1S03G

The structure of a ribosomal protein s8/spc operon mrna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 47-MER
publication title The structure of a ribosomal protein S8/spc operon mRNA complex.
pubmed doi rcsb
molecule tags Transcription/rna
total genus 29
structure length 126
sequence length 126
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1s03G01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s03G02
4DR6H 2VQFH 4DR5H 3T1HH 4LFBH 4PDBA 5LMUH 2UUAH 4DV3H 5LL6b 2UU9H 4JYAH 4DR1H 1AN7A 1N33H 1HNXH 4LF5H 1HNZH 1J5EH 1N34H 3T1YH 1I94H 5A2QW 2UXCH 4OX9H 3J81W 1FKAH 1XMOH 4DV5H 4DR4H 5BR8H 4DR2H 1XNQH 2ZM6H 4JI7H 3J80W 4NXMH 4DUZH 2UUCH 4YY3H 4LFCH 4B3SH 4LF8H 1HNWH 1IBMH 1I6UA 1IBKH 1SEIA 3RF2A 4LF6H 4DV6H 4DV2H 2UUBH 4KHPH 4JI1H 3JAMW 4JI5H 4X65H 4DUYH 4DR7H 5IT9W 4JI6H 1IBLH 4YHHH 4DV7H 4LF7H 5LMNH 4LFAH 4JI2H 4JI0H 4GKKH 2VQEH 4K0KH 3J7AK 4DV0H 3OTOH 2UXBH 1N32H 2F4VH 5IWAH 4JI8H 1XMQH 4B3TH 4X64H 4JV5H 4JI4H 4LF4H 4DR3H 1FJGH 4AQYH 4DV4H 4B3MH 1S03G 4NXNH 4X66H 4X62H 4GKJH 1N36H 4DV1H 5FLXW 4JI3H 2HHHH 1XNRH 4B3RH 4LF9H 2UXDH 2E5LH 1HR0H
chains in the Genus database with same CATH superfamily
3HOYG 4DR6H 2FPIB 3JRXA 1MZBA 3UOEA 4DR5H 4LFBH 3BAAA 3EPGA 2CQYA 2YZMA 2DPJA 2VOBA 1GYFA 3GABA 3OSSD 2V59A 2UVWA 3I4MG 3GLKA 1TWAA 2C35B 3BQ2A 4QW8A 4EYIB 3LP8A 5KFBA 3PW7A 4ZI7F 4M9UA 2I87A 3FDSA 3GV8B 4F4XA 3M9NB 2CWFA 4MTDA 3GTLA 2R7MA 3H20A 4YBZB 3I4NG 2OH2A 1KEEA 4Q43A 3RBDA 2FLNA 2VPSA 3OETA 3T1YH 3M4IA 2AGOA 2IA6A 3HOWG 2UXCH 5KFZA 2R7KA 2W8LA 5C8YF 4AM3A 4O3SA 3NGDA 5C5JA 1ZQ7A 3KHLA 2JEGA 3TQTA 3HBLA 5DGBA 3L4KA 4JV2A 5BMVF 4IRKA 5C44G 4BY7G 2W70A 1OWTA 4H8AA 1TUAA 4DR4H 4FS2A 4TQSA 1XNQH 4DR2H 4WBNF 2Q2UA 2CKZB 4A3FG 4GC6A 4ZOLF 2R6FA 3J80W 3MWDA 3MFIA 3WO1A 3HOXG 2MJHA 4E9JA 2UVUA 3Q8QB 2CWHA 3PW0A 2PVPA 3HXLA 2UUCH 2FLPA 2BQ3A 3VKEA 2VUGA 4O3OA 5DGAA 1RYRA 2PT7G 5JEAG 2R85A 3KAJA 2CTLA 5DQIA 3H3VH 2QK4A 4O4IF 4O3NA 3GKUA 4FBUA 4TV9F 2DIKA 3TINA 1EUDB 2XD4A 4YR3A 1CE8A 1WCMG 3RTXA 3EYYA 4ECVA 5KFIA 4WD3A 4QW9A 2VA3A 3V4ZA 4QWAA 2W9CB 4HR7A 2BQUA 2FMRA 1ZTGA 2UUBH 4OO1G 5KFYA 2R8JA 4CC6A 3GTJA 2PN1A 2FK1A 4DLKA 2NU7B 3M9MB 4O3RA 1MSZA 4F4YA 2DPIA 2UVVA 2W6OA 3N8DA 5KG5A 3SI8A 2K1HA 2JZXA 1KJJA 5IT9W 1TWHA 2B63G 3RAXA 2VA2A 3FAUA 4LF7H 4RB3C 3GTGA 2R92A 1Z2PX 3T5HA 4JV1A 1AUVA 2JA5A 4RB2C 4YQWA 5KG1A 5KFQA 2PY9A 3KALA 3GV7B 2VPQA 3PZPA 4DV0H 5HBRB 3PR5B 3KHRA 2ZDHA 3GIKA 3RB4A 2J9GA 4A2BA 2JEIA 2F4VH 4YAJB 4JI8H 1DT4A 2YS6A 1IOVA 4I55F 5KFMA 1XMQH 5KFTA 5D1OA 1VAJA 5KFVA 2W9BB 1BXRA 3BABA 5BPHA 4FU0A 2O4CA 4UCSA 5KG6A 5KFEA 1Y1WA 5L1JA 5L1LA 2CW7A 3L7ZC 1T94A 3I12A 3KTMA 4ECYA 2JEJA 2GPSA 5C1OA 4ECXA 2A1SA 1M0TA 2YZGA 2HGSA 4DV4H 4ETSA 1RK6A 4DL2A 2JA9A 2M8WA 2W6QA 1S03G 3OHBA 3K3PA 5D1PA 2J6SA 2R7ZA 2E2HA 3N43B 4NZRM 1W96A 5KFUA 5KFWA 2FK2A 4Q44A 2RF4A 1VIHA 2W7OA 5L1KA 4NLGA 1N36H 4U6PA 3VPBA 4DV1H 5FLXW 2WB1A 5IYDG 5F9NA 3G8CA 4C5BA 3KDKA 2DZDA 2HHHH 4EFBA 5KFPA 3N41B 2QNDA 1VBGA 2VQDA 2FPPB 2E5LH 5KT4A 4GC7A 1SYXB 2AQ4A 1T36A 4EBEA 2BQRA 2CPQA 4PDBA 2JA6A 1SFOA 4Q45A 4RNMA 2C2DA 2UUAH 4DL5A 4TV8F 5EDWA 1O75A 4RB1A 1AN7A 5EZYF 1HNXH 3UFXB 5KX5F 3HOUG 2Z0SA 2XCAA 1GGOA 3OUZA 2W7PA 1E4GT 2V4QA 2UVRA 4QWEA 1E4EB 3ETHA 5C0XG 5LP6F 4Q8EA 4RU9A 3PO3G 1B04A 5LOVF 5KFKA 2IMWP 5JQWA 1P8LA 1ZETA 5KT5A 2Y3MA 1N56A 3E5NA 5A2QW 5FPRA 4OX9H 4B8CD 1EYZA 4C5CA 5F9LA 4YR2A 2JA7A 3J81W 3R5FA 3M9OB 1ZZIA 1K1QA 2OLSA 1V9NA 2W6ZA 1EC6A 1X4NA 4ZHQF 5KT7A 4A3JG 5EWEA 2OWOA 2G8YA 2FB9A 1K1GA 2V4RA 5CB4F 1VS0A 2WE6A 3NCVA 3RGZA 4U7CA 2R92G 4TQRA 4NXMH 1Z2OX 1B6RA 3AYHB 2JA5G 4AYBA 2YU9A 4O2AF 3R5XA 4DUZH 2WB1E 4ECQA 2HH3A 1V51A 3RIZA 4A3CG 2W9CA 3Q8SB 5IYBG 2FKLA 1JKJB 5CA0F 4BY1G 1ULZA 4J9LA 1RYSA 5KT2A 1KJIA 3OUUA 4EGQA 4LF8H 5LYJF 5GONF 1HNWH 3RFCA 1IBMH 5KFGA 1I6UA 1PK8A 2O03A 2W9AA 3JZIA 5K36G 4QWCA 2V58A 1SEIA 2NU9B 5K2MA 2YRWA 4DV6H 1Y1WG 3VPDA 4FJUA 4OCHA 1KJQA 2YL2A 4ZQIA 5DLGA 5KFAA 3MFHA 2FJZA 4RZQA 4JI1H 1S0OA 1A0IA 2R7ZG 3JAMW 5CA1F 2V9WA 1C3OA 4YP3A 3KHGA 4M7EA 3BA9A 1WHRA 4XX0B 4DUYH 5DLFA 3V4SA 4RUAA 2RGRA 4DR7H 4JI6H 1IBLH 3GIQA 4HNVA 4ECSA 4QJFA 1BJTA 1TAEA 5KFCA 1T3NA 1CQJB 4JI2H 2W9BA 4EBDA 3HKZE 2WTFA 4A3MG 1C30A 2R8GA 1JDBB 3T5LA 4ED8A 1S0NA 3QFFA 5EWGA 2HH2A 5CAEB 4O3PA 2W57A 1K83A 1N32H 2AU0A 5L1IA 2FP4B 2I8CA 4J9KA 4WALA 2ZJTA 5KFLA 4EGJA 3V6HA 2JA6G 5FLMG 5KFOA 2PBZA 1KBLA 4BA2I 2WAQA 4LH7A 2RGVA 4BBSG 2E2IA 4YR0A 1DIKA 2C2EA 2LRRA 5J2TF 4EEQA 1X4MA 2M05A 1W93A 3H0GA 4DL4A 2J6UA 3RV4A 4JI4H 2RDIA 3K5IA 4LF4H 2IP4A 5KFFA 1X0AA 4DR3H 1VBHA 4AQYH 2W6MA 4JUZA 4A3LG 2ASLA 2YCHA 1WH2A 1IOWA 4E4TA 3MR6A 2R87A 2ZDGA 4UCRA 4J9PA 1WTJA 4G3IA 5KG2A 3C0FB 2ASJA 5DQGA 2CTFA 1DV1A 4X66H 1GO3E 4R7RA 5KFJA 1EUCB 2P0AA 4ED6A 1UNNC 1RK5A 3PW4A 2JA7G 2R82A 1GSHA 2R86A 2FK3A 4JI3H 4MV9A 3ORRA 5FPOA 3RV3A 3JSLA 3K5HA 3EZJA 4C2MA 1XNRH 1CS0A 4R8UB 4LF9H 3PO2G 5JVLA 4MAMA 3GTMA 2CW8A 1V4YA 2KSWA 4QWDA 4QMFB 4MV6A 4LSXA 1EZ1A 5KT6A 2XGQA 4A3BG 2JVZA 3T1HH 2ZDQA 4MV1A 4IRDA 1M7JA 1UC9A 1JDEA 3ORQA 2FPHX 5LL6b 4JYAH 1BGWA 4DL3A 1JXLA 2Y0SA 4A3GG 4Y8VB 1AUXA 3L2PA 2AXYA 3GIMA 4EG0A 4LF5H 1XDNA 1X9NA 1HNZH 1ZZJA 2VR1A 3RGXA 3BJYA 3GTOA 4HYKA 2AGPA 3CQZA 1KHMA 1RJPA 3KHHA 4APMA 1PX2A 1JIHA 5H80A 1I94H 3GIPA 4O4HF 5FJ8G 5KFDA 4IR1A 2PMZA 4B8TA 2C00A 2YQRA 4BWSC 2DWCA 1XMOH 3T5JA 2D9IA 3IN5A 4I4TF 3V6JA 1TA8A 1GSOA 1I7NA 3G6VA 2ZM6H 3MJFA 4O2BF 3OSPA 5KFHA 4UCVA 4A2AA 2GLTA 5DG8A 3JRWA 2C28A 4IRCA 2NVXA 1WVNA 5JH7F 3PN1A 4HQ6A 4YY3H 4QIWA 4J9OA 4ECTA 2Q2TA 2VKCA 3PVXA 2HJWA 1ODHA 2R93A 5D8DA 4EYHB 3RB6A 3RUPA 1J5KA 2FE3A 2CZGA 3GIIA 4O3QA 3H40A 3H0GG 5KKNB 4JV0A 3GIDA 2YYAA 4LF6H 4A3IG 2M6QA 2R7NA 4DV2H 2FMAA 5LXTF 5IP9G 4KHPH 3GR5A 4FBTA 1V8CA 3OSNA 3AEVB 4Q0YA 1XRHA 4RNNA 3MR2A 4IFDG 5DG7A 4UCTA 2LTLA 3GV5B 3G6YA 2OPUA 4MV4A 1X9ZA 3SE7A 4RB0A 3VMMA 1I50A 4BXXG 4J9MA 2J6TA 2R8KA 2X0SA 5C4XG 1WE8A 3I0PA 4DV7H 5IP7G 3HOZG 5LMNH 3MWEA 4A3DG 2BA0A 4LFAH 4J9RA 4JVYA 1EHIA 4JI0H 1FVIA 5L9XA 4GKKH 1NXUA 3GQCA 4J9QA 1I3QA 3RAQA 5LA6F 4IR9A 4DL6A 3KAKA 4LH6A 3J7AK 4RAZA 4MTEA 1S68A 2JE6I 3OTOH 3K3VA 4RZRA 3BA8A 2YW2A 1S10A 1ZZKA 4CC5A 1N48A 2CTMA 4EC5A 3N6XA 2IBKA 1B6SA 1Z2IA 2HVRA 1WR2A 2XCLA 2LTMA 4B3TH 3N42B 3QD7X 4LMYA 1Y14B 1B33N 4IZOA 2ASDA 3RJ0A 2CTKA 1FJGH 4YJ2F 2ATLA 1SCUB 2SCUB 3GTQA 2R84A 1ZHSA 4AIMA 4QIWE 3KXYT 1JLLB 4R8UA 5KG0A 2ZQEA 2ANRA 5BPFA 4B3MH 3R5HA 2YRXA 4ED7A 4DL7A 3MR3A 3VPCA 5KT3A 1VKZA 2XC9A 1KC7A 3FKIA 4MV3A 4GKJH 3LMLA 3WNZA 4NBQA 1A9XA 3GIJA 2V5AA 2W71A 4EBCA 3QZ7A 3TIGA 4F50A 3RB0A 4NZTM 4ED1A 2CTEA 1VBIA 4B3RH 2BL5A 4QWBA 4YJ3F 5JUMA 4BBRG 3BQ0A 4A3EG 3SB1A 1L2ZA 1VIGA 4J9NA 5KFRA 4BA1I 2HVQA 2E3UA 3UQ8A 2VQFH 4FJSA 4AYBE 2R7LA 4ME6A 1DGSA 4YB8B 3RB3A 4JVHA 4XYLB 4Q8FA 3HB9A 5FD5A 2VUMG 3HOVG 5LMUH 4DV3H 2UU9H 4MV7A 4DR1H 4RUCA 4MV8A 5JVDF 1N33H 2R93G 5J2UF 2RDJA 2WYOA 1TWCA 1ZHQA 3BQ1A 2HVSA 4F4WA 2CTJA 1DV2A 1J5EH 4FS1A 1N34H 1TWFA 4XZ3B 5KG3A 3U9TA 5C1PA 4EEYA 5DT9A 4PWQA 3T5KA 4MA0A 2W6NA 1J4WA 3U1KA 4FM9A 3N40P 4WANA 1FKAH 2WDTA 5EOYA 3H4DA 2NU8B 2C22A 1K1SA 4DV5H 5C3EG 4RNOA 4A3KG 1E4EA 3U9SA 2NVYA 5BR8H 3Q8RB 4ECWA 2GPWA 4G08A 4JI7H 1S9FA 1E4FT 1DTJA 3G6XA 4TUYF 4IWXA 4O4LF 2I80A 1RJRA 2JEFA 3N44B 4ED3A 2QYZA 5DG9A 2OPVA 1Y1VG 2BR0A 4IHJF 2XGPA 3WO0A 4RAYA 5KFXA 4A93G 4LFCH 1M6VA 4B3SH 5KG7A 3GTPA 2DGRA 1PQXA 5KFNA 3H4BA 5KG4A 2WAQE 3ETJA 2NU6B 4HNUA 4I50F 3QZ8A 1IBKH 4UCOA 3RF2A 3Q1KA 4J0MA 3MR5A 1RJQA 3L4JA 1UG8A 2FFMA 4UCUA 2JA8G 5FD6A 2NN6G 2DLNA 1GLVA 2W6PA 4JI5H 2YS7A 4X65H 2JEAI 4IAJA 1S0MA 1UC8A 4MA5A 1GSAA 3FKIG 3MWMA 2P2RA 3KDGA 2XCPA 3BG5A 3TIIA 3F8NA 4YHHH 4XYMB 5KFSA 3EPIA 4GLXA 2VUMA 3DF7A 1CQIB 2PQUA 2FPGB 4OD6A 3R23A 1I7LA 3RBEA 2C2RA 2YZNA 2VQEH 4K0KH 1S97A 2XIGA 5IYZF 4F4ZA 4HNTA 2R8IA 1KJ8A 3JSNA 4ECRA 2UXBH 5T14A 3CVZA 4I7HA 4ED0A 3GTKA 5IWAH 2NUAB 1JX4A 4ED2A 1S20A 5IYCG 2CPMA 5EWFA 2FLLA 4LIJA 2W8KA 1WSCA 3PW2A 3PW5A 4X64H 3PR4A 4JV5H 1WCMA 2ALZA 2Y0SE 3LWBA 1V9PA 3IG0A 2R8HA 5HV6A 5DQHA 1R9TA 4L1KA 1Z2NX 4ECZA 2X06A 4IWYA 2AGQA 4NXNH 5D1OB 4LSAA 4YAKB 1M0WA 3Q2OA 4X62H 3Q8PB 5I47A 3OHAA 2B63A 4C5AA 2PMZE 1TWGA 3V6KA 1BNCA 2LF0A 4ECUA 2ANNA 3V69A 3TQ1A 4UFZA 1KJ9A 1Y1VA 3HKZA 4J9SA 1F0XA 4EFEA 2JEBI 2UXDH 3FMAA 3GILA 2MCTA 1HR0H
chains in the Genus database with same CATH topology
1SYXB 2HVQA 4LSXA 3UQ8A 4DR6H 2VQFH 1MZBA 4DR5H 3T1HH 4LFBH 3BAAA 4PDBA 1DGSA 1GYFA 2VOBA 5FD5A 3GABA 3OSSD 5LMUH 2UUAH 2FPHX 4DV3H 5LL6b 2UU9H 4JYAH 4DR1H 1BGWA 1AN7A 1O75A 4MV7A 1N33H 4RB1A 1HNXH 2WYOA 3L2PA 1E4GT 1ZHQA 2HVSA 4LF5H 1XDNA 1X9NA 1HNZH 4MTDA 3RGXA 1B04A 1J5EH 3H20A 1N34H 1P8LA 2VPSA 4APMA 5DT9A 2Y3MA 3OETA 3T1YH 1I94H 3M4IA 5A2QW 2UXCH 5FPRA 4OX9H 4B8CD 4FM9A 3N40P 3J81W 1FKAH 2WDTA 5EOYA 1XMOH 4BWSC 2D9IA 3L4KA 4DV5H 1TA8A 4DR4H 2OWOA 5BR8H 4DR2H 1XNQH 2ZM6H 1VS0A 2WE6A 3NCVA 4G08A 4JI7H 3RGZA 1E4FT 4UCVA 3J80W 4NXMH 1Z2OX 4A2AA 4E9JA 4DUZH 3N44B 3HXLA 2UUCH 3RIZA 3PN1A 2VUGA 4YY3H 4RAYA 2PT7G 4LFCH 3KAJA 2Q2TA 2VKCA 4B3SH 1ODHA 4LF8H 1HNWH 1IBMH 1I6UA 2FE3A 2O03A 1IBKH 1SEIA 3RTXA 3EYYA 3RF2A 4UCOA 4J0MA 3L4JA 4LF6H 4DV6H 4OCHA 4UCUA 5FD6A 4DV2H 2UUBH 4KHPH 3GR5A 4RZQA 4CC6A 4JI1H 1A0IA 3JAMW 4JI5H 4Q0YA 4X65H 4IAJA 4UCTA 4M7EA 3BA9A 4DUYH 3MWMA 1X9ZA 3KDGA 4RB0A 4DR7H 2RGRA 5IT9W 4JI6H 1IBLH 4YHHH 3F8NA 3FAUA 4DV7H 4LF7H 4RB3C 4GLXA 5LMNH 1BJTA 3DF7A 1TAEA 4LFAH 1Z2PX 4JI2H 4OD6A 4JI0H 1FVIA 4GKKH 4RB2C 2VQEH 4K0KH 2XIGA 3KALA 3KAKA 3J7AK 4LH6A 4RAZA 2MCTA 4MTEA 1S68A 4DV0H 2W57A 3OTOH 2UXBH 1N32H 3BA8A 3CVZA 3JSNA 3K3VA 4I7HA 4CC5A 4A2BA 2F4VH 2ZJTA 5IWAH 4EC5A 4JI8H 3N6XA 4LH7A 1XMQH 2RGVA 5D1OA 2HVRA 3N42B 4B3TH 4X64H 3QD7X 3BABA 4LMYA 4JV5H 4EEQA 2O4CA 4UCSA 4JI4H 4LF4H 1V9PA 3IG0A 4DR3H 1FJGH 3RJ0A 4AQYH 2CW7A 1ZHSA 3KXYT 2YCHA 1M0TA 1WH2A 2ZQEA 1Z2NX 2HGSA 4DV4H 4ETSA 4UCRA 4B3MH 1S03G 5D1PA 4NXNH 3C0FB 5D1OB 3N43B 4NZRM 4LSAA 1M0WA 4X66H 4X62H 4GKJH 3LMLA 1N36H 4R7RA 4DV1H 5FLXW 3KDKA 4NZTM 2LF0A 4JI3H 4MV9A 2HHHH 3JSLA 5FPOA 3EZJA 4UFZA 1XNRH 4B3RH 3N41B 4LF9H 4EFBA 2Q2UA 1F0XA 4EFEA 3SB1A 2UXDH 2CW8A 3FMAA 1L2ZA 2E5LH 2KSWA 1HR0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 H;  2VQF H;  4DR5 H;  3T1H H;  4LFB H;  4PDB A;  5LMU H;  2UUA H;  4DV3 H;  5LL6 b;  2UU9 H;  4JYA H;  4DR1 H;  1AN7 A;  1N33 H;  1HNX H;  4LF5 H;  1HNZ H;  1J5E H;  1N34 H;  3T1Y H;  1I94 H;  5A2Q W;  2UXC H;  4OX9 H;  3J81 W;  1FKA H;  1XMO H;  4DV5 H;  4DR4 H;  5BR8 H;  4DR2 H;  1XNQ H;  2ZM6 H;  4JI7 H;  3J80 W;  4NXM H;  4DUZ H;  2UUC H;  4YY3 H;  4LFC H;  4B3S H;  4LF8 H;  1HNW H;  1IBM H;  1I6U A;  1IBK H;  1SEI A;  3RF2 A;  4LF6 H;  4DV6 H;  4DV2 H;  2UUB H;  4KHP H;  4JI1 H;  3JAM W;  4JI5 H;  4X65 H;  4DUY H;  4DR7 H;  5IT9 W;  4JI6 H;  1IBL H;  4YHH H;  4DV7 H;  4LF7 H;  5LMN H;  4LFA H;  4JI2 H;  4JI0 H;  4GKK H;  2VQE H;  4K0K H;  3J7A K;  4DV0 H;  3OTO H;  2UXB H;  1N32 H;  2F4V H;  5IWA H;  4JI8 H;  1XMQ H;  4B3T H;  4X64 H;  4JV5 H;  4JI4 H;  4LF4 H;  4DR3 H;  1FJG H;  4AQY H;  4DV4 H;  4B3M H;  1S03 G;  4NXN H;  4X66 H;  4X62 H;  4GKJ H;  1N36 H;  4DV1 H;  5FLX W;  4JI3 H;  2HHH H;  1XNR H;  4B3R H;  4LF9 H;  2UXD H;  2E5L H;  1HR0 H; 
#chains in the Genus database with same CATH topology
 3HOY G;  4DR6 H;  2FPI B;  3JRX A;  1MZB A;  3UOE A;  4DR5 H;  4LFB H;  3BAA A;  3EPG A;  2CQY A;  2YZM A;  2DPJ A;  2VOB A;  1GYF A;  3GAB A;  3OSS D;  2V59 A;  2UVW A;  3I4M G;  3GLK A;  1TWA A;  2C35 B;  3BQ2 A;  4QW8 A;  4EYI B;  3LP8 A;  5KFB A;  3PW7 A;  4ZI7 F;  4M9U A;  2I87 A;  3FDS A;  3GV8 B;  4F4X A;  3M9N B;  2CWF A;  4MTD A;  3GTL A;  2R7M A;  3H20 A;  4YBZ B;  3I4N G;  2OH2 A;  1KEE A;  4Q43 A;  3RBD A;  2FLN A;  2VPS A;  3OET A;  3T1Y H;  3M4I A;  2AGO A;  2IA6 A;  3HOW G;  2UXC H;  5KFZ A;  2R7K A;  2W8L A;  5C8Y F;  4AM3 A;  4O3S A;  3NGD A;  5C5J A;  1ZQ7 A;  3KHL A;  2JEG A;  3TQT A;  3HBL A;  5DGB A;  3L4K A;  4JV2 A;  5BMV F;  4IRK A;  5C44 G;  4BY7 G;  2W70 A;  1OWT A;  4H8A A;  1TUA A;  4DR4 H;  4FS2 A;  4TQS A;  1XNQ H;  4DR2 H;  4WBN F;  2Q2U A;  2CKZ B;  4A3F G;  4GC6 A;  4ZOL F;  2R6F A;  3J80 W;  3MWD A;  3MFI A;  3WO1 A;  3HOX G;  2MJH A;  4E9J A;  2UVU A;  3Q8Q B;  2CWH A;  3PW0 A;  2PVP A;  3HXL A;  2UUC H;  2FLP A;  2BQ3 A;  3VKE A;  2VUG A;  4O3O A;  5DGA A;  1RYR A;  2PT7 G;  5JEA G;  2R85 A;  3KAJ A;  2CTL A;  5DQI A;  3H3V H;  2QK4 A;  4O4I F;  4O3N A;  3GKU A;  4FBU A;  4TV9 F;  2DIK A;  3TIN A;  1EUD B;  2XD4 A;  4YR3 A;  1CE8 A;  1WCM G;  3RTX A;  3EYY A;  4ECV A;  5KFI A;  4WD3 A;  4QW9 A;  2VA3 A;  3V4Z A;  4QWA A;  2W9C B;  4HR7 A;  2BQU A;  2FMR A;  1ZTG A;  2UUB H;  4OO1 G;  5KFY A;  2R8J A;  4CC6 A;  3GTJ A;  2PN1 A;  2FK1 A;  4DLK A;  2NU7 B;  3M9M B;  4O3R A;  1MSZ A;  4F4Y A;  2DPI A;  2UVV A;  2W6O A;  3N8D A;  5KG5 A;  3SI8 A;  2K1H A;  2JZX A;  1KJJ A;  5IT9 W;  1TWH A;  2B63 G;  3RAX A;  2VA2 A;  3FAU A;  4LF7 H;  4RB3 C;  3GTG A;  2R92 A;  1Z2P X;  3T5H A;  4JV1 A;  1AUV A;  2JA5 A;  4RB2 C;  4YQW A;  5KG1 A;  5KFQ A;  2PY9 A;  3KAL A;  3GV7 B;  2VPQ A;  3PZP A;  4DV0 H;  5HBR B;  3PR5 B;  3KHR A;  2ZDH A;  3GIK A;  3RB4 A;  2J9G A;  4A2B A;  2JEI A;  2F4V H;  4YAJ B;  4JI8 H;  1DT4 A;  2YS6 A;  1IOV A;  4I55 F;  5KFM A;  1XMQ H;  5KFT A;  5D1O A;  1VAJ A;  5KFV A;  2W9B B;  1BXR A;  3BAB A;  5BPH A;  4FU0 A;  2O4C A;  4UCS A;  5KG6 A;  5KFE A;  1Y1W A;  5L1J A;  5L1L A;  2CW7 A;  3L7Z C;  1T94 A;  3I12 A;  3KTM A;  4ECY A;  2JEJ A;  2GPS A;  5C1O A;  4ECX A;  2A1S A;  1M0T A;  2YZG A;  2HGS A;  4DV4 H;  4ETS A;  1RK6 A;  4DL2 A;  2JA9 A;  2M8W A;  2W6Q A;  1S03 G;  3OHB A;  3K3P A;  5D1P A;  2J6S A;  2R7Z A;  2E2H A;  3N43 B;  4NZR M;  1W96 A;  5KFU A;  5KFW A;  2FK2 A;  4Q44 A;  2RF4 A;  1VIH A;  2W7O A;  5L1K A;  4NLG A;  1N36 H;  4U6P A;  3VPB A;  4DV1 H;  5FLX W;  2WB1 A;  5IYD G;  5F9N A;  3G8C A;  4C5B A;  3KDK A;  2DZD A;  2HHH H;  4EFB A;  5KFP A;  3N41 B;  2QND A;  1VBG A;  2VQD A;  2FPP B;  2E5L H;  5KT4 A;  4GC7 A;  1SYX B;  2AQ4 A;  1T36 A;  4EBE A;  2BQR A;  2CPQ A;  4PDB A;  2JA6 A;  1SFO A;  4Q45 A;  4RNM A;  2C2D A;  2UUA H;  4DL5 A;  4TV8 F;  5EDW A;  1O75 A;  4RB1 A;  1AN7 A;  5EZY F;  1HNX H;  3UFX B;  5KX5 F;  3HOU G;  2Z0S A;  2XCA A;  1GGO A;  3OUZ A;  2W7P A;  1E4G T;  2V4Q A;  2UVR A;  4QWE A;  1E4E B;  3ETH A;  5C0X G;  5LP6 F;  4Q8E A;  4RU9 A;  3PO3 G;  1B04 A;  5LOV F;  5KFK A;  2IMW P;  5JQW A;  1P8L A;  1ZET A;  5KT5 A;  2Y3M A;  1N56 A;  3E5N A;  5A2Q W;  5FPR A;  4OX9 H;  4B8C D;  1EYZ A;  4C5C A;  5F9L A;  4YR2 A;  2JA7 A;  3J81 W;  3R5F A;  3M9O B;  1ZZI A;  1K1Q A;  2OLS A;  1V9N A;  2W6Z A;  1EC6 A;  1X4N A;  4ZHQ F;  5KT7 A;  4A3J G;  5EWE A;  2OWO A;  2G8Y A;  2FB9 A;  1K1G A;  2V4R A;  5CB4 F;  1VS0 A;  2WE6 A;  3NCV A;  3RGZ A;  4U7C A;  2R92 G;  4TQR A;  4NXM H;  1Z2O X;  1B6R A;  3AYH B;  2JA5 G;  4AYB A;  2YU9 A;  4O2A F;  3R5X A;  4DUZ H;  2WB1 E;  4ECQ A;  2HH3 A;  1V51 A;  3RIZ A;  4A3C G;  2W9C A;  3Q8S B;  5IYB G;  2FKL A;  1JKJ B;  5CA0 F;  4BY1 G;  1ULZ A;  4J9L A;  1RYS A;  5KT2 A;  1KJI A;  3OUU A;  4EGQ A;  4LF8 H;  5LYJ F;  5GON F;  1HNW H;  3RFC A;  1IBM H;  5KFG A;  1I6U A;  1PK8 A;  2O03 A;  2W9A A;  3JZI A;  5K36 G;  4QWC A;  2V58 A;  1SEI A;  2NU9 B;  5K2M A;  2YRW A;  4DV6 H;  1Y1W G;  3VPD A;  4FJU A;  4OCH A;  1KJQ A;  2YL2 A;  4ZQI A;  5DLG A;  5KFA A;  3MFH A;  2FJZ A;  4RZQ A;  4JI1 H;  1S0O A;  1A0I A;  2R7Z G;  3JAM W;  5CA1 F;  2V9W A;  1C3O A;  4YP3 A;  3KHG A;  4M7E A;  3BA9 A;  1WHR A;  4XX0 B;  4DUY H;  5DLF A;  3V4S A;  4RUA A;  2RGR A;  4DR7 H;  4JI6 H;  1IBL H;  3GIQ A;  4HNV A;  4ECS A;  4QJF A;  1BJT A;  1TAE A;  5KFC A;  1T3N A;  1CQJ B;  4JI2 H;  2W9B A;  4EBD A;  3HKZ E;  2WTF A;  4A3M G;  1C30 A;  2R8G A;  1JDB B;  3T5L A;  4ED8 A;  1S0N A;  3QFF A;  5EWG A;  2HH2 A;  5CAE B;  4O3P A;  2W57 A;  1K83 A;  1N32 H;  2AU0 A;  5L1I A;  2FP4 B;  2I8C A;  4J9K A;  4WAL A;  2ZJT A;  5KFL A;  4EGJ A;  3V6H A;  2JA6 G;  5FLM G;  5KFO A;  2PBZ A;  1KBL A;  4BA2 I;  2WAQ A;  4LH7 A;  2RGV A;  4BBS G;  2E2I A;  4YR0 A;  1DIK A;  2C2E A;  2LRR A;  5J2T F;  4EEQ A;  1X4M A;  2M05 A;  1W93 A;  3H0G A;  4DL4 A;  2J6U A;  3RV4 A;  4JI4 H;  2RDI A;  3K5I A;  4LF4 H;  2IP4 A;  5KFF A;  1X0A A;  4DR3 H;  1VBH A;  4AQY H;  2W6M A;  4JUZ A;  4A3L G;  2ASL A;  2YCH A;  1WH2 A;  1IOW A;  4E4T A;  3MR6 A;  2R87 A;  2ZDG A;  4UCR A;  4J9P A;  1WTJ A;  4G3I A;  5KG2 A;  3C0F B;  2ASJ A;  5DQG A;  2CTF A;  1DV1 A;  4X66 H;  1GO3 E;  4R7R A;  5KFJ A;  1EUC B;  2P0A A;  4ED6 A;  1UNN C;  1RK5 A;  3PW4 A;  2JA7 G;  2R82 A;  1GSH A;  2R86 A;  2FK3 A;  4JI3 H;  4MV9 A;  3ORR A;  5FPO A;  3RV3 A;  3JSL A;  3K5H A;  3EZJ A;  4C2M A;  1XNR H;  1CS0 A;  4R8U B;  4LF9 H;  3PO2 G;  5JVL A;  4MAM A;  3GTM A;  2CW8 A;  1V4Y A;  2KSW A;  4QWD A;  4QMF B;  4MV6 A;  4LSX A;  1EZ1 A;  5KT6 A;  2XGQ A;  4A3B G;  2JVZ A;  3T1H H;  2ZDQ A;  4MV1 A;  4IRD A;  1M7J A;  1UC9 A;  1JDE A;  3ORQ A;  2FPH X;  5LL6 b;  4JYA H;  1BGW A;  4DL3 A;  1JXL A;  2Y0S A;  4A3G G;  4Y8V B;  1AUX A;  3L2P A;  2AXY A;  3GIM A;  4EG0 A;  4LF5 H;  1XDN A;  1X9N A;  1HNZ H;  1ZZJ A;  2VR1 A;  3RGX A;  3BJY A;  3GTO A;  4HYK A;  2AGP A;  3CQZ A;  1KHM A;  1RJP A;  3KHH A;  4APM A;  1PX2 A;  1JIH A;  5H80 A;  1I94 H;  3GIP A;  4O4H F;  5FJ8 G;  5KFD A;  4IR1 A;  2PMZ A;  4B8T A;  2C00 A;  2YQR A;  4BWS C;  2DWC A;  1XMO H;  3T5J A;  2D9I A;  3IN5 A;  4I4T F;  3V6J A;  1TA8 A;  1GSO A;  1I7N A;  3G6V A;  2ZM6 H;  3MJF A;  4O2B F;  3OSP A;  5KFH A;  4UCV A;  4A2A A;  2GLT A;  5DG8 A;  3JRW A;  2C28 A;  4IRC A;  2NVX A;  1WVN A;  5JH7 F;  3PN1 A;  4HQ6 A;  4YY3 H;  4QIW A;  4J9O A;  4ECT A;  2Q2T A;  2VKC A;  3PVX A;  2HJW A;  1ODH A;  2R93 A;  5D8D A;  4EYH B;  3RB6 A;  3RUP A;  1J5K A;  2FE3 A;  2CZG A;  3GII A;  4O3Q A;  3H40 A;  3H0G G;  5KKN B;  4JV0 A;  3GID A;  2YYA A;  4LF6 H;  4A3I G;  2M6Q A;  2R7N A;  4DV2 H;  2FMA A;  5LXT F;  5IP9 G;  4KHP H;  3GR5 A;  4FBT A;  1V8C A;  3OSN A;  3AEV B;  4Q0Y A;  1XRH A;  4RNN A;  3MR2 A;  4IFD G;  5DG7 A;  4UCT A;  2LTL A;  3GV5 B;  3G6Y A;  2OPU A;  4MV4 A;  1X9Z A;  3SE7 A;  4RB0 A;  3VMM A;  1I50 A;  4BXX G;  4J9M A;  2J6T A;  2R8K A;  2X0S A;  5C4X G;  1WE8 A;  3I0P A;  4DV7 H;  5IP7 G;  3HOZ G;  5LMN H;  3MWE A;  4A3D G;  2BA0 A;  4LFA H;  4J9R A;  4JVY A;  1EHI A;  4JI0 H;  1FVI A;  5L9X A;  4GKK H;  1NXU A;  3GQC A;  4J9Q A;  1I3Q A;  3RAQ A;  5LA6 F;  4IR9 A;  4DL6 A;  3KAK A;  4LH6 A;  3J7A K;  4RAZ A;  4MTE A;  1S68 A;  2JE6 I;  3OTO H;  3K3V A;  4RZR A;  3BA8 A;  2YW2 A;  1S10 A;  1ZZK A;  4CC5 A;  1N48 A;  2CTM A;  4EC5 A;  3N6X A;  2IBK A;  1B6S A;  1Z2I A;  2HVR A;  1WR2 A;  2XCL A;  2LTM A;  4B3T H;  3N42 B;  3QD7 X;  4LMY A;  1Y14 B;  1B33 N;  4IZO A;  2ASD A;  3RJ0 A;  2CTK A;  1FJG H;  4YJ2 F;  2ATL A;  1SCU B;  2SCU B;  3GTQ A;  2R84 A;  1ZHS A;  4AIM A;  4QIW E;  3KXY T;  1JLL B;  4R8U A;  5KG0 A;  2ZQE A;  2ANR A;  5BPF A;  4B3M H;  3R5H A;  2YRX A;  4ED7 A;  4DL7 A;  3MR3 A;  3VPC A;  5KT3 A;  1VKZ A;  2XC9 A;  1KC7 A;  3FKI A;  4MV3 A;  4GKJ H;  3LML A;  3WNZ A;  4NBQ A;  1A9X A;  3GIJ A;  2V5A A;  2W71 A;  4EBC A;  3QZ7 A;  3TIG A;  4F50 A;  3RB0 A;  4NZT M;  4ED1 A;  2CTE A;  1VBI A;  4B3R H;  2BL5 A;  4QWB A;  4YJ3 F;  5JUM A;  4BBR G;  3BQ0 A;  4A3E G;  3SB1 A;  1L2Z A;  1VIG A;  4J9N A;  5KFR A;  4BA1 I;  2HVQ A;  2E3U A;  3UQ8 A;  2VQF H;  4FJS A;  4AYB E;  2R7L A;  4ME6 A;  1DGS A;  4YB8 B;  3RB3 A;  4JVH A;  4XYL B;  4Q8F A;  3HB9 A;  5FD5 A;  2VUM G;  3HOV G;  5LMU H;  4DV3 H;  2UU9 H;  4MV7 A;  4DR1 H;  4RUC A;  4MV8 A;  5JVD F;  1N33 H;  2R93 G;  5J2U F;  2RDJ A;  2WYO A;  1TWC A;  1ZHQ A;  3BQ1 A;  2HVS A;  4F4W A;  2CTJ A;  1DV2 A;  1J5E H;  4FS1 A;  1N34 H;  1TWF A;  4XZ3 B;  5KG3 A;  3U9T A;  5C1P A;  4EEY A;  5DT9 A;  4PWQ A;  3T5K A;  4MA0 A;  2W6N A;  1J4W A;  3U1K A;  4FM9 A;  3N40 P;  4WAN A;  1FKA H;  2WDT A;  5EOY A;  3H4D A;  2NU8 B;  2C22 A;  1K1S A;  4DV5 H;  5C3E G;  4RNO A;  4A3K G;  1E4E A;  3U9S A;  2NVY A;  5BR8 H;  3Q8R B;  4ECW A;  2GPW A;  4G08 A;  4JI7 H;  1S9F A;  1E4F T;  1DTJ A;  3G6X A;  4TUY F;  4IWX A;  4O4L F;  2I80 A;  1RJR A;  2JEF A;  3N44 B;  4ED3 A;  2QYZ A;  5DG9 A;  2OPV A;  1Y1V G;  2BR0 A;  4IHJ F;  2XGP A;  3WO0 A;  4RAY A;  5KFX A;  4A93 G;  4LFC H;  1M6V A;  4B3S H;  5KG7 A;  3GTP A;  2DGR A;  1PQX A;  5KFN A;  3H4B A;  5KG4 A;  2WAQ E;  3ETJ A;  2NU6 B;  4HNU A;  4I50 F;  3QZ8 A;  1IBK H;  4UCO A;  3RF2 A;  3Q1K A;  4J0M A;  3MR5 A;  1RJQ A;  3L4J A;  1UG8 A;  2FFM A;  4UCU A;  2JA8 G;  5FD6 A;  2NN6 G;  2DLN A;  1GLV A;  2W6P A;  4JI5 H;  2YS7 A;  4X65 H;  2JEA I;  4IAJ A;  1S0M A;  1UC8 A;  4MA5 A;  1GSA A;  3FKI G;  3MWM A;  2P2R A;  3KDG A;  2XCP A;  3BG5 A;  3TII A;  3F8N A;  4YHH H;  4XYM B;  5KFS A;  3EPI A;  4GLX A;  2VUM A;  3DF7 A;  1CQI B;  2PQU A;  2FPG B;  4OD6 A;  3R23 A;  1I7L A;  3RBE A;  2C2R A;  2YZN A;  2VQE H;  4K0K H;  1S97 A;  2XIG A;  5IYZ F;  4F4Z A;  4HNT A;  2R8I A;  1KJ8 A;  3JSN A;  4ECR A;  2UXB H;  5T14 A;  3CVZ A;  4I7H A;  4ED0 A;  3GTK A;  5IWA H;  2NUA B;  1JX4 A;  4ED2 A;  1S20 A;  5IYC G;  2CPM A;  5EWF A;  2FLL A;  4LIJ A;  2W8K A;  1WSC A;  3PW2 A;  3PW5 A;  4X64 H;  3PR4 A;  4JV5 H;  1WCM A;  2ALZ A;  2Y0S E;  3LWB A;  1V9P A;  3IG0 A;  2R8H A;  5HV6 A;  5DQH A;  1R9T A;  4L1K A;  1Z2N X;  4ECZ A;  2X06 A;  4IWY A;  2AGQ A;  4NXN H;  5D1O B;  4LSA A;  4YAK B;  1M0W A;  3Q2O A;  4X62 H;  3Q8P B;  5I47 A;  3OHA A;  2B63 A;  4C5A A;  2PMZ E;  1TWG A;  3V6K A;  1BNC A;  2LF0 A;  4ECU A;  2ANN A;  3V69 A;  3TQ1 A;  4UFZ A;  1KJ9 A;  1Y1V A;  3HKZ A;  4J9S A;  1F0X A;  4EFE A;  2JEB I;  2UXD H;  3FMA A;  3GIL A;  2MCT A;  1HR0 H; 
#chains in the Genus database with same CATH homology
 1SYX B;  2HVQ A;  4LSX A;  3UQ8 A;  4DR6 H;  2VQF H;  1MZB A;  4DR5 H;  3T1H H;  4LFB H;  3BAA A;  4PDB A;  1DGS A;  1GYF A;  2VOB A;  5FD5 A;  3GAB A;  3OSS D;  5LMU H;  2UUA H;  2FPH X;  4DV3 H;  5LL6 b;  2UU9 H;  4JYA H;  4DR1 H;  1BGW A;  1AN7 A;  1O75 A;  4MV7 A;  1N33 H;  4RB1 A;  1HNX H;  2WYO A;  3L2P A;  1E4G T;  1ZHQ A;  2HVS A;  4LF5 H;  1XDN A;  1X9N A;  1HNZ H;  4MTD A;  3RGX A;  1B04 A;  1J5E H;  3H20 A;  1N34 H;  1P8L A;  2VPS A;  4APM A;  5DT9 A;  2Y3M A;  3OET A;  3T1Y H;  1I94 H;  3M4I A;  5A2Q W;  2UXC H;  5FPR A;  4OX9 H;  4B8C D;  4FM9 A;  3N40 P;  3J81 W;  1FKA H;  2WDT A;  5EOY A;  1XMO H;  4BWS C;  2D9I A;  3L4K A;  4DV5 H;  1TA8 A;  4DR4 H;  2OWO A;  5BR8 H;  4DR2 H;  1XNQ H;  2ZM6 H;  1VS0 A;  2WE6 A;  3NCV A;  4G08 A;  4JI7 H;  3RGZ A;  1E4F T;  4UCV A;  3J80 W;  4NXM H;  1Z2O X;  4A2A A;  4E9J A;  4DUZ H;  3N44 B;  3HXL A;  2UUC H;  3RIZ A;  3PN1 A;  2VUG A;  4YY3 H;  4RAY A;  2PT7 G;  4LFC H;  3KAJ A;  2Q2T A;  2VKC A;  4B3S H;  1ODH A;  4LF8 H;  1HNW H;  1IBM H;  1I6U A;  2FE3 A;  2O03 A;  1IBK H;  1SEI A;  3RTX A;  3EYY A;  3RF2 A;  4UCO A;  4J0M A;  3L4J A;  4LF6 H;  4DV6 H;  4OCH A;  4UCU A;  5FD6 A;  4DV2 H;  2UUB H;  4KHP H;  3GR5 A;  4RZQ A;  4CC6 A;  4JI1 H;  1A0I A;  3JAM W;  4JI5 H;  4Q0Y A;  4X65 H;  4IAJ A;  4UCT A;  4M7E A;  3BA9 A;  4DUY H;  3MWM A;  1X9Z A;  3KDG A;  4RB0 A;  4DR7 H;  2RGR A;  5IT9 W;  4JI6 H;  1IBL H;  4YHH H;  3F8N A;  3FAU A;  4DV7 H;  4LF7 H;  4RB3 C;  4GLX A;  5LMN H;  1BJT A;  3DF7 A;  1TAE A;  4LFA H;  1Z2P X;  4JI2 H;  4OD6 A;  4JI0 H;  1FVI A;  4GKK H;  4RB2 C;  2VQE H;  4K0K H;  2XIG A;  3KAL A;  3KAK A;  3J7A K;  4LH6 A;  4RAZ A;  2MCT A;  4MTE A;  1S68 A;  4DV0 H;  2W57 A;  3OTO H;  2UXB H;  1N32 H;  3BA8 A;  3CVZ A;  3JSN A;  3K3V A;  4I7H A;  4CC5 A;  4A2B A;  2F4V H;  2ZJT A;  5IWA H;  4EC5 A;  4JI8 H;  3N6X A;  4LH7 A;  1XMQ H;  2RGV A;  5D1O A;  2HVR A;  3N42 B;  4B3T H;  4X64 H;  3QD7 X;  3BAB A;  4LMY A;  4JV5 H;  4EEQ A;  2O4C A;  4UCS A;  4JI4 H;  4LF4 H;  1V9P A;  3IG0 A;  4DR3 H;  1FJG H;  3RJ0 A;  4AQY H;  2CW7 A;  1ZHS A;  3KXY T;  2YCH A;  1M0T A;  1WH2 A;  2ZQE A;  1Z2N X;  2HGS A;  4DV4 H;  4ETS A;  4UCR A;  4B3M H;  1S03 G;  5D1P A;  4NXN H;  3C0F B;  5D1O B;  3N43 B;  4NZR M;  4LSA A;  1M0W A;  4X66 H;  4X62 H;  4GKJ H;  3LML A;  1N36 H;  4R7R A;  4DV1 H;  5FLX W;  3KDK A;  4NZT M;  2LF0 A;  4JI3 H;  4MV9 A;  2HHH H;  3JSL A;  5FPO A;  3EZJ A;  4UFZ A;  1XNR H;  4B3R H;  3N41 B;  4LF9 H;  4EFB A;  2Q2U A;  1F0X A;  4EFE A;  3SB1 A;  2UXD H;  2CW8 A;  3FMA A;  1L2Z A;  2E5L H;  2KSW A;  1HR0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...