1S0PA

Structure of the n-terminal domain of the adenylyl cyclase-associated protein (cap) from dictyostelium discoideum.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
176
Chain Sequence
SVKEFQNLVDQHITPFVALSKKLAPEVGNQVEQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPHVAEMRGSAEFYTNRILKEFKGVNQDQVDWVSNYVNFLKDLEKYIKQYHTTGLTWNPKGGDAKSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE N-TERMINAL DOMAIN OF THE ADENYLYL CYCLASE-ASSOCIATED PROTEIN (CAP) FROM DICTYOSTELIUM DISCOIDEUM
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Membrane protein
molecule keywords Adenylyl cyclase-associated protein
total genus 66
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.330 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1s0pA01
1S0PA 1TJFA
chains in the Genus database with same CATH superfamily
3R9MA 2V8SE 4O60A 4FLBA 4BETA 2IOLA 4JA7A 3V30A 4GA2A 2P9PG 2RD0A 1WM5A 1IXVA 1XGWA 1E7UA 3BQOA 3TWWA 2DCPA 3KD7A 2VQ2A 4U0ZA 4YNDA 2KCLA 1OY3D 4L7TA 4MRUA 3UM3A 1KZOA 2OEVA 2X6FA 1H2VC 2BF0X 4BEPA 2BKGA 1JCQA 1TJFA 4XEIG 1E96B 2R05A 2EINE 3FUDA 1ZU2A 1DCQA 3FUKA 4BSZB 3FUIA 3IV0A 3CVUA 4LERA 2F0YA 1XNFA 3MKRA 3CIAA 3T8KA 3ABKE 3SFYA 2DVWA 3D3MA 3E32A 3ZIMA 2CG2A 2R5SA 5EN5D 3CK9A 2WQ7A 3C98A 5JHAA 3NZSA 3HXBA 2DWZA 4ANVA 3RSEG 3SI5A 2KZTA 4JVSA 3ML9A 1TEZA 5CMWA 3QWPA 5ENRD 2V5FA 3D9IA 2YHEA 5ENPD 4AIFA 4GPKA 4ILHB 1MYOA 1LF8A 3Q5MA 2C0MA 4A55A 3SZ7A 5FT9A 5BW8C 5B3SE 1ZBPA 3CGHA 4CDRA 3PZ4A 2ZGGA 5ANRA 4RG6A 1DCEA 4DX5D 3TWTA 3EU9A 3I4GA 4B89A 2WXPA 4CT0A 3CV0A 1UG3A 3KSQA 3SY2A 3R7RA 3ZGQA 4FU3A 3DSWA 2F8YA 3RO3A 2L0IA 2NYJA 4JL0A 4I6JA 3AU5A 3CVVA 2X3MA 1K8KG 4RG9A 1JCRA 3J5QB 2FULA 1BD8A 4UWHA 4GAAA 1FCHA 3ASOE 4BX8A 2XHEA 2WXKA 4WWNA 3APDA 1IKND 4FHJA 4MBGA 4EHMA 3O48A 5ANLA 3VLFA 3B7SA 3PRZA 1OWPA 2KBXA 2P9IG 3HDXA 4J8FA 5ENTD 2JABA 4CRWA 1S0PA 4MKTA 5JJ6A 3NB2A 3FH8A 3MZLB 3S2AA 1N4RA 3ASGA 1MHQA 4F7AA 2QY7A 5CCLA 5LFAA 4CDNA 4HOSA 1HH8A 3ZNGA 4I2WA 4E85A 3PNTB 3VTXA 5KCMA 2XZDG 5D0QD 3D9PA 4F1PA 1LTXA 2AXVA 2UY1B 4UQZA 2GRLA 1UJJA 3I3NA 4GTSA 3PEUB 4LNBA 4JZYA 4ATZD 3FUMA 5D0OD 4LNUD 1WY6A 2X38A 1N4SA 4ANWA 1K1AA 3Q79A 2P2CP 4HI9A 4F6RD 2Y69E 4Z68A 1JPLA 3SQVA 1P5QA 4JPSA 5JHBA 4ME2A 3HXDA 3CVYA 3SBTB 3AG1E 3PZ1A 3TWXA 2XENA 5B1AE 1N95A 2P9SG 3EHQA 3GZ1A 4U95D 1EF1C 4A63B 3FU5A 3CSFA 5CCMA 4KMOA 3ZPJA 2WXIA 3UM1A 4JEUA 2ZIRA 4HS2A 1JCSA 4BERA 3TL5A 3ZYQA 3Q4AB 2AXUA 1AP7A 3TWVA 5LOZA 1U3DA 4N2QA 4BWRA 2IOSA 4GB9A 3ZKJA 1EDUA 3SFZA 5A7DB 2IO3C 3HHMA 3JQ0A 3DSUA 1TN8A 4TUUA 2AJAA 2GRMA 4U8VD 3ESLA 2WQ6A 3APFA 4HOTA 4RQIA 1JWFA 1KPSB 5ENSD 1OCZE 1E8ZA 2VSOE 4HXIA 4B8CB 4F53A 2EIKE 1TNUA 4YVQC 3ASHA 3FH5A 4W9RA 3TXMA 4L23A 2OVFA 1FVFA 2R2LA 4HOQA 3V2OA 1O5MA 3B7BA 3AAAC 5T4YA 3TWUA 2IJGX 1UN8A 3APCA 4DJAA 4BT9A 3TG5A 3ZYMA 2BKKB 4C0EA 4UWGA 3FTYA 4EPZA 4JHRA 3LVQE 3JQ1A 4XZ4A 3KS2A 1SQMA 3FUHA 5EILA 5JJTA 2PQNA 3E37A 4H7YA 3KEZA 3EIJA 4AP2A 3FP3A 2VGYA 3WXXA 2EIJE 4GYWA 3MGBA 4DUIA 5BV1A 4LRZA 3LYAA 5LX8A 1MX2A 3DPYA 4GTOA 5B1BE 2L9BA 3TWQA 1OWOA 2H6GA 1JUQA 1Z6TA 5BXOA 4GYYA 2PZIA 3NOCD 1MQSA 4KBQA 3NBNB 3D9OA 3FHEA 1TN7A 3OAWA 5HS0A 5G04J 1KT0A 1KZPA 3W9GA 4WNEA 1LD7A 3CLJA 4AY6A 3GYZA 2CHXA 4XI0A 4B8AA 3GZ2A 1A5EA 4U8HA 3PUJA 2ZGDA 4G11A 4DLQA 3IXEA 1HX8A 4I6GA 3OXLA 2FEZA 1Y6IA 3D9JA 4LUNU 4J6IA 4GMLA 4GTPA 2WXJA 1K1BA 3L82A 5FIOA 2DYRE 4J0UA 5JJ7A 4PUCA 1OCRE 2PM7A 4CGWA 2J49A 2OVBA 2BUGA 3AS4A 3CKBA 3FUJA 5KNGA 5ITZF 5LCWJ 3CHMA 4ANUA 2J8SD 1BI8B 3I5PA 3MKQA 4APOA 2PL2A 3RK6A 3UXGA 1U3CA 1KLXA 1EPUA 3NOGD 4UUCA 3BUAA 1HFAA 3IHYA 1OCCE 3E30A 3G2TA 1D9SA 3C3QA 3TWSA 3TAXA 4HI8A 1QNFA 3PDNA 4EBAG 1HXIA 2J07A 3CR3A 3EDTB 4JA9A 1MJ0A 2R17C 1FT2A 4R7LA 5A23A 3E34A 1ZB1A 1MX6A 4GMRA 3SBSA 2IFUA 4G23A 4FP7A 1G3NB 3UM2A 4GU5A 3C3OA 2JEKA 3ZYLA 4A1SA 4GA1A 3UMVA 2I2OA 3E4BA 2GROB 2R02A 5FQ7A 2RFAA 2V4LA 3N71A 4OAUC 3HXEA 1IQRA 1SZ9A 3CVPA 1S64A 4I6EA 5AQBA 1HE8A 3KSLA 3AS5A 3FWVA 2VTBA 4OYSA 4I1OB 3UKRG 3DSVA 4HBDA 1FT1A 3UIOC 1N94A 3ZW3A 4B93B 2MRIA 4I9CA 5EX0A 4BSXA 5BXUA 5ENNA 2VSXE 3SF4A 2Y4UA 5AJLA 3FDHA 2AXZA 4IYPA 2KZTB 2J4BA 1QBQA 4A3TA 2ETAA 1N4PA 3ULQA 2YQ8A 2HR2A 3RKVA 2QYUA 4B94A 2GW1A 3B7UX 2P9LG 2Q7FA 4F1SA 2QYJA 4Q69A 2IU1A 4DX2A 3UT4A 3EJNA 5EKQD 2XPIA 3S7DA 5IY5E 3T5XA 4KXKB 2XCCA 3CQCB 1D8EA 3QWVA 4BY6A 5DBKA 4RVBA 4U0SA 3ASFA 3D9LA 2X6HA 4WNFA 4DI4A 3U3WA 3DSXA 3ASDA 3EHNA 3FTVA 2P9UG 2VYIA 3QJZA 5ARGA 4XE0A 2RKKA 2LAHA 4JD2G 2GRNB 4EZLA 4G8LA 4WNGA 4N2SA 3PEVB 5G05J 2I6HA 4IULA 5CBNA 5FZRA 3U9WA 2I1KA 4HVBA 3G2WA 2FF4A 3MV3B 3LY8A 2V5QC 4LSZE 1IQUA 3PE3A 4XX5A 5A6CA 3PUKA 5AJDA 3ZYKA 2P9KG 3MEKA 4GCOA 1TNZA 4TUMA 5E76A 3IHVA 2XS1A 3DSSA 3IKOB 5C2YA 3S7JA 3ULYA 2IEJA 1LD8A 3CK8A 5FQ8A 1H2UA 3FTZA 1IYGA 3FEYA 4FC8A 1BPOA 4LEUA 2V4HC 4HNAD 5C1DA 3MV2B 3CVLA 5J90A 1H6OA 3ZEFA 4UQXA 1U2VG 2WXOA 4WWPA 3HXCA 3VLDA 2JLBA 1DVPA 5AAOA 2XZTG 3QK0A 2X6IA 2EILE 4NACA 4CT4A 3FEXA 3UUXA 4EZJA 1Z5SC 4RSYA 1NI1A 2LSUA 1NA3A 2DBAA 4WNDA 2I1JA 1SVXA 4ILIA 5ENQD 2KCVA 4AVXA 2PM6A 4EQFA 4PDXA 3JXIA 4PH4B 4GTQA 3UX4A 4ATGA 1O1RA 1TYQG 4M3OA 3CVQA 5CHEE 5HQ8A 3R7QA 2R03A 4JB8P 4OVVA 1H0AA 4GZDA 4IRUA 3FUEA 3URZA 2DZNA 3DXKG 2XEEA 5FZSA 5JMND 3FTWA 3ENEA 1HO8A 4ANXA 5FZQA 5EIDA 1MX4A 4MS6A 3MYVA 5EYPF 3Q7AA 3CHOA 2WXGA 2WB2A 2CHZA 5KJMA 4HORA 3NQPA 3U64A 2I9CA 3CKCA 5BT1A 4AM9A 3D9MA 3AU4A 4JEHA 2XEHA 3TG4A 4DX7D 4OAVB 1NA0A 3TJPA 3HG0D 3EIQC 2RG8A 1S70B 1Z3YA 1H19A 4BTAA 3P1UA 4JW1A 1O1TA 4UI9K 2WMNA 4LG6A 4CGVA 1SW6A 4JHJA 3DXMG 3UI2A 2VGXB 2GRRB 1A17A 3VTYA 4CYMD 3KAEA 3EUVA 3I4RB 3PREA 4Q94A 3FH7A 3PZDA 2WM9A 3IEGA 2C0LA 3HIZA 4XKBA 3UT8A 1JWGA 4U8YD 1OXJA 3ZXPA 3L16A 3CHSA 3FTXA 3ML8A 4TXPA 4G1TA 3OXFA 4QFVA 1ELWA 4MLPA 3LY7A 3TXNA 4J7WA 2MYOA 4GCNA 2PQRA 2XQ0A 3U4TA 2XPZA 5FINA 2A4ZA 2GRQB 4GTMA 4KZCA 4EBAA 3G2SA 4HFGA 3ONLA 5G55A 2FI7A 2ZISA 2J9QA 3SGHA 2WXMA 3FFLA 4I1MA 2EQXA 4U04A 4K5BA 3L13A 4D10C 4ZHBA 4DX1A 4GA0A 4KVMA 3L54A 2CFZA 3QB2A 3UPVA 2XRYA 2H6HA 4KT6B 5DIZA 1V55E 4C48B 4K0RA 3BEEA 5KJLA 2ZXWE 3ZU7B 1H6KA 2OEWA 3QC1A 5J08A 3LS8A 5AN8A 2IF4A 3BG0B 3DBSA 1YMPA 2DYSE 2HE0A 1INZA 5KJNA 2ONDA 2A5UA 1QZ2A 3CEQA 2BEDA 4K5AB 1OT8A 3T9KA 1S63A 3QNKA 1E8YA 2ILRA 2HO1A 3ZHEA 4Q96A 2VSYA 5CEDB 1NFIE 3DEPA 2ETBA 2J09A 2WVIA 5AENA 4UQYA 4DX6D 2H6IA 4EECA 5CEAA 3LPZA 4E6HA 2FBNA 4G24A 3LEWA 4Y6CA 3CVXA 1BI7B 4IN3B 4CCAA 3FU6A 2NSZA 3QARA 5ARFA 3LDZA 1TNBA 4F3VA 4FLHA 3R9AB 2WXLA 5EDSA 3DEOA 4O1OA 1TN6A 3SO8A 3L08A 4ABNA 2CFUA 3MX3A 3JXJA 3UINC 3G2UA 1TNOA 5BUZA 5BNWA 4DLOA 2E0IA 4AOFA 4L2YA 5LP0A 4M7CA 4P29A 4PS8A 3PH0C 2R59A 3EHRA 4NURA 4ACKA 5E75A 2L6JA 1PC2A 1QYMA 4NRHB 5AQ9A 4ACLA 1BU9A 2NXPA 3RAUA 4YDYA 3AJIA 4J8EA 5FQ4A 1PY1A 5KJKA 3ZRHA 3B7RL 4B0ZA 4YDOA 2B0OE 1WG0A 2XGOA 4HLLA 1HS6A 4U07A 2P58C 3GW4A 4BTBA 1BLXB 2KXPC 1N54A 5D66A 3B95A 4I43A 5AIJA 4L2LA 3LVRE 2Y4TA 3G2VA 4KVOA 1VDYA 3NAWA 3QWWA 5BPPA 2WMOA 4HQDA 2WXRA 4GZ3A 1OWNA 3FU0A 1SZAA 4U96D 3PS6A 4U63A 4TXRA 2M63A 2ZU6B 3BG1B 4TV3A 4C9BB 4ZFHA 2XEVA 3D9NA 4O6FA 4DK5A 3CVNA 4UI9J 4GTTA 2KC7A 3C3RA 4J8DA 1RW2A 4FULA 4JHKA 3Q47B 4G8KA 4DI3A 2WQHA 3LJ3A 2WXQA 4AJWA 3ASNE 1H6PA 3LCAA 2FO7A 3RRNB 3J5PA 3PZ3A 4XKCA 3EHMA 3PZ2A 5EIBE 1E8XA 4AV7A 3EU5A 2QFCA 3CHPA 1ELKA 1SA4A 5CRVA 1HG2A 2OCCE 3TGOA 4L1BA 2CHWA 2GGFA 2Y1LE 2B6CA 4ILGA 5ENOD 1H2TC 3PNLB 3FUFA 3ABLE 1NZNA 1YYHA 2V0PA 2HYZA 2A5EA 2IY0C 4K5CA 4BX9A 4LCTA 1E90A 1SA5A 2IONA 4APFA 4PS7A 4H7XA 3JUIA 2WPVA 2F8XK 4HOUA 2XRZA 3UM0A 3FULA 3V79K 3B13A 3ZUVB 3UKUG 2KATA 2XCBA 5FTPA 3RIBA 5KNHD 2DIWA 1NP7A 4AXHA 1FVHA 3T5VA 3LKUA 2MOWA 5CRUA 5T3RA 4HRNA 1HZ4A 1EYHA 3FUNA 3DPDA 3NF1A 3Q7FA 2E2EA 3OXGA 4GYOA 4FJZA 2OV8A 1AWCB 1DNPA 3MKQB 4FADA 5T8IA 3ZN3A 3ZXSA 3Q75A 3QDNA 4PS3A 2AW6A 3OTNA 4YVOA 1UW4B 2LSVA 2MHKA 1N0RA 4GZCA 2XGMA 2VGEA 5AQAA 2LUHA 4XI9A 1HU3A 4TRQA 4HRLA 1Z3XA 4GMJA 5CMYA 2LXMA 3L6AA 3ZFWA 4C0MA 5JA4D 4UI9C 2GRPB 3W9FA 5M72A 3HYMB 3ABME 1QQEA 1TNYA 5HRYA 3V31A 2YINA 4N39A 2J4DA 1N4QA 3C5RA 5HI7A 1OWLA 4NIKA 5FWQA 3D9KA 3GZSA 2DZOA 2CG3A 2FO1E 3ISMC 3K9IA 1E8WA 2VSNA 5EYLA 2XGSA 1IHBA 3L17A 3PVLA 4WAFA 3O4ZA 3DWLG 3FU3A 3D9HA 2QZAA 4QQIA 4KYOB 3ZHEB 4HB5A 1FPPA 4X8QA 4RLYA 4U7EB 4XIFA 4DPRA 3CVWA 4FHKA 4NQ0A 3JUEA 2AWIA 3ULEG 3JCKC 4CEMA 3KEAA 4OVUA 3SHFA 2IO2C 2LO6A 1UJKA 1ELRA 4URKA 5FJYA 3E33A 3VLEA 4G2VA 2BTDA 1V54E 2L6BA 3CSTA 3RJVA 2QC9A 3LJNA 2NC9A 3Q49B 1N52A 4N3BA 5CERB 5CBOA 1MZCA 3LY9A 3Q15A 5CECB 2YNQA 4JC8A 4WUYA 3PE4A 3CK7A 2RFMA 3UT7A 3ZVVA 5G2NA 3T8MA 4BT8A 2EIME 3UIPC 2PNNA 3B7TA 3S7FA 3X2QE 2LNIA 4AY5A 2L0TB 3F6QA 3FY4A 2LAIA 1UN9A 4GTVA 3RU0A 4CZ2D 3MJWA 1OCOE 4G26A 1TJCA 5G04C 2XPYA 4O1PA 2LXLA 1OUVA 1KT1A 2UY1A 2AVPA 3P2BA 4FJYA 2C2LA 3U66A 4A1GA 2OOEA 2UWJG 2WXNA 2Y3AA 1IHGA 4TXQA 1OWMA 3CHRA 3QOUA 5KBAA 3UTMA 1HF8A 3QKYA 4UWLA 1GW6A 2H6FA 3S7BA 3CQGB 3LXUX 4Y6WA 1N11A 2WXFA 4I17A 3DRAA 4CDMA 4I1AA 4L9PA 2WXHA 3RRUA 3L22A 3MA5A 4I9EA 4GZ6A 4GZ5A 1RZ4A 1K3ZD 4EZKA 4K03A 2F37A 3UQ3A 3HXFA 4BESA 1NL4A 5LCWC 3FTUA 4J8SA 4UWKA 2P9NG 2VJ8A 3AG4E 4JXTA 3SD5A 1D8DA 3BU8A 2HM8A 1X5BA 4N5QA 3HRAA 3JYSA 4U0UA 4AEZC 3Q9UC 1B89A 4BFRA 2KCKA 3V2XA 4N3AA 1YA0A 5G05C 4YDEA 4N3CA 4KZ0A 3RRMB 4UWFA 1L5JA 3RO2A 2XS8A 3Q78A 4N5CA 1Q2ZA 5FQ6A 1UOHA 3IBEA 2VGXA 3HVEB 5BV0A 1YCSB 4G25A 4DRXE 1W3BA 3C72A 1Y8MA 3HVEA 3SNXA 3NZUA 5EX3A 4V3IA 2Y0BG 5H7PA 2IQCA 2KM4A 4GTRA 3TWRA 3CHQA 4A3VA 5KWDA 1N9AA 2YHCA 1X81A 2VTBB 3SFXA 2X6KA 2ETCA 4I2ZA 3AS8A 1E7VA 3WG7E 3ONKA 1HG5A 1DC2A 5AQ7A 4YDWA 3AG3E 3L9TA 4HLEA 5AYWD 1PAQA 4WWOA 3MCXA 4LNGA 2J08A 3FTSA 3QAQA 3DSTA 4J8YA 4FA6A 5AARA 3Q9NC 3ESKA 5D2MC 3Q73A 1WDYA 4HRMB 4GPMA 1O1SA 3AG2E 5HKPA 1N0QA 2X6JA 1TR4A 1WAO1
chains in the Genus database with same CATH topology
1E90A 1Z6TA 4MS6A 2V8SE 3MYVA 4GYYA 2IONA 2PZIA 4APFA 4FLBA 3CHOA 4PS7A 2WXGA 4H7XA 3JUIA 1MQSA 2IOLA 4KBQA 2WPVA 2CHZA 4JA7A 2WB2A 4HOUA 5KJMA 4HORA 4GA2A 3D9OA 3FHEA 3NQPA 2XRZA 3FULA 2RD0A 3B13A 1WM5A 3OAWA 3U64A 2KATA 2XCBA 1XGWA 2I9CA 5FTPA 3RIBA 2DIWA 1E7UA 5G04J 1NP7A 1KT0A 4AXHA 1FVHA 3T5VA 3LKUA 3CKCA 5BT1A 4AM9A 4WNEA 2DCPA 3CLJA 3D9MA 2MOWA 3KD7A 4AY6A 3AU4A 2VQ2A 4JEHA 4U0ZA 5T3RA 3TG4A 4YNDA 3GYZA 1HZ4A 2KCLA 1EYHA 2CHXA 3FUNA 1NA0A 3DPDA 3NF1A 3TJPA 4XI0A 4L7TA 2E2EA 3OXGA 4MRUA 4B8AA 4GYOA 4FJZA 3EIQC 3GZ2A 2RG8A 4U8HA 1Z3YA 3PUJA 1H19A 2OV8A 4BTAA 3P1UA 1DNPA 4G11A 4JW1A 2X6FA 3MKQB 4UI9K 4DLQA 4FADA 2WMNA 1H2VC 2BF0X 5T8IA 1HX8A 4CGVA 3ZN3A 3ZXSA 4JHJA 4I6GA 3OXLA 3QDNA 2FEZA 1TJFA 1Y6IA 4PS3A 2AW6A 1E96B 2VGXB 3D9JA 3FUDA 3OTNA 4LUNU 4YVOA 1ZU2A 4J6IA 4GMLA 1A17A 1UW4B 2LSVA 2MHKA 3FUKA 3FUIA 3IV0A 3VTYA 3CVUA 3KAEA 4LERA 4GZCA 3I4RB 1XNFA 2XGMA 3MKRA 3PREA 2WXJA 3CIAA 4Q94A 4XI9A 3FH7A 1HU3A 4J0UA 3PZDA 2WM9A 5JJ7A 3IEGA 4PUCA 4TRQA 2C0LA 3D3MA 1Z3XA 3HIZA 4GMJA 4XKBA 2PM7A 4CGWA 3ZIMA 3UT8A 2CG2A 2R5SA 1JWGA 3CK9A 5CMYA 2WQ7A 3L6AA 2J49A 2OVBA 2BUGA 3AS4A 3ZFWA 3CKBA 3L16A 3FUJA 3C98A 3CHSA 3FTXA 4C0MA 3ML8A 5JHAA 4UI9C 5LCWJ 3NZSA 3CHMA 4ANUA 3I5PA 3MKQA 4G1TA 3OXFA 4APOA 2PL2A 4QFVA 1ELWA 4ANVA 3RK6A 4MLPA 5M72A 3SI5A 2KZTA 3HYMB 1QQEA 2YINA 3LY7A 1U3CA 4JVSA 1KLXA 4N39A 2J4DA 3TXNA 3ML9A 1EPUA 1TEZA 5HI7A 1OWLA 1HFAA 5CMWA 4GCNA 2PQRA 3IHYA 2XQ0A 3QWPA 2V5FA 5FWQA 3D9IA 2YHEA 3D9KA 3GZSA 3U4TA 4AIFA 4GPKA 4ILHB 2CG3A 3G2TA 2XPZA 1LF8A 3K9IA 3Q5MA 2A4ZA 1E8WA 2VSNA 2C0MA 4A55A 3TAXA 3SZ7A 5FT9A 2XGSA 3L17A 5BW8C 1ZBPA 3CGHA 3PVLA 3O4ZA 4WAFA 1QNFA 3FU3A 3PDNA 4CDRA 4KZCA 4EBAG 4EBAA 1HXIA 2J07A 3G2SA 3CR3A 5ANRA 4KYOB 4HFGA 3ONLA 5G55A 2FI7A 4RG6A 3ZHEB 2J9QA 3SGHA 3EDTB 4JA9A 2WXMA 3FFLA 4I1MA 2EQXA 2R17C 4XIFA 4U04A 3I4GA 4DPRA 3CVWA 4B89A 4R7LA 2WXPA 5A23A 3L13A 3CV0A 4FHKA 4CT0A 4D10C 4NQ0A 1UG3A 3R7RA 2AWIA 3ZGQA 3JCKC 4CEMA 4FU3A 4GA0A 3SBSA 2IFUA 4G23A 3RO3A 2L0IA 4JL0A 4FP7A 4I6JA 4OVUA 3AU5A 3L54A 4KVMA 3CVVA 2X3MA 4GU5A 2JEKA 3ZYLA 2CFZA 4A1SA 3QB2A 3SHFA 3UPVA 4GA1A 2XRYA 3UMVA 2LO6A 4RG9A 1UJKA 2I2OA 4KT6B 3E4BA 2FULA 5DIZA 1ELRA 4UWHA 4URKA 5FJYA 4GAAA 5FQ7A 1FCHA 3VLEA 2V4LA 4G2VA 2BTDA 4BX8A 3N71A 2XHEA 2WXKA 4WWNA 4K0RA 3APDA 1IQRA 3CSTA 4FHJA 3RJVA 1SZ9A 3BEEA 3CVPA 3O48A 4I6EA 5ANLA 3VLFA 5KJLA 3B7SA 3PRZA 1HE8A 1OWPA 1H6KA 3QC1A 2NC9A 5J08A 3AS5A 3Q49B 1N52A 4N3BA 3HDXA 3FWVA 4J8FA 3LS8A 2IF4A 3BG0B 3LY9A 3Q15A 2VTBA 3DBSA 4CRWA 1S0PA 4MKTA 5JJ6A 4OYSA 1INZA 4I1OB 2YNQA 4JC8A 5KJNA 4WUYA 3PE4A 3ZW3A 2ONDA 3FH8A 3MZLB 3CK7A 2A5UA 3S2AA 2MRIA 3ASGA 3UT7A 3ZVVA 1MHQA 5G2NA 4I9CA 3T8MA 4BT8A 4F7AA 5EX0A 1QZ2A 2QY7A 5CCLA 5LFAA 4CDNA 4BSXA 3CEQA 4HOSA 1HH8A 3B7TA 3S7FA 2LNIA 4AY5A 2L0TB 5ENNA 2VSXE 3FY4A 3SF4A 2LAIA 4I2WA 3QNKA 1E8YA 2ILRA 1UN9A 4E85A 3PNTB 3VTXA 2HO1A 2Y4UA 5KCMA 5D0QD 5AJLA 3D9PA 3RU0A 3ZHEA 3FDHA 2AXZA 4IYPA 4Q96A 2AXVA 2J4BA 2KZTB 2UY1B 2VSYA 3MJWA 1TJCA 2GRLA 4G26A 1UJJA 4UQZA 4A3TA 3ULQA 5G04C 2J09A 2WVIA 2XPYA 5AENA 2YQ8A 2HR2A 3I3NA 1OUVA 4UQYA 1KT1A 3RKVA 3PEUB 4B94A 4EECA 2GW1A 2UY1A 3B7UX 4JZYA 2Q7FA 3LPZA 2AVPA 3P2BA 3FUMA 4F1SA 4FJYA 2C2LA 3U66A 4Q69A 2IU1A 5D0OD 4A1GA 2OOEA 3UT4A 2UWJG 4E6HA 2WXNA 2FBNA 3EJNA 4G24A 3LEWA 4Y6CA 1WY6A 3CVXA 5EKQD 2Y3AA 2XPIA 4IN3B 1IHGA 3S7DA 2X38A 3FU6A 2NSZA 3T5XA 4CCAA 1OWMA 3CHRA 4ANWA 3QARA 2XCCA 3CQCB 3LDZA 3QOUA 4KXKB 5ARFA 4F3VA 4FLHA 1HF8A 3R9AB 3QKYA 3QWVA 4UWLA 2WXLA 4BY6A 5EDSA 1GW6A 3S7BA 3CQGB 1JPLA 3L08A 5DBKA 4ABNA 3LXUX 2CFUA 3MX3A 1P5QA 4Y6WA 4JPSA 3G2UA 2WXFA 4RVBA 4I17A 4U0SA 3ASFA 3D9LA 2X6HA 4WNFA 5JHBA 4CDMA 4DI4A 3U3WA 4ME2A 5BUZA 5BNWA 4I1AA 4DLOA 3CVYA 2E0IA 3SBTB 3EHNA 3ASDA 4AOFA 3FTVA 2WXHA 3RRUA 3L22A 3MA5A 2VYIA 4L2YA 3QJZA 4I9EA 5ARGA 4XE0A 5LP0A 4P29A 4PS8A 2LAHA 4GZ6A 4GZ5A 3PH0C 4WNGA 4EZLA 2R59A 4N2SA 4NURA 4ACKA 5E75A 3PEVB 5G05J 2I6HA 2L6JA 3GZ1A 1EF1C 4IULA 1PC2A 4K03A 2I1KA 3FU5A 5FZRA 3U9WA 3CSFA 3UQ3A 4NRHB 4EZKA 5LCWC 4ACLA 5CCMA 4HVBA 2NXPA 3FTUA 4J8SA 4UWKA 4KMOA 3ZPJA 3G2WA 2FF4A 2WXIA 3MV3B 3LY8A 4J8EA 5FQ4A 4JEUA 2VJ8A 4JXTA 3SD5A 1PY1A 5KJKA 4HS2A 3ZRHA 3TL5A 3B7RL 1IQUA 2HM8A 1X5BA 3ZYQA 3Q4AB 4B0ZA 3PE3A 2AXUA 4XX5A 5A6CA 3PUKA 5LOZA 5AJDA 2XGOA 3JYSA 4U0UA 1U3DA 4N2QA 1HS6A 4U07A 4BWRA 2IOSA 2P58C 3GW4A 4GB9A 4AEZC 4BTBA 1B89A 1EDUA 3ZYKA 3SFZA 3MEKA 4GCOA 4BFRA 2KCKA 5A7DB 1N54A 4N3AA 3HHMA 1YA0A 3JQ0A 4I43A 5AIJA 4L2LA 3LVRE 2Y4TA 5G05C 3G2VA 4N3CA 4KVOA 5E76A 1VDYA 3IHVA 3QWWA 5BPPA 2WMOA 4KZ0A 2WXRA 4TUUA 4GZ3A 3RRMB 1OWNA 3FU0A 4UWFA 1L5JA 5C2YA 3IKOB 3RO2A 4N5CA 3S7JA 2GRMA 1SZAA 5FQ6A 3ESLA 3IBEA 3PS6A 2WQ6A 3APFA 4U63A 3CK8A 2VGXA 4HOTA 1JWFA 3HVEB 5FQ8A 1H2UA 3FTZA 5BV0A 1IYGA 3FEYA 1E8ZA 2M63A 1BPOA 2VSOE 4FC8A 2ZU6B 1W3BA 4G25A 4HXIA 1Y8MA 3BG1B 4B8CB 3HVEA 3SNXA 3NZUA 5EX3A 4F53A 4LEUA 4V3IA 4TV3A 4C9BB 5C1DA 3MV2B 2IQCA 2XEVA 3CVLA 3ASHA 3D9NA 3FH5A 2KM4A 4O6FA 4W9RA 4YVQC 5J90A 4DK5A 3ZEFA 4UQXA 3TXMA 3CVNA 3CHQA 2WXOA 4L23A 4WWPA 4UI9J 4A3VA 2OVFA 1FVFA 2KC7A 2YHCA 4J8DA 4FULA 4JHKA 4HOQA 3VLDA 2JLBA 1DVPA 3QK0A 3Q47B 2X6IA 2VTBB 4DI3A 2WQHA 4NACA 4CT4A 2X6KA 3FEXA 3LJ3A 2WXQA 3UUXA 4EZJA 4I2ZA 3AS8A 1E7VA 4AJWA 5T4YA 4RSYA 3ONKA 1HG5A 3LCAA 2FO7A 2LSUA 1NA3A 2IJGX 1UN8A 2DBAA 3APCA 4WNDA 3RRNB 2I1JA 4DJAA 4BT9A 4ILIA 3TG5A 3ZYMA 4C0EA 2KCVA 4AVXA 2PM6A 4EQFA 4UWGA 4HLEA 4XKCA 3EHMA 3FTYA 4PDXA 5AYWD 4EPZA 4JHRA 4PH4B 3LVQE 3JQ1A 4XZ4A 3KS2A 1PAQA 1SQMA 3FUHA 3UX4A 4WWOA 4ATGA 5JJTA 1E8XA 3MCXA 2PQNA 4AV7A 2J08A 2QFCA 3FTSA 4H7YA 3QAQA 3KEZA 3CHPA 3EIJA 4FA6A 4M3OA 3CVQA 1ELKA 5CHEE 4AP2A 1HG2A 3TGOA 3ESKA 3FP3A 2VGYA 3R7QA 4L1BA 3WXXA 5HQ8A 2CHWA 2GGFA 4OVVA 1H0AA 4GYWA 3MGBA 4ILGA 4GZDA 5BV1A 1H2TC 4LRZA 3LYAA 4IRUA 3FUEA 3URZA 5LX8A 3PNLB 3FUFA 2X6JA 5FZSA 3FTWA 1NZNA 2L9BA 2V0PA 3ENEA 2HYZA 1HO8A 4ANXA 5FZQA 1OWOA 1WAO1 1JUQA 4BX9A 4LCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0P A;  1TJF A; 
#chains in the Genus database with same CATH topology
 3R9M A;  2V8S E;  4O60 A;  4FLB A;  4BET A;  2IOL A;  4JA7 A;  3V30 A;  4GA2 A;  2P9P G;  2RD0 A;  1WM5 A;  1IXV A;  1XGW A;  1E7U A;  3BQO A;  3TWW A;  2DCP A;  3KD7 A;  2VQ2 A;  4U0Z A;  4YND A;  2KCL A;  1OY3 D;  4L7T A;  4MRU A;  3UM3 A;  1KZO A;  2OEV A;  2X6F A;  1H2V C;  2BF0 X;  4BEP A;  2BKG A;  1JCQ A;  1TJF A;  4XEI G;  1E96 B;  2R05 A;  2EIN E;  3FUD A;  1ZU2 A;  1DCQ A;  3FUK A;  4BSZ B;  3FUI A;  3IV0 A;  3CVU A;  4LER A;  2F0Y A;  1XNF A;  3MKR A;  3CIA A;  3T8K A;  3ABK E;  3SFY A;  2DVW A;  3D3M A;  3E32 A;  3ZIM A;  2CG2 A;  2R5S A;  5EN5 D;  3CK9 A;  2WQ7 A;  3C98 A;  5JHA A;  3NZS A;  3HXB A;  2DWZ A;  4ANV A;  3RSE G;  3SI5 A;  2KZT A;  4JVS A;  3ML9 A;  1TEZ A;  5CMW A;  3QWP A;  5ENR D;  2V5F A;  3D9I A;  2YHE A;  5ENP D;  4AIF A;  4GPK A;  4ILH B;  1MYO A;  1LF8 A;  3Q5M A;  2C0M A;  4A55 A;  3SZ7 A;  5FT9 A;  5BW8 C;  5B3S E;  1ZBP A;  3CGH A;  4CDR A;  3PZ4 A;  2ZGG A;  5ANR A;  4RG6 A;  1DCE A;  4DX5 D;  3TWT A;  3EU9 A;  3I4G A;  4B89 A;  2WXP A;  4CT0 A;  3CV0 A;  1UG3 A;  3KSQ A;  3SY2 A;  3R7R A;  3ZGQ A;  4FU3 A;  3DSW A;  2F8Y A;  3RO3 A;  2L0I A;  2NYJ A;  4JL0 A;  4I6J A;  3AU5 A;  3CVV A;  2X3M A;  1K8K G;  4RG9 A;  1JCR A;  3J5Q B;  2FUL A;  1BD8 A;  4UWH A;  4GAA A;  1FCH A;  3ASO E;  4BX8 A;  2XHE A;  2WXK A;  4WWN A;  3APD A;  1IKN D;  4FHJ A;  4MBG A;  4EHM A;  3O48 A;  5ANL A;  3VLF A;  3B7S A;  3PRZ A;  1OWP A;  2KBX A;  2P9I G;  3HDX A;  4J8F A;  5ENT D;  2JAB A;  4CRW A;  1S0P A;  4MKT A;  5JJ6 A;  3NB2 A;  3FH8 A;  3MZL B;  3S2A A;  1N4R A;  3ASG A;  1MHQ A;  4F7A A;  2QY7 A;  5CCL A;  5LFA A;  4CDN A;  4HOS A;  1HH8 A;  3ZNG A;  4I2W A;  4E85 A;  3PNT B;  3VTX A;  5KCM A;  2XZD G;  5D0Q D;  3D9P A;  4F1P A;  1LTX A;  2AXV A;  2UY1 B;  4UQZ A;  2GRL A;  1UJJ A;  3I3N A;  4GTS A;  3PEU B;  4LNB A;  4JZY A;  4ATZ D;  3FUM A;  5D0O D;  4LNU D;  1WY6 A;  2X38 A;  1N4S A;  4ANW A;  1K1A A;  3Q79 A;  2P2C P;  4HI9 A;  4F6R D;  2Y69 E;  4Z68 A;  1JPL A;  3SQV A;  1P5Q A;  4JPS A;  5JHB A;  4ME2 A;  3HXD A;  3CVY A;  3SBT B;  3AG1 E;  3PZ1 A;  3TWX A;  2XEN A;  5B1A E;  1N95 A;  2P9S G;  3EHQ A;  3GZ1 A;  4U95 D;  1EF1 C;  4A63 B;  3FU5 A;  3CSF A;  5CCM A;  4KMO A;  3ZPJ A;  2WXI A;  3UM1 A;  4JEU A;  2ZIR A;  4HS2 A;  1JCS A;  4BER A;  3TL5 A;  3ZYQ A;  3Q4A B;  2AXU A;  1AP7 A;  3TWV A;  5LOZ A;  1U3D A;  4N2Q A;  4BWR A;  2IOS A;  4GB9 A;  3ZKJ A;  1EDU A;  3SFZ A;  5A7D B;  2IO3 C;  3HHM A;  3JQ0 A;  3DSU A;  1TN8 A;  4TUU A;  2AJA A;  2GRM A;  4U8V D;  3ESL A;  2WQ6 A;  3APF A;  4HOT A;  4RQI A;  1JWF A;  1KPS B;  5ENS D;  1OCZ E;  1E8Z A;  2VSO E;  4HXI A;  4B8C B;  4F53 A;  2EIK E;  1TNU A;  4YVQ C;  3ASH A;  3FH5 A;  4W9R A;  3TXM A;  4L23 A;  2OVF A;  1FVF A;  2R2L A;  4HOQ A;  3V2O A;  1O5M A;  3B7B A;  3AAA C;  5T4Y A;  3TWU A;  2IJG X;  1UN8 A;  3APC A;  4DJA A;  4BT9 A;  3TG5 A;  3ZYM A;  2BKK B;  4C0E A;  4UWG A;  3FTY A;  4EPZ A;  4JHR A;  3LVQ E;  3JQ1 A;  4XZ4 A;  3KS2 A;  1SQM A;  3FUH A;  5EIL A;  5JJT A;  2PQN A;  3E37 A;  4H7Y A;  3KEZ A;  3EIJ A;  4AP2 A;  3FP3 A;  2VGY A;  3WXX A;  2EIJ E;  4GYW A;  3MGB A;  4DUI A;  5BV1 A;  4LRZ A;  3LYA A;  5LX8 A;  1MX2 A;  3DPY A;  4GTO A;  5B1B E;  2L9B A;  3TWQ A;  1OWO A;  2H6G A;  1JUQ A;  1Z6T A;  5BXO A;  4GYY A;  2PZI A;  3NOC D;  1MQS A;  4KBQ A;  3NBN B;  3D9O A;  3FHE A;  1TN7 A;  3OAW A;  5HS0 A;  5G04 J;  1KT0 A;  1KZP A;  3W9G A;  4WNE A;  1LD7 A;  3CLJ A;  4AY6 A;  3GYZ A;  2CHX A;  4XI0 A;  4B8A A;  3GZ2 A;  1A5E A;  4U8H A;  3PUJ A;  2ZGD A;  4G11 A;  4DLQ A;  3IXE A;  1HX8 A;  4I6G A;  3OXL A;  2FEZ A;  1Y6I A;  3D9J A;  4LUN U;  4J6I A;  4GML A;  4GTP A;  2WXJ A;  1K1B A;  3L82 A;  5FIO A;  2DYR E;  4J0U A;  5JJ7 A;  4PUC A;  1OCR E;  2PM7 A;  4CGW A;  2J49 A;  2OVB A;  2BUG A;  3AS4 A;  3CKB A;  3FUJ A;  5KNG A;  5ITZ F;  5LCW J;  3CHM A;  4ANU A;  2J8S D;  1BI8 B;  3I5P A;  3MKQ A;  4APO A;  2PL2 A;  3RK6 A;  3UXG A;  1U3C A;  1KLX A;  1EPU A;  3NOG D;  4UUC A;  3BUA A;  1HFA A;  3IHY A;  1OCC E;  3E30 A;  3G2T A;  1D9S A;  3C3Q A;  3TWS A;  3TAX A;  4HI8 A;  1QNF A;  3PDN A;  4EBA G;  1HXI A;  2J07 A;  3CR3 A;  3EDT B;  4JA9 A;  1MJ0 A;  2R17 C;  1FT2 A;  4R7L A;  5A23 A;  3E34 A;  1ZB1 A;  1MX6 A;  4GMR A;  3SBS A;  2IFU A;  4G23 A;  4FP7 A;  1G3N B;  3UM2 A;  4GU5 A;  3C3O A;  2JEK A;  3ZYL A;  4A1S A;  4GA1 A;  3UMV A;  2I2O A;  3E4B A;  2GRO B;  2R02 A;  5FQ7 A;  2RFA A;  2V4L A;  3N71 A;  4OAU C;  3HXE A;  1IQR A;  1SZ9 A;  3CVP A;  1S64 A;  4I6E A;  5AQB A;  1HE8 A;  3KSL A;  3AS5 A;  3FWV A;  2VTB A;  4OYS A;  4I1O B;  3UKR G;  3DSV A;  4HBD A;  1FT1 A;  3UIO C;  1N94 A;  3ZW3 A;  4B93 B;  2MRI A;  4I9C A;  5EX0 A;  4BSX A;  5BXU A;  5ENN A;  2VSX E;  3SF4 A;  2Y4U A;  5AJL A;  3FDH A;  2AXZ A;  4IYP A;  2KZT B;  2J4B A;  1QBQ A;  4A3T A;  2ETA A;  1N4P A;  3ULQ A;  2YQ8 A;  2HR2 A;  3RKV A;  2QYU A;  4B94 A;  2GW1 A;  3B7U X;  2P9L G;  2Q7F A;  4F1S A;  2QYJ A;  4Q69 A;  2IU1 A;  4DX2 A;  3UT4 A;  3EJN A;  5EKQ D;  2XPI A;  3S7D A;  5IY5 E;  3T5X A;  4KXK B;  2XCC A;  3CQC B;  1D8E A;  3QWV A;  4BY6 A;  5DBK A;  4RVB A;  4U0S A;  3ASF A;  3D9L A;  2X6H A;  4WNF A;  4DI4 A;  3U3W A;  3DSX A;  3ASD A;  3EHN A;  3FTV A;  2P9U G;  2VYI A;  3QJZ A;  5ARG A;  4XE0 A;  2RKK A;  2LAH A;  4JD2 G;  2GRN B;  4EZL A;  4G8L A;  4WNG A;  4N2S A;  3PEV B;  5G05 J;  2I6H A;  4IUL A;  5CBN A;  5FZR A;  3U9W A;  2I1K A;  4HVB A;  3G2W A;  2FF4 A;  3MV3 B;  3LY8 A;  2V5Q C;  4LSZ E;  1IQU A;  3PE3 A;  4XX5 A;  5A6C A;  3PUK A;  5AJD A;  3ZYK A;  2P9K G;  3MEK A;  4GCO A;  1TNZ A;  4TUM A;  5E76 A;  3IHV A;  2XS1 A;  3DSS A;  3IKO B;  5C2Y A;  3S7J A;  3ULY A;  2IEJ A;  1LD8 A;  3CK8 A;  5FQ8 A;  1H2U A;  3FTZ A;  1IYG A;  3FEY A;  4FC8 A;  1BPO A;  4LEU A;  2V4H C;  4HNA D;  5C1D A;  3MV2 B;  3CVL A;  5J90 A;  1H6O A;  3ZEF A;  4UQX A;  1U2V G;  2WXO A;  4WWP A;  3HXC A;  3VLD A;  2JLB A;  1DVP A;  5AAO A;  2XZT G;  3QK0 A;  2X6I A;  2EIL E;  4NAC A;  4CT4 A;  3FEX A;  3UUX A;  4EZJ A;  1Z5S C;  4RSY A;  1NI1 A;  2LSU A;  1NA3 A;  2DBA A;  4WND A;  2I1J A;  1SVX A;  4ILI A;  5ENQ D;  2KCV A;  4AVX A;  2PM6 A;  4EQF A;  4PDX A;  3JXI A;  4PH4 B;  4GTQ A;  3UX4 A;  4ATG A;  1O1R A;  1TYQ G;  4M3O A;  3CVQ A;  5CHE E;  5HQ8 A;  3R7Q A;  2R03 A;  4JB8 P;  4OVV A;  1H0A A;  4GZD A;  4IRU A;  3FUE A;  3URZ A;  2DZN A;  3DXK G;  2XEE A;  5FZS A;  5JMN D;  3FTW A;  3ENE A;  1HO8 A;  4ANX A;  5FZQ A;  5EID A;  1MX4 A;  4MS6 A;  3MYV A;  5EYP F;  3Q7A A;  3CHO A;  2WXG A;  2WB2 A;  2CHZ A;  5KJM A;  4HOR A;  3NQP A;  3U64 A;  2I9C A;  3CKC A;  5BT1 A;  4AM9 A;  3D9M A;  3AU4 A;  4JEH A;  2XEH A;  3TG4 A;  4DX7 D;  4OAV B;  1NA0 A;  3TJP A;  3HG0 D;  3EIQ C;  2RG8 A;  1S70 B;  1Z3Y A;  1H19 A;  4BTA A;  3P1U A;  4JW1 A;  1O1T A;  4UI9 K;  2WMN A;  4LG6 A;  4CGV A;  1SW6 A;  4JHJ A;  3DXM G;  3UI2 A;  2VGX B;  2GRR B;  1A17 A;  3VTY A;  4CYM D;  3KAE A;  3EUV A;  3I4R B;  3PRE A;  4Q94 A;  3FH7 A;  3PZD A;  2WM9 A;  3IEG A;  2C0L A;  3HIZ A;  4XKB A;  3UT8 A;  1JWG A;  4U8Y D;  1OXJ A;  3ZXP A;  3L16 A;  3CHS A;  3FTX A;  3ML8 A;  4TXP A;  4G1T A;  3OXF A;  4QFV A;  1ELW A;  4MLP A;  3LY7 A;  3TXN A;  4J7W A;  2MYO A;  4GCN A;  2PQR A;  2XQ0 A;  3U4T A;  2XPZ A;  5FIN A;  2A4Z A;  2GRQ B;  4GTM A;  4KZC A;  4EBA A;  3G2S A;  4HFG A;  3ONL A;  5G55 A;  2FI7 A;  2ZIS A;  2J9Q A;  3SGH A;  2WXM A;  3FFL A;  4I1M A;  2EQX A;  4U04 A;  4K5B A;  3L13 A;  4D10 C;  4ZHB A;  4DX1 A;  4GA0 A;  4KVM A;  3L54 A;  2CFZ A;  3QB2 A;  3UPV A;  2XRY A;  2H6H A;  4KT6 B;  5DIZ A;  1V55 E;  4C48 B;  4K0R A;  3BEE A;  5KJL A;  2ZXW E;  3ZU7 B;  1H6K A;  2OEW A;  3QC1 A;  5J08 A;  3LS8 A;  5AN8 A;  2IF4 A;  3BG0 B;  3DBS A;  1YMP A;  2DYS E;  2HE0 A;  1INZ A;  5KJN A;  2OND A;  2A5U A;  1QZ2 A;  3CEQ A;  2BED A;  4K5A B;  1OT8 A;  3T9K A;  1S63 A;  3QNK A;  1E8Y A;  2ILR A;  2HO1 A;  3ZHE A;  4Q96 A;  2VSY A;  5CED B;  1NFI E;  3DEP A;  2ETB A;  2J09 A;  2WVI A;  5AEN A;  4UQY A;  4DX6 D;  2H6I A;  4EEC A;  5CEA A;  3LPZ A;  4E6H A;  2FBN A;  4G24 A;  3LEW A;  4Y6C A;  3CVX A;  1BI7 B;  4IN3 B;  4CCA A;  3FU6 A;  2NSZ A;  3QAR A;  5ARF A;  3LDZ A;  1TNB A;  4F3V A;  4FLH A;  3R9A B;  2WXL A;  5EDS A;  3DEO A;  4O1O A;  1TN6 A;  3SO8 A;  3L08 A;  4ABN A;  2CFU A;  3MX3 A;  3JXJ A;  3UIN C;  3G2U A;  1TNO A;  5BUZ A;  5BNW A;  4DLO A;  2E0I A;  4AOF A;  4L2Y A;  5LP0 A;  4M7C A;  4P29 A;  4PS8 A;  3PH0 C;  2R59 A;  3EHR A;  4NUR A;  4ACK A;  5E75 A;  2L6J A;  1PC2 A;  1QYM A;  4NRH B;  5AQ9 A;  4ACL A;  1BU9 A;  2NXP A;  3RAU A;  4YDY A;  3AJI A;  4J8E A;  5FQ4 A;  1PY1 A;  5KJK A;  3ZRH A;  3B7R L;  4B0Z A;  4YDO A;  2B0O E;  1WG0 A;  2XGO A;  4HLL A;  1HS6 A;  4U07 A;  2P58 C;  3GW4 A;  4BTB A;  1BLX B;  2KXP C;  1N54 A;  5D66 A;  3B95 A;  4I43 A;  5AIJ A;  4L2L A;  3LVR E;  2Y4T A;  3G2V A;  4KVO A;  1VDY A;  3NAW A;  3QWW A;  5BPP A;  2WMO A;  4HQD A;  2WXR A;  4GZ3 A;  1OWN A;  3FU0 A;  1SZA A;  4U96 D;  3PS6 A;  4U63 A;  4TXR A;  2M63 A;  2ZU6 B;  3BG1 B;  4TV3 A;  4C9B B;  4ZFH A;  2XEV A;  3D9N A;  4O6F A;  4DK5 A;  3CVN A;  4UI9 J;  4GTT A;  2KC7 A;  3C3R A;  4J8D A;  1RW2 A;  4FUL A;  4JHK A;  3Q47 B;  4G8K A;  4DI3 A;  2WQH A;  3LJ3 A;  2WXQ A;  4AJW A;  3ASN E;  1H6P A;  3LCA A;  2FO7 A;  3RRN B;  3J5P A;  3PZ3 A;  4XKC A;  3EHM A;  3PZ2 A;  5EIB E;  1E8X A;  4AV7 A;  3EU5 A;  2QFC A;  3CHP A;  1ELK A;  1SA4 A;  5CRV A;  1HG2 A;  2OCC E;  3TGO A;  4L1B A;  2CHW A;  2GGF A;  2Y1L E;  2B6C A;  4ILG A;  5ENO D;  1H2T C;  3PNL B;  3FUF A;  3ABL E;  1NZN A;  1YYH A;  2V0P A;  2HYZ A;  2A5E A;  2IY0 C;  4K5C A;  4BX9 A;  4LCT A;  1E90 A;  1SA5 A;  2ION A;  4APF A;  4PS7 A;  4H7X A;  3JUI A;  2WPV A;  2F8X K;  4HOU A;  2XRZ A;  3UM0 A;  3FUL A;  3V79 K;  3B13 A;  3ZUV B;  3UKU G;  2KAT A;  2XCB A;  5FTP A;  3RIB A;  5KNH D;  2DIW A;  1NP7 A;  4AXH A;  1FVH A;  3T5V A;  3LKU A;  2MOW A;  5CRU A;  5T3R A;  4HRN A;  1HZ4 A;  1EYH A;  3FUN A;  3DPD A;  3NF1 A;  3Q7F A;  2E2E A;  3OXG A;  4GYO A;  4FJZ A;  2OV8 A;  1AWC B;  1DNP A;  3MKQ B;  4FAD A;  5T8I A;  3ZN3 A;  3ZXS A;  3Q75 A;  3QDN A;  4PS3 A;  2AW6 A;  3OTN A;  4YVO A;  1UW4 B;  2LSV A;  2MHK A;  1N0R A;  4GZC A;  2XGM A;  2VGE A;  5AQA A;  2LUH A;  4XI9 A;  1HU3 A;  4TRQ A;  4HRL A;  1Z3X A;  4GMJ A;  5CMY A;  2LXM A;  3L6A A;  3ZFW A;  4C0M A;  5JA4 D;  4UI9 C;  2GRP B;  3W9F A;  5M72 A;  3HYM B;  3ABM E;  1QQE A;  1TNY A;  5HRY A;  3V31 A;  2YIN A;  4N39 A;  2J4D A;  1N4Q A;  3C5R A;  5HI7 A;  1OWL A;  4NIK A;  5FWQ A;  3D9K A;  3GZS A;  2DZO A;  2CG3 A;  2FO1 E;  3ISM C;  3K9I A;  1E8W A;  2VSN A;  5EYL A;  2XGS A;  1IHB A;  3L17 A;  3PVL A;  4WAF A;  3O4Z A;  3DWL G;  3FU3 A;  3D9H A;  2QZA A;  4QQI A;  4KYO B;  3ZHE B;  4HB5 A;  1FPP A;  4X8Q A;  4RLY A;  4U7E B;  4XIF A;  4DPR A;  3CVW A;  4FHK A;  4NQ0 A;  3JUE A;  2AWI A;  3ULE G;  3JCK C;  4CEM A;  3KEA A;  4OVU A;  3SHF A;  2IO2 C;  2LO6 A;  1UJK A;  1ELR A;  4URK A;  5FJY A;  3E33 A;  3VLE A;  4G2V A;  2BTD A;  1V54 E;  2L6B A;  3CST A;  3RJV A;  2QC9 A;  3LJN A;  2NC9 A;  3Q49 B;  1N52 A;  4N3B A;  5CER B;  5CBO A;  1MZC A;  3LY9 A;  3Q15 A;  5CEC B;  2YNQ A;  4JC8 A;  4WUY A;  3PE4 A;  3CK7 A;  2RFM A;  3UT7 A;  3ZVV A;  5G2N A;  3T8M A;  4BT8 A;  2EIM E;  3UIP C;  2PNN A;  3B7T A;  3S7F A;  3X2Q E;  2LNI A;  4AY5 A;  2L0T B;  3F6Q A;  3FY4 A;  2LAI A;  1UN9 A;  4GTV A;  3RU0 A;  4CZ2 D;  3MJW A;  1OCO E;  4G26 A;  1TJC A;  5G04 C;  2XPY A;  4O1P A;  2LXL A;  1OUV A;  1KT1 A;  2UY1 A;  2AVP A;  3P2B A;  4FJY A;  2C2L A;  3U66 A;  4A1G A;  2OOE A;  2UWJ G;  2WXN A;  2Y3A A;  1IHG A;  4TXQ A;  1OWM A;  3CHR A;  3QOU A;  5KBA A;  3UTM A;  1HF8 A;  3QKY A;  4UWL A;  1GW6 A;  2H6F A;  3S7B A;  3CQG B;  3LXU X;  4Y6W A;  1N11 A;  2WXF A;  4I17 A;  3DRA A;  4CDM A;  4I1A A;  4L9P A;  2WXH A;  3RRU A;  3L22 A;  3MA5 A;  4I9E A;  4GZ6 A;  4GZ5 A;  1RZ4 A;  1K3Z D;  4EZK A;  4K03 A;  2F37 A;  3UQ3 A;  3HXF A;  4BES A;  1NL4 A;  5LCW C;  3FTU A;  4J8S A;  4UWK A;  2P9N G;  2VJ8 A;  3AG4 E;  4JXT A;  3SD5 A;  1D8D A;  3BU8 A;  2HM8 A;  1X5B A;  4N5Q A;  3HRA A;  3JYS A;  4U0U A;  4AEZ C;  3Q9U C;  1B89 A;  4BFR A;  2KCK A;  3V2X A;  4N3A A;  1YA0 A;  5G05 C;  4YDE A;  4N3C A;  4KZ0 A;  3RRM B;  4UWF A;  1L5J A;  3RO2 A;  2XS8 A;  3Q78 A;  4N5C A;  1Q2Z A;  5FQ6 A;  1UOH A;  3IBE A;  2VGX A;  3HVE B;  5BV0 A;  1YCS B;  4G25 A;  4DRX E;  1W3B A;  3C72 A;  1Y8M A;  3HVE A;  3SNX A;  3NZU A;  5EX3 A;  4V3I A;  2Y0B G;  5H7P A;  2IQC A;  2KM4 A;  4GTR A;  3TWR A;  3CHQ A;  4A3V A;  5KWD A;  1N9A A;  2YHC A;  1X81 A;  2VTB B;  3SFX A;  2X6K A;  2ETC A;  4I2Z A;  3AS8 A;  1E7V A;  3WG7 E;  3ONK A;  1HG5 A;  1DC2 A;  5AQ7 A;  4YDW A;  3AG3 E;  3L9T A;  4HLE A;  5AYW D;  1PAQ A;  4WWO A;  3MCX A;  4LNG A;  2J08 A;  3FTS A;  3QAQ A;  3DST A;  4J8Y A;  4FA6 A;  5AAR A;  3Q9N C;  3ESK A;  5D2M C;  3Q73 A;  1WDY A;  4HRM B;  4GPM A;  1O1S A;  3AG2 E;  5HKP A;  1N0Q A;  2X6J A;  1TR4 A;  1WAO 1; 
#chains in the Genus database with same CATH homology
 1E90 A;  1Z6T A;  4MS6 A;  2V8S E;  3MYV A;  4GYY A;  2ION A;  2PZI A;  4APF A;  4FLB A;  3CHO A;  4PS7 A;  2WXG A;  4H7X A;  3JUI A;  1MQS A;  2IOL A;  4KBQ A;  2WPV A;  2CHZ A;  4JA7 A;  2WB2 A;  4HOU A;  5KJM A;  4HOR A;  4GA2 A;  3D9O A;  3FHE A;  3NQP A;  2XRZ A;  3FUL A;  2RD0 A;  3B13 A;  1WM5 A;  3OAW A;  3U64 A;  2KAT A;  2XCB A;  1XGW A;  2I9C A;  5FTP A;  3RIB A;  2DIW A;  1E7U A;  5G04 J;  1NP7 A;  1KT0 A;  4AXH A;  1FVH A;  3T5V A;  3LKU A;  3CKC A;  5BT1 A;  4AM9 A;  4WNE A;  2DCP A;  3CLJ A;  3D9M A;  2MOW A;  3KD7 A;  4AY6 A;  3AU4 A;  2VQ2 A;  4JEH A;  4U0Z A;  5T3R A;  3TG4 A;  4YND A;  3GYZ A;  1HZ4 A;  2KCL A;  1EYH A;  2CHX A;  3FUN A;  1NA0 A;  3DPD A;  3NF1 A;  3TJP A;  4XI0 A;  4L7T A;  2E2E A;  3OXG A;  4MRU A;  4B8A A;  4GYO A;  4FJZ A;  3EIQ C;  3GZ2 A;  2RG8 A;  4U8H A;  1Z3Y A;  3PUJ A;  1H19 A;  2OV8 A;  4BTA A;  3P1U A;  1DNP A;  4G11 A;  4JW1 A;  2X6F A;  3MKQ B;  4UI9 K;  4DLQ A;  4FAD A;  2WMN A;  1H2V C;  2BF0 X;  5T8I A;  1HX8 A;  4CGV A;  3ZN3 A;  3ZXS A;  4JHJ A;  4I6G A;  3OXL A;  3QDN A;  2FEZ A;  1TJF A;  1Y6I A;  4PS3 A;  2AW6 A;  1E96 B;  2VGX B;  3D9J A;  3FUD A;  3OTN A;  4LUN U;  4YVO A;  1ZU2 A;  4J6I A;  4GML A;  1A17 A;  1UW4 B;  2LSV A;  2MHK A;  3FUK A;  3FUI A;  3IV0 A;  3VTY A;  3CVU A;  3KAE A;  4LER A;  4GZC A;  3I4R B;  1XNF A;  2XGM A;  3MKR A;  3PRE A;  2WXJ A;  3CIA A;  4Q94 A;  4XI9 A;  3FH7 A;  1HU3 A;  4J0U A;  3PZD A;  2WM9 A;  5JJ7 A;  3IEG A;  4PUC A;  4TRQ A;  2C0L A;  3D3M A;  1Z3X A;  3HIZ A;  4GMJ A;  4XKB A;  2PM7 A;  4CGW A;  3ZIM A;  3UT8 A;  2CG2 A;  2R5S A;  1JWG A;  3CK9 A;  5CMY A;  2WQ7 A;  3L6A A;  2J49 A;  2OVB A;  2BUG A;  3AS4 A;  3ZFW A;  3CKB A;  3L16 A;  3FUJ A;  3C98 A;  3CHS A;  3FTX A;  4C0M A;  3ML8 A;  5JHA A;  4UI9 C;  5LCW J;  3NZS A;  3CHM A;  4ANU A;  3I5P A;  3MKQ A;  4G1T A;  3OXF A;  4APO A;  2PL2 A;  4QFV A;  1ELW A;  4ANV A;  3RK6 A;  4MLP A;  5M72 A;  3SI5 A;  2KZT A;  3HYM B;  1QQE A;  2YIN A;  3LY7 A;  1U3C A;  4JVS A;  1KLX A;  4N39 A;  2J4D A;  3TXN A;  3ML9 A;  1EPU A;  1TEZ A;  5HI7 A;  1OWL A;  1HFA A;  5CMW A;  4GCN A;  2PQR A;  3IHY A;  2XQ0 A;  3QWP A;  2V5F A;  5FWQ A;  3D9I A;  2YHE A;  3D9K A;  3GZS A;  3U4T A;  4AIF A;  4GPK A;  4ILH B;  2CG3 A;  3G2T A;  2XPZ A;  1LF8 A;  3K9I A;  3Q5M A;  2A4Z A;  1E8W A;  2VSN A;  2C0M A;  4A55 A;  3TAX A;  3SZ7 A;  5FT9 A;  2XGS A;  3L17 A;  5BW8 C;  1ZBP A;  3CGH A;  3PVL A;  3O4Z A;  4WAF A;  1QNF A;  3FU3 A;  3PDN A;  4CDR A;  4KZC A;  4EBA G;  4EBA A;  1HXI A;  2J07 A;  3G2S A;  3CR3 A;  5ANR A;  4KYO B;  4HFG A;  3ONL A;  5G55 A;  2FI7 A;  4RG6 A;  3ZHE B;  2J9Q A;  3SGH A;  3EDT B;  4JA9 A;  2WXM A;  3FFL A;  4I1M A;  2EQX A;  2R17 C;  4XIF A;  4U04 A;  3I4G A;  4DPR A;  3CVW A;  4B89 A;  4R7L A;  2WXP A;  5A23 A;  3L13 A;  3CV0 A;  4FHK A;  4CT0 A;  4D10 C;  4NQ0 A;  1UG3 A;  3R7R A;  2AWI A;  3ZGQ A;  3JCK C;  4CEM A;  4FU3 A;  4GA0 A;  3SBS A;  2IFU A;  4G23 A;  3RO3 A;  2L0I A;  4JL0 A;  4FP7 A;  4I6J A;  4OVU A;  3AU5 A;  3L54 A;  4KVM A;  3CVV A;  2X3M A;  4GU5 A;  2JEK A;  3ZYL A;  2CFZ A;  4A1S A;  3QB2 A;  3SHF A;  3UPV A;  4GA1 A;  2XRY A;  3UMV A;  2LO6 A;  4RG9 A;  1UJK A;  2I2O A;  4KT6 B;  3E4B A;  2FUL A;  5DIZ A;  1ELR A;  4UWH A;  4URK A;  5FJY A;  4GAA A;  5FQ7 A;  1FCH A;  3VLE A;  2V4L A;  4G2V A;  2BTD A;  4BX8 A;  3N71 A;  2XHE A;  2WXK A;  4WWN A;  4K0R A;  3APD A;  1IQR A;  3CST A;  4FHJ A;  3RJV A;  1SZ9 A;  3BEE A;  3CVP A;  3O48 A;  4I6E A;  5ANL A;  3VLF A;  5KJL A;  3B7S A;  3PRZ A;  1HE8 A;  1OWP A;  1H6K A;  3QC1 A;  2NC9 A;  5J08 A;  3AS5 A;  3Q49 B;  1N52 A;  4N3B A;  3HDX A;  3FWV A;  4J8F A;  3LS8 A;  2IF4 A;  3BG0 B;  3LY9 A;  3Q15 A;  2VTB A;  3DBS A;  4CRW A;  1S0P A;  4MKT A;  5JJ6 A;  4OYS A;  1INZ A;  4I1O B;  2YNQ A;  4JC8 A;  5KJN A;  4WUY A;  3PE4 A;  3ZW3 A;  2OND A;  3FH8 A;  3MZL B;  3CK7 A;  2A5U A;  3S2A A;  2MRI A;  3ASG A;  3UT7 A;  3ZVV A;  1MHQ A;  5G2N A;  4I9C A;  3T8M A;  4BT8 A;  4F7A A;  5EX0 A;  1QZ2 A;  2QY7 A;  5CCL A;  5LFA A;  4CDN A;  4BSX A;  3CEQ A;  4HOS A;  1HH8 A;  3B7T A;  3S7F A;  2LNI A;  4AY5 A;  2L0T B;  5ENN A;  2VSX E;  3FY4 A;  3SF4 A;  2LAI A;  4I2W A;  3QNK A;  1E8Y A;  2ILR A;  1UN9 A;  4E85 A;  3PNT B;  3VTX A;  2HO1 A;  2Y4U A;  5KCM A;  5D0Q D;  5AJL A;  3D9P A;  3RU0 A;  3ZHE A;  3FDH A;  2AXZ A;  4IYP A;  4Q96 A;  2AXV A;  2J4B A;  2KZT B;  2UY1 B;  2VSY A;  3MJW A;  1TJC A;  2GRL A;  4G26 A;  1UJJ A;  4UQZ A;  4A3T A;  3ULQ A;  5G04 C;  2J09 A;  2WVI A;  2XPY A;  5AEN A;  2YQ8 A;  2HR2 A;  3I3N A;  1OUV A;  4UQY A;  1KT1 A;  3RKV A;  3PEU B;  4B94 A;  4EEC A;  2GW1 A;  2UY1 A;  3B7U X;  4JZY A;  2Q7F A;  3LPZ A;  2AVP A;  3P2B A;  3FUM A;  4F1S A;  4FJY A;  2C2L A;  3U66 A;  4Q69 A;  2IU1 A;  5D0O D;  4A1G A;  2OOE A;  3UT4 A;  2UWJ G;  4E6H A;  2WXN A;  2FBN A;  3EJN A;  4G24 A;  3LEW A;  4Y6C A;  1WY6 A;  3CVX A;  5EKQ D;  2Y3A A;  2XPI A;  4IN3 B;  1IHG A;  3S7D A;  2X38 A;  3FU6 A;  2NSZ A;  3T5X A;  4CCA A;  1OWM A;  3CHR A;  4ANW A;  3QAR A;  2XCC A;  3CQC B;  3LDZ A;  3QOU A;  4KXK B;  5ARF A;  4F3V A;  4FLH A;  1HF8 A;  3R9A B;  3QKY A;  3QWV A;  4UWL A;  2WXL A;  4BY6 A;  5EDS A;  1GW6 A;  3S7B A;  3CQG B;  1JPL A;  3L08 A;  5DBK A;  4ABN A;  3LXU X;  2CFU A;  3MX3 A;  1P5Q A;  4Y6W A;  4JPS A;  3G2U A;  2WXF A;  4RVB A;  4I17 A;  4U0S A;  3ASF A;  3D9L A;  2X6H A;  4WNF A;  5JHB A;  4CDM A;  4DI4 A;  3U3W A;  4ME2 A;  5BUZ A;  5BNW A;  4I1A A;  4DLO A;  3CVY A;  2E0I A;  3SBT B;  3EHN A;  3ASD A;  4AOF A;  3FTV A;  2WXH A;  3RRU A;  3L22 A;  3MA5 A;  2VYI A;  4L2Y A;  3QJZ A;  4I9E A;  5ARG A;  4XE0 A;  5LP0 A;  4P29 A;  4PS8 A;  2LAH A;  4GZ6 A;  4GZ5 A;  3PH0 C;  4WNG A;  4EZL A;  2R59 A;  4N2S A;  4NUR A;  4ACK A;  5E75 A;  3PEV B;  5G05 J;  2I6H A;  2L6J A;  3GZ1 A;  1EF1 C;  4IUL A;  1PC2 A;  4K03 A;  2I1K A;  3FU5 A;  5FZR A;  3U9W A;  3CSF A;  3UQ3 A;  4NRH B;  4EZK A;  5LCW C;  4ACL A;  5CCM A;  4HVB A;  2NXP A;  3FTU A;  4J8S A;  4UWK A;  4KMO A;  3ZPJ A;  3G2W A;  2FF4 A;  2WXI A;  3MV3 B;  3LY8 A;  4J8E A;  5FQ4 A;  4JEU A;  2VJ8 A;  4JXT A;  3SD5 A;  1PY1 A;  5KJK A;  4HS2 A;  3ZRH A;  3TL5 A;  3B7R L;  1IQU A;  2HM8 A;  1X5B A;  3ZYQ A;  3Q4A B;  4B0Z A;  3PE3 A;  2AXU A;  4XX5 A;  5A6C A;  3PUK A;  5LOZ A;  5AJD A;  2XGO A;  3JYS A;  4U0U A;  1U3D A;  4N2Q A;  1HS6 A;  4U07 A;  4BWR A;  2IOS A;  2P58 C;  3GW4 A;  4GB9 A;  4AEZ C;  4BTB A;  1B89 A;  1EDU A;  3ZYK A;  3SFZ A;  3MEK A;  4GCO A;  4BFR A;  2KCK A;  5A7D B;  1N54 A;  4N3A A;  3HHM A;  1YA0 A;  3JQ0 A;  4I43 A;  5AIJ A;  4L2L A;  3LVR E;  2Y4T A;  5G05 C;  3G2V A;  4N3C A;  4KVO A;  5E76 A;  1VDY A;  3IHV A;  3QWW A;  5BPP A;  2WMO A;  4KZ0 A;  2WXR A;  4TUU A;  4GZ3 A;  3RRM B;  1OWN A;  3FU0 A;  4UWF A;  1L5J A;  5C2Y A;  3IKO B;  3RO2 A;  4N5C A;  3S7J A;  2GRM A;  1SZA A;  5FQ6 A;  3ESL A;  3IBE A;  3PS6 A;  2WQ6 A;  3APF A;  4U63 A;  3CK8 A;  2VGX A;  4HOT A;  1JWF A;  3HVE B;  5FQ8 A;  1H2U A;  3FTZ A;  5BV0 A;  1IYG A;  3FEY A;  1E8Z A;  2M63 A;  1BPO A;  2VSO E;  4FC8 A;  2ZU6 B;  1W3B A;  4G25 A;  4HXI A;  1Y8M A;  3BG1 B;  4B8C B;  3HVE A;  3SNX A;  3NZU A;  5EX3 A;  4F53 A;  4LEU A;  4V3I A;  4TV3 A;  4C9B B;  5C1D A;  3MV2 B;  2IQC A;  2XEV A;  3CVL A;  3ASH A;  3D9N A;  3FH5 A;  2KM4 A;  4O6F A;  4W9R A;  4YVQ C;  5J90 A;  4DK5 A;  3ZEF A;  4UQX A;  3TXM A;  3CVN A;  3CHQ A;  2WXO A;  4L23 A;  4WWP A;  4UI9 J;  4A3V A;  2OVF A;  1FVF A;  2KC7 A;  2YHC A;  4J8D A;  4FUL A;  4JHK A;  4HOQ A;  3VLD A;  2JLB A;  1DVP A;  3QK0 A;  3Q47 B;  2X6I A;  2VTB B;  4DI3 A;  2WQH A;  4NAC A;  4CT4 A;  2X6K A;  3FEX A;  3LJ3 A;  2WXQ A;  3UUX A;  4EZJ A;  4I2Z A;  3AS8 A;  1E7V A;  4AJW A;  5T4Y A;  4RSY A;  3ONK A;  1HG5 A;  3LCA A;  2FO7 A;  2LSU A;  1NA3 A;  2IJG X;  1UN8 A;  2DBA A;  3APC A;  4WND A;  3RRN B;  2I1J A;  4DJA A;  4BT9 A;  4ILI A;  3TG5 A;  3ZYM A;  4C0E A;  2KCV A;  4AVX A;  2PM6 A;  4EQF A;  4UWG A;  4HLE A;  4XKC A;  3EHM A;  3FTY A;  4PDX A;  5AYW D;  4EPZ A;  4JHR A;  4PH4 B;  3LVQ E;  3JQ1 A;  4XZ4 A;  3KS2 A;  1PAQ A;  1SQM A;  3FUH A;  3UX4 A;  4WWO A;  4ATG A;  5JJT A;  1E8X A;  3MCX A;  2PQN A;  4AV7 A;  2J08 A;  2QFC A;  3FTS A;  4H7Y A;  3QAQ A;  3KEZ A;  3CHP A;  3EIJ A;  4FA6 A;  4M3O A;  3CVQ A;  1ELK A;  5CHE E;  4AP2 A;  1HG2 A;  3TGO A;  3ESK A;  3FP3 A;  2VGY A;  3R7Q A;  4L1B A;  3WXX A;  5HQ8 A;  2CHW A;  2GGF A;  4OVV A;  1H0A A;  4GYW A;  3MGB A;  4ILG A;  4GZD A;  5BV1 A;  1H2T C;  4LRZ A;  3LYA A;  4IRU A;  3FUE A;  3URZ A;  5LX8 A;  3PNL B;  3FUF A;  2X6J A;  5FZS A;  3FTW A;  1NZN A;  2L9B A;  2V0P A;  3ENE A;  2HYZ A;  1HO8 A;  4ANX A;  5FZQ A;  1OWO A;  1WAO 1;  1JUQ A;  4BX9 A;  4LCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...