The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
110
|
structure length |
110
|
Chain Sequence |
MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Pyrococcus furiosus
|
| molecule keywords |
hypothetical protein PF0455
|
| total genus |
17
|
| structure length |
110
|
| sequence length |
110
|
| ec nomenclature | |
| pdb deposition date | 2003-12-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04266 | ASCH | ASCH domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 | Hypothetical protein. |
#chains in the Genus database with same CATH superfamily 2DP9 A; 1TE7 A; 2E5O A; 2KKU A; 1XNE A; 1S04 A; 1WK2 A; 2Z0T A; 3IUW A; #chains in the Genus database with same CATH topology 3LWP A; 2DP9 A; 1TE7 A; 3M6W A; 2E5O A; 4CI3 B; 4TZ4 C; 3LDF A; 1SQW A; 4DMG A; 2APO A; 2J5V A; 3M6V A; 1WXX A; 3M65 A; 3LWQ A; 1Q7H A; 3HJY A; 3LJC A; 1R3F A; 1ZE1 A; 2AUS A; 3C0K A; 1R3E A; 2KKU A; 1WXW A; 2HVY A; 4Q1T A; 1T5Y A; 1IT8 A; 1K8W A; 1IT7 A; 3HAX A; 2ANE A; 3U28 A; 2P38 A; 2B78 A; 2CWW A; 3IUW A; 4CI1 B; 2AS0 A; 4CI2 B; 3M6X A; 1UOY A; 2EY4 A; 3D79 A; 3ZV0 C; 1ZS7 A; 1S04 A; 1XNE A; 2Q07 A; 3LWO A; 2RFK A; 3MQK A; 2AB4 A; 2FRX A; 1SGV A; 3M4X A; 3M6U A; 3VSE A; 3LWR A; 1ZBO A; 1ZL3 A; 3HJW A; 3UAI A; 1WK2 A; 2J5T A; 2Z0T A; 1J2B A; 1IQ8 A; 3LWV A; 2CX0 A; 2CX1 A; 1ZE2 A; #chains in the Genus database with same CATH homology 2DP9 A; 1TE7 A; 2E5O A; 2KKU A; 1WHZ A; 1XNE A; 1S04 A; 1WK2 A; 2Z0T A; 4C26 A; 3IUW A; 4P78 C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
