1S03G

The structure of a ribosomal protein s8/spc operon mrna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a ribosomal protein S8/spc operon mRNA complex.
pubmed doi rcsb
molecule tags Transcription/rna
molecule keywords 47-MER
total genus 29
structure length 126
sequence length 126
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1s03G01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s03G02
4LF6H 4K0KH 3T1HH 4JYAH 4JV5H 4LFBH 1I94H 4KHPH 4DR2H 4DV1H 4X66H 2HHHH 1HNZH 3OTOH 4DR1H 1IBMH 1AN7A 1FKAH 1HR0H 3T1YH 4LFAH 4OX9H 1SEIA 1N33H 4JI1H 5FLXW 4DV4H 4DR7H 2ZM6H 1IBKH 1N34H 5LL6b 4LF7H 2UUAH 2E5LH 4X62H 1XNRH 5BR8H 4YY3H 4NXNH 4DR3H 4DR4H 1XNQH 4GKJH 5A2QW 4DR5H 1N36H 4LFCH 2UUCH 4JI5H 1XMQH 1N32H 4DR6H 2UXDH 4X64H 2VQEH 4B3MH 3J7AK 2UU9H 1HNWH 1IBLH 4LF5H 3RF2A 4B3SH 4B3TH 4DV3H 4DV2H 4AQYH 4DUZH 5LMNH 4GKKH 4B3RH 1XMOH 4JI2H 4DV6H 4JI7H 4LF4H 4DUYH 5IWAH 4JI4H 3JAMW 4DV5H 3J80W 4JI0H 3J81W 4JI8H 4JI3H 5IT9W 2F4VH 4PDBA 4JI6H 2UUBH 1J5EH 1I6UA 5LMUH 1S03G 4DV0H 2VQFH 4LF8H 2UXBH 4X65H 4YHHH 4NXMH 1FJGH 4LF9H 4DV7H 2UXCH 1HNXH
chains in the Genus database with same CATH superfamily
4LF6H 4AYBE 4ETSA 2NU6B 5C1OA 4K0KH 4MTDA 3T1HH 3GV7B 2R8KA 5C8YF 3RJ0A 3MFIA 3R5XA 2AGPA 1I94H 3N42B 4BBRG 4DV1H 3QZ7A 2VA2A 4A3KG 3GQCA 3TQTA 2R7LA 2HHHH 5KFAA 3OTOH 1AN7A 3HXLA 3N6XA 2CTKA 3GABA 1FKAH 4MAMA 4UCTA 1O75A 4U7CA 3K5HA 2LF0A 4QWDA 3Q8RB 2B63G 1Y1WA 2VOBA 4MV9A 1SEIA 3GTMA 2OPVA 2CTFA 1VKZA 4ED0A 4ECYA 1KJ9A 4I55F 2XCLA 4LMYA 2R7ZA 1ZZKA 2SCUB 3BABA 4JI1H 2CW7A 4IRDA 2UVUA 1VIGA 2YRXA 5DT9A 3GTPA 4O2AF 4B8TA 1EZ1A 4I7HA 1J4WA 4QJFA 1K83A 5LYJF 4YJ2F 4XZ3B 2XGQA 1JLLB 2YU9A 3UOEA 1ZHSA 5IYBG 2J6TA 4QWAA 1B6SA 1ZZIA 3GIPA 4ECVA 3OSSD 4RNOA 1RK6A 5EDWA 2DGRA 4E4TA 4MV8A 5L1JA 2FB9A 5KFPA 2X0SA 2R93A 2M8WA 2PT7G 4X62H 3CVZA 3N40P 3C0FB 4UCVA 1VAJA 3KDGA 4A3CG 2R7NA 3I0PA 3MR2A 3K3VA 4HQ6A 4A3FG 1Z2NX 4R8UA 5KG2A 5KFFA 1RJRA 4DR4H 4J9MA 2R92G 2E3UA 4Q0YA 2R8JA 5KG6A 2WTFA 1WR2A 2AU0A 3KHGA 4ZI7F 3MR6A 3RGZA 2ASDA 4RZQA 3RV3A 4A2BA 2HGSA 5CA1F 3M4IA 3RTXA 2R85A 4ECXA 3PW0A 2ANRA 2HH2A 4LF5H 4TQRA 2JA8G 4AIMA 4FS2A 3MJFA 2Y3MA 5KG0A 3UQ8A 3V6HA 5KKNB 3EPGA 3U9TA 5KFNA 5EWGA 3QD7X 2QYZA 5L1KA 4MV4A 3HKZE 4DLKA 2VUGA 4RNNA 4F4YA 3RB4A 3HKZA 1B6RA 4G3IA 4Y8VB 4A3LG 1X9ZA 2NN6G 4GKKH 2R6FA 2WAQA 1XMOH 5D1OA 4FBTA 3LP8A 3SB1A 4DV6H 2VUMG 4E9JA 1ZZJA 3M9OB 2YZNA 3HOVG 3V4ZA 1BXRA 1JIHA 1KJ8A 4QW8A 4IWYA 4IAJA 2P0AA 5LXTF 4JI4H 3JAMW 2CKZB 4DV5H 1UC8A 3T5JA 2R86A 3G6YA 1Z2IA 3R5HA 4EGJA 4J9NA 3I4NG 4RAYA 3CQZA 4BA2I 1WVNA 3JZIA 5T14A 5DG8A 4MV1A 1KJJA 5KT5A 4U6PA 4Q43A 3KTMA 2YW2A 3BQ2A 4EYHB 2E2IA 1TWFA 1J5EH 1I50A 5LMUH 1GSHA 5K36G 2FJZA 3OSNA 2D9IA 2ASJA 2JA5A 5F9NA 1XRHA 2LTLA 3N41B 1VS0A 2UXBH 2RGVA 5C4XG 5KT7A 4Q45A 2W7PA 1WE8A 3SI8A 3T5HA 3K5IA 1L2ZA 4EBDA 3GKUA 3WNZA 4YHHH 4ECWA 2CQYA 4LF9H 3GIMA 2CTLA 4RNMA 2XGPA 2GPWA 1HNXH 4RUCA 2AQ4A 1RYSA 4IRKA 2CWFA 3KAJA 1E4EA 5KFJA 1W93A 2V9WA 4LFBH 1S20A 4O4IF 1ZETA 1T3NA 3RFCA 1TA8A 2W9AA 3N8DA 1TWGA 3AEVB 4X66H 2WYOA 3MWDA 4UCRA 4RB2C 4J9PA 2ASLA 4XX0B 2CTEA 3IG0A 2Q2UA 2WAQE 1EYZA 3GLKA 2KSWA 1S9FA 1V9PA 4GC7A 2WDTA 4O3QA 2CTMA 3H4BA 3G6XA 2R8IA 1HR0H 3GIJA 1K1GA 3HOUG 1SCUB 2VQDA 3PN1A 3RGXA 5LA6F 1V8CA 2CPMA 2W6QA 4ED8A 2V58A 3WO1A 1N33H 5CAEB 3V4SA 5C5JA 4F4XA 4A3DG 2E2HA 3R23A 2BR0A 4NBQA 5JEAG 4DR7H 2YRWA 5KFRA 2BQUA 3RAXA 2R7MA 3FDSA 2HVQA 4DL2A 4QIWA 3RBDA 5K2MA 3Q8PB 2M05A 2J6UA 1V51A 4FJUA 1K1SA 2J9GA 2YCHA 4JV0A 1S0OA 5DQIA 1S0NA 4NLGA 2W9BA 4G08A 4ZQIA 5KG3A 3L4KA 5KFZA 5KG5A 5D1PA 2C2DA 2LTMA 5LOVF 4YY3H 5KFOA 4EYIB 2FFMA 5BPFA 2DPIA 4JV2A 4UCSA 4DR3H 5KG7A 1XNQH 1J5KA 3SE7A 1GO3E 1V4YA 2DLNA 3FKIA 2BQRA 5KFLA 1CE8A 3KHHA 4JVHA 1MSZA 1N36H 1N56A 3I4MG 4A3IG 5DGAA 2CPQA 3OETA 4LFCH 1GSAA 5EZYF 5JH7F 2G8YA 1ZQ7A 4JI5H 4IHJF 2Y0SE 1S97A 3H0GG 4EFEA 4ECUA 2R92A 3GTQA 4DR6H 3JSNA 3Q1KA 2JA5G 3IN5A 1TAEA 1B33N 2UXDH 3HB9A 5KFUA 2XCAA 2AGOA 5KFIA 3GILA 4H8AA 4MA0A 4ECQA 3PW4A 3J7AK 2UU9H 1HNWH 2FMRA 3MFHA 3RF2A 4F4ZA 4A3BG 3EYYA 4BBSG 1M6VA 2HJWA 4BY1G 4C5AA 4QWEA 4GC6A 2UVVA 3L2PA 2R8GA 4AQYH 3R5FA 1X4NA 3HOWG 3NCVA 2DWCA 5CB4F 5DQGA 3TINA 1X4MA 3F8NA 4ZHQF 5IP9G 4JI2H 5KT6A 2XC9A 3OSPA 2OWOA 4IRCA 2YZMA 4JI7H 1RYRA 2JZXA 3BA8A 3BA9A 4O3PA 3L4JA 2GPSA 2PQUA 2FPIB 4IFDG 1ZTGA 2YS7A 2PVPA 2RF4A 1OWTA 4WANA 3RIZA 1IOVA 2PMZA 5I47A 5KT4A 3J80W 1KEEA 4EBCA 4O2BF 2W6ZA 4JI8H 3T5LA 4JI3H 1VIHA 2JEIA 2R8HA 4WALA 4ECZA 2FPHX 2CW8A 2PY9A 3KAKA 4JI6H 3GTLA 4BXXG 1WCMG 4HR7A 1I6UA 1E4EB 1PQXA 1SYXB 2WB1E 4FM9A 1I7LA 1KHMA 2R82A 3GIIA 2JA6G 2Y0SA 2NU8B 2HVRA 1M7JA 3TIGA 1DT4A 4EEQA 5KFCA 3Q8SB 2V5AA 2ZDHA 4IWXA 3FAUA 4ECSA 4NXMH 1FJGH 4J9RA 3OHAA 4DL3A 2ATLA 4RB1A 2ZQEA 4R8UB 3MR5A 2ALZA 1AUXA 5KT2A 5L1IA 1ODHA 5KFGA 2C2EA 2NVYA 4ED3A 4MV6A 2FLNA 4JV5H 4J9SA 3H20A 4DR2H 5HV6A 3OHBA 2QK4A 4ED1A 1I7NA 1HNZH 1TUAA 1M0TA 4FU0A 3EZJA 4DR1H 4O3RA 1W96A 5KFDA 4HYKA 2W70A 2CZGA 1V9NA 3T1YH 2W9BB 4OX9H 1VBHA 2IA6A 3GTJA 3GTOA 2C35B 4I4TF 5DQHA 4ED2A 5LP6F 2OH2A 3GV8B 2V59A 4M7EA 3MR3A 5FLXW 4AM3A 2XD4A 4NZTM 2ZM6H 2K1HA 1E4GT 1XDNA 2RDIA 3JRXA 4MV3A 5DGBA 1SFOA 1KJIA 2ANNA 2FPGB 3QFFA 1N34H 4EGQA 3VPBA 3PO3G 3OUUA 2BQ3A 2R87A 5D8DA 3GIKA 2R84A 2RGRA 1B04A 3VMMA 2CTJA 1GGOA 2M6QA 4LF7H 3EPIA 1EUDB 4YJ3F 1M0WA 4C2MA 4XYMB 3M9NB 2UUAH 2J6SA 3OUZA 4Q8FA 1XNRH 2AGQA 4LSAA 5BR8H 1RJQA 3KDKA 2VR1A 4IZOA 2W8LA 1EUCB 4AYBA 2YS6A 4JVYA 3GIDA 4R7RA 2NVXA 5JVDF 3RB0A 5KX5F 5A2QW 1C30A 4DR5H 4TQSA 4ME6A 3PR5B 4GLXA 5FPOA 4C5CA 4EFBA 5C1PA 2NU7B 3KHLA 1F0XA 5KFMA 1GYFA 1XMQH 5DLFA 1X9NA 1JX4A 1KBLA 3GTKA 5KG1A 1ULZA 2I87A 4YAJB 2I80A 5KFVA 3PW7A 3V69A 4QW9A 4X64H 2DIKA 4ZOLF 2P2RA 4B3MH 2CWHA 2PBZA 4YBZB 1MZBA 2UVRA 4MV7A 1N48A 3GIQA 1DIKA 2NUAB 4O4HF 3G6VA 3DF7A 4OCHA 1BGWA 2VUMA 4APMA 4HNVA 4DV2H 1Y14B 3I12A 4RU9A 5DG9A 2C2RA 5FPRA 1KC7A 5CA0F 4J9QA 4J9OA 1WH2A 4DUZH 2YL2A 1WTJA 4YR3A 3H3VH 1E4FT 3V6JA 3L7ZC 2JEJA 4LF4H 4DUYH 4DL7A 1TWCA 1WHRA 5IWAH 4TV9F 2QNDA 1EC6A 1CQIB 3V6KA 4EG0A 5IYDG 5DG7A 1TWHA 5HBRB 1Y1WG 1JDBB 2JEAI 4JI0H 3J81W 3FMAA 5KFTA 2DPJA 2Z0SA 4C5BA 3G8CA 5J2UF 5KFWA 3RB6A 2HH3A 3N44B 3HOXG 4M9UA 1JKJB 4NZRM 2W6NA 3JRWA 4HNTA 4TUYF 4DL5A 3HBLA 3TIIA 4LSXA 5FLMG 4XYLB 1S03G 1VBIA 4DV0H 2VQFH 3VKEA 2FLPA 2ZJTA 2OLSA 3UFXB 4WBNF 4RB3C 4ED6A 3PZPA 3RBEA 2FE3A 4QWBA 4MA5A 2I8CA 2MJHA 4A3JG 1S10A 1KJQA 2FMAA 4O3NA 3Q2OA 2VA3A 3MWMA 1UG8A 4DV7H 1ZHQA 2R7ZG 1X0AA 2FK1A 4TV8F 1GSOA 5C0XG 1UC9A 2FKLA 5IP7G 2JA7A 4UCOA 4WD3A 3LWBA 3GR5A 2O4CA 2R7KA 3E5NA 4A3EG 4JYAH 1DV1A 5KFBA 3U1KA 4KHPH 2W71A 3KALA 2IBKA 1T94A 2W9CA 2YYAA 5JQWA 3GV5B 5KFXA 3VPDA 4OO1G 1IBMH 4LH7A 2VKCA 4EC5A 2FPPB 4YR2A 4LFAH 2W6MA 2FP4B 3PO2G 4O3SA 5BPHA 3PVXA 4CC5A 5IYZF 4YP3A 1IOWA 1Y1VG 3GTGA 2JA7G 3U9SA 3BAAA 2XCPA 4QMFB 4J0MA 2JEGA 4DV4H 4UCUA 4ED7A 1JDEA 3ETJA 1IBKH 2NU9B 4YQWA 1NXUA 5KFEA 4QIWE 4YAKB 2JEFA 2O03A 2Q2TA 1BNCA 3BG5A 1Z2OX 5EWEA 4RAZA 4YB8B 3KHRA 1RJPA 3BJYA 5EWFA 5LL6b 4A3MG 2RDJA 4BY7G 2C00A 2W7OA 1DGSA 4RUAA 2W9CB 3T5KA 2JA6A 4OD6A 2R93G 5JUMA 2E5LH 3RV4A 2FK3A 5GONF 1CS0A 4DL4A 3RB3A 5JVLA 1K1QA 1A9XA 2AXYA 4A3GG 4IR9A 3H0GA 5H80A 4NXNH 1S68A 2W57A 2W6PA 3ORRA 4FS1A 3PR4A 3ETHA 4Q8EA 4GKJH 2JA9A 1VBGA 4PWQA 2ZDQA 2GLTA 3K3PA 3KXYT 4I50F 1P8LA 4UFZA 5KG4A 3H4DA 2MCTA 5BMVF 2OPUA 2V4QA 2UUCH 5KFQA 2FK2A 5EOYA 2IP4A 5KFKA 2YQRA 2ZDGA 4LH6A 5F9LA 1N32H 3QZ8A 1DV2A 2UVWA 2PN1A 5J2TF 2LRRA 4RZRA 2VQEH 5KT3A 5C44G 4A93G 2DZDA 1IBLH 1WCMA 3RUPA 4B3SH 4B3TH 5L1LA 2JVZA 4B8CD 4Q44A 4J9LA 3TQ1A 4F4WA 4DV3H 1TWAA 3JSLA 4LIJA 4QWCA 1A0IA 3M9MB 4ECRA 1JXLA 2JEBI 4BA1I 4F50A 5FD5A 4EEYA 1CQJB 4JV1A 3WO0A 2VPSA 5LMNH 4CC6A 2W8KA 1PK8A 5D1OB 3H40A 4ECTA 4B3RH 3LMLA 5KFSA 1BJTA 4O3OA 1R9TA 2IMWP 2X06A 5FD6A 1I3QA 3NGDA 4IR1A 3PW2A 4RB0A 3PW5A 4DL6A 1DTJA 2HVSA 2B63A 5KFYA 5FJ8G 4BWSC 3RAQA 5KFHA 4FBUA 5L9XA 2BA0A 2PMZE 2VPQA 4JUZA 3MWEA 4FJSA 4EBEA 2YZGA 2C22A 4L1KA 2C28A 2V4RA 3BQ1A 3ORQA 1WSCA 5IT9W 2WB1A 2F4VH 4PDBA 1FVIA 4O4LF 2UUBH 3Q8QB 1GLVA 3N43B 1UNNC 5DLGA 1AUVA 1Z2PX 2A1SA 5IYCG 1EHIA 2WE6A 2W6OA 4LF8H 3BQ0A 1C3OA 1RK5A 2BL5A 4MTEA 4X65H 4A2AA 4J9KA 3AYHB 3HOZG 2XIGA 3VPCA 4YR0A 1S0MA 3HOYG 2UXCH 1T36A 2JE6I 1Y1VA 3FKIG 5C3EG 2FLLA 4HNUA 1PX2A
chains in the Genus database with same CATH topology
4LF6H 3KAJA 4UCOA 4ETSA 3GR5A 2O4CA 4K0KH 3T1HH 4MTDA 4JYAH 3RJ0A 4JV5H 4LFBH 1I94H 3N42B 4KHPH 3H20A 4DR2H 1TA8A 4DV1H 3KALA 2WYOA 4X66H 4UCRA 4RB2C 3IG0A 2HHHH 2Q2UA 1HNZH 3OTOH 1M0TA 3EZJA 2KSWA 4DR1H 1IBMH 1V9PA 1AN7A 2VKCA 2WDTA 1FKAH 3GABA 4EC5A 3HXLA 3N6XA 1HR0H 1O75A 4UCTA 2LF0A 3T1YH 4LFAH 4OX9H 3PN1A 2VOBA 4MV9A 1SEIA 3RGXA 4CC5A 1N33H 4LMYA 4M7EA 3BAAA 3BABA 4JI1H 2CW7A 4J0MA 5FLXW 4DV4H 4DR7H 4UCUA 4NZTM 2ZM6H 1IBKH 5DT9A 1E4GT 1XDNA 4I7HA 2HVQA 1N34H 2RGRA 2O03A 2Q2TA 1Z2OX 1B04A 4RAZA 1ZHSA 2YCHA 5LL6b 4LF7H 1DGSA 3OSSD 1M0WA 4OD6A 4G08A 2UUAH 2E5LH 3L4KA 4X62H 2PT7G 1XNRH 3CVZA 3N40P 5D1PA 4LSAA 3C0FB 4UCVA 5BR8H 3KDKA 3KDGA 4YY3H 3K3VA 4NXNH 1S68A 1Z2NX 2W57A 4UCSA 4DR3H 4R7RA 4DR4H 1XNQH 4GKJH 4UFZA 3KXYT 4Q0YA 1P8LA 5A2QW 4DR5H 4GLXA 2MCTA 1N36H 5FPOA 4EFBA 3OETA 2UUCH 4LFCH 1F0XA 5EOYA 1GYFA 1XMQH 4JI5H 1X9NA 4LH6A 4EFEA 1N32H 3RGZA 4RZQA 4DR6H 3JSNA 4A2BA 1TAEA 2HGSA 2UXDH 3M4IA 4X64H 2VQEH 3RTXA 4B3MH 3J7AK 1MZBA 4MV7A 2UU9H 1HNWH 1IBLH 4LF5H 3RF2A 4B3SH 4B3TH 4B8CD 4OCHA 1BGWA 3DF7A 3EYYA 4APMA 4DV3H 2Y3MA 3JSLA 4DV2H 3UQ8A 1A0IA 3L2PA 5FPRA 4AQYH 3QD7X 5FD5A 3NCVA 1WH2A 4LH7A 2VUGA 4DUZH 2VPSA 5LMNH 4CC6A 5D1OB 1X9ZA 4GKKH 3F8NA 4B3RH 5D1OA 1XMOH 1E4FT 3LMLA 1BJTA 4JI2H 3SB1A 4DV6H 4E9JA 5FD6A 2OWOA 4JI7H 4RB0A 3BA9A 4LF4H 4DUYH 3BA8A 3L4JA 4IAJA 5IWAH 4JI4H 3JAMW 2HVSA 4DV5H 4BWSC 3RIZA 3FMAA 3J80W 4JI0H 3J81W 4JI8H 4RAYA 4JI3H 3N44B 2FPHX 5IT9W 2CW8A 4NZRM 2F4VH 4PDBA 4JI6H 1FVIA 2UUBH 1J5EH 3KAKA 1I6UA 3N43B 4LSXA 5LMUH 1SYXB 4FM9A 1S03G 1Z2PX 2D9IA 4DV0H 2VQFH 2HVRA 2WE6A 4LF8H 1VS0A 2ZJTA 2UXBH 2RGVA 3N41B 4EEQA 4RB3C 1L2ZA 4MTEA 4X65H 2FE3A 4A2AA 3FAUA 4YHHH 4NXMH 1FJGH 4LF9H 2XIGA 4RB1A 2ZQEA 3MWMA 1ZHQA 4DV7H 2UXCH 1HNXH 1ODHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 H;  4K0K H;  3T1H H;  4JYA H;  4JV5 H;  4LFB H;  1I94 H;  4KHP H;  4DR2 H;  4DV1 H;  4X66 H;  2HHH H;  1HNZ H;  3OTO H;  4DR1 H;  1IBM H;  1AN7 A;  1FKA H;  1HR0 H;  3T1Y H;  4LFA H;  4OX9 H;  1SEI A;  1N33 H;  4JI1 H;  5FLX W;  4DV4 H;  4DR7 H;  2ZM6 H;  1IBK H;  1N34 H;  5LL6 b;  4LF7 H;  2UUA H;  2E5L H;  4X62 H;  1XNR H;  5BR8 H;  4YY3 H;  4NXN H;  4DR3 H;  4DR4 H;  1XNQ H;  4GKJ H;  5A2Q W;  4DR5 H;  1N36 H;  4LFC H;  2UUC H;  4JI5 H;  1XMQ H;  1N32 H;  4DR6 H;  2UXD H;  4X64 H;  2VQE H;  4B3M H;  3J7A K;  2UU9 H;  1HNW H;  1IBL H;  4LF5 H;  3RF2 A;  4B3S H;  4B3T H;  4DV3 H;  4DV2 H;  4AQY H;  4DUZ H;  5LMN H;  4GKK H;  4B3R H;  1XMO H;  4JI2 H;  4DV6 H;  4JI7 H;  4LF4 H;  4DUY H;  5IWA H;  4JI4 H;  3JAM W;  4DV5 H;  3J80 W;  4JI0 H;  3J81 W;  4JI8 H;  4JI3 H;  5IT9 W;  2F4V H;  4PDB A;  4JI6 H;  2UUB H;  1J5E H;  1I6U A;  5LMU H;  1S03 G;  4DV0 H;  2VQF H;  4LF8 H;  2UXB H;  4X65 H;  4YHH H;  4NXM H;  1FJG H;  4LF9 H;  4DV7 H;  2UXC H;  1HNX H; 
#chains in the Genus database with same CATH topology
 4LF6 H;  4AYB E;  4ETS A;  2NU6 B;  5C1O A;  4K0K H;  4MTD A;  3T1H H;  3GV7 B;  2R8K A;  5C8Y F;  3RJ0 A;  3MFI A;  3R5X A;  2AGP A;  1I94 H;  3N42 B;  4BBR G;  4DV1 H;  3QZ7 A;  2VA2 A;  4A3K G;  3GQC A;  3TQT A;  2R7L A;  2HHH H;  5KFA A;  3OTO H;  1AN7 A;  3HXL A;  3N6X A;  2CTK A;  3GAB A;  1FKA H;  4MAM A;  4UCT A;  1O75 A;  4U7C A;  3K5H A;  2LF0 A;  4QWD A;  3Q8R B;  2B63 G;  1Y1W A;  2VOB A;  4MV9 A;  1SEI A;  3GTM A;  2OPV A;  2CTF A;  1VKZ A;  4ED0 A;  4ECY A;  1KJ9 A;  4I55 F;  2XCL A;  4LMY A;  2R7Z A;  1ZZK A;  2SCU B;  3BAB A;  4JI1 H;  2CW7 A;  4IRD A;  2UVU A;  1VIG A;  2YRX A;  5DT9 A;  3GTP A;  4O2A F;  4B8T A;  1EZ1 A;  4I7H A;  1J4W A;  4QJF A;  1K83 A;  5LYJ F;  4YJ2 F;  4XZ3 B;  2XGQ A;  1JLL B;  2YU9 A;  3UOE A;  1ZHS A;  5IYB G;  2J6T A;  4QWA A;  1B6S A;  1ZZI A;  3GIP A;  4ECV A;  3OSS D;  4RNO A;  1RK6 A;  5EDW A;  2DGR A;  4E4T A;  4MV8 A;  5L1J A;  2FB9 A;  5KFP A;  2X0S A;  2R93 A;  2M8W A;  2PT7 G;  4X62 H;  3CVZ A;  3N40 P;  3C0F B;  4UCV A;  1VAJ A;  3KDG A;  4A3C G;  2R7N A;  3I0P A;  3MR2 A;  3K3V A;  4HQ6 A;  4A3F G;  1Z2N X;  4R8U A;  5KG2 A;  5KFF A;  1RJR A;  4DR4 H;  4J9M A;  2R92 G;  2E3U A;  4Q0Y A;  2R8J A;  5KG6 A;  2WTF A;  1WR2 A;  2AU0 A;  3KHG A;  4ZI7 F;  3MR6 A;  3RGZ A;  2ASD A;  4RZQ A;  3RV3 A;  4A2B A;  2HGS A;  5CA1 F;  3M4I A;  3RTX A;  2R85 A;  4ECX A;  3PW0 A;  2ANR A;  2HH2 A;  4LF5 H;  4TQR A;  2JA8 G;  4AIM A;  4FS2 A;  3MJF A;  2Y3M A;  5KG0 A;  3UQ8 A;  3V6H A;  5KKN B;  3EPG A;  3U9T A;  5KFN A;  5EWG A;  3QD7 X;  2QYZ A;  5L1K A;  4MV4 A;  3HKZ E;  4DLK A;  2VUG A;  4RNN A;  4F4Y A;  3RB4 A;  3HKZ A;  1B6R A;  4G3I A;  4Y8V B;  4A3L G;  1X9Z A;  2NN6 G;  4GKK H;  2R6F A;  2WAQ A;  1XMO H;  5D1O A;  4FBT A;  3LP8 A;  3SB1 A;  4DV6 H;  2VUM G;  4E9J A;  1ZZJ A;  3M9O B;  2YZN A;  3HOV G;  3V4Z A;  1BXR A;  1JIH A;  1KJ8 A;  4QW8 A;  4IWY A;  4IAJ A;  2P0A A;  5LXT F;  4JI4 H;  3JAM W;  2CKZ B;  4DV5 H;  1UC8 A;  3T5J A;  2R86 A;  3G6Y A;  1Z2I A;  3R5H A;  4EGJ A;  4J9N A;  3I4N G;  4RAY A;  3CQZ A;  4BA2 I;  1WVN A;  3JZI A;  5T14 A;  5DG8 A;  4MV1 A;  1KJJ A;  5KT5 A;  4U6P A;  4Q43 A;  3KTM A;  2YW2 A;  3BQ2 A;  4EYH B;  2E2I A;  1TWF A;  1J5E H;  1I50 A;  5LMU H;  1GSH A;  5K36 G;  2FJZ A;  3OSN A;  2D9I A;  2ASJ A;  2JA5 A;  5F9N A;  1XRH A;  2LTL A;  3N41 B;  1VS0 A;  2UXB H;  2RGV A;  5C4X G;  5KT7 A;  4Q45 A;  2W7P A;  1WE8 A;  3SI8 A;  3T5H A;  3K5I A;  1L2Z A;  4EBD A;  3GKU A;  3WNZ A;  4YHH H;  4ECW A;  2CQY A;  4LF9 H;  3GIM A;  2CTL A;  4RNM A;  2XGP A;  2GPW A;  1HNX H;  4RUC A;  2AQ4 A;  1RYS A;  4IRK A;  2CWF A;  3KAJ A;  1E4E A;  5KFJ A;  1W93 A;  2V9W A;  4LFB H;  1S20 A;  4O4I F;  1ZET A;  1T3N A;  3RFC A;  1TA8 A;  2W9A A;  3N8D A;  1TWG A;  3AEV B;  4X66 H;  2WYO A;  3MWD A;  4UCR A;  4RB2 C;  4J9P A;  2ASL A;  4XX0 B;  2CTE A;  3IG0 A;  2Q2U A;  2WAQ E;  1EYZ A;  3GLK A;  2KSW A;  1S9F A;  1V9P A;  4GC7 A;  2WDT A;  4O3Q A;  2CTM A;  3H4B A;  3G6X A;  2R8I A;  1HR0 H;  3GIJ A;  1K1G A;  3HOU G;  1SCU B;  2VQD A;  3PN1 A;  3RGX A;  5LA6 F;  1V8C A;  2CPM A;  2W6Q A;  4ED8 A;  2V58 A;  3WO1 A;  1N33 H;  5CAE B;  3V4S A;  5C5J A;  4F4X A;  4A3D G;  2E2H A;  3R23 A;  2BR0 A;  4NBQ A;  5JEA G;  4DR7 H;  2YRW A;  5KFR A;  2BQU A;  3RAX A;  2R7M A;  3FDS A;  2HVQ A;  4DL2 A;  4QIW A;  3RBD A;  5K2M A;  3Q8P B;  2M05 A;  2J6U A;  1V51 A;  4FJU A;  1K1S A;  2J9G A;  2YCH A;  4JV0 A;  1S0O A;  5DQI A;  1S0N A;  4NLG A;  2W9B A;  4G08 A;  4ZQI A;  5KG3 A;  3L4K A;  5KFZ A;  5KG5 A;  5D1P A;  2C2D A;  2LTM A;  5LOV F;  4YY3 H;  5KFO A;  4EYI B;  2FFM A;  5BPF A;  2DPI A;  4JV2 A;  4UCS A;  4DR3 H;  5KG7 A;  1XNQ H;  1J5K A;  3SE7 A;  1GO3 E;  1V4Y A;  2DLN A;  3FKI A;  2BQR A;  5KFL A;  1CE8 A;  3KHH A;  4JVH A;  1MSZ A;  1N36 H;  1N56 A;  3I4M G;  4A3I G;  5DGA A;  2CPQ A;  3OET A;  4LFC H;  1GSA A;  5EZY F;  5JH7 F;  2G8Y A;  1ZQ7 A;  4JI5 H;  4IHJ F;  2Y0S E;  1S97 A;  3H0G G;  4EFE A;  4ECU A;  2R92 A;  3GTQ A;  4DR6 H;  3JSN A;  3Q1K A;  2JA5 G;  3IN5 A;  1TAE A;  1B33 N;  2UXD H;  3HB9 A;  5KFU A;  2XCA A;  2AGO A;  5KFI A;  3GIL A;  4H8A A;  4MA0 A;  4ECQ A;  3PW4 A;  3J7A K;  2UU9 H;  1HNW H;  2FMR A;  3MFH A;  3RF2 A;  4F4Z A;  4A3B G;  3EYY A;  4BBS G;  1M6V A;  2HJW A;  4BY1 G;  4C5A A;  4QWE A;  4GC6 A;  2UVV A;  3L2P A;  2R8G A;  4AQY H;  3R5F A;  1X4N A;  3HOW G;  3NCV A;  2DWC A;  5CB4 F;  5DQG A;  3TIN A;  1X4M A;  3F8N A;  4ZHQ F;  5IP9 G;  4JI2 H;  5KT6 A;  2XC9 A;  3OSP A;  2OWO A;  4IRC A;  2YZM A;  4JI7 H;  1RYR A;  2JZX A;  3BA8 A;  3BA9 A;  4O3P A;  3L4J A;  2GPS A;  2PQU A;  2FPI B;  4IFD G;  1ZTG A;  2YS7 A;  2PVP A;  2RF4 A;  1OWT A;  4WAN A;  3RIZ A;  1IOV A;  2PMZ A;  5I47 A;  5KT4 A;  3J80 W;  1KEE A;  4EBC A;  4O2B F;  2W6Z A;  4JI8 H;  3T5L A;  4JI3 H;  1VIH A;  2JEI A;  2R8H A;  4WAL A;  4ECZ A;  2FPH X;  2CW8 A;  2PY9 A;  3KAK A;  4JI6 H;  3GTL A;  4BXX G;  1WCM G;  4HR7 A;  1I6U A;  1E4E B;  1PQX A;  1SYX B;  2WB1 E;  4FM9 A;  1I7L A;  1KHM A;  2R82 A;  3GII A;  2JA6 G;  2Y0S A;  2NU8 B;  2HVR A;  1M7J A;  3TIG A;  1DT4 A;  4EEQ A;  5KFC A;  3Q8S B;  2V5A A;  2ZDH A;  4IWX A;  3FAU A;  4ECS A;  4NXM H;  1FJG H;  4J9R A;  3OHA A;  4DL3 A;  2ATL A;  4RB1 A;  2ZQE A;  4R8U B;  3MR5 A;  2ALZ A;  1AUX A;  5KT2 A;  5L1I A;  1ODH A;  5KFG A;  2C2E A;  2NVY A;  4ED3 A;  4MV6 A;  2FLN A;  4JV5 H;  4J9S A;  3H20 A;  4DR2 H;  5HV6 A;  3OHB A;  2QK4 A;  4ED1 A;  1I7N A;  1HNZ H;  1TUA A;  1M0T A;  4FU0 A;  3EZJ A;  4DR1 H;  4O3R A;  1W96 A;  5KFD A;  4HYK A;  2W70 A;  2CZG A;  1V9N A;  3T1Y H;  2W9B B;  4OX9 H;  1VBH A;  2IA6 A;  3GTJ A;  3GTO A;  2C35 B;  4I4T F;  5DQH A;  4ED2 A;  5LP6 F;  2OH2 A;  3GV8 B;  2V59 A;  4M7E A;  3MR3 A;  5FLX W;  4AM3 A;  2XD4 A;  4NZT M;  2ZM6 H;  2K1H A;  1E4G T;  1XDN A;  2RDI A;  3JRX A;  4MV3 A;  5DGB A;  1SFO A;  1KJI A;  2ANN A;  2FPG B;  3QFF A;  1N34 H;  4EGQ A;  3VPB A;  3PO3 G;  3OUU A;  2BQ3 A;  2R87 A;  5D8D A;  3GIK A;  2R84 A;  2RGR A;  1B04 A;  3VMM A;  2CTJ A;  1GGO A;  2M6Q A;  4LF7 H;  3EPI A;  1EUD B;  4YJ3 F;  1M0W A;  4C2M A;  4XYM B;  3M9N B;  2UUA H;  2J6S A;  3OUZ A;  4Q8F A;  1XNR H;  2AGQ A;  4LSA A;  5BR8 H;  1RJQ A;  3KDK A;  2VR1 A;  4IZO A;  2W8L A;  1EUC B;  4AYB A;  2YS6 A;  4JVY A;  3GID A;  4R7R A;  2NVX A;  5JVD F;  3RB0 A;  5KX5 F;  5A2Q W;  1C30 A;  4DR5 H;  4TQS A;  4ME6 A;  3PR5 B;  4GLX A;  5FPO A;  4C5C A;  4EFB A;  5C1P A;  2NU7 B;  3KHL A;  1F0X A;  5KFM A;  1GYF A;  1XMQ H;  5DLF A;  1X9N A;  1JX4 A;  1KBL A;  3GTK A;  5KG1 A;  1ULZ A;  2I87 A;  4YAJ B;  2I80 A;  5KFV A;  3PW7 A;  3V69 A;  4QW9 A;  4X64 H;  2DIK A;  4ZOL F;  2P2R A;  4B3M H;  2CWH A;  2PBZ A;  4YBZ B;  1MZB A;  2UVR A;  4MV7 A;  1N48 A;  3GIQ A;  1DIK A;  2NUA B;  4O4H F;  3G6V A;  3DF7 A;  4OCH A;  1BGW A;  2VUM A;  4APM A;  4HNV A;  4DV2 H;  1Y14 B;  3I12 A;  4RU9 A;  5DG9 A;  2C2R A;  5FPR A;  1KC7 A;  5CA0 F;  4J9Q A;  4J9O A;  1WH2 A;  4DUZ H;  2YL2 A;  1WTJ A;  4YR3 A;  3H3V H;  1E4F T;  3V6J A;  3L7Z C;  2JEJ A;  4LF4 H;  4DUY H;  4DL7 A;  1TWC A;  1WHR A;  5IWA H;  4TV9 F;  2QND A;  1EC6 A;  1CQI B;  3V6K A;  4EG0 A;  5IYD G;  5DG7 A;  1TWH A;  5HBR B;  1Y1W G;  1JDB B;  2JEA I;  4JI0 H;  3J81 W;  3FMA A;  5KFT A;  2DPJ A;  2Z0S A;  4C5B A;  3G8C A;  5J2U F;  5KFW A;  3RB6 A;  2HH3 A;  3N44 B;  3HOX G;  4M9U A;  1JKJ B;  4NZR M;  2W6N A;  3JRW A;  4HNT A;  4TUY F;  4DL5 A;  3HBL A;  3TII A;  4LSX A;  5FLM G;  4XYL B;  1S03 G;  1VBI A;  4DV0 H;  2VQF H;  3VKE A;  2FLP A;  2ZJT A;  2OLS A;  3UFX B;  4WBN F;  4RB3 C;  4ED6 A;  3PZP A;  3RBE A;  2FE3 A;  4QWB A;  4MA5 A;  2I8C A;  2MJH A;  4A3J G;  1S10 A;  1KJQ A;  2FMA A;  4O3N A;  3Q2O A;  2VA3 A;  3MWM A;  1UG8 A;  4DV7 H;  1ZHQ A;  2R7Z G;  1X0A A;  2FK1 A;  4TV8 F;  1GSO A;  5C0X G;  1UC9 A;  2FKL A;  5IP7 G;  2JA7 A;  4UCO A;  4WD3 A;  3LWB A;  3GR5 A;  2O4C A;  2R7K A;  3E5N A;  4A3E G;  4JYA H;  1DV1 A;  5KFB A;  3U1K A;  4KHP H;  2W71 A;  3KAL A;  2IBK A;  1T94 A;  2W9C A;  2YYA A;  5JQW A;  3GV5 B;  5KFX A;  3VPD A;  4OO1 G;  1IBM H;  4LH7 A;  2VKC A;  4EC5 A;  2FPP B;  4YR2 A;  4LFA H;  2W6M A;  2FP4 B;  3PO2 G;  4O3S A;  5BPH A;  3PVX A;  4CC5 A;  5IYZ F;  4YP3 A;  1IOW A;  1Y1V G;  3GTG A;  2JA7 G;  3U9S A;  3BAA A;  2XCP A;  4QMF B;  4J0M A;  2JEG A;  4DV4 H;  4UCU A;  4ED7 A;  1JDE A;  3ETJ A;  1IBK H;  2NU9 B;  4YQW A;  1NXU A;  5KFE A;  4QIW E;  4YAK B;  2JEF A;  2O03 A;  2Q2T A;  1BNC A;  3BG5 A;  1Z2O X;  5EWE A;  4RAZ A;  4YB8 B;  3KHR A;  1RJP A;  3BJY A;  5EWF A;  5LL6 b;  4A3M G;  2RDJ A;  4BY7 G;  2C00 A;  2W7O A;  1DGS A;  4RUA A;  2W9C B;  3T5K A;  2JA6 A;  4OD6 A;  2R93 G;  5JUM A;  2E5L H;  3RV4 A;  2FK3 A;  5GON F;  1CS0 A;  4DL4 A;  3RB3 A;  5JVL A;  1K1Q A;  1A9X A;  2AXY A;  4A3G G;  4IR9 A;  3H0G A;  5H80 A;  4NXN H;  1S68 A;  2W57 A;  2W6P A;  3ORR A;  4FS1 A;  3PR4 A;  3ETH A;  4Q8E A;  4GKJ H;  2JA9 A;  1VBG A;  4PWQ A;  2ZDQ A;  2GLT A;  3K3P A;  3KXY T;  4I50 F;  1P8L A;  4UFZ A;  5KG4 A;  3H4D A;  2MCT A;  5BMV F;  2OPU A;  2V4Q A;  2UUC H;  5KFQ A;  2FK2 A;  5EOY A;  2IP4 A;  5KFK A;  2YQR A;  2ZDG A;  4LH6 A;  5F9L A;  1N32 H;  3QZ8 A;  1DV2 A;  2UVW A;  2PN1 A;  5J2T F;  2LRR A;  4RZR A;  2VQE H;  5KT3 A;  5C44 G;  4A93 G;  2DZD A;  1IBL H;  1WCM A;  3RUP A;  4B3S H;  4B3T H;  5L1L A;  2JVZ A;  4B8C D;  4Q44 A;  4J9L A;  3TQ1 A;  4F4W A;  4DV3 H;  1TWA A;  3JSL A;  4LIJ A;  4QWC A;  1A0I A;  3M9M B;  4ECR A;  1JXL A;  2JEB I;  4BA1 I;  4F50 A;  5FD5 A;  4EEY A;  1CQJ B;  4JV1 A;  3WO0 A;  2VPS A;  5LMN H;  4CC6 A;  2W8K A;  1PK8 A;  5D1O B;  3H40 A;  4ECT A;  4B3R H;  3LML A;  5KFS A;  1BJT A;  4O3O A;  1R9T A;  2IMW P;  2X06 A;  5FD6 A;  1I3Q A;  3NGD A;  4IR1 A;  3PW2 A;  4RB0 A;  3PW5 A;  4DL6 A;  1DTJ A;  2HVS A;  2B63 A;  5KFY A;  5FJ8 G;  4BWS C;  3RAQ A;  5KFH A;  4FBU A;  5L9X A;  2BA0 A;  2PMZ E;  2VPQ A;  4JUZ A;  3MWE A;  4FJS A;  4EBE A;  2YZG A;  2C22 A;  4L1K A;  2C28 A;  2V4R A;  3BQ1 A;  3ORQ A;  1WSC A;  5IT9 W;  2WB1 A;  2F4V H;  4PDB A;  1FVI A;  4O4L F;  2UUB H;  3Q8Q B;  1GLV A;  3N43 B;  1UNN C;  5DLG A;  1AUV A;  1Z2P X;  2A1S A;  5IYC G;  1EHI A;  2WE6 A;  2W6O A;  4LF8 H;  3BQ0 A;  1C3O A;  1RK5 A;  2BL5 A;  4MTE A;  4X65 H;  4A2A A;  4J9K A;  3AYH B;  3HOZ G;  2XIG A;  3VPC A;  4YR0 A;  1S0M A;  3HOY G;  2UXC H;  1T36 A;  2JE6 I;  1Y1V A;  3FKI G;  5C3E G;  2FLL A;  4HNU A;  1PX2 A; 
#chains in the Genus database with same CATH homology
 4LF6 H;  3KAJ A;  4UCO A;  4ETS A;  3GR5 A;  2O4C A;  4K0K H;  3T1H H;  4MTD A;  4JYA H;  3RJ0 A;  4JV5 H;  4LFB H;  1I94 H;  3N42 B;  4KHP H;  3H20 A;  4DR2 H;  1TA8 A;  4DV1 H;  3KAL A;  2WYO A;  4X66 H;  4UCR A;  4RB2 C;  3IG0 A;  2HHH H;  2Q2U A;  1HNZ H;  3OTO H;  1M0T A;  3EZJ A;  2KSW A;  4DR1 H;  1IBM H;  1V9P A;  1AN7 A;  2VKC A;  2WDT A;  1FKA H;  3GAB A;  4EC5 A;  3HXL A;  3N6X A;  1HR0 H;  1O75 A;  4UCT A;  2LF0 A;  3T1Y H;  4LFA H;  4OX9 H;  3PN1 A;  2VOB A;  4MV9 A;  1SEI A;  3RGX A;  4CC5 A;  1N33 H;  4LMY A;  4M7E A;  3BAA A;  3BAB A;  4JI1 H;  2CW7 A;  4J0M A;  5FLX W;  4DV4 H;  4DR7 H;  4UCU A;  4NZT M;  2ZM6 H;  1IBK H;  5DT9 A;  1E4G T;  1XDN A;  4I7H A;  2HVQ A;  1N34 H;  2RGR A;  2O03 A;  2Q2T A;  1Z2O X;  1B04 A;  4RAZ A;  1ZHS A;  2YCH A;  5LL6 b;  4LF7 H;  1DGS A;  3OSS D;  1M0W A;  4OD6 A;  4G08 A;  2UUA H;  2E5L H;  3L4K A;  4X62 H;  2PT7 G;  1XNR H;  3CVZ A;  3N40 P;  5D1P A;  4LSA A;  3C0F B;  4UCV A;  5BR8 H;  3KDK A;  3KDG A;  4YY3 H;  3K3V A;  4NXN H;  1S68 A;  1Z2N X;  2W57 A;  4UCS A;  4DR3 H;  4R7R A;  4DR4 H;  1XNQ H;  4GKJ H;  4UFZ A;  3KXY T;  4Q0Y A;  1P8L A;  5A2Q W;  4DR5 H;  4GLX A;  2MCT A;  1N36 H;  5FPO A;  4EFB A;  3OET A;  2UUC H;  4LFC H;  1F0X A;  5EOY A;  1GYF A;  1XMQ H;  4JI5 H;  1X9N A;  4LH6 A;  4EFE A;  1N32 H;  3RGZ A;  4RZQ A;  4DR6 H;  3JSN A;  4A2B A;  1TAE A;  2HGS A;  2UXD H;  3M4I A;  4X64 H;  2VQE H;  3RTX A;  4B3M H;  3J7A K;  1MZB A;  4MV7 A;  2UU9 H;  1HNW H;  1IBL H;  4LF5 H;  3RF2 A;  4B3S H;  4B3T H;  4B8C D;  4OCH A;  1BGW A;  3DF7 A;  3EYY A;  4APM A;  4DV3 H;  2Y3M A;  3JSL A;  4DV2 H;  3UQ8 A;  1A0I A;  3L2P A;  5FPR A;  4AQY H;  3QD7 X;  5FD5 A;  3NCV A;  1WH2 A;  4LH7 A;  2VUG A;  4DUZ H;  2VPS A;  5LMN H;  4CC6 A;  5D1O B;  1X9Z A;  4GKK H;  3F8N A;  4B3R H;  5D1O A;  1XMO H;  1E4F T;  3LML A;  1BJT A;  4JI2 H;  3SB1 A;  4DV6 H;  4E9J A;  5FD6 A;  2OWO A;  4JI7 H;  4RB0 A;  3BA9 A;  4LF4 H;  4DUY H;  3BA8 A;  3L4J A;  4IAJ A;  5IWA H;  4JI4 H;  3JAM W;  2HVS A;  4DV5 H;  4BWS C;  3RIZ A;  3FMA A;  3J80 W;  4JI0 H;  3J81 W;  4JI8 H;  4RAY A;  4JI3 H;  3N44 B;  2FPH X;  5IT9 W;  2CW8 A;  4NZR M;  2F4V H;  4PDB A;  4JI6 H;  1FVI A;  2UUB H;  1J5E H;  3KAK A;  1I6U A;  3N43 B;  4LSX A;  5LMU H;  1SYX B;  4FM9 A;  1S03 G;  1Z2P X;  2D9I A;  4DV0 H;  2VQF H;  2HVR A;  2WE6 A;  4LF8 H;  1VS0 A;  2ZJT A;  2UXB H;  2RGV A;  3N41 B;  4EEQ A;  4RB3 C;  1L2Z A;  4MTE A;  4X65 H;  2FE3 A;  4A2A A;  3FAU A;  4YHH H;  4NXM H;  1FJG H;  4LF9 H;  2XIG A;  4RB1 A;  2ZQE A;  3MWM A;  1ZHQ A;  4DV7 H;  2UXC H;  1HNX H;  1ODH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...