1DV2A 5EWFA 1CQJB 1TAEA 4EYHB 2R85A 2I80A 3KALA 4L1KA 2CTLA 3V6HA 1PQXA 1WH2A 2ANNA 2DIKA 3U9SA 4OX9H 5FJ8G 2R92G 2LF0A 2F4VH 3N44B 1VS0A 1KC7A 1Y1WG 3ORRA 1IBLH 2ANRA 4DV3H 2M6QA 3CQZA 4O3SA 4J0MA 5BMVF 1WTJA 2OPUA 1WHRA 1K1GA 5C44G 1NXUA 1TWGA 3PW0A 4RAZA 5EWEA 3RB3A 4A3EG 1SFOA 3U9TA 3Q2OA 4YAJB 2FK1A 2BR0A 1B04A 5T14A 2B63A 3G8CA 4YJ2F 2DPIA 1A9XA 3GQCA 3ETJA 1TWFA 2E2HA 1ZZIA 2JA9A 4LF6H 4Q43A 4RNMA 3L7ZC 3GV5B 2FKLA 4UCRA 5FD5A 4UCVA 3GIPA 3HOZG 1BNCA 1RJQA 3OUUA 4IHJF 4CC6A 4LSXA 3BAAA 4EFEA 1X9ZA 5DLFA 1W93A 3RB0A 3I4NG 3PR5B 5KFNA 4J9LA 3MR5A 2D9IA 4DUYH 5DQIA 3GIMA 4YR2A 3PR4A 1R9TA 1JXLA 2JA8G 5KFHA 3GIKA 1P8LA 4DV0H 2W6PA 1B33N 4M7EA 4QWCA 2JE6I 2JA7A 4BY7G 3BQ1A 3JRXA 3HOXG 3TIIA 1MZBA 4R7RA 1Y14B 1J5EH 3V4SA 5KFBA 2C2EA 3L4JA 1I94H 3F8NA 2HJWA 4LH6A 5IYBG 4ZQIA 4XX0B 1DTJA 1N36H 2FMRA 2UVUA 3TIGA 4F4XA 2HVSA 3GIQA 1DT4A 4OD6A 4LF9H 4HNVA 3OHBA 5KFIA 2KSWA 4NLGA 2HH3A 2X0SA 4RZRA 1JX4A 2JA5G 1GSOA 4G08A 2UUBH 3I12A 2FLPA 3RV3A 2BQRA 5L1KA 5KFCA 4O3RA 2YRWA 4XYLB 4QWBA 3BQ0A 3GTGA 4WD3A 1WCMA 5KG1A 2YZNA 4ECYA 4HQ6A 2B63G 5KG4A 5JH7F 1A0IA 1UNNC 5LP6F 1EYZA 2Y3MA 4NZTM 1V9PA 4O2BF 5IP7G 2HVQA 1S20A 4DV1H 3M9MB 2UVWA 1J4WA 4RU9A 5BPFA 4ECVA 2UXCH 2J9GA 3UQ8A 1XNQH 3Q8QB 3IN5A 2VR1A 2PVPA 4IWYA 5F9LA 3M9OB 3PVXA 5FPRA 2VUMA 3JAMW 2X06A 4O3PA 4NBQA 4O2AF 2CTEA 1C3OA 4XZ3B 5LMUH 3I0PA 1UC8A 4GC7A 4O3OA 4MA0A 3ORQA 3VMMA 5CAEB 4UCOA 3RB6A 2AXYA 2SCUB 4F4WA 4JV2A 3VKEA 2RGVA 4J9SA 1JDBB 1ZQ7A 3RB4A 4BWSC 1ULZA 2DPJA 3Q8PB 1XRHA 3N6XA 5C0XG 4RNOA 4A3IG 2JA7G 1HNZH 2E3UA 5L1LA 4FS2A 2XCAA 5JEAG 4DUZH 1ODHA 4DL4A 3WO0A 2QK4A 2R92A 2YL2A 4A3CG 1M6VA 4LFAH 4JYAH 1I6UA 1Y1WA 5L1IA 3OTOH 5KFKA 4QWEA 4MV9A 2FPGB 2W6NA 2BL5A 2W6ZA 4PDBA 2PMZE 4ETSA 4IWXA 4PWQA 1C30A 3GKUA 2JA6G 2V4RA 1WE8A 4YR0A 5EOYA 1AUVA 4NXMH 2FB9A 3HKZA 3SB1A 3KAJA 3VPDA 2W9BB 2C35B 2CWHA 2FFMA 5L9XA 3HKZE 1GSAA 3GTMA 4BA2I 4BA1I 2ZQEA 2YU9A 4TQRA 5JQWA 3HOVG 3TQ1A 4JV1A 1VKZA 4A3GG 4WALA 3RV4A 2LRRA 1MSZA 1VBIA 2VUMG 4B3TH 4X64H 3GR5A 3J7AK 1VBGA 3BA9A 2ATLA 1S9FA 2PBZA 4A2BA 5A2QW 5KFYA 5BPHA 1N48A 1UG8A 2W9CB 2VQDA 4DR5H 4RNNA 3KHLA 4B3RH 5LOVF 3GTPA 4EYIB 4HR7A 5EDWA 5KG3A 3L2PA 4AYBA 2R87A 3GIIA 5KFVA 2C28A 1IBKH 4IFDG 4DR4H 5FPOA 4AYBE 3KTMA 5KFMA 4K0KH 4LFBH 4O3NA 4Q45A 4FU0A 3SE7A 4ECQA 2VA3A 4KHPH 4F4YA 2LTMA 5DLGA 2C2DA 2XCLA 2UVVA 3RAXA 3M9NB 2JA5A 5H80A 3AEVB 4QW9A 5KT6A 1VAJA 3H0GG 2JEFA 2NN6G 2OPVA 5KG6A 3PW2A 4ED8A 3GTQA 5FLMG 2R7MA 2XCPA 2GLTA 4JV0A 3EZJA 4EGJA 2ZDQA 4HNTA 4YP3A 4DV6H 5KFFA 4DLKA 1JDEA 1S68A 5C8YF 4EBCA 4LFCH 2VKCA 3MR6A 3V6JA 2CW8A 1N56A 1WVNA 2UU9H 4H8AA 1V9NA 3RIZA 3SI8A 1ZETA 1K83A 4GKJH 2W7OA 4LF4H 3OUZA 4J9NA 5KG5A 1KJ9A 2XGPA 5IT9W 1RJRA 5CA0F 4RUAA 4JVHA 5KFPA 1L2ZA 3BA8A 4ZOLF 3QZ7A 3JSLA 1HNWH 3KAKA 4ECRA 2Q2TA 2FK2A 4FBTA 1WSCA 4IRCA 1AN7A 4EEQA 4ECZA 2V9WA 2FPPB 1E4EB 5DT9A 4DR6H 5KFOA 2V5AA 2ASDA 4FM9A 3KDGA 1I50A 2CTMA 2R7NA 4RB0A 3T5KA 2JEBI 4LIJA 1XNRH 1EUDB 4UCTA 5BR8H 5LA6F 4R8UB 5EWGA 4JI0H 4BBSG 1N32H 4M9UA 4C2MA 2IBKA 4ED6A 1FKAH 1VIHA 2PN1A 1TWAA 3GILA 5KFGA 5KT7A 3QZ8A 5JVLA 2C2RA 2W8LA 1KJ8A 5HBRB 2ALZA 4MAMA 3L4KA 3H20A 2JEIA 2OH2A 2W6QA 5K2MA 4J9OA 2YCHA 2FLLA 2UXDH 2XGQA 3GV8B 1ZZKA 2UXBH 3N41B 4DL2A 2JA6A 2CQYA 1WR2A 3RAQA 3HOYG 2W57A 1M7JA 1W96A 5KFSA 2M8WA 4LMYA 2CZGA 3N42B 3MR3A 2BQUA 4UFZA 2NU8B 2AQ4A 4ECSA 2WTFA 2MJHA 4A3DG 4YB8B 4TV8F 3HOUG 1RJPA 4MV8A 3Q8SB 1S0MA 4EGQA 2J6TA 2J6UA 4DR3H 5KFLA 1DV1A 2WAQA 3HB9A 4I55F 4ED1A 4DL7A 1S97A 2O03A 5HV6A 4RB1A 4O4LF 5KFJA 4EC5A 1KEEA 2WAQE 4MV1A 4HYKA 2BQ3A 2CTKA 3EYYA 4B8TA 4QWAA 5C4XG 4NXNH 3T5JA 4LSAA 5D1OB 1ZZJA 4JI5H 4A3KG 1HNXH 5C1PA 1DIKA 4A3JG 5IWAH 4RB2C 2YZGA 3EPGA 2DLNA 2AGQA 5KT4A 4MTDA 2HH2A 4GLXA 4ECXA 4JI8H 2O4CA 3CVZA 4TQSA 3V4ZA 4EBDA 4IRKA 4LF5H 4XYMB 5I47A 3BQ2A 3GTLA 3LMLA 3PW4A 3MWDA 2P2RA 4A3FG 2PMZA 5C3EG 3H0GA 4DR1H 4LH7A 3RGXA 2QYZA 1S0NA 4DV2H 3RUPA 3RJ0A 2VA2A 4FBUA 1XMOH 4IR9A 4JI4H 1GYFA 4RZQA 4O3QA 2W70A 3Q8RB 2ASJA 1BJTA 2YS7A 2CPQA 4GKKH 3M4IA 2NU9B 5DGAA 2W8KA 3T5LA 3G6VA 1O75A 4DL5A 2J6SA 4DR7H 4X62H 3LWBA 4JI3H 4MTEA 5JVDF 1X9NA 2VQFH 1X4MA 1GO3E 3E5NA 1HR0H 2YRXA 4AM3A 1E4GT 1BGWA 1S03G 1V4YA 1XDNA 5KFWA 2UUCH 2IMWP 2FE3A 1JIHA 1DGSA 1KJJA 3NGDA 4F50A 2W6OA 2E5LH 3PN1A 2WYOA 4JI6H 2GPSA 3HXLA 1CE8A 5F9NA 4YQWA 3J81W 2R7ZA 2VUGA 1ZHQA 5IYDG 5KG0A 2W9BA 3UOEA 4X66H 3JZIA 4J9RA 4QJFA 4MA5A 2YQRA 1I7LA 4YR3A 3OETA 1EZ1A 1AUXA 2P0AA 4MV3A 5FD6A 4YBZB 2AGOA 2R84A 2NVYA 2NUAB 4IR1A 3H4BA 2JZXA 3MWMA 1X0AA 2R7KA 1TUAA 4F4ZA 4FJUA 4J9MA 4QW8A 1B6RA 4GC6A 4JV5H 3T1HH 5KFAA 3BG5A 2W9AA 4O4HF 3ETHA 1X4NA 5LMNH 2CTFA 1Z2PX 2Y0SA 3QFFA 4AIMA 5DG8A 3KHHA 2LTLA 2VQEH 4ZHQF 2YS6A 2RDIA 3JRWA 2W9CA 2UUAH 3GLKA 5DGBA 4ECWA 3H3VH 3K5HA 3OSSD 5KFDA 2Y0SE 2RGRA 4DV7H 1KHMA 4C5CA 4DV4H 4BXXG 4X65H 2IP4A 3QD7X 5KFXA 3OHAA 5J2UF 3HBLA 3JSNA 1GLVA 2FP4B 2ZM6H 5KFRA 1N34H 2ASLA 4JI7H 2R86A 3V69A 4UCSA 2R8IA 2FLNA 5KFQA 5KG7A 2A1SA 2DZDA 1ZHSA 2XIGA 3DF7A 2YW2A 2PY9A 4ED3A 3H4DA 4LF8H 3WNZA 1K1QA 1CS0A 2WB1A 4ZI7F 1KJIA 1I3QA 2G8YA 2FK3A 3MJFA 4O4IF 4B8CD 4I50F 4CC5A 2K1HA 5L1JA 1S0OA 2R8HA 2WB1E 5DG9A 5KX5F 4E9JA 2YYAA 3GV7B 3K3VA 2JEJA 3J80W 4IZOA 3PZPA 4DR2H 4IAJA 2R7ZG 2E2IA 1RYRA 2R8GA 5JUMA 3C0FB 4Q8FA 2R8JA 5FLXW 4B3SH 5K36G 4YY3H 5CA1F 2QNDA 5IP9G 3MFIA 2MCTA 2JEGA 1Z2NX 4NZRM 2HGSA 1T94A 2RF4A 2ZJTA 4DV5H 4JUZA 2ZDGA 1Y1VG 4MV4A 4A3LG 2CPMA 4MV7A 3OSPA 4BBRG 1KBLA 1ZTGA 5KFUA 1T3NA 2R82A 4EBEA 4G3IA 1E4EA 5LYJF 4FJSA 3PO2G 2FPHX 5KG2A 4ECUA 3TQTA 2DWCA 4WBNF 4QMFB 1EHIA 3VPBA 5KT3A 5DQGA 2W71A 3IG0A 4R8UA 2W6MA 1TWCA 4A2AA 3I4MG 1B6SA 4U6PA 2VPSA 5J2TF 4IRDA 1PK8A 2WE6A 2PT7G 3MR2A 3PW5A 3T1YH 1I7NA 4Q44A 1Z2OX 2NU7B 4Y8VB 2NU6B 5GONF 5LL6b 4ME6A 1N33H 3FAUA 5C5JA 3GABA 1S10A 3K3PA 4UCUA 2BA0A 3H40A 4A3BG 2R6FA 2R93A 3R5HA 2VPQA 2DGRA 3T5HA 1Z2IA 2Z0SA 3Q1KA 5EZYF 3V6KA 1M0TA 2R8KA 2I87A 4HNUA 3RFCA 3MFHA 4OCHA 3RTXA 2ZDHA 4EFBA 1EC6A 4YJ3F 3PW7A 3FDSA 2OLSA 4YAKB 4ED7A 2CWFA 4J9KA 2C22A 3LP8A 4E4TA 1TWHA 2XD4A 4JVYA 3MWEA 5KKNB 5DQHA 1VIGA 4ED2A 5KFTA 4J9PA 4C5AA 3RBDA 3G6YA 5D8DA 1JKJB 2JVZA 3K5IA 4Q0YA 2HVRA 2OWOA 3FMAA 3OSNA 4QIWA 5D1OA 2CKZB 3KDKA 4FS1A 5KFZA 3GTOA 4C5BA 3KHGA 3R5XA 4QIWE 3N40P 1F0XA 4EEYA 1IOWA 4JI1H 2FPIB 2HHHH 4EG0A 2PQUA 1K1SA 5KFEA 5C1OA 1UC9A 3R23A 5IYCG 1V51A 5LXTF 5CB4F 3GIDA 3FKIA 4YHHH 4RUCA 3GTJA 2W7PA 3BJYA 2IA6A 4RB3C 1GGOA 4MV6A 3TINA 3GIJA 2YZMA 4J9QA 1T36A 1J5KA 2AGPA 2R93G 1BXRA 3U1KA 1OWTA 5KT5A 4LF7H 2JEAI 3RBEA 2UVRA 4AQYH 1IBMH
chains in the Genus database with same CATH topology
4UCSA 3JAMW 1FKAH 1ZHSA 2XIGA 3DF7A 5LMUH 3KXYT 3RF2A 4LF8H 4UCOA 1TA8A 3NCVA 3L4KA 5D1PA 3H20A 1SEIA 2RGVA 4CC5A 4B8CD 4B3MH 2YCHA 2UXDH 4BWSC 4E9JA 1M0WA 2UXBH 1FVIA 3J80W 3K3VA 3N41B 3N6XA 1FJGH 2VOBA 4DR2H 2W57A 4IAJA 1HNZH 4LMYA 2CW7A 3BABA 1SYXB 3N42B 4DUZH 1ODHA 3C0FB 4UFZA 4JI2H 3N43B 5FLXW 4B3SH 3RGZA 4YY3H 4LFAH 4JYAH 1I6UA 2MCTA 1E4FT 1Z2NX 4NZRM 3OTOH 2HGSA 4APMA 2ZJTA 4DV5H 4DR3H 2WDTA 4MV9A 4MV7A 4PDBA 4ETSA 2O03A 4RB1A 1XMQH 4I7HA 2Q2UA 4EC5A 4RAYA 3EYYA 1TAEA 2FPHX 5EOYA 4NXMH 3SB1A 4NXNH 3KAJA 3KALA 4LSAA 5D1OB 4JI5H 1WH2A 3IG0A 1HNXH 4OX9H 2ZQEA 2LF0A 5IWAH 2F4VH 3N44B 4A2AA 1VS0A 4RB2C 1IBLH 2VPSA 4DV3H 4J0MA 4MTDA 2WE6A 4GLXA 2PT7G 3T1YH 2O4CA 4JI8H 3CVZA 4RAZA 1Z2OX 4B3TH 4X64H 4LF5H 1B04A 5LL6b 3GR5A 3J7AK 3LMLA 1N33H 3FAUA 3BA9A 3GABA 4A2BA 5A2QW 4DR1H 4LH7A 4UCUA 3RGXA 4DV2H 4LF6H 3RJ0A 4DR5H 1XMOH 1GYFA 4JI4H 4RZQA 4B3RH 4UCRA 5FD5A 4UCVA 1BJTA 4GKKH 1M0TA 3M4IA 4CC6A 3L2PA 1O75A 4LSXA 3BAAA 4EFEA 4DR7H 1X9ZA 4X62H 4JI3H 4MTEA 4OCHA 3RTXA 4EFBA 2VQFH 1X9NA 1IBKH 4DR4H 5FPOA 1HR0H 2D9IA 4DUYH 4K0KH 4LFBH 1S03G 1BGWA 1E4GT 1XDNA 2UUCH 4KHPH 2FE3A 1DGSA 3PN1A 2E5LH 1P8LA 4DV0H 4JI6H 2WYOA 3HXLA 4M7EA 3J81W 4Q0YA 2HVRA 2VUGA 1ZHQA 3FMAA 2OWOA 1MZBA 4R7RA 4X66H 1J5EH 5D1OA 3KDKA 3EZJA 4DV6H 3OETA 5FD6A 1S68A 3L4JA 1I94H 3F8NA 4LFCH 2VKCA 4LH6A 3N40P 1F0XA 1N36H 4JI1H 2HHHH 2CW8A 3MWMA 2HVSA 2UU9H 4LF9H 4OD6A 3RIZA 4GKJH 2KSWA 4LF4H 4JV5H 3T1HH 4G08A 2UUBH 5IT9W 1L2ZA 3BA8A 5LMNH 4YHHH 1Z2PX 3JSLA 1HNWH 3KAKA 2Q2TA 2VQEH 2UUAH 1AN7A 1A0IA 3OSSD 4EEQA 4RB3C 2RGRA 2Y3MA 4NZTM 5DT9A 4DV4H 4DV7H 1V9PA 4X65H 4DV1H 2HVQA 4DR6H 3QD7X 4FM9A 3KDGA 2UXCH 4RB0A 3UQ8A 1XNQH 4LF7H 1XNRH 3JSNA 4UCTA 5BR8H 2ZM6H 1N34H 4AQYH 1IBMH 4JI0H 4JI7H 1N32H 5FPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM W;  1FKA H;  5LMU H;  3RF2 A;  4LF8 H;  1SEI A;  4B3M H;  2UXD H;  2UXB H;  3J80 W;  1FJG H;  4DR2 H;  1HNZ H;  4DUZ H;  4JI2 H;  5FLX W;  4B3S H;  4YY3 H;  4LFA H;  4JYA H;  1I6U A;  3OTO H;  4DV5 H;  4DR3 H;  4PDB A;  1XMQ H;  4NXM H;  4NXN H;  4JI5 H;  1HNX H;  4OX9 H;  5IWA H;  2F4V H;  1IBL H;  4DV3 H;  3T1Y H;  4JI8 H;  4B3T H;  4X64 H;  4LF5 H;  5LL6 b;  3J7A K;  1N33 H;  5A2Q W;  4DR1 H;  4DV2 H;  4LF6 H;  4DR5 H;  1XMO H;  4JI4 H;  4B3R H;  4GKK H;  4DR7 H;  4X62 H;  4JI3 H;  2VQF H;  1IBK H;  4DR4 H;  1HR0 H;  4DUY H;  4K0K H;  4LFB H;  1S03 G;  2UUC H;  4KHP H;  2E5L H;  4DV0 H;  4JI6 H;  3J81 W;  4X66 H;  1J5E H;  4DV6 H;  1I94 H;  4LFC H;  1N36 H;  4JI1 H;  2HHH H;  2UU9 H;  4LF9 H;  4GKJ H;  4LF4 H;  4JV5 H;  3T1H H;  2UUB H;  5IT9 W;  5LMN H;  4YHH H;  1HNW H;  2VQE H;  2UUA H;  1AN7 A;  4DV7 H;  4DV4 H;  4X65 H;  4DV1 H;  4DR6 H;  2UXC H;  1XNQ H;  4LF7 H;  1XNR H;  5BR8 H;  2ZM6 H;  1N34 H;  4AQY H;  1IBM H;  4JI0 H;  4JI7 H;  1N32 H; 
#chains in the Genus database with same CATH topology
 3N8D A;  1SCU B;  1KJQ A;  4DL3 A;  2C00 A;  3KXY T;  2RDJ A;  5IYZ F;  3RF2 A;  1V8C A;  3R5F A;  1TA8 A;  1WCM G;  2R7L A;  3NCV A;  4I4T F;  3G6X A;  5D1P A;  1Y1V A;  1RYS A;  1EUC B;  1SEI A;  3VPC A;  4B3M H;  1GSH A;  4WAN A;  3KHR A;  2M05 A;  2V58 A;  1PX2 A;  4QWD A;  5DG7 A;  3PO3 G;  1CQI B;  1FVI A;  1M0W A;  2I8C A;  1FJG H;  2VOB A;  2AU0 A;  4OO1 G;  1JLL B;  2CW7 A;  3BAB A;  3UFX B;  1SYX B;  2V59 A;  3HOW G;  4TV9 F;  4BY1 G;  4JI2 H;  3N43 B;  3RGZ A;  3WO1 A;  4ECT A;  4A93 G;  1E4F T;  4APM A;  4U7C A;  2XC9 A;  2V4Q A;  5KT2 A;  1VBH A;  2CTJ A;  2WDT A;  3EPI A;  1IOV A;  2NVX A;  1RK5 A;  1RK6 A;  2FJZ A;  4TUY F;  2GPW A;  3GTK A;  4A3M G;  3AYH B;  4Q8E A;  1XMQ H;  4I7H A;  2Q2U A;  4DL6 A;  4RAY A;  3FKI G;  2FMA A;  4ED0 A;  1DV2 A;  5EWF A;  1CQJ B;  1TAE A;  4EYH B;  2R85 A;  2I80 A;  3KAL A;  4L1K A;  2CTL A;  3V6H A;  1PQX A;  1WH2 A;  2ANN A;  2DIK A;  3U9S A;  4OX9 H;  5FJ8 G;  2R92 G;  2LF0 A;  2F4V H;  3N44 B;  1VS0 A;  1KC7 A;  1Y1W G;  3ORR A;  1IBL H;  2ANR A;  4DV3 H;  2M6Q A;  3CQZ A;  4O3S A;  4J0M A;  5BMV F;  1WTJ A;  2OPU A;  1WHR A;  1K1G A;  5C44 G;  1NXU A;  1TWG A;  3PW0 A;  4RAZ A;  5EWE A;  3RB3 A;  4A3E G;  1SFO A;  3U9T A;  3Q2O A;  4YAJ B;  2FK1 A;  2BR0 A;  1B04 A;  5T14 A;  2B63 A;  3G8C A;  4YJ2 F;  2DPI A;  1A9X A;  3GQC A;  3ETJ A;  1TWF A;  2E2H A;  1ZZI A;  2JA9 A;  4LF6 H;  4Q43 A;  4RNM A;  3L7Z C;  3GV5 B;  2FKL A;  4UCR A;  5FD5 A;  4UCV A;  3GIP A;  3HOZ G;  1BNC A;  1RJQ A;  3OUU A;  4IHJ F;  4CC6 A;  4LSX A;  3BAA A;  4EFE A;  1X9Z A;  5DLF A;  1W93 A;  3RB0 A;  3I4N G;  3PR5 B;  5KFN A;  4J9L A;  3MR5 A;  2D9I A;  4DUY H;  5DQI A;  3GIM A;  4YR2 A;  3PR4 A;  1R9T A;  1JXL A;  2JA8 G;  5KFH A;  3GIK A;  1P8L A;  4DV0 H;  2W6P A;  1B33 N;  4M7E A;  4QWC A;  2JE6 I;  2JA7 A;  4BY7 G;  3BQ1 A;  3JRX A;  3HOX G;  3TII A;  1MZB A;  4R7R A;  1Y14 B;  1J5E H;  3V4S A;  5KFB A;  2C2E A;  3L4J A;  1I94 H;  3F8N A;  2HJW A;  4LH6 A;  5IYB G;  4ZQI A;  4XX0 B;  1DTJ A;  1N36 H;  2FMR A;  2UVU A;  3TIG A;  4F4X A;  2HVS A;  3GIQ A;  1DT4 A;  4OD6 A;  4LF9 H;  4HNV A;  3OHB A;  5KFI A;  2KSW A;  4NLG A;  2HH3 A;  2X0S A;  4RZR A;  1JX4 A;  2JA5 G;  1GSO A;  4G08 A;  2UUB H;  3I12 A;  2FLP A;  3RV3 A;  2BQR A;  5L1K A;  5KFC A;  4O3R A;  2YRW A;  4XYL B;  4QWB A;  3BQ0 A;  3GTG A;  4WD3 A;  1WCM A;  5KG1 A;  2YZN A;  4ECY A;  4HQ6 A;  2B63 G;  5KG4 A;  5JH7 F;  1A0I A;  1UNN C;  5LP6 F;  1EYZ A;  2Y3M A;  4NZT M;  1V9P A;  4O2B F;  5IP7 G;  2HVQ A;  1S20 A;  4DV1 H;  3M9M B;  2UVW A;  1J4W A;  4RU9 A;  5BPF A;  4ECV A;  2UXC H;  2J9G A;  3UQ8 A;  1XNQ H;  3Q8Q B;  3IN5 A;  2VR1 A;  2PVP A;  4IWY A;  5F9L A;  3M9O B;  3PVX A;  5FPR A;  2VUM A;  3JAM W;  2X06 A;  4O3P A;  4NBQ A;  4O2A F;  2CTE A;  1C3O A;  4XZ3 B;  5LMU H;  3I0P A;  1UC8 A;  4GC7 A;  4O3O A;  4MA0 A;  3ORQ A;  3VMM A;  5CAE B;  4UCO A;  3RB6 A;  2AXY A;  2SCU B;  4F4W A;  4JV2 A;  3VKE A;  2RGV A;  4J9S A;  1JDB B;  1ZQ7 A;  3RB4 A;  4BWS C;  1ULZ A;  2DPJ A;  3Q8P B;  1XRH A;  3N6X A;  5C0X G;  4RNO A;  4A3I G;  2JA7 G;  1HNZ H;  2E3U A;  5L1L A;  4FS2 A;  2XCA A;  5JEA G;  4DUZ H;  1ODH A;  4DL4 A;  3WO0 A;  2QK4 A;  2R92 A;  2YL2 A;  4A3C G;  1M6V A;  4LFA H;  4JYA H;  1I6U A;  1Y1W A;  5L1I A;  3OTO H;  5KFK A;  4QWE A;  4MV9 A;  2FPG B;  2W6N A;  2BL5 A;  2W6Z A;  4PDB A;  2PMZ E;  4ETS A;  4IWX A;  4PWQ A;  1C30 A;  3GKU A;  2JA6 G;  2V4R A;  1WE8 A;  4YR0 A;  5EOY A;  1AUV A;  4NXM H;  2FB9 A;  3HKZ A;  3SB1 A;  3KAJ A;  3VPD A;  2W9B B;  2C35 B;  2CWH A;  2FFM A;  5L9X A;  3HKZ E;  1GSA A;  3GTM A;  4BA2 I;  4BA1 I;  2ZQE A;  2YU9 A;  4TQR A;  5JQW A;  3HOV G;  3TQ1 A;  4JV1 A;  1VKZ A;  4A3G G;  4WAL A;  3RV4 A;  2LRR A;  1MSZ A;  1VBI A;  2VUM G;  4B3T H;  4X64 H;  3GR5 A;  3J7A K;  1VBG A;  3BA9 A;  2ATL A;  1S9F A;  2PBZ A;  4A2B A;  5A2Q W;  5KFY A;  5BPH A;  1N48 A;  1UG8 A;  2W9C B;  2VQD A;  4DR5 H;  4RNN A;  3KHL A;  4B3R H;  5LOV F;  3GTP A;  4EYI B;  4HR7 A;  5EDW A;  5KG3 A;  3L2P A;  4AYB A;  2R87 A;  3GII A;  5KFV A;  2C28 A;  1IBK H;  4IFD G;  4DR4 H;  5FPO A;  4AYB E;  3KTM A;  5KFM A;  4K0K H;  4LFB H;  4O3N A;  4Q45 A;  4FU0 A;  3SE7 A;  4ECQ A;  2VA3 A;  4KHP H;  4F4Y A;  2LTM A;  5DLG A;  2C2D A;  2XCL A;  2UVV A;  3RAX A;  3M9N B;  2JA5 A;  5H80 A;  3AEV B;  4QW9 A;  5KT6 A;  1VAJ A;  3H0G G;  2JEF A;  2NN6 G;  2OPV A;  5KG6 A;  3PW2 A;  4ED8 A;  3GTQ A;  5FLM G;  2R7M A;  2XCP A;  2GLT A;  4JV0 A;  3EZJ A;  4EGJ A;  2ZDQ A;  4HNT A;  4YP3 A;  4DV6 H;  5KFF A;  4DLK A;  1JDE A;  1S68 A;  5C8Y F;  4EBC A;  4LFC H;  2VKC A;  3MR6 A;  3V6J A;  2CW8 A;  1N56 A;  1WVN A;  2UU9 H;  4H8A A;  1V9N A;  3RIZ A;  3SI8 A;  1ZET A;  1K83 A;  4GKJ H;  2W7O A;  4LF4 H;  3OUZ A;  4J9N A;  5KG5 A;  1KJ9 A;  2XGP A;  5IT9 W;  1RJR A;  5CA0 F;  4RUA A;  4JVH A;  5KFP A;  1L2Z A;  3BA8 A;  4ZOL F;  3QZ7 A;  3JSL A;  1HNW H;  3KAK A;  4ECR A;  2Q2T A;  2FK2 A;  4FBT A;  1WSC A;  4IRC A;  1AN7 A;  4EEQ A;  4ECZ A;  2V9W A;  2FPP B;  1E4E B;  5DT9 A;  4DR6 H;  5KFO A;  2V5A A;  2ASD A;  4FM9 A;  3KDG A;  1I50 A;  2CTM A;  2R7N A;  4RB0 A;  3T5K A;  2JEB I;  4LIJ A;  1XNR H;  1EUD B;  4UCT A;  5BR8 H;  5LA6 F;  4R8U B;  5EWG A;  4JI0 H;  4BBS G;  1N32 H;  4M9U A;  4C2M A;  2IBK A;  4ED6 A;  1FKA H;  1VIH A;  2PN1 A;  1TWA A;  3GIL A;  5KFG A;  5KT7 A;  3QZ8 A;  5JVL A;  2C2R A;  2W8L A;  1KJ8 A;  5HBR B;  2ALZ A;  4MAM A;  3L4K A;  3H20 A;  2JEI A;  2OH2 A;  2W6Q A;  5K2M A;  4J9O A;  2YCH A;  2FLL A;  2UXD H;  2XGQ A;  3GV8 B;  1ZZK A;  2UXB H;  3N41 B;  4DL2 A;  2JA6 A;  2CQY A;  1WR2 A;  3RAQ A;  3HOY G;  2W57 A;  1M7J A;  1W96 A;  5KFS A;  2M8W A;  4LMY A;  2CZG A;  3N42 B;  3MR3 A;  2BQU A;  4UFZ A;  2NU8 B;  2AQ4 A;  4ECS A;  2WTF A;  2MJH A;  4A3D G;  4YB8 B;  4TV8 F;  3HOU G;  1RJP A;  4MV8 A;  3Q8S B;  1S0M A;  4EGQ A;  2J6T A;  2J6U A;  4DR3 H;  5KFL A;  1DV1 A;  2WAQ A;  3HB9 A;  4I55 F;  4ED1 A;  4DL7 A;  1S97 A;  2O03 A;  5HV6 A;  4RB1 A;  4O4L F;  5KFJ A;  4EC5 A;  1KEE A;  2WAQ E;  4MV1 A;  4HYK A;  2BQ3 A;  2CTK A;  3EYY A;  4B8T A;  4QWA A;  5C4X G;  4NXN H;  3T5J A;  4LSA A;  5D1O B;  1ZZJ A;  4JI5 H;  4A3K G;  1HNX H;  5C1P A;  1DIK A;  4A3J G;  5IWA H;  4RB2 C;  2YZG A;  3EPG A;  2DLN A;  2AGQ A;  5KT4 A;  4MTD A;  2HH2 A;  4GLX A;  4ECX A;  4JI8 H;  2O4C A;  3CVZ A;  4TQS A;  3V4Z A;  4EBD A;  4IRK A;  4LF5 H;  4XYM B;  5I47 A;  3BQ2 A;  3GTL A;  3LML A;  3PW4 A;  3MWD A;  2P2R A;  4A3F G;  2PMZ A;  5C3E G;  3H0G A;  4DR1 H;  4LH7 A;  3RGX A;  2QYZ A;  1S0N A;  4DV2 H;  3RUP A;  3RJ0 A;  2VA2 A;  4FBU A;  1XMO H;  4IR9 A;  4JI4 H;  1GYF A;  4RZQ A;  4O3Q A;  2W70 A;  3Q8R B;  2ASJ A;  1BJT A;  2YS7 A;  2CPQ A;  4GKK H;  3M4I A;  2NU9 B;  5DGA A;  2W8K A;  3T5L A;  3G6V A;  1O75 A;  4DL5 A;  2J6S A;  4DR7 H;  4X62 H;  3LWB A;  4JI3 H;  4MTE A;  5JVD F;  1X9N A;  2VQF H;  1X4M A;  1GO3 E;  3E5N A;  1HR0 H;  2YRX A;  4AM3 A;  1E4G T;  1BGW A;  1S03 G;  1V4Y A;  1XDN A;  5KFW A;  2UUC H;  2IMW P;  2FE3 A;  1JIH A;  1DGS A;  1KJJ A;  3NGD A;  4F50 A;  2W6O A;  2E5L H;  3PN1 A;  2WYO A;  4JI6 H;  2GPS A;  3HXL A;  1CE8 A;  5F9N A;  4YQW A;  3J81 W;  2R7Z A;  2VUG A;  1ZHQ A;  5IYD G;  5KG0 A;  2W9B A;  3UOE A;  4X66 H;  3JZI A;  4J9R A;  4QJF A;  4MA5 A;  2YQR A;  1I7L A;  4YR3 A;  3OET A;  1EZ1 A;  1AUX A;  2P0A A;  4MV3 A;  5FD6 A;  4YBZ B;  2AGO A;  2R84 A;  2NVY A;  2NUA B;  4IR1 A;  3H4B A;  2JZX A;  3MWM A;  1X0A A;  2R7K A;  1TUA A;  4F4Z A;  4FJU A;  4J9M A;  4QW8 A;  1B6R A;  4GC6 A;  4JV5 H;  3T1H H;  5KFA A;  3BG5 A;  2W9A A;  4O4H F;  3ETH A;  1X4N A;  5LMN H;  2CTF A;  1Z2P X;  2Y0S A;  3QFF A;  4AIM A;  5DG8 A;  3KHH A;  2LTL A;  2VQE H;  4ZHQ F;  2YS6 A;  2RDI A;  3JRW A;  2W9C A;  2UUA H;  3GLK A;  5DGB A;  4ECW A;  3H3V H;  3K5H A;  3OSS D;  5KFD A;  2Y0S E;  2RGR A;  4DV7 H;  1KHM A;  4C5C A;  4DV4 H;  4BXX G;  4X65 H;  2IP4 A;  3QD7 X;  5KFX A;  3OHA A;  5J2U F;  3HBL A;  3JSN A;  1GLV A;  2FP4 B;  2ZM6 H;  5KFR A;  1N34 H;  2ASL A;  4JI7 H;  2R86 A;  3V69 A;  4UCS A;  2R8I A;  2FLN A;  5KFQ A;  5KG7 A;  2A1S A;  2DZD A;  1ZHS A;  2XIG A;  3DF7 A;  2YW2 A;  2PY9 A;  4ED3 A;  3H4D A;  4LF8 H;  3WNZ A;  1K1Q A;  1CS0 A;  2WB1 A;  4ZI7 F;  1KJI A;  1I3Q A;  2G8Y A;  2FK3 A;  3MJF A;  4O4I F;  4B8C D;  4I50 F;  4CC5 A;  2K1H A;  5L1J A;  1S0O A;  2R8H A;  2WB1 E;  5DG9 A;  5KX5 F;  4E9J A;  2YYA A;  3GV7 B;  3K3V A;  2JEJ A;  3J80 W;  4IZO A;  3PZP A;  4DR2 H;  4IAJ A;  2R7Z G;  2E2I A;  1RYR A;  2R8G A;  5JUM A;  3C0F B;  4Q8F A;  2R8J A;  5FLX W;  4B3S H;  5K36 G;  4YY3 H;  5CA1 F;  2QND A;  5IP9 G;  3MFI A;  2MCT A;  2JEG A;  1Z2N X;  4NZR M;  2HGS A;  1T94 A;  2RF4 A;  2ZJT A;  4DV5 H;  4JUZ A;  2ZDG A;  1Y1V G;  4MV4 A;  4A3L G;  2CPM A;  4MV7 A;  3OSP A;  4BBR G;  1KBL A;  1ZTG A;  5KFU A;  1T3N A;  2R82 A;  4EBE A;  4G3I A;  1E4E A;  5LYJ F;  4FJS A;  3PO2 G;  2FPH X;  5KG2 A;  4ECU A;  3TQT A;  2DWC A;  4WBN F;  4QMF B;  1EHI A;  3VPB A;  5KT3 A;  5DQG A;  2W71 A;  3IG0 A;  4R8U A;  2W6M A;  1TWC A;  4A2A A;  3I4M G;  1B6S A;  4U6P A;  2VPS A;  5J2T F;  4IRD A;  1PK8 A;  2WE6 A;  2PT7 G;  3MR2 A;  3PW5 A;  3T1Y H;  1I7N A;  4Q44 A;  1Z2O X;  2NU7 B;  4Y8V B;  2NU6 B;  5GON F;  5LL6 b;  4ME6 A;  1N33 H;  3FAU A;  5C5J A;  3GAB A;  1S10 A;  3K3P A;  4UCU A;  2BA0 A;  3H40 A;  4A3B G;  2R6F A;  2R93 A;  3R5H A;  2VPQ A;  2DGR A;  3T5H A;  1Z2I A;  2Z0S A;  3Q1K A;  5EZY F;  3V6K A;  1M0T A;  2R8K A;  2I87 A;  4HNU A;  3RFC A;  3MFH A;  4OCH A;  3RTX A;  2ZDH A;  4EFB A;  1EC6 A;  4YJ3 F;  3PW7 A;  3FDS A;  2OLS A;  4YAK B;  4ED7 A;  2CWF A;  4J9K A;  2C22 A;  3LP8 A;  4E4T A;  1TWH A;  2XD4 A;  4JVY A;  3MWE A;  5KKN B;  5DQH A;  1VIG A;  4ED2 A;  5KFT A;  4J9P A;  4C5A A;  3RBD A;  3G6Y A;  5D8D A;  1JKJ B;  2JVZ A;  3K5I A;  4Q0Y A;  2HVR A;  2OWO A;  3FMA A;  3OSN A;  4QIW A;  5D1O A;  2CKZ B;  3KDK A;  4FS1 A;  5KFZ A;  3GTO A;  4C5B A;  3KHG A;  3R5X A;  4QIW E;  3N40 P;  1F0X A;  4EEY A;  1IOW A;  4JI1 H;  2FPI B;  2HHH H;  4EG0 A;  2PQU A;  1K1S A;  5KFE A;  5C1O A;  1UC9 A;  3R23 A;  5IYC G;  1V51 A;  5LXT F;  5CB4 F;  3GID A;  3FKI A;  4YHH H;  4RUC A;  3GTJ A;  2W7P A;  3BJY A;  2IA6 A;  4RB3 C;  1GGO A;  4MV6 A;  3TIN A;  3GIJ A;  2YZM A;  4J9Q A;  1T36 A;  1J5K A;  2AGP A;  2R93 G;  1BXR A;  3U1K A;  1OWT A;  5KT5 A;  4LF7 H;  2JEA I;  3RBE A;  2UVR A;  4AQY H;  1IBM H; 
#chains in the Genus database with same CATH homology
 4UCS A;  3JAM W;  1FKA H;  1ZHS A;  2XIG A;  3DF7 A;  5LMU H;  3KXY T;  3RF2 A;  4LF8 H;  4UCO A;  1TA8 A;  3NCV A;  3L4K A;  5D1P A;  3H20 A;  1SEI A;  2RGV A;  4CC5 A;  4B8C D;  4B3M H;  2YCH A;  2UXD H;  4BWS C;  4E9J A;  1M0W A;  2UXB H;  1FVI A;  3J80 W;  3K3V A;  3N41 B;  3N6X A;  1FJG H;  2VOB A;  4DR2 H;  2W57 A;  4IAJ A;  1HNZ H;  4LMY A;  2CW7 A;  3BAB A;  1SYX B;  3N42 B;  4DUZ H;  1ODH A;  3C0F B;  4UFZ A;  4JI2 H;  3N43 B;  5FLX W;  4B3S H;  3RGZ A;  4YY3 H;  4LFA H;  4JYA H;  1I6U A;  2MCT A;  1E4F T;  1Z2N X;  4NZR M;  3OTO H;  2HGS A;  4APM A;  2ZJT A;  4DV5 H;  4DR3 H;  2WDT A;  4MV9 A;  4MV7 A;  4PDB A;  4ETS A;  2O03 A;  4RB1 A;  1XMQ H;  4I7H A;  2Q2U A;  4EC5 A;  4RAY A;  3EYY A;  1TAE A;  2FPH X;  5EOY A;  4NXM H;  3SB1 A;  4NXN H;  3KAJ A;  3KAL A;  4LSA A;  5D1O B;  4JI5 H;  1WH2 A;  3IG0 A;  1HNX H;  4OX9 H;  2ZQE A;  2LF0 A;  5IWA H;  2F4V H;  3N44 B;  4A2A A;  1VS0 A;  4RB2 C;  1IBL H;  2VPS A;  4DV3 H;  4J0M A;  4MTD A;  2WE6 A;  4GLX A;  2PT7 G;  3T1Y H;  2O4C A;  4JI8 H;  3CVZ A;  4RAZ A;  1Z2O X;  4B3T H;  4X64 H;  4LF5 H;  1B04 A;  5LL6 b;  3GR5 A;  3J7A K;  3LML A;  1N33 H;  3FAU A;  3BA9 A;  3GAB A;  4A2B A;  5A2Q W;  4DR1 H;  4LH7 A;  4UCU A;  3RGX A;  4DV2 H;  4LF6 H;  3RJ0 A;  4DR5 H;  1XMO H;  1GYF A;  4JI4 H;  4RZQ A;  4B3R H;  4UCR A;  5FD5 A;  4UCV A;  1BJT A;  4GKK H;  1M0T A;  3M4I A;  4CC6 A;  3L2P A;  1O75 A;  4LSX A;  3BAA A;  4EFE A;  4DR7 H;  1X9Z A;  4X62 H;  4JI3 H;  4MTE A;  4OCH A;  3RTX A;  4EFB A;  2VQF H;  1X9N A;  1IBK H;  4DR4 H;  5FPO A;  1HR0 H;  2D9I A;  4DUY H;  4K0K H;  4LFB H;  1S03 G;  1BGW A;  1E4G T;  1XDN A;  2UUC H;  4KHP H;  2FE3 A;  1DGS A;  3PN1 A;  2E5L H;  1P8L A;  4DV0 H;  4JI6 H;  2WYO A;  3HXL A;  4M7E A;  3J81 W;  4Q0Y A;  2HVR A;  2VUG A;  1ZHQ A;  3FMA A;  2OWO A;  1MZB A;  4R7R A;  4X66 H;  1J5E H;  5D1O A;  3KDK A;  3EZJ A;  4DV6 H;  3OET A;  5FD6 A;  1S68 A;  3L4J A;  1I94 H;  3F8N A;  4LFC H;  2VKC A;  4LH6 A;  3N40 P;  1F0X A;  1N36 H;  4JI1 H;  2HHH H;  2CW8 A;  3MWM A;  2HVS A;  2UU9 H;  4LF9 H;  4OD6 A;  3RIZ A;  4GKJ H;  2KSW A;  4LF4 H;  4JV5 H;  3T1H H;  4G08 A;  2UUB H;  5IT9 W;  1L2Z A;  3BA8 A;  5LMN H;  4YHH H;  1Z2P X;  3JSL A;  1HNW H;  3KAK A;  2Q2T A;  2VQE H;  2UUA H;  1AN7 A;  1A0I A;  3OSS D;  4EEQ A;  4RB3 C;  2RGR A;  2Y3M A;  4NZT M;  5DT9 A;  4DV4 H;  4DV7 H;  1V9P A;  4X65 H;  4DV1 H;  2HVQ A;  4DR6 H;  3QD7 X;  4FM9 A;  3KDG A;  2UXC H;  4RB0 A;  3UQ8 A;  1XNQ H;  4LF7 H;  1XNR H;  3JSN A;  4UCT A;  5BR8 H;  2ZM6 H;  1N34 H;  4AQY H;  1IBM H;  4JI0 H;  4JI7 H;  1N32 H;  5FPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...