1S04A

Solution nmr structure of protein pf0455 from pyrococcus furiosus. northeast structural genomics consortium target pfr13
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF0455
publication title Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13
rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1s04A00
1WK2A 2DP9A 1S04A 1TE7A 2E5OA 2KKUA 3IUWA 2Z0TA 1XNEA
chains in the Genus database with same CATH superfamily
3LJCA 2CX1A 3M6VA 2J5TA 3MQKA 2Q07A 1S04A 3LDFA 3M6XA 4DMGA 2B78A 4CI2B 3M4XA 1XNEA 1R3FA 1IT8A 2J5VA 2RFKA 3M6UA 1TE7A 1ZE1A 2CWWA 2FRXA 1T5YA 2P38A 1J2BA 3C0KA 1ZL3A 4CI1B 1SGVA 3HJWA 3HJYA 4CI3B 1IT7A 1SQWA 2AS0A 1ZS7A 3LWOA 1WXWA 2ANEA 3D79A 4TZ4C 1K8WA 3ZV0C 3LWPA 3IUWA 3M65A 3M6WA 1ZE2A 1R3EA 1Q7HA 2EY4A 4Q1TA 1IQ8A 3LWRA 1WK2A 3VSEA 1ZBOA 2AUSA 1WXXA 2DP9A 3HAXA 2HVYA 3U28A 2CX0A 2E5OA 2KKUA 3UAIA 2Z0TA 3LWQA 2AB4A 1UOYA 3LWVA 2APOA
chains in the Genus database with same CATH topology
4C26A 1WK2A 2DP9A 1S04A 1TE7A 4P78C 2E5OA 2KKUA 3IUWA 1WHZA 2Z0TA 1XNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WK2 A;  2DP9 A;  1S04 A;  1TE7 A;  2E5O A;  2KKU A;  3IUW A;  2Z0T A;  1XNE A; 
#chains in the Genus database with same CATH topology
 3LJC A;  2CX1 A;  3M6V A;  2J5T A;  3MQK A;  2Q07 A;  1S04 A;  3LDF A;  3M6X A;  4DMG A;  2B78 A;  4CI2 B;  3M4X A;  1XNE A;  1R3F A;  1IT8 A;  2J5V A;  2RFK A;  3M6U A;  1TE7 A;  1ZE1 A;  2CWW A;  2FRX A;  1T5Y A;  2P38 A;  1J2B A;  3C0K A;  1ZL3 A;  4CI1 B;  1SGV A;  3HJW A;  3HJY A;  4CI3 B;  1IT7 A;  1SQW A;  2AS0 A;  1ZS7 A;  3LWO A;  1WXW A;  2ANE A;  3D79 A;  4TZ4 C;  1K8W A;  3ZV0 C;  3LWP A;  3IUW A;  3M65 A;  3M6W A;  1ZE2 A;  1R3E A;  1Q7H A;  2EY4 A;  4Q1T A;  1IQ8 A;  3LWR A;  1WK2 A;  3VSE A;  1ZBO A;  2AUS A;  1WXX A;  2DP9 A;  3HAX A;  2HVY A;  3U28 A;  2CX0 A;  2E5O A;  2KKU A;  3UAI A;  2Z0T A;  3LWQ A;  2AB4 A;  1UOY A;  3LWV A;  2APO A; 
#chains in the Genus database with same CATH homology
 4C26 A;  1WK2 A;  2DP9 A;  1S04 A;  1TE7 A;  4P78 C;  2E5O A;  2KKU A;  3IUW A;  1WHZ A;  2Z0T A;  1XNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...