1S03G

The structure of a ribosomal protein s8/spc operon mrna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a ribosomal protein S8/spc operon mRNA complex.
pubmed doi rcsb
molecule tags Transcription/rna
molecule keywords 47-MER
total genus 29
structure length 126
sequence length 126
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 1s03G01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1s03G02
4YHHH 2UU9H 4LF8H 4LF6H 5FLXW 4B3MH 4LFAH 2UXDH 5LMNH 2VQFH 4B3SH 1N32H 4GKJH 4AQYH 4YY3H 4JI7H 4GKKH 3RF2A 4NXNH 4JI2H 4LF5H 1HNXH 1IBLH 1FKAH 4K0KH 4X62H 2UUCH 1XMOH 1HNWH 4DR6H 5LL6b 1N33H 4JV5H 1XMQH 5IT9W 4DR3H 4JI8H 2HHHH 4NXMH 4DV5H 4JI6H 4DV4H 3T1YH 1I94H 4JI5H 5LMUH 2F4VH 4X64H 3OTOH 4DV2H 4B3TH 4LFBH 4JI1H 4DR4H 5BR8H 5IWAH 4DR2H 3J7AK 4JI0H 2E5LH 4DR5H 4DUZH 2UUBH 1XNRH 4X65H 1XNQH 2ZM6H 1IBMH 4KHPH 4DR7H 1HR0H 1S03G 4B3RH 1I6UA 4DUYH 1J5EH 5A2QW 2UXCH 1AN7A 4LF4H 4DV3H 1FJGH 2VQEH 4DV1H 4OX9H 4X66H 4LF7H 3JAMW 4DV6H 3J80W 3J81W 1IBKH 1HNZH 1N36H 4LFCH 2UXBH 1N34H 4DR1H 4PDBA 2UUAH 4DV0H 1SEIA 4LF9H 4DV7H 4JI3H 4JI4H 3T1HH 4JYAH
chains in the Genus database with same CATH superfamily
1S0MA 2JEJA 4LH6A 4UCUA 1VKZA 4BWSC 4AM3A 2FLPA 1KJQA 3BAAA 1I3QA 4YP3A 4R8UB 5KG1A 5L1KA 5KFAA 1VBHA 3GIMA 2OPUA 1CQJB 2R8JA 2W6QA 3T5JA 2JEGA 5BPHA 5FLXW 3RFCA 4FS2A 2CPMA 1Z2OX 4LFAH 2W8LA 1M6VA 4JUZA 5KT3A 3HOZG 3OUUA 1N32H 4A93G 3RJ0A 2R7MA 2LF0A 4BBSG 4AQYH 2HVRA 3VPBA 3M9NB 3K3PA 3GTQA 2HGSA 3GLKA 1CS0A 1W93A 2UVUA 4HNUA 4C5CA 3L7ZC 1O75A 4OCHA 1PK8A 4J9MA 3RF2A 4QIWE 5JVDF 4NXNH 4ECSA 5KFQA 3OHBA 5JUMA 5KFNA 1A0IA 4LF5H 4UCRA 3HOWG 2YQRA 5CA0F 3R23A 5C8YF 2YRWA 4IR9A 2LTMA 2VUMA 1TWAA 5FD5A 4I7HA 4FJSA 4K0KH 4X62H 1V9NA 2G8YA 4B8CD 3BABA 4IWYA 5D1PA 3RB0A 4E9JA 5C1PA 4EBDA 2WB1A 4YAKB 2V58A 1GSHA 1I50A 3RV3A 5LL6b 4ZHQF 4A3GG 2M8WA 5HV6A 1V8CA 2JA5A 5JH7F 2PMZE 4MV7A 2W70A 1WH2A 1BGWA 2W6MA 2YRXA 4IAJA 4RAZA 2R7LA 4TV9F 4UCSA 4DV5H 4JI6H 2W57A 3GQCA 1N56A 4A3LG 2JA6A 5C0XG 5C4XG 2YYAA 1GLVA 1W96A 3OSSD 3KXYT 4JV0A 5KFYA 4MV8A 3HXLA 1FVIA 2WAQA 3ETHA 4I50F 5FJ8G 4I4TF 1KJIA 4RB3C 3KHGA 1MZBA 4LFBH 1M7JA 4ED7A 1GSOA 5BR8H 4EFEA 2NN6G 4O2BF 3KTMA 4FS1A 4EGJA 5IP7G 3L2PA 3N41B 3RIZA 3BQ2A 4JV1A 4DR2H 5EWFA 4BXXG 4ZQIA 4L1KA 1VS0A 2RDIA 4JI0H 5DQHA 3LWBA 4JVHA 4O2AF 1T36A 3T5KA 5L1JA 2J9GA 1B6SA 4J9KA 4ED8A 3Q8SB 3RBDA 1DTJA 1XNQH 4IRDA 2ZM6H 5JEAG 5F9LA 3EYYA 4RU9A 2ANNA 2FPGB 3H0GA 4TQRA 2FK3A 1S03G 3WO1A 2WB1E 4GC6A 3H3VH 2GPSA 1I6UA 3IG0A 3I4NG 1UC9A 2UXCH 2W9CB 4O4IF 2YS7A 4J9LA 4EBCA 4A3MG 1Y1VA 3TQ1A 2IMWP 3HOVG 1X0AA 4LF4H 3GIQA 2Y0SE 3AYHB 4MV1A 3VPDA 3Q1KA 3EPIA 1WCMG 2XCAA 4ECYA 1XDNA 4OX9H 2C00A 2R82A 2PVPA 4DL2A 2FPIB 4F50A 3GTOA 2R92G 4BA2I 4ED3A 4RUCA 3V6JA 1NXUA 2AQ4A 2RGRA 1UG8A 3M9MB 4JV2A 3GTMA 3OSPA 4DV6H 3JSNA 2CTFA 2CWHA 2V5AA 3CVZA 3HKZE 1EC6A 3PW4A 2HH2A 3J81W 1WTJA 3ORQA 4IRKA 4ETSA 3G6VA 1RJQA 1N36H 2R7NA 2W6NA 1JIHA 2WTFA 1Z2PX 1ZZIA 3R5XA 3N42B 4UCVA 4ED2A 2AGPA 2JA7A 4MTEA 2I87A 1SEIA 4LF9H 4DV7H 2PY9A 1JKJB 5KFTA 3U9TA 2XGQA 4GC7A 2Q2UA 4JI4H 4DL7A 3CQZA 2V59A 4CC5A 3GIPA 2DZDA 4Q45A 4F4WA 1GGOA 2J6SA 2JA8G 4RZQA 2BR0A 1VBGA 1RJPA 1B04A 2CW8A 3M9OB 4O4LF 5L1LA 3SB1A 1IOVA 4LF8H 1K1QA 2WE6A 3K3VA 4Q8FA 2VA2A 4B3MH 4EGQA 2B63A 2UXDH 4DL5A 4NZTM 2RGVA 5DGBA 2E2IA 2VUMG 1ODHA 2DIKA 4TQSA 4RB0A 3KHLA 2DGRA 3H40A 2JVZA 4YBZB 3G6YA 5KG7A 3FAUA 2YS6A 4AYBA 5CA1F 2ASDA 5DT9A 4O3RA 3HOYG 4FJUA 4NBQA 3MJFA 5HBRB 4ECRA 4BA1I 2O4CA 1PX2A 4EG0A 4UCTA 2JEFA 2R7ZA 2XC9A 3V6KA 4WBNF 2JZXA 2R87A 2VOBA 2CTLA 1DT4A 3LP8A 3N6XA 2AGQA 2JA6G 5KKNB 2OH2A 2PQUA 4O3NA 2R84A 4EC5A 3FDSA 5KFZA 3OETA 1XMOH 2VPQA 1L2ZA 3MFIA 3QFFA 2VKCA 4R7RA 5KG3A 4GLXA 2QNDA 2A1SA 1V4YA 4DR6H 1OWTA 4Q44A 1KJ9A 4ECUA 2GPWA 1N33H 4YR2A 1R9TA 3GV5B 2R93A 2P2RA 3C0FB 2WYOA 2SCUB 3N43B 2YZMA 2BL5A 4JI8H 2HHHH 4QWAA 4A2AA 4NXMH 5KT4A 3RGXA 3RB6A 4DV4H 2UVRA 3T1YH 3H20A 2R8IA 5KFXA 4JI5H 3MR3A 3KHRA 3RBEA 2C2DA 5LMUH 3RB3A 1BJTA 2DPIA 3OTOH 2W6ZA 5K36G 4QWCA 2W8KA 4XX0B 2W9BB 2JE6I 4JI1H 3JSLA 4QJFA 5DG7A 4A3JG 5CAEB 5DGAA 3RB4A 1SYXB 2VQDA 2W6PA 4MV6A 4FU0A 5KFVA 3GIJA 2FLLA 2ZDQA 1GYFA 1DIKA 4WANA 4XYLB 3GV7B 4DR5H 2KSWA 4YR0A 3BQ1A 3TIGA 2IBKA 2C2EA 1TWGA 1VBIA 1E4GT 2HVQA 5L9XA 1I7NA 1Y1WA 4A3FG 4X65H 1ULZA 1S20A 2HJWA 2W6OA 4U6PA 2CTMA 4HNTA 1S68A 4DR7H 4TUYF 5DG9A 2XGPA 3PO3G 1HR0H 2YZGA 5KFMA 3WNZA 4B3RH 2X0SA 1J5EH 2CPQA 5LYJF 4A3KG 3BG5A 2R8KA 1DV1A 5IYZF 3Q8PB 4C5BA 4ED6A 3RV4A 4J9OA 4NLGA 4DV3H 1K1GA 1FJGH 2DLNA 4MTDA 2QYZA 1V51A 2ASJA 3GIKA 2HH3A 4LF7H 5FD6A 3NGDA 1A9XA 4AIMA 1E4EB 1RYRA 3NCVA 2AGOA 4J0MA 3AEVB 4ECWA 3T5LA 1KEEA 2FFMA 5C44G 4TV8F 4ME6A 2CWFA 5KG4A 1I7LA 1X9ZA 3GKUA 3V69A 4JVYA 5KFPA 4DR1H 3UFXB 4ECVA 4LSAA 5KFFA 2UUAH 2JEAI 2FKLA 4Y8VB 5JVLA 3JRWA 4DV0H 3H4BA 3MWMA 5KX5F 2CTEA 2ATLA 2FLNA 4JI3H 4AYBE 2UVVA 1RJRA 3GABA 3T1HH 2ZDGA 1JDEA 4LH7A 2O03A 4RUAA 3I12A 5LOVF 4O3OA 2UU9H 1BNCA 4F4YA 4OO1G 2JA5G 4Q8EA 2ASLA 1K1SA 5EWGA 2Z0SA 1EZ1A 5IYCG 4EYHB 2NVYA 5KFUA 2JEBI 4LF6H 1EYZA 2BQ3A 2R86A 2JEIA 3R5FA 3HKZA 4J9NA 1P8LA 4ECQA 1ZETA 3RAXA 2J6UA 1JDBB 2JA9A 4MV4A 1WHRA 2CTKA 3BA9A 1E4EA 3UOEA 3RGZA 1J4WA 5KG0A 3PVXA 5LMNH 2R7ZG 2VR1A 4BY1G 5DLFA 3PR4A 2YL2A 4YJ3F 5EOYA 4GKJH 4F4XA 4RB1A 3KALA 4A2BA 3PZPA 4YY3H 4JI7H 4EEYA 2OWOA 3E5NA 5EWEA 3G8CA 1ZQ7A 4O4HF 4C2MA 1J5KA 2PMZA 1XRHA 2Y3MA 1TAEA 3QZ8A 3I4MG 4JI2H 4ECXA 2R93G 2CW7A 3DF7A 2IP4A 5DLGA 2C22A 4HNVA 1FKAH 3SI8A 1CQIB 4H8AA 1HNWH 2R6FA 4ED1A 4G08A 1RK6A 4BBRG 4EEQA 3BA8A 1TUAA 1Y1VG 1XMQH 3OUZA 5IT9W 3GIIA 4Q0YA 5I47A 2FE3A 1M0TA 5KFRA 2ZDHA 1I94H 3MR5A 4IHJF 3PR5B 5H80A 4DLKA 2F4VH 1B33N 5FPRA 4X64H 3GTPA 4FBUA 3I0PA 3KDKA 4DV2H 3KAJA 4B3TH 1S9FA 4DR4H 3MR6A 1Y1WG 2CTJA 3M4IA 2HVSA 2W9CA 2VUGA 5IYDG 2V4QA 5T14A 5IWAH 5KFWA 4Q43A 3PO2G 3UQ8A 3L4JA 3J7AK 1T94A 1VAJA 3FKIA 3OSNA 4ECTA 5EDWA 2Q2TA 4MV3A 2C2RA 4HYKA 5DG8A 4DUZH 5DQGA 1VIGA 3G6XA 3EPGA 2XCLA 4XZ3B 4WALA 4YQWA 2W7PA 3RAQA 4YAJB 1XNRH 2E2HA 3GTJA 3Q2OA 2ZJTA 1JXLA 3GILA 4O3PA 4QWEA 2R85A 1UNNC 4KHPH 4RNNA 4RZRA 3H4DA 3PW2A 5GONF 1V9PA 1Y14B 2IA6A 1KC7A 4APMA 2FMRA 5KFEA 2FK1A 3JRXA 3K5IA 1AN7A 1UC8A 2AU0A 4J9RA 1ZTGA 1Z2NX 2FP4B 2I8CA 5BMVF 4XYMB 3PW7A 4ED0A 5KFBA 4ECZA 3HB9A 3KDGA 5KT7A 4DV1H 5C5JA 2V4RA 5KT5A 4LSXA 1C30A 3VKEA 2W9AA 3J80W 1E4FT 2C35B 4WD3A 3N40P 3RTXA 3SE7A 1TWFA 3ORRA 4YJ2F 4LFCH 1EUCB 1EUDB 4B8TA 1AUVA 5FPOA 4QMFB 1SFOA 4J9SA 2NVXA 2I80A 3N8DA 2YW2A 4HR7A 4ZOLF 5KG2A 1ZHSA 2M6QA 2FMAA 3F8NA 3RUPA 2D9IA 2J6TA 3K5HA 4G3IA 1JLLB 4YHHH 2NU8B 5FLMG 2GLTA 4C5AA 1S97A 2AXYA 2E3UA 3U1KA 4UFZA 1KBLA 3EZJA 3HBLA 2UVWA 4A3DG 3T5HA 5LA6F 2BQRA 4O3SA 4U7CA 5LXTF 2FPHX 3H0GG 2CZGA 1ZZJA 3VPCA 2DWCA 5DQIA 1RK5A 2RF4A 3HOXG 2XD4A 2OLSA 5C1OA 2CQYA 4MAMA 1EHIA 5KFHA 1IOWA 2K1HA 4FM9A 1RYSA 2NU9B 2CKZB 2PBZA 2BQUA 2VQFH 4B3SH 4CC6A 3V4ZA 4MA5A 1WCMA 1WR2A 2NU6B 4A3EG 4DL3A 2FJZA 1S10A 4GKKH 2M05A 4DL4A 1C3OA 2MJHA 5KFDA 3QZ7A 3BQ0A 3GR5A 4IFDG 1DGSA 1SCUB 4QIWA 3WO0A 4A3IG 4BY7G 2C28A 1HNXH 2WDTA 5J2TF 4E4TA 4IRCA 5CB4F 1IBLH 4F4ZA 2JA7G 2RDJA 5C3EG 3PW0A 1KHMA 5KG5A 5KFSA 1X4NA 3MWEA 2UUCH 3GV8B 3MR2A 3VMMA 2YU9A 5KT6A 4YR3A 3TINA 3ETJA 3IN5A 4A3CG 2ALZA 4HQ6A 3V6HA 4JV5H 1CE8A 3OHAA 4QW8A 5LP6F 2W9BA 1KJJA 2LRRA 4DR3H 3GIDA 2OPVA 2X06A 1TWHA 3N44B 4I55F 4MV9A 5KFOA 5KT2A 4LIJA 3BJYA 4FBTA 4A3BG 2WAQE 3KHHA 3Q8RB 3FKIG 5KFIA 1TWCA 2LTLA 1KJ8A 3MFHA 5BPFA 2DPJA 2BA0A 1N48A 2NU7B 1JX4A 2B63G 3R5HA 5KFKA 3TIIA 3KAKA 2R7KA 3LMLA 1T3NA 1X4MA 1ZHQA 4IR1A 4IZOA 4MA0A 4OD6A 4LMYA 1TA8A 2XCPA 5D1OB 1X9NA 2V9WA 3TQTA 5EZYF 2E5LH 1WSCA 1F0XA 3PN1A 2XIGA 5F9NA 1AUXA 4R8UA 4EBEA 1S0NA 2Y0SA 3PW5A 4YB8B 4PWQA 2UUBH 5KFGA 1DV2A 1VIHA 4M7EA 5L1IA 4RB2C 4RNOA 1IBMH 1GSAA 1ZZKA 2ANRA 4M9UA 1MSZA 4RAYA 2W71A 1Z2IA 2W7OA 3GTLA 4J9PA 4QWBA 4DUYH 4IWXA 5A2QW 3L4KA 1GO3E 4J9QA 1K83A 2VPSA 3Q8QB 1WVNA 2MCTA 2R8GA 2P0AA 5KFJA 4EYIB 2VQEH 4QW9A 5K2MA 5IYBG 3HOUG 2NUAB 4QWDA 4X66H 3JZIA 5KFLA 4O3QA 2VA3A 4UCOA 5J2UF 5D1OA 5D8DA 3JAMW 3U9SA 2R8HA 4DL6A 1PQXA 2YZNA 3GTKA 1IBKH 4ZI7F 1HNZH 2PT7G 2ZQEA 2UXBH 2PN1A 1WE8A 5KFCA 1M0WA 3GTGA 1N34H 2FK2A 1S0OA 2FB9A 4PDBA 4RNMA 1B6RA 5JQWA 3FMAA 1BXRA 2R92A 2YCHA 3V4SA 5IP9G 4EFBA 3QD7X 2FPPB 4NZRM 5KG6A 2QK4A 4JYAH 3MWDA
chains in the Genus database with same CATH topology
4YHHH 4LH6A 4UCUA 4BWSC 3BAAA 2UU9H 4UFZA 3EZJA 4RZQA 1B04A 2CW8A 2FPHX 3SB1A 4LF8H 4LF6H 2WE6A 3K3VA 1P8LA 5FLXW 4B3MH 3BA9A 1Z2OX 3RGZA 4LFAH 4FM9A 2UXDH 4LH7A 5LMNH 4NZTM 2VQFH 2RGVA 4B3SH 1N32H 4CC6A 3RJ0A 1ODHA 5EOYA 4GKJH 2LF0A 4Q0YA 3KALA 4AQYH 4RB0A 4A2BA 4RB1A 4YY3H 4JI7H 2HVRA 2OWOA 2HGSA 3FAUA 4GKKH 5DT9A 1O75A 4OCHA 3RF2A 4NXNH 2Y3MA 1TAEA 2O4CA 4JI2H 1A0IA 4LF5H 4UCRA 3GR5A 1DGSA 4UCTA 2CW7A 3DF7A 1HNXH 2WDTA 2VOBA 5FD5A 1IBLH 3N6XA 4I7HA 1FKAH 4K0KH 4X62H 3BABA 5D1PA 4B8CD 4E9JA 4EC5A 2UUCH 3OETA 1XMOH 1HNWH 1L2ZA 2VKCA 4R7RA 4GLXA 4G08A 4DR6H 4EEQA 5LL6b 3BA8A 1N33H 4JV5H 1XMQH 3C0FB 4MV7A 2WYOA 3N43B 5IT9W 3N44B 4DR3H 4JI8H 2HHHH 1BGWA 1M0TA 1WH2A 2FE3A 4NXMH 4IAJA 4DV5H 4JI6H 2W57A 4DV4H 4RAZA 3T1YH 3H20A 4UCSA 3RGXA 4MV9A 1I94H 4JI5H 3OSSD 3KXYT 5LMUH 2F4VH 3HXLA 4X64H 1BJTA 1FVIA 5FPRA 3OTOH 3KDKA 4RB3C 4DV2H 3KAJA 4B3TH 4LFBH 1MZBA 4JI1H 4DR4H 3JSLA 3M4IA 2HVSA 5BR8H 3KAKA 3LMLA 4EFEA 2VUGA 3L2PA 1SYXB 3N41B 3RIZA 5IWAH 4DR2H 1ZHQA 4OD6A 4LMYA 1TA8A 3UQ8A 3L4JA 5D1OB 3J7AK 1X9NA 1GYFA 1VS0A 4JI0H 2E5LH 2Q2TA 4DR5H 2KSWA 1F0XA 3PN1A 2XIGA 4DUZH 2UUBH 1E4GT 2HVQA 4M7EA 1XNRH 4RB2C 4X65H 1XNQH 2ZJTA 2ZM6H 1IBMH 3EYYA 4KHPH 4DR7H 1S68A 4RAYA 1HR0H 1S03G 1V9PA 4B3RH 1I6UA 4DUYH 1J5EH 5A2QW 3IG0A 2UXCH 4APMA 3L4KA 2VPSA 1AN7A 1Z2NX 2MCTA 4LF4H 4DV3H 1FJGH 4MTDA 2VQEH 3KDGA 1XDNA 4DV1H 4OX9H 4X66H 4LF7H 4LSXA 4A2AA 2RGRA 4UCOA 5FD6A 5D1OA 3JAMW 4DV6H 3JSNA 3J80W 3NCVA 1E4FT 3CVZA 3N40P 3RTXA 4J0MA 3J81W 1IBKH 4ETSA 1HNZH 1N36H 2PT7G 2ZQEA 4LFCH 2UXBH 1X9ZA 1M0WA 1Z2PX 1N34H 5FPOA 4DR1H 3N42B 4UCVA 4LSAA 4PDBA 2UUAH 4MTEA 3FMAA 4DV0H 1SEIA 4LF9H 4DV7H 1ZHSA 2YCHA 3QD7X 3F8NA 3MWMA 4EFBA 4JI3H 4JI4H 4NZRM 2D9IA 3GABA 3T1HH 2Q2UA 4CC5A 4JYAH 2O03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH H;  2UU9 H;  4LF8 H;  4LF6 H;  5FLX W;  4B3M H;  4LFA H;  2UXD H;  5LMN H;  2VQF H;  4B3S H;  1N32 H;  4GKJ H;  4AQY H;  4YY3 H;  4JI7 H;  4GKK H;  3RF2 A;  4NXN H;  4JI2 H;  4LF5 H;  1HNX H;  1IBL H;  1FKA H;  4K0K H;  4X62 H;  2UUC H;  1XMO H;  1HNW H;  4DR6 H;  5LL6 b;  1N33 H;  4JV5 H;  1XMQ H;  5IT9 W;  4DR3 H;  4JI8 H;  2HHH H;  4NXM H;  4DV5 H;  4JI6 H;  4DV4 H;  3T1Y H;  1I94 H;  4JI5 H;  5LMU H;  2F4V H;  4X64 H;  3OTO H;  4DV2 H;  4B3T H;  4LFB H;  4JI1 H;  4DR4 H;  5BR8 H;  5IWA H;  4DR2 H;  3J7A K;  4JI0 H;  2E5L H;  4DR5 H;  4DUZ H;  2UUB H;  1XNR H;  4X65 H;  1XNQ H;  2ZM6 H;  1IBM H;  4KHP H;  4DR7 H;  1HR0 H;  1S03 G;  4B3R H;  1I6U A;  4DUY H;  1J5E H;  5A2Q W;  2UXC H;  1AN7 A;  4LF4 H;  4DV3 H;  1FJG H;  2VQE H;  4DV1 H;  4OX9 H;  4X66 H;  4LF7 H;  3JAM W;  4DV6 H;  3J80 W;  3J81 W;  1IBK H;  1HNZ H;  1N36 H;  4LFC H;  2UXB H;  1N34 H;  4DR1 H;  4PDB A;  2UUA H;  4DV0 H;  1SEI A;  4LF9 H;  4DV7 H;  4JI3 H;  4JI4 H;  3T1H H;  4JYA H; 
#chains in the Genus database with same CATH topology
 1S0M A;  2JEJ A;  4LH6 A;  4UCU A;  1VKZ A;  4BWS C;  4AM3 A;  2FLP A;  1KJQ A;  3BAA A;  1I3Q A;  4YP3 A;  4R8U B;  5KG1 A;  5L1K A;  5KFA A;  1VBH A;  3GIM A;  2OPU A;  1CQJ B;  2R8J A;  2W6Q A;  3T5J A;  2JEG A;  5BPH A;  5FLX W;  3RFC A;  4FS2 A;  2CPM A;  1Z2O X;  4LFA H;  2W8L A;  1M6V A;  4JUZ A;  5KT3 A;  3HOZ G;  3OUU A;  1N32 H;  4A93 G;  3RJ0 A;  2R7M A;  2LF0 A;  4BBS G;  4AQY H;  2HVR A;  3VPB A;  3M9N B;  3K3P A;  3GTQ A;  2HGS A;  3GLK A;  1CS0 A;  1W93 A;  2UVU A;  4HNU A;  4C5C A;  3L7Z C;  1O75 A;  4OCH A;  1PK8 A;  4J9M A;  3RF2 A;  4QIW E;  5JVD F;  4NXN H;  4ECS A;  5KFQ A;  3OHB A;  5JUM A;  5KFN A;  1A0I A;  4LF5 H;  4UCR A;  3HOW G;  2YQR A;  5CA0 F;  3R23 A;  5C8Y F;  2YRW A;  4IR9 A;  2LTM A;  2VUM A;  1TWA A;  5FD5 A;  4I7H A;  4FJS A;  4K0K H;  4X62 H;  1V9N A;  2G8Y A;  4B8C D;  3BAB A;  4IWY A;  5D1P A;  3RB0 A;  4E9J A;  5C1P A;  4EBD A;  2WB1 A;  4YAK B;  2V58 A;  1GSH A;  1I50 A;  3RV3 A;  5LL6 b;  4ZHQ F;  4A3G G;  2M8W A;  5HV6 A;  1V8C A;  2JA5 A;  5JH7 F;  2PMZ E;  4MV7 A;  2W70 A;  1WH2 A;  1BGW A;  2W6M A;  2YRX A;  4IAJ A;  4RAZ A;  2R7L A;  4TV9 F;  4UCS A;  4DV5 H;  4JI6 H;  2W57 A;  3GQC A;  1N56 A;  4A3L G;  2JA6 A;  5C0X G;  5C4X G;  2YYA A;  1GLV A;  1W96 A;  3OSS D;  3KXY T;  4JV0 A;  5KFY A;  4MV8 A;  3HXL A;  1FVI A;  2WAQ A;  3ETH A;  4I50 F;  5FJ8 G;  4I4T F;  1KJI A;  4RB3 C;  3KHG A;  1MZB A;  4LFB H;  1M7J A;  4ED7 A;  1GSO A;  5BR8 H;  4EFE A;  2NN6 G;  4O2B F;  3KTM A;  4FS1 A;  4EGJ A;  5IP7 G;  3L2P A;  3N41 B;  3RIZ A;  3BQ2 A;  4JV1 A;  4DR2 H;  5EWF A;  4BXX G;  4ZQI A;  4L1K A;  1VS0 A;  2RDI A;  4JI0 H;  5DQH A;  3LWB A;  4JVH A;  4O2A F;  1T36 A;  3T5K A;  5L1J A;  2J9G A;  1B6S A;  4J9K A;  4ED8 A;  3Q8S B;  3RBD A;  1DTJ A;  1XNQ H;  4IRD A;  2ZM6 H;  5JEA G;  5F9L A;  3EYY A;  4RU9 A;  2ANN A;  2FPG B;  3H0G A;  4TQR A;  2FK3 A;  1S03 G;  3WO1 A;  2WB1 E;  4GC6 A;  3H3V H;  2GPS A;  1I6U A;  3IG0 A;  3I4N G;  1UC9 A;  2UXC H;  2W9C B;  4O4I F;  2YS7 A;  4J9L A;  4EBC A;  4A3M G;  1Y1V A;  3TQ1 A;  2IMW P;  3HOV G;  1X0A A;  4LF4 H;  3GIQ A;  2Y0S E;  3AYH B;  4MV1 A;  3VPD A;  3Q1K A;  3EPI A;  1WCM G;  2XCA A;  4ECY A;  1XDN A;  4OX9 H;  2C00 A;  2R82 A;  2PVP A;  4DL2 A;  2FPI B;  4F50 A;  3GTO A;  2R92 G;  4BA2 I;  4ED3 A;  4RUC A;  3V6J A;  1NXU A;  2AQ4 A;  2RGR A;  1UG8 A;  3M9M B;  4JV2 A;  3GTM A;  3OSP A;  4DV6 H;  3JSN A;  2CTF A;  2CWH A;  2V5A A;  3CVZ A;  3HKZ E;  1EC6 A;  3PW4 A;  2HH2 A;  3J81 W;  1WTJ A;  3ORQ A;  4IRK A;  4ETS A;  3G6V A;  1RJQ A;  1N36 H;  2R7N A;  2W6N A;  1JIH A;  2WTF A;  1Z2P X;  1ZZI A;  3R5X A;  3N42 B;  4UCV A;  4ED2 A;  2AGP A;  2JA7 A;  4MTE A;  2I87 A;  1SEI A;  4LF9 H;  4DV7 H;  2PY9 A;  1JKJ B;  5KFT A;  3U9T A;  2XGQ A;  4GC7 A;  2Q2U A;  4JI4 H;  4DL7 A;  3CQZ A;  2V59 A;  4CC5 A;  3GIP A;  2DZD A;  4Q45 A;  4F4W A;  1GGO A;  2J6S A;  2JA8 G;  4RZQ A;  2BR0 A;  1VBG A;  1RJP A;  1B04 A;  2CW8 A;  3M9O B;  4O4L F;  5L1L A;  3SB1 A;  1IOV A;  4LF8 H;  1K1Q A;  2WE6 A;  3K3V A;  4Q8F A;  2VA2 A;  4B3M H;  4EGQ A;  2B63 A;  2UXD H;  4DL5 A;  4NZT M;  2RGV A;  5DGB A;  2E2I A;  2VUM G;  1ODH A;  2DIK A;  4TQS A;  4RB0 A;  3KHL A;  2DGR A;  3H40 A;  2JVZ A;  4YBZ B;  3G6Y A;  5KG7 A;  3FAU A;  2YS6 A;  4AYB A;  5CA1 F;  2ASD A;  5DT9 A;  4O3R A;  3HOY G;  4FJU A;  4NBQ A;  3MJF A;  5HBR B;  4ECR A;  4BA1 I;  2O4C A;  1PX2 A;  4EG0 A;  4UCT A;  2JEF A;  2R7Z A;  2XC9 A;  3V6K A;  4WBN F;  2JZX A;  2R87 A;  2VOB A;  2CTL A;  1DT4 A;  3LP8 A;  3N6X A;  2AGQ A;  2JA6 G;  5KKN B;  2OH2 A;  2PQU A;  4O3N A;  2R84 A;  4EC5 A;  3FDS A;  5KFZ A;  3OET A;  1XMO H;  2VPQ A;  1L2Z A;  3MFI A;  3QFF A;  2VKC A;  4R7R A;  5KG3 A;  4GLX A;  2QND A;  2A1S A;  1V4Y A;  4DR6 H;  1OWT A;  4Q44 A;  1KJ9 A;  4ECU A;  2GPW A;  1N33 H;  4YR2 A;  1R9T A;  3GV5 B;  2R93 A;  2P2R A;  3C0F B;  2WYO A;  2SCU B;  3N43 B;  2YZM A;  2BL5 A;  4JI8 H;  2HHH H;  4QWA A;  4A2A A;  4NXM H;  5KT4 A;  3RGX A;  3RB6 A;  4DV4 H;  2UVR A;  3T1Y H;  3H20 A;  2R8I A;  5KFX A;  4JI5 H;  3MR3 A;  3KHR A;  3RBE A;  2C2D A;  5LMU H;  3RB3 A;  1BJT A;  2DPI A;  3OTO H;  2W6Z A;  5K36 G;  4QWC A;  2W8K A;  4XX0 B;  2W9B B;  2JE6 I;  4JI1 H;  3JSL A;  4QJF A;  5DG7 A;  4A3J G;  5CAE B;  5DGA A;  3RB4 A;  1SYX B;  2VQD A;  2W6P A;  4MV6 A;  4FU0 A;  5KFV A;  3GIJ A;  2FLL A;  2ZDQ A;  1GYF A;  1DIK A;  4WAN A;  4XYL B;  3GV7 B;  4DR5 H;  2KSW A;  4YR0 A;  3BQ1 A;  3TIG A;  2IBK A;  2C2E A;  1TWG A;  1VBI A;  1E4G T;  2HVQ A;  5L9X A;  1I7N A;  1Y1W A;  4A3F G;  4X65 H;  1ULZ A;  1S20 A;  2HJW A;  2W6O A;  4U6P A;  2CTM A;  4HNT A;  1S68 A;  4DR7 H;  4TUY F;  5DG9 A;  2XGP A;  3PO3 G;  1HR0 H;  2YZG A;  5KFM A;  3WNZ A;  4B3R H;  2X0S A;  1J5E H;  2CPQ A;  5LYJ F;  4A3K G;  3BG5 A;  2R8K A;  1DV1 A;  5IYZ F;  3Q8P B;  4C5B A;  4ED6 A;  3RV4 A;  4J9O A;  4NLG A;  4DV3 H;  1K1G A;  1FJG H;  2DLN A;  4MTD A;  2QYZ A;  1V51 A;  2ASJ A;  3GIK A;  2HH3 A;  4LF7 H;  5FD6 A;  3NGD A;  1A9X A;  4AIM A;  1E4E B;  1RYR A;  3NCV A;  2AGO A;  4J0M A;  3AEV B;  4ECW A;  3T5L A;  1KEE A;  2FFM A;  5C44 G;  4TV8 F;  4ME6 A;  2CWF A;  5KG4 A;  1I7L A;  1X9Z A;  3GKU A;  3V69 A;  4JVY A;  5KFP A;  4DR1 H;  3UFX B;  4ECV A;  4LSA A;  5KFF A;  2UUA H;  2JEA I;  2FKL A;  4Y8V B;  5JVL A;  3JRW A;  4DV0 H;  3H4B A;  3MWM A;  5KX5 F;  2CTE A;  2ATL A;  2FLN A;  4JI3 H;  4AYB E;  2UVV A;  1RJR A;  3GAB A;  3T1H H;  2ZDG A;  1JDE A;  4LH7 A;  2O03 A;  4RUA A;  3I12 A;  5LOV F;  4O3O A;  2UU9 H;  1BNC A;  4F4Y A;  4OO1 G;  2JA5 G;  4Q8E A;  2ASL A;  1K1S A;  5EWG A;  2Z0S A;  1EZ1 A;  5IYC G;  4EYH B;  2NVY A;  5KFU A;  2JEB I;  4LF6 H;  1EYZ A;  2BQ3 A;  2R86 A;  2JEI A;  3R5F A;  3HKZ A;  4J9N A;  1P8L A;  4ECQ A;  1ZET A;  3RAX A;  2J6U A;  1JDB B;  2JA9 A;  4MV4 A;  1WHR A;  2CTK A;  3BA9 A;  1E4E A;  3UOE A;  3RGZ A;  1J4W A;  5KG0 A;  3PVX A;  5LMN H;  2R7Z G;  2VR1 A;  4BY1 G;  5DLF A;  3PR4 A;  2YL2 A;  4YJ3 F;  5EOY A;  4GKJ H;  4F4X A;  4RB1 A;  3KAL A;  4A2B A;  3PZP A;  4YY3 H;  4JI7 H;  4EEY A;  2OWO A;  3E5N A;  5EWE A;  3G8C A;  1ZQ7 A;  4O4H F;  4C2M A;  1J5K A;  2PMZ A;  1XRH A;  2Y3M A;  1TAE A;  3QZ8 A;  3I4M G;  4JI2 H;  4ECX A;  2R93 G;  2CW7 A;  3DF7 A;  2IP4 A;  5DLG A;  2C22 A;  4HNV A;  1FKA H;  3SI8 A;  1CQI B;  4H8A A;  1HNW H;  2R6F A;  4ED1 A;  4G08 A;  1RK6 A;  4BBR G;  4EEQ A;  3BA8 A;  1TUA A;  1Y1V G;  1XMQ H;  3OUZ A;  5IT9 W;  3GII A;  4Q0Y A;  5I47 A;  2FE3 A;  1M0T A;  5KFR A;  2ZDH A;  1I94 H;  3MR5 A;  4IHJ F;  3PR5 B;  5H80 A;  4DLK A;  2F4V H;  1B33 N;  5FPR A;  4X64 H;  3GTP A;  4FBU A;  3I0P A;  3KDK A;  4DV2 H;  3KAJ A;  4B3T H;  1S9F A;  4DR4 H;  3MR6 A;  1Y1W G;  2CTJ A;  3M4I A;  2HVS A;  2W9C A;  2VUG A;  5IYD G;  2V4Q A;  5T14 A;  5IWA H;  5KFW A;  4Q43 A;  3PO2 G;  3UQ8 A;  3L4J A;  3J7A K;  1T94 A;  1VAJ A;  3FKI A;  3OSN A;  4ECT A;  5EDW A;  2Q2T A;  4MV3 A;  2C2R A;  4HYK A;  5DG8 A;  4DUZ H;  5DQG A;  1VIG A;  3G6X A;  3EPG A;  2XCL A;  4XZ3 B;  4WAL A;  4YQW A;  2W7P A;  3RAQ A;  4YAJ B;  1XNR H;  2E2H A;  3GTJ A;  3Q2O A;  2ZJT A;  1JXL A;  3GIL A;  4O3P A;  4QWE A;  2R85 A;  1UNN C;  4KHP H;  4RNN A;  4RZR A;  3H4D A;  3PW2 A;  5GON F;  1V9P A;  1Y14 B;  2IA6 A;  1KC7 A;  4APM A;  2FMR A;  5KFE A;  2FK1 A;  3JRX A;  3K5I A;  1AN7 A;  1UC8 A;  2AU0 A;  4J9R A;  1ZTG A;  1Z2N X;  2FP4 B;  2I8C A;  5BMV F;  4XYM B;  3PW7 A;  4ED0 A;  5KFB A;  4ECZ A;  3HB9 A;  3KDG A;  5KT7 A;  4DV1 H;  5C5J A;  2V4R A;  5KT5 A;  4LSX A;  1C30 A;  3VKE A;  2W9A A;  3J80 W;  1E4F T;  2C35 B;  4WD3 A;  3N40 P;  3RTX A;  3SE7 A;  1TWF A;  3ORR A;  4YJ2 F;  4LFC H;  1EUC B;  1EUD B;  4B8T A;  1AUV A;  5FPO A;  4QMF B;  1SFO A;  4J9S A;  2NVX A;  2I80 A;  3N8D A;  2YW2 A;  4HR7 A;  4ZOL F;  5KG2 A;  1ZHS A;  2M6Q A;  2FMA A;  3F8N A;  3RUP A;  2D9I A;  2J6T A;  3K5H A;  4G3I A;  1JLL B;  4YHH H;  2NU8 B;  5FLM G;  2GLT A;  4C5A A;  1S97 A;  2AXY A;  2E3U A;  3U1K A;  4UFZ A;  1KBL A;  3EZJ A;  3HBL A;  2UVW A;  4A3D G;  3T5H A;  5LA6 F;  2BQR A;  4O3S A;  4U7C A;  5LXT F;  2FPH X;  3H0G G;  2CZG A;  1ZZJ A;  3VPC A;  2DWC A;  5DQI A;  1RK5 A;  2RF4 A;  3HOX G;  2XD4 A;  2OLS A;  5C1O A;  2CQY A;  4MAM A;  1EHI A;  5KFH A;  1IOW A;  2K1H A;  4FM9 A;  1RYS A;  2NU9 B;  2CKZ B;  2PBZ A;  2BQU A;  2VQF H;  4B3S H;  4CC6 A;  3V4Z A;  4MA5 A;  1WCM A;  1WR2 A;  2NU6 B;  4A3E G;  4DL3 A;  2FJZ A;  1S10 A;  4GKK H;  2M05 A;  4DL4 A;  1C3O A;  2MJH A;  5KFD A;  3QZ7 A;  3BQ0 A;  3GR5 A;  4IFD G;  1DGS A;  1SCU B;  4QIW A;  3WO0 A;  4A3I G;  4BY7 G;  2C28 A;  1HNX H;  2WDT A;  5J2T F;  4E4T A;  4IRC A;  5CB4 F;  1IBL H;  4F4Z A;  2JA7 G;  2RDJ A;  5C3E G;  3PW0 A;  1KHM A;  5KG5 A;  5KFS A;  1X4N A;  3MWE A;  2UUC H;  3GV8 B;  3MR2 A;  3VMM A;  2YU9 A;  5KT6 A;  4YR3 A;  3TIN A;  3ETJ A;  3IN5 A;  4A3C G;  2ALZ A;  4HQ6 A;  3V6H A;  4JV5 H;  1CE8 A;  3OHA A;  4QW8 A;  5LP6 F;  2W9B A;  1KJJ A;  2LRR A;  4DR3 H;  3GID A;  2OPV A;  2X06 A;  1TWH A;  3N44 B;  4I55 F;  4MV9 A;  5KFO A;  5KT2 A;  4LIJ A;  3BJY A;  4FBT A;  4A3B G;  2WAQ E;  3KHH A;  3Q8R B;  3FKI G;  5KFI A;  1TWC A;  2LTL A;  1KJ8 A;  3MFH A;  5BPF A;  2DPJ A;  2BA0 A;  1N48 A;  2NU7 B;  1JX4 A;  2B63 G;  3R5H A;  5KFK A;  3TII A;  3KAK A;  2R7K A;  3LML A;  1T3N A;  1X4M A;  1ZHQ A;  4IR1 A;  4IZO A;  4MA0 A;  4OD6 A;  4LMY A;  1TA8 A;  2XCP A;  5D1O B;  1X9N A;  2V9W A;  3TQT A;  5EZY F;  2E5L H;  1WSC A;  1F0X A;  3PN1 A;  2XIG A;  5F9N A;  1AUX A;  4R8U A;  4EBE A;  1S0N A;  2Y0S A;  3PW5 A;  4YB8 B;  4PWQ A;  2UUB H;  5KFG A;  1DV2 A;  1VIH A;  4M7E A;  5L1I A;  4RB2 C;  4RNO A;  1IBM H;  1GSA A;  1ZZK A;  2ANR A;  4M9U A;  1MSZ A;  4RAY A;  2W71 A;  1Z2I A;  2W7O A;  3GTL A;  4J9P A;  4QWB A;  4DUY H;  4IWX A;  5A2Q W;  3L4K A;  1GO3 E;  4J9Q A;  1K83 A;  2VPS A;  3Q8Q B;  1WVN A;  2MCT A;  2R8G A;  2P0A A;  5KFJ A;  4EYI B;  2VQE H;  4QW9 A;  5K2M A;  5IYB G;  3HOU G;  2NUA B;  4QWD A;  4X66 H;  3JZI A;  5KFL A;  4O3Q A;  2VA3 A;  4UCO A;  5J2U F;  5D1O A;  5D8D A;  3JAM W;  3U9S A;  2R8H A;  4DL6 A;  1PQX A;  2YZN A;  3GTK A;  1IBK H;  4ZI7 F;  1HNZ H;  2PT7 G;  2ZQE A;  2UXB H;  2PN1 A;  1WE8 A;  5KFC A;  1M0W A;  3GTG A;  1N34 H;  2FK2 A;  1S0O A;  2FB9 A;  4PDB A;  4RNM A;  1B6R A;  5JQW A;  3FMA A;  1BXR A;  2R92 A;  2YCH A;  3V4S A;  5IP9 G;  4EFB A;  3QD7 X;  2FPP B;  4NZR M;  5KG6 A;  2QK4 A;  4JYA H;  3MWD A; 
#chains in the Genus database with same CATH homology
 4YHH H;  4LH6 A;  4UCU A;  4BWS C;  3BAA A;  2UU9 H;  4UFZ A;  3EZJ A;  4RZQ A;  1B04 A;  2CW8 A;  2FPH X;  3SB1 A;  4LF8 H;  4LF6 H;  2WE6 A;  3K3V A;  1P8L A;  5FLX W;  4B3M H;  3BA9 A;  1Z2O X;  3RGZ A;  4LFA H;  4FM9 A;  2UXD H;  4LH7 A;  5LMN H;  4NZT M;  2VQF H;  2RGV A;  4B3S H;  1N32 H;  4CC6 A;  3RJ0 A;  1ODH A;  5EOY A;  4GKJ H;  2LF0 A;  4Q0Y A;  3KAL A;  4AQY H;  4RB0 A;  4A2B A;  4RB1 A;  4YY3 H;  4JI7 H;  2HVR A;  2OWO A;  2HGS A;  3FAU A;  4GKK H;  5DT9 A;  1O75 A;  4OCH A;  3RF2 A;  4NXN H;  2Y3M A;  1TAE A;  2O4C A;  4JI2 H;  1A0I A;  4LF5 H;  4UCR A;  3GR5 A;  1DGS A;  4UCT A;  2CW7 A;  3DF7 A;  1HNX H;  2WDT A;  2VOB A;  5FD5 A;  1IBL H;  3N6X A;  4I7H A;  1FKA H;  4K0K H;  4X62 H;  3BAB A;  5D1P A;  4B8C D;  4E9J A;  4EC5 A;  2UUC H;  3OET A;  1XMO H;  1HNW H;  1L2Z A;  2VKC A;  4R7R A;  4GLX A;  4G08 A;  4DR6 H;  4EEQ A;  5LL6 b;  3BA8 A;  1N33 H;  4JV5 H;  1XMQ H;  3C0F B;  4MV7 A;  2WYO A;  3N43 B;  5IT9 W;  3N44 B;  4DR3 H;  4JI8 H;  2HHH H;  1BGW A;  1M0T A;  1WH2 A;  2FE3 A;  4NXM H;  4IAJ A;  4DV5 H;  4JI6 H;  2W57 A;  4DV4 H;  4RAZ A;  3T1Y H;  3H20 A;  4UCS A;  3RGX A;  4MV9 A;  1I94 H;  4JI5 H;  3OSS D;  3KXY T;  5LMU H;  2F4V H;  3HXL A;  4X64 H;  1BJT A;  1FVI A;  5FPR A;  3OTO H;  3KDK A;  4RB3 C;  4DV2 H;  3KAJ A;  4B3T H;  4LFB H;  1MZB A;  4JI1 H;  4DR4 H;  3JSL A;  3M4I A;  2HVS A;  5BR8 H;  3KAK A;  3LML A;  4EFE A;  2VUG A;  3L2P A;  1SYX B;  3N41 B;  3RIZ A;  5IWA H;  4DR2 H;  1ZHQ A;  4OD6 A;  4LMY A;  1TA8 A;  3UQ8 A;  3L4J A;  5D1O B;  3J7A K;  1X9N A;  1GYF A;  1VS0 A;  4JI0 H;  2E5L H;  2Q2T A;  4DR5 H;  2KSW A;  1F0X A;  3PN1 A;  2XIG A;  4DUZ H;  2UUB H;  1E4G T;  2HVQ A;  4M7E A;  1XNR H;  4RB2 C;  4X65 H;  1XNQ H;  2ZJT A;  2ZM6 H;  1IBM H;  3EYY A;  4KHP H;  4DR7 H;  1S68 A;  4RAY A;  1HR0 H;  1S03 G;  1V9P A;  4B3R H;  1I6U A;  4DUY H;  1J5E H;  5A2Q W;  3IG0 A;  2UXC H;  4APM A;  3L4K A;  2VPS A;  1AN7 A;  1Z2N X;  2MCT A;  4LF4 H;  4DV3 H;  1FJG H;  4MTD A;  2VQE H;  3KDG A;  1XDN A;  4DV1 H;  4OX9 H;  4X66 H;  4LF7 H;  4LSX A;  4A2A A;  2RGR A;  4UCO A;  5FD6 A;  5D1O A;  3JAM W;  4DV6 H;  3JSN A;  3J80 W;  3NCV A;  1E4F T;  3CVZ A;  3N40 P;  3RTX A;  4J0M A;  3J81 W;  1IBK H;  4ETS A;  1HNZ H;  1N36 H;  2PT7 G;  2ZQE A;  4LFC H;  2UXB H;  1X9Z A;  1M0W A;  1Z2P X;  1N34 H;  5FPO A;  4DR1 H;  3N42 B;  4UCV A;  4LSA A;  4PDB A;  2UUA H;  4MTE A;  3FMA A;  4DV0 H;  1SEI A;  4LF9 H;  4DV7 H;  1ZHS A;  2YCH A;  3QD7 X;  3F8N A;  3MWM A;  4EFB A;  4JI3 H;  4JI4 H;  4NZR M;  2D9I A;  3GAB A;  3T1H H;  2Q2U A;  4CC5 A;  4JYA H;  2O03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...