1S0PA

Structure of the n-terminal domain of the adenylyl cyclase-associated protein (cap) from dictyostelium discoideum.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
176
Chain Sequence
SVKEFQNLVDQHITPFVALSKKLAPEVGNQVEQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPHVAEMRGSAEFYTNRILKEFKGVNQDQVDWVSNYVNFLKDLEKYIKQYHTTGLTWNPKGGDAKSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE N-TERMINAL DOMAIN OF THE ADENYLYL CYCLASE-ASSOCIATED PROTEIN (CAP) FROM DICTYOSTELIUM DISCOIDEUM
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Membrane protein
molecule keywords Adenylyl cyclase-associated protein
total genus 66
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.330 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1s0pA01
1S0PA 1TJFA
chains in the Genus database with same CATH superfamily
2P9KG 2V0PA 4HRMB 1O1TA 2WQ7A 4ANWA 3CVXA 2YHCA 3KSQA 3J5QB 2ZIRA 1IYGA 3FHEA 1UJKA 2LXLA 3HXEA 2CG3A 4B89A 2XQ0A 5KJMA 1TJCA 1YA0A 2LXMA 3ML8A 3ULYA 4PS8A 3AAAC 1E8WA 5FT9A 4UWFA 3RAUA 1KLXA 4WWNA 3G2WA 3D9IA 3ONKA 3WG7E 1W3BA 5DIZA 3FU5A 5KNGA 4AY6A 4NRHB 2PL2A 2DIWA 3FTSA 4JXTA 4MKTA 5CEDB 3MV2B 4LG6A 4U8HA 4JPSA 2YHEA 4HRNA 3GYZA 4GTSA 4J8DA 4B8AA 3DXKG 5ITZF 1HH8A 2IF4A 3I4GA 4CDRA 5LP0A 2VGEA 1O1SA 1DNPA 1TNYA 3APCA 3ZYQA 1INZA 4BFRA 2XENA 3MZLB 3D9PA 1GW6A 4ZHBA 1HZ4A 4GTOA 4L9PA 4JD2G 4N2QA 4RSYA 1JWFA 4GCOA 3CLJA 3PZ2A 3I5PA 3L22A 4DI3A 3CHOA 4G1TA 4AM9A 3G2VA 2CHXA 4M3OA 3FU3A 2EIJE 1Q2ZA 2YINA 4UQYA 3F6QA 4RG9A 2E0IA 4GZDA 1BU9A 1SA5A 3D9LA 4PS7A 3UPVA 3QJZA 4WWOA 2WXMA 3DSSA 3T8MA 3HG0D 2X6FA 2QYJA 3KD7A 3ASDA 3DSWA 3UUXA 5AN8A 4JEHA 1H19A 4K0RA 2RKKA 5G05J 3C3RA 5ARGA 3CHMA 4KT6B 2LO6A 2X6IA 2GRLA 3IKOB 4FHKA 3RRUA 2DZOA 2XEVA 5BNWA 3CVPA 4BESA 4WWPA 3ZFWA 5J08A 2QY7A 3FUDA 4GZ3A 1NI1A 3HRAA 2FBNA 3T9KA 3FEYA 1AWCB 1Z6TA 4WNDA 4GU5A 3TJPA 3V30A 3Q49B 2PQRA 5CERB 3UM1A 3DPDA 3PH0C 3G2SA 4RLYA 3EHMA 3FTUA 1OCRE 2A5EA 4IN3B 5EYPF 1HO8A 1WY6A 2AWIA 2I1KA 1IQUA 3FUEA 4BTBA 1FPPA 3CK8A 3UMVA 3FFLA 5JHBA 1N4RA 3RRMB 3LJ3A 5AJLA 3GZSA 5AARA 2MRIA 3RO3A 1O5MA 1TJFA 3PS6A 4A1SA 3T8KA 4XI0A 3G2TA 2KCKA 4FLHA 4FJYA 2WXIA 2FO1E 1WAO1 3TXMA 4HQDA 4DLOA 2PNNA 5FWQA 4I9CA 4UI9C 5KJNA 4W9RA 4OAUC 2MHKA 1V54E 2VTBA 4LNGA 2WVIA 1ELWA 2BUGA 4C9BB 1QYMA 3UT4A 3D3MA 4ME2A 5JJ7A 4AP2A 2PM7A 3C5RA 4G25A 4MLPA 5AQ7A 1TN7A 4U07A 3LCAA 4U63A 3LY8A 2P2CP 4N3BA 3FTXA 4I2WA 4FA6A 5D66A 2FF4A 3IHVA 3QWWA 2BF0X 3D9KA 3URZA 2WB2A 2ETBA 3ZNGA 1E96B 3S7FA 3PNLB 5HS0A 1ZU2A 5KNHD 2IFUA 4GMLA 4I43A 2FULA 3MCXA 1SA4A 2CHWA 4BETA 3CKCA 4DRXE 4G8KA 4XX5A 2XRZA 3QARA 5FQ7A 2JEKA 1G3NB 3LVRE 4EZLA 3APFA 2BKKB 3LY7A 1L5JA 1PAQA 3EUVA 5A7DB 2L0IA 2XEEA 3D9MA 2JLBA 3UXGA 3UM0A 3HVEB 3MEKA 2ILRA 5AIJA 5CCLA 2DCPA 2M63A 1HFAA 3MA5A 4HFGA 4F53A 2UWJG 2MOWA 4GTVA 1EYHA 1U2VG 3QNKA 5EN5D 4CGVA 3W9GA 2J08A 4APFA 1K3ZD 4I9EA 2Q7FA 4HBDA 3ZN3A 2IEJA 2WQ6A 5AYWD 3ZVVA 3PNTB 4FADA 1JPLA 4TXRA 4HB5A 3SO8A 2R59A 1OY3D 4OVVA 4L7TA 3ZW3A 2DZNA 1ZBPA 2DWZA 3FY4A 4DX2A 3LYAA 4CZ2D 4HRLA 4TRQA 4JL0A 1IHBA 1V55E 1XGWA 3CEQA 4MBGA 1MX4A 4GYYA 1S64A 2LUHA 1MZCA 2KCLA 1YYHA 4MRUA 3ZPJA 5B3SE 4PUCA 5A6CA 2XS1A 1TNUA 5ENPD 1JCQA 2GW1A 4GMJA 3Q4AB 5CHEE 1HG5A 3CVWA 4JB8P 3C72A 5ANLA 2ZGGA 2GRRB 2EQXA 4KZ0A 5J90A 1O1RA 3LXUX 4GTPA 3PVLA 2R2LA 1LTXA 3PZ1A 3Q9NC 2FO7A 4CDMA 2RD0A 3PRZA 5CMYA 3CSTA 3W9FA 3ZGQA 4JA7A 3B95A 4K03A 2C0MA 4GTRA 4F1PA 2H6FA 3OXLA 2F37A 3ENEA 4WNEA 4CCAA 2ZU6B 5FZRA 5JHAA 3QOUA 2V8SE 3U4TA 5CMWA 3Q7FA 2XGMA 3ABLE 4B93B 2L6JA 4Y6CA 1BI7B 4OAVB 1HE8A 3LEWA 4AOFA 2RFMA 2WXKA 2VGYA 3B7UX 4GYWA 4ANXA 3MKRA 4Q94A 3GW4A 3SGHA 3B7RL 4TUMA 1QNFA 3AJIA 3R7QA 2Y0BG 3UINC 4AJWA 1NL4A 1NA0A 2PQNA 3D9JA 4ATGA 4EZJA 3OAWA 5KJKA 2DVWA 1BLXB 4ANVA 2YNQA 2EILE 2J49A 1N9AA 4HXIA 4BX8A 3ASFA 3J5PA 1NA3A 2OOEA 2UY1B 1HF8A 3P2BA 1UW4B 2IU1A 2WXOA 4JZYA 3C3QA 4J8FA 1OWMA 4UQXA 4ZFHA 5ENTD 4U0ZA 5KCMA 1OWPA 3UM2A 3ZXSA 3DSTA 3NAWA 1E8ZA 2IQCA 1BD8A 4V3IA 5E76A 3CHSA 2WXGA 3ASGA 1UJJA 4GB9A 3HVEA 1TN6A 4L2YA 1DC2A 1Z5SC 4O1OA 4UWLA 1UN9A 2PZIA 2CFZA 2WMOA 3SFYA 3ULEG 4ACKA 4O60A 4FHJA 1OWLA 3FU0A 4I6GA 5AQAA 4F6RD 1FCHA 2PM6A 3LPZA 3U64A 3VLEA 4EBAG 3NB2A 3FUNA 3QK0A 2QYUA 3I4RB 3CVYA 3TWQA 1LD8A 3SHFA 1KT1A 2HYZA 1A5EA 4YVOA 2XCCA 4U0SA 5DBKA 4QFVA 2XCBA 3ML9A 2VSXE 2AXVA 3CVNA 1DCEA 3Q9UC 5IY5E 4APOA 5AENA 4L2LA 2I6HA 2P58C 5LCWC 3CVVA 3MV3B 4NIKA 2EIME 1D8DA 4TUUA 5HRYA 4OVUA 5KJLA 3SY2A 4EZKA 5A23A 4IRUA 3D9NA 1K1AA 5AAOA 3IHYA 2XZDG 3BG1B 1Z3YA 1N94A 1TEZA 3KS2A 4H7YA 3ASHA 2R17C 1QZ2A 3QB2A 1FVHA 2AXUA 3C3OA 1OCCE 3LS8A 3MKQB 3PZ3A 1N0RA 1D8EA 1PY1A 4XIFA 3T5VA 1EPUA 1KT0A 3EIJA 3EHQA 4L1BA 3BG0B 2XRYA 3TGOA 1TNBA 3E30A 4XEIG 3CIAA 4HORA 3C98A 1U3CA 1KZPA 1HXIA 4YDOA 4FULA 3UT7A 4ATZD 2IOSA 5FIOA 3P1UA 1SZ9A 5LX8A 3FUFA 3ASOE 4AY5A 3SNXA 5BW8C 4UWGA 4U8VD 3V79K 4Y6WA 1E8YA 1EDUA 4GZCA 4HOUA 3SI5A 3FTWA 3ULQA 2VGXB 1U3DA 1MYOA 3AG4E 3SF4A 3JXIA 4J0UA 3TAXA 1JUQA 3FUIA 2L9BA 4HS2A 4JHRA 3ZUVB 1ELKA 2I1JA 1H0AA 5AQ9A 1TNZA 5EDSA 2LNIA 2ZGDA 2B6CA 4YNDA 4BEPA 2OVBA 3FUJA 2NXPA 2Y4UA 1KPSB 5ENSD 2VSYA 2OEVA 4RG6A 3OXGA 4HVBA 4BT9A 4I1OB 2XZTG 3BQOA 2YQ8A 2L0TB 4IYPA 2X3MA 4FLBA 4J7WA 2GROB 3MGBA 1EF1C 1OWNA 1YCSB 3HXFA 2XPZA 3R7RA 4DX6D 2LSVA 3Q5MA 1X5BA 3RRNB 2GRQB 4WUYA 2QFCA 4BSZB 3SFZA 4GA2A 2KC7A 3LJNA 3IBEA 1DVPA 4CDNA 2RFAA 3NBNB 4I1MA 1OWOA 2BKGA 3DSUA 4I6EA 3RK6A 1P5QA 2V5FA 3X2QE 4U04A 4G11A 5G04C 4UUCA 3IV0A 3ZIMA 2X6JA 1N4SA 3HIZA 2DBAA 3HXDA 3O4ZA 3ZHEB 4HLLA 4XI9A 4PS3A 3MX3A 3CQCB 4ILHB 4DI4A 2WQHA 1OUVA 3SBSA 4JEUA 4HOQA 1E90A 5BXUA 2CG2A 4O1PA 4UI9K 2P9PG 3HYMB 1HU3A 1H6PA 2AJAA 3BEEA 4GTTA 4A55A 5FZSA 5ENRD 3I3NA 1MX6A 2BEDA 3U66A 1N0QA 1AP7A 2ZXWE 1SW6A 3E34A 1OCZE 3LY9A 5LFAA 3PREA 1NFIE 4EBAA 5KBAA 1IKND 3KSLA 3L6AA 1BI8B 3UKUG 4U95D 3R9MA 4XKBA 2KZTB 2AW6A 4KVMA 3U3WA 4KVOA 4GA0A 4ILGA 2HR2A 3S7JA 3L08A 3PE3A 4KYOB 2J8SD 2WM9A 4EHMA 4YDYA 2J4DA 4QQIA 2R03A 3ONLA 3CR3A 4TXPA 1E7VA 2HO1A 3MJWA 1HG2A 1WM5A 2GGFA 3FWVA 3FTVA 1S70B 4H7XA 4N3CA 4N3AA 4E6HA 5CBNA 4CT0A 2IOLA 4U96D 5KWDA 4M7CA 4JA9A 2DYRE 4GTQA 3JUEA 5T3RA 1X81A 3DBSA 4LRZA 5G05C 3MKQA 1SZAA 2IO3C 3L54A 4BERA 3Q15A 4K5CA 5CECB 1IXVA 2B0OE 3FUKA 4GZ5A 1BPOA 4TXQA 2P9NG 4B94A 4DPRA 2IO2C 1QQEA 2VGXA 2GRNB 1WG0A 2VTBB 5FQ4A 3PUJA 2WXJA 4C0MA 2I2OA 2XEHA 1SQMA 2A4ZA 1ELRA 4PH4B 1PC2A 3EDTB 3LDZA 4EECA 1UN8A 3CGHA 3CKBA 3ZKJA 1HS6A 3Q78A 4Q96A 4CYMD 3L82A 1H2VC 2A5UA 2H6HA 2NYJA 4URKA 3E32A 3WXXA 3GZ2A 5EX0A 3ZYKA 3Q75A 3NOGD 2KATA 4G23A 4LSZE 1ZB1A 4KBQA 2JABA 3TWSA 2V4LA 4G24A 3OXFA 3UTMA 3UIPC 1Y6IA 4N5QA 2EIKE 3BUAA 4A3VA 3VTXA 4G2VA 3TWUA 3PE4A 3E33A 3FH7A 2UY1A 3DSVA 4EQFA 1K1BA 3DPYA 3LVQE 4A1GA 1TN8A 2KZTA 3EU9A 2ETCA 5BT1A 4I2ZA 2P9IG 3ABME 2P9UG 4C0EA 3UT8A 2R5SA 2ONDA 3CVQA 3QKYA 2WXRA 2XPIA 3EIQC 3L9TA 4YDWA 2P9SG 5EX3A 3V2OA 3ZYMA 4LERA 4BX9A 3GZ1A 2VSOE 2BTDA 5HQ8A 4ANUA 3N71A 5BUZA 1N11A 3AG2E 5JMND 3CHPA 1E8XA 3AS5A 3UI2A 1TNOA 2V5QC 3CV0A 2XGSA 4FU3A 2HE0A 4TV3A 5FQ8A 2AXZA 3ISMC 1RW2A 4XZ4A 4DK5A 2F8YA 1TR4A 1NZNA 5D0QD 3KEAA 3PDNA 1NP7A 1KZOA 2V4HC 5B1BE 4KXKB 3E37A 3AS8A 5EILA 3TG4A 2WXHA 2NSZA 4I6JA 5JJ6A 4HNAD 4Z68A 5JJTA 5EIDA 2OEWA 3SZ7A 2F0YA 1A17A 5CRUA 4ABNA 4J8YA 1MHQA 3Q79A 4LNBA 2LAHA 2R02A 4K5AB 5T4YA 1N52A 2ZISA 5CCMA 1JCSA 4DX5D 3ZRHA 3RKVA 1N4QA 4YVQC 3LKUA 3JXJA 3R9AB 5C1DA 2MYOA 3FTYA 3PZ4A 3B7TA 3D9HA 2LAIA 4I1AA 4GPKA 2XS8A 1IQRA 1LD7A 2CHZA 3NF1A 3SFXA 4N5CA 2FEZA 1QBQA 4K5BA 5FQ6A 1IHGA 4UWKA 5HI7A 1FT1A 4J8EA 2FI7A 2WXFA 2J4BA 1MX2A 1OT8A 4G26A 1TYQG 2KXPC 3RIBA 2OVFA 4GCNA 5ENQD 1B89A 3IEGA 2QC9A 4AIFA 3V31A 4JHJA 3FP3A 2GRMA 3JCKC 4I17A 2J07A 4GA1A 3TWRA 2DYSE 3CVLA 3TWXA 4ACLA 2NC9A 4A3TA 3HDXA 5BV1A 3KEZA 4FP7A 2IJGX 3VTYA 1K8KG 4CT4A 3TL5A 4CRWA 3PEUB 5LCWJ 3QAQA 4O6FA 4DJAA 2XPYA 3HHMA 4LNUD 3FULA 4HOTA 3CHRA 1H6KA 5B1AE 3ZU7B 5G2NA 3Q73A 5ENNA 3UX4A 4GZ6A 4E85A 2IY0C 3L16A 3FH8A 3SD5A 4B0ZA 4AXHA 3T5XA 4BWRA 4EPZA 3ZEFA 1S0PA 4RVBA 1N54A 3ZYLA 2Y4TA 3TWWA 3TXNA 1HX8A 3AG1E 5AJDA 3L17A 5BXOA 5M72A 2VSNA 3S7BA 4L23A 3CVUA 3Q7AA 3KAEA 2WPVA 4KZCA 5G04J 5HKPA 2OCCE 4D10C 3EHNA 2AVPA 2VJ8A 5JA4D 3MYVA 4MS6A 4A63B 2XGOA 1FVFA 3DRAA 3FU6A 4UQZA 1Y8MA 3PEVB 5LOZA 5H7PA 4F7AA 1JWGA 1H2TC 1N4PA 5EYLA 3RU0A 1H2UA 3FTZA 3CK7A 4GTMA 3RJVA 2GRPB 1Z3XA 4LEUA 3AU4A 5FINA 4HI9A 5FJYA 4BTAA 2WXNA 4WAFA 2IONA 1S63A 4FC8A 5T8IA 2H6GA 3ESKA 3S7DA 3DEPA 4JHKA 2OV8A 4JVSA 2R05A 4J6IA 3CSFA 2Y3AA 3HXCA 4XKCA 5EKQD 3O48A 3IXEA 3JYSA 1UOHA 4F3VA 1JCRA 5FZQA 4DLQA 2HM8A 4G8LA 4U0UA 4P29A 3U9WA 3D9OA 2KBXA 2I9CA 2Y1LE 2RG8A 3CQGB 2F8XK 3NOCD 5D2MC 3QDNA 3QWPA 2Y69E 4DX7D 3V2XA 4LUNU 3ABKE 1MQSA 2VQ2A 1YMPA 4GAAA 4WNGA 4HLEA 3FDHA 4U7EB 2L6BA 3EHRA 5ENOD 3PZDA 4KMOA 3DWLG 3G2UA 5E75A 3BU8A 3TWTA 3UIOC 4YDEA 3AG3E 3SQVA 4N39A 3DSXA 4AV7A 3APDA 3B7BA 4Q69A 4JW1A 1FT2A 4HI8A 4AVXA 1H6OA 5ANRA 1LF8A 3PUKA 5G55A 2LSUA 2EINE 3TWVA 4N2SA 2WMNA 1UG3A 4ILIA 1N95A 2X6KA 4R7LA 4PDXA 5ARFA 5AQBA 4XE0A 1RZ4A 3K9IA 3UKRG 3ESLA 4X8QA 2WXQA 1OXJA 3JUIA 1WDYA 2X38A 4WNFA 4BT8A 3VLFA 3FH5A 1VDYA 5CRVA 2WXPA 4B8CB 3AU5A 4DX1A 4RQIA 2P9LG 5C2YA 3JQ0A 4AEZC 3CK9A 3ZHEA 2J09A 3NQPA 4U8YD 3FUHA 3QWVA 4UWHA 1XNFA 4J8SA 5D0OD 3ZXPA 2C0LA 5EIBE 4BSXA 4BY6A 4F1SA 2ETAA 4IULA 1SVXA 2J9QA 2H6IA 3TG5A 2XHEA 4FJZA 4C48B 2KCVA 5CEAA 5BV0A 4CEMA 2VYIA 1D9SA 4GPMA 2C2LA 5BPPA 3EJNA 5FTPA 3FUMA 3E4BA 4JC8A 3NZSA 4GYOA 3EU5A 1OCOE 3B7SA 4CGWA 2CFUA 1DCQA 3S2AA 4OYSA 2QZAA 1E7UA 3VLDA 4NQ0A 2X6HA 3NZUA 4DUIA 3L13A 4LCTA 3RO2A 3HXBA 2E2EA 3OTNA 3DXMG 3SBTB 2KM4A 3QC1A 4NURA 2WXLA 4GMRA 3B13A 3RSEG 3UM3A 3AS4A 3UQ3A 4NACA 3Q47B 3FEXA 3ASNE 3CHQA 3DEOA 1MJ0A 4HOSA 3JQ1A 4UI9J 5CBOA
chains in the Genus database with same CATH topology
3ZPJA 4GA2A 4PUCA 5A6CA 2KC7A 2V0PA 2LAIA 4I1AA 4GPKA 1IQRA 2GW1A 2CHZA 2WQ7A 3IBEA 3NF1A 4GMJA 4ANWA 3Q4AB 3CVXA 1DVPA 5CHEE 4N5CA 2YHCA 2FEZA 4CDNA 1HG5A 3CVWA 1IYGA 5FQ6A 5ANLA 1IHGA 3FHEA 4UWKA 1UJKA 2EQXA 5HI7A 4I1MA 1OWOA 2CG3A 4KZ0A 5J90A 3LXUX 4B89A 4J8EA 2FI7A 4I6EA 3RK6A 3PVLA 1P5QA 2V5FA 2WXFA 2XQ0A 2J4BA 5KJMA 1TJCA 4U04A 4G26A 1YA0A 2FO7A 3ML8A 3RIBA 2RD0A 4CDMA 4G11A 4PS8A 5G04C 2OVFA 1E8WA 5FT9A 4UWFA 3PRZA 4GCNA 3CSTA 5CMYA 1B89A 3IEGA 1KLXA 3IV0A 4AIFA 4WWNA 3G2WA 3D9IA 3FP3A 3ONKA 4JHJA 2GRMA 3JCKC 4I17A 4JA7A 1W3BA 5DIZA 4K03A 3ZIMA 2J07A 2X6JA 2C0MA 3FU5A 4GA1A 3HIZA 4AY6A 2DBAA 3OXLA 4NRHB 2PL2A 3ENEA 3CVLA 4WNEA 4CCAA 2ZU6B 3O4ZA 3ZHEB 2DIWA 2NC9A 4ACLA 5FZRA 4A3TA 3HDXA 5BV1A 4XI9A 5JHAA 3FTSA 3QOUA 4JXTA 4MKTA 2V8SE 3U4TA 3MV2B 5CMWA 4U8HA 4PS3A 2XGMA 4JPSA 2YHEA 3MX3A 3CQCB 3KEZA 2L6JA 4Y6CA 4FP7A 2IJGX 4ILHB 3GYZA 3VTYA 4J8DA 2WQHA 4B8AA 1OUVA 1HE8A 3SBSA 3TL5A 3LEWA 3PEUB 4CRWA 4CT4A 5LCWJ 1HH8A 4JEUA 4AOFA 2IF4A 3QAQA 4O6FA 4HOQA 1E90A 2WXKA 2VGYA 3B7UX 3I4GA 4GYWA 4ANXA 4CDRA 5LP0A 2CG2A 4DJAA 2XPYA 3HHMA 4UI9K 1DNPA 3APCA 3FULA 3MKRA 3GW4A 4Q94A 3HYMB 3SGHA 1HU3A 4HOTA 3B7RL 3CHRA 1H6KA 1QNFA 3BEEA 5G2NA 3ZYQA 4A55A 1INZA 5ENNA 4BFRA 3UX4A 5FZSA 4GZ6A 3MZLB 3R7QA 3D9PA 1GW6A 3I3NA 1HZ4A 4AJWA 4E85A 3U66A 3L16A 3FH8A 3SD5A 4N2QA 4RSYA 1JWFA 1NA0A 4GCOA 4B0ZA 4AXHA 3LY9A 3CLJA 3I5PA 5LFAA 2PQNA 3D9JA 3T5XA 3L22A 4BWRA 3PREA 4EPZA 4EBAA 3ZEFA 1S0PA 4DI3A 3CHOA 4ATGA 4EZJA 3OAWA 4RVBA 4G1TA 5KJKA 1N54A 3ZYLA 2Y4TA 3L6AA 4AM9A 3G2VA 3TXNA 2CHXA 4M3OA 1HX8A 3FU3A 4ANVA 4XKBA 2KZTB 5AJDA 3L17A 2AW6A 5M72A 4KVMA 3U3WA 2YINA 2YNQA 4UQYA 4KVOA 4RG9A 2J49A 2VSNA 4GA0A 3S7BA 4L23A 4ILGA 3CVUA 2HR2A 3KAEA 2WPVA 2E0IA 4GZDA 4KZCA 3S7JA 3L08A 3PE3A 3D9LA 4KYOB 5G04J 4PS7A 3SFZA 4HXIA 3QJZA 3UPVA 2WM9A 4D10C 4BX8A 3EHNA 3ASFA 2AVPA 2J4DA 1NA3A 2VJ8A 3MYVA 4MS6A 2XGOA 2OOEA 4WWOA 2UY1B 1FVFA 1HF8A 3FU6A 3ONLA 4UQZA 1Y8MA 1UW4B 3CR3A 3P2BA 3PEVB 1E7VA 2IU1A 2WXMA 2HO1A 2WXOA 3MJWA 4JZYA 3T8MA 1HG2A 2X6FA 4J8FA 1OWMA 5LOZA 4UQXA 4F7AA 1WM5A 1JWGA 1H2TC 2GGFA 3FWVA 3FTVA 3KD7A 4U0ZA 4H7XA 1OWPA 3ASDA 5KCMA 4N3CA 3UUXA 3ZXSA 3RU0A 1H2UA 4JEHA 1E8ZA 1H19A 2IQCA 4K0RA 3FTZA 3CK7A 4N3AA 4V3IA 5G05J 5ARGA 4E6HA 3CHMA 5E76A 4CT0A 2IOLA 4KT6B 3CHSA 2LO6A 2WXGA 3ASGA 2X6IA 1Z3XA 2GRLA 3RJVA 3IKOB 4LEUA 3AU4A 4JA9A 1UJJA 4GB9A 3HVEA 5T3RA 3DBSA 4L2YA 4LRZA 4FHKA 5FJYA 3RRUA 4BTAA 2WXNA 5G05C 2XEVA 4WAFA 3CVPA 5BNWA 3MKQA 2IONA 4FC8A 5T8IA 1SZAA 4UWLA 4WWPA 3ZFWA 1UN9A 3L54A 5J08A 2QY7A 3ESKA 2PZIA 3FUDA 4GZ3A 3S7DA 3Q15A 2FBNA 4JHKA 2OV8A 4JVSA 2CFZA 2WMOA 3FEYA 1Z6TA 4ACKA 4J6IA 3CSFA 2Y3AA 4WNDA 4XKCA 4FHJA 5EKQD 3FUKA 3O48A 4GZ5A 1BPOA 1OWLA 3FU0A 4I6GA 3JYSA 4GU5A 3TJPA 1FCHA 3Q49B 2PM6A 4B94A 4DPRA 4F3VA 2PQRA 3LPZA 3U64A 5FZQA 3VLEA 4DLQA 4EBAG 3FUNA 3QK0A 2HM8A 3DPDA 3PH0C 3I4RB 3G2SA 4P29A 4U0UA 3U9WA 3D9OA 3CVYA 1QQEA 2VGXA 3EHMA 3FTUA 2I9CA 2VTBB 2RG8A 3CQGB 5FQ4A 3PUJA 3SHFA 1KT1A 2WXJA 4IN3B 4C0MA 1HO8A 1WY6A 2HYZA 2AWIA 2I1KA 4YVOA 1IQUA 3QDNA 2I2OA 2XCCA 3FUEA 4U0SA 4BTBA 3QWPA 3CK8A 3UMVA 1SQMA 2A4ZA 1ELRA 4PH4B 1PC2A 3EDTB 5DBKA 3LDZA 2XCBA 3FFLA 4QFVA 5JHBA 4LUNU 3ML9A 3RRMB 2VSXE 3ZGQA 4EECA 1UN8A 1MQSA 2VQ2A 3CGHA 3LJ3A 4WNGA 4GAAA 5AJLA 3GZSA 2AXVA 2MRIA 3CKBA 4HLEA 3CVNA 3RO3A 3PS6A 1TJFA 4A1SA 3FDHA 4XI0A 3G2TA 1HS6A 4APOA 5AENA 4L2LA 4Q96A 2KCKA 2I6HA 4FLHA 2P58C 4FJYA 5LCWC 2WXIA 3CVVA 1H2VC 3MV3B 1WAO1 3PZDA 4KMOA 3TXMA 2A5UA 4TUUA 4DLOA 4OVUA 3G2UA 5FWQA 4URKA 4I9CA 4UI9C 5KJNA 3WXXA 5KJLA 5E75A 3GZ2A 4W9RA 5EX0A 3ZYKA 2MHKA 2VTBA 4EZKA 5A23A 2WVIA 1ELWA 2BUGA 4N39A 4C9BB 2KATA 4DI4A 4G23A 4IRUA 3UT4A 4AV7A 3D9NA 3APDA 3D3MA 4Q69A 4ME2A 5JJ7A 4AP2A 3IHYA 4JW1A 4KBQA 3BG1B 2PM7A 2V4LA 1Z3YA 3OXFA 4G25A 4G24A 1Y6IA 4MLPA 4AVXA 5ANRA 1LF8A 3PUKA 1TEZA 4U07A 3LCAA 5G55A 4U63A 4A3VA 3LY8A 3KS2A 4N3BA 2LSUA 4H7YA 3FTXA 3VTXA 3ASHA 4I2WA 2R17C 4N2SA 4G2VA 4FA6A 2WMNA 3PE4A 1QZ2A 3QB2A 1FVHA 1UG3A 3FH7A 4ILIA 2FF4A 3IHVA 3QWWA 2AXUA 2BF0X 3D9KA 2UY1A 3LS8A 3URZA 2WB2A 2X6KA 3MKQB 4R7LA 1PY1A 4XIFA 4PDXA 4EQFA 5ARFA 1E96B 3S7FA 3LVQE 3T5VA 1EPUA 4XE0A 4A1GA 1KT0A 3EIJA 3K9IA 4L1BA 3BG0B 2XRYA 3ESLA 2WXQA 3PNLB 3JUIA 3TGOA 2KZTA 2X38A 4WNFA 4BT8A 1ZU2A 3VLFA 2IFUA 4GMLA 5BT1A 3FH5A 4I43A 2FULA 3MCXA 3CIAA 1VDYA 4HORA 2CHWA 4I2ZA 3C98A 1U3CA 3CKCA 4C0EA 3UT8A 2R5SA 1HXIA 2ONDA 3CVQA 4XX5A 2XRZA 2WXPA 3QKYA 2WXRA 2XPIA 3EIQC 3QARA 4FULA 3AU5A 5FQ7A 3UT7A 4B8CB 2JEKA 2IOSA 3LVRE 4EZLA 5EX3A 3APFA 3P1UA 3JQ0A 5C2YA 3ZYMA 4LERA 3LY7A 4AEZC 1L5JA 1PAQA 1SZ9A 3CK9A 5LX8A 3ZHEA 2J09A 3NQPA 5A7DB 4BX9A 2L0IA 3FUFA 3GZ1A 4AY5A 3D9MA 2JLBA 2VSOE 3SNXA 2BTDA 5BW8C 4UWGA 5HQ8A 3FUHA 3HVEB 3QWVA 1XNFA 4J8SA 4UWHA 3MEKA 3N71A 5D0OD 4ANUA 5BUZA 4Y6WA 2C0LA 2ILRA 4BY6A 4BSXA 1E8YA 1EDUA 4F1SA 5AIJA 4GZCA 3CHPA 4HOUA 2DCPA 3SI5A 5CCLA 4IULA 2M63A 3FTWA 2J9QA 3TG5A 2XHEA 4FJZA 1E8XA 3AS5A 3ULQA 2KCVA 3CV0A 2XGSA 5BV0A 1HFAA 3MA5A 4CEMA 4FU3A 2VGXB 4HFGA 2VYIA 1U3DA 4TV3A 5FQ8A 2AXZA 4F53A 3SF4A 2UWJG 2MOWA 1EYHA 3QNKA 4CGVA 4XZ4A 4J0UA 3TAXA 2J08A 2C2LA 1JUQA 4APFA 4DK5A 5BPPA 3EJNA 1NZNA 3PDNA 4I9EA 3FUIA 1NP7A 2Q7FA 3FUMA 5D0QD 5FTPA 3E4BA 4KXKB 4JC8A 2L9BA 4HS2A 3AS8A 4JHRA 3NZSA 3ZN3A 3TG4A 2WXHA 2NSZA 4GYOA 4I6JA 1ELKA 2I1JA 1H0AA 5AYWD 3ZVVA 2WQ6A 3PNTB 2LNIA 5EDSA 3B7SA 5JJ6A 4YNDA 4CGWA 4FADA 2CFUA 2OVBA 1JPLA 3FUJA 3S2AA 2R59A 5JJTA 4OYSA 2NXPA 2Y4UA 2VSYA 1E7UA 4OVVA 3VLDA 4NQ0A 3SZ7A 2X6HA 4RG6A 3NZUA 1A17A 3OXGA 4BT9A 4I1OB 4HVBA 4L7TA 3ZW3A 3L13A 1ZBPA 4ABNA 1MHQA 2YQ8A 3FY4A 2L0TB 4IYPA 4LCTA 3RO2A 2X3MA 4FLBA 2LAHA 5T4YA 2E2EA 1N52A 3OTNA 5CCMA 3LYAA 3SBTB 3MGBA 2KM4A 3ZRHA 3QC1A 4NURA 4TRQA 2WXLA 3RKVA 4JL0A 3B13A 1XGWA 1EF1C 1OWNA 3CEQA 3AS4A 2XPZA 3UQ3A 3R7RA 4YVQC 3LKUA 4NACA 4GYYA 2LSVA 3Q47B 3FEXA 3R9AB 3Q5MA 1X5BA 3CHQA 5C1DA 3FTYA 3RRNB 2KCLA 4WUYA 2QFCA 4HOSA 3JQ1A 3B7TA 4UI9J 4MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0P A;  1TJF A; 
#chains in the Genus database with same CATH topology
 2P9K G;  2V0P A;  4HRM B;  1O1T A;  2WQ7 A;  4ANW A;  3CVX A;  2YHC A;  3KSQ A;  3J5Q B;  2ZIR A;  1IYG A;  3FHE A;  1UJK A;  2LXL A;  3HXE A;  2CG3 A;  4B89 A;  2XQ0 A;  5KJM A;  1TJC A;  1YA0 A;  2LXM A;  3ML8 A;  3ULY A;  4PS8 A;  3AAA C;  1E8W A;  5FT9 A;  4UWF A;  3RAU A;  1KLX A;  4WWN A;  3G2W A;  3D9I A;  3ONK A;  3WG7 E;  1W3B A;  5DIZ A;  3FU5 A;  5KNG A;  4AY6 A;  4NRH B;  2PL2 A;  2DIW A;  3FTS A;  4JXT A;  4MKT A;  5CED B;  3MV2 B;  4LG6 A;  4U8H A;  4JPS A;  2YHE A;  4HRN A;  3GYZ A;  4GTS A;  4J8D A;  4B8A A;  3DXK G;  5ITZ F;  1HH8 A;  2IF4 A;  3I4G A;  4CDR A;  5LP0 A;  2VGE A;  1O1S A;  1DNP A;  1TNY A;  3APC A;  3ZYQ A;  1INZ A;  4BFR A;  2XEN A;  3MZL B;  3D9P A;  1GW6 A;  4ZHB A;  1HZ4 A;  4GTO A;  4L9P A;  4JD2 G;  4N2Q A;  4RSY A;  1JWF A;  4GCO A;  3CLJ A;  3PZ2 A;  3I5P A;  3L22 A;  4DI3 A;  3CHO A;  4G1T A;  4AM9 A;  3G2V A;  2CHX A;  4M3O A;  3FU3 A;  2EIJ E;  1Q2Z A;  2YIN A;  4UQY A;  3F6Q A;  4RG9 A;  2E0I A;  4GZD A;  1BU9 A;  1SA5 A;  3D9L A;  4PS7 A;  3UPV A;  3QJZ A;  4WWO A;  2WXM A;  3DSS A;  3T8M A;  3HG0 D;  2X6F A;  2QYJ A;  3KD7 A;  3ASD A;  3DSW A;  3UUX A;  5AN8 A;  4JEH A;  1H19 A;  4K0R A;  2RKK A;  5G05 J;  3C3R A;  5ARG A;  3CHM A;  4KT6 B;  2LO6 A;  2X6I A;  2GRL A;  3IKO B;  4FHK A;  3RRU A;  2DZO A;  2XEV A;  5BNW A;  3CVP A;  4BES A;  4WWP A;  3ZFW A;  5J08 A;  2QY7 A;  3FUD A;  4GZ3 A;  1NI1 A;  3HRA A;  2FBN A;  3T9K A;  3FEY A;  1AWC B;  1Z6T A;  4WND A;  4GU5 A;  3TJP A;  3V30 A;  3Q49 B;  2PQR A;  5CER B;  3UM1 A;  3DPD A;  3PH0 C;  3G2S A;  4RLY A;  3EHM A;  3FTU A;  1OCR E;  2A5E A;  4IN3 B;  5EYP F;  1HO8 A;  1WY6 A;  2AWI A;  2I1K A;  1IQU A;  3FUE A;  4BTB A;  1FPP A;  3CK8 A;  3UMV A;  3FFL A;  5JHB A;  1N4R A;  3RRM B;  3LJ3 A;  5AJL A;  3GZS A;  5AAR A;  2MRI A;  3RO3 A;  1O5M A;  1TJF A;  3PS6 A;  4A1S A;  3T8K A;  4XI0 A;  3G2T A;  2KCK A;  4FLH A;  4FJY A;  2WXI A;  2FO1 E;  1WAO 1;  3TXM A;  4HQD A;  4DLO A;  2PNN A;  5FWQ A;  4I9C A;  4UI9 C;  5KJN A;  4W9R A;  4OAU C;  2MHK A;  1V54 E;  2VTB A;  4LNG A;  2WVI A;  1ELW A;  2BUG A;  4C9B B;  1QYM A;  3UT4 A;  3D3M A;  4ME2 A;  5JJ7 A;  4AP2 A;  2PM7 A;  3C5R A;  4G25 A;  4MLP A;  5AQ7 A;  1TN7 A;  4U07 A;  3LCA A;  4U63 A;  3LY8 A;  2P2C P;  4N3B A;  3FTX A;  4I2W A;  4FA6 A;  5D66 A;  2FF4 A;  3IHV A;  3QWW A;  2BF0 X;  3D9K A;  3URZ A;  2WB2 A;  2ETB A;  3ZNG A;  1E96 B;  3S7F A;  3PNL B;  5HS0 A;  1ZU2 A;  5KNH D;  2IFU A;  4GML A;  4I43 A;  2FUL A;  3MCX A;  1SA4 A;  2CHW A;  4BET A;  3CKC A;  4DRX E;  4G8K A;  4XX5 A;  2XRZ A;  3QAR A;  5FQ7 A;  2JEK A;  1G3N B;  3LVR E;  4EZL A;  3APF A;  2BKK B;  3LY7 A;  1L5J A;  1PAQ A;  3EUV A;  5A7D B;  2L0I A;  2XEE A;  3D9M A;  2JLB A;  3UXG A;  3UM0 A;  3HVE B;  3MEK A;  2ILR A;  5AIJ A;  5CCL A;  2DCP A;  2M63 A;  1HFA A;  3MA5 A;  4HFG A;  4F53 A;  2UWJ G;  2MOW A;  4GTV A;  1EYH A;  1U2V G;  3QNK A;  5EN5 D;  4CGV A;  3W9G A;  2J08 A;  4APF A;  1K3Z D;  4I9E A;  2Q7F A;  4HBD A;  3ZN3 A;  2IEJ A;  2WQ6 A;  5AYW D;  3ZVV A;  3PNT B;  4FAD A;  1JPL A;  4TXR A;  4HB5 A;  3SO8 A;  2R59 A;  1OY3 D;  4OVV A;  4L7T A;  3ZW3 A;  2DZN A;  1ZBP A;  2DWZ A;  3FY4 A;  4DX2 A;  3LYA A;  4CZ2 D;  4HRL A;  4TRQ A;  4JL0 A;  1IHB A;  1V55 E;  1XGW A;  3CEQ A;  4MBG A;  1MX4 A;  4GYY A;  1S64 A;  2LUH A;  1MZC A;  2KCL A;  1YYH A;  4MRU A;  3ZPJ A;  5B3S E;  4PUC A;  5A6C A;  2XS1 A;  1TNU A;  5ENP D;  1JCQ A;  2GW1 A;  4GMJ A;  3Q4A B;  5CHE E;  1HG5 A;  3CVW A;  4JB8 P;  3C72 A;  5ANL A;  2ZGG A;  2GRR B;  2EQX A;  4KZ0 A;  5J90 A;  1O1R A;  3LXU X;  4GTP A;  3PVL A;  2R2L A;  1LTX A;  3PZ1 A;  3Q9N C;  2FO7 A;  4CDM A;  2RD0 A;  3PRZ A;  5CMY A;  3CST A;  3W9F A;  3ZGQ A;  4JA7 A;  3B95 A;  4K03 A;  2C0M A;  4GTR A;  4F1P A;  2H6F A;  3OXL A;  2F37 A;  3ENE A;  4WNE A;  4CCA A;  2ZU6 B;  5FZR A;  5JHA A;  3QOU A;  2V8S E;  3U4T A;  5CMW A;  3Q7F A;  2XGM A;  3ABL E;  4B93 B;  2L6J A;  4Y6C A;  1BI7 B;  4OAV B;  1HE8 A;  3LEW A;  4AOF A;  2RFM A;  2WXK A;  2VGY A;  3B7U X;  4GYW A;  4ANX A;  3MKR A;  4Q94 A;  3GW4 A;  3SGH A;  3B7R L;  4TUM A;  1QNF A;  3AJI A;  3R7Q A;  2Y0B G;  3UIN C;  4AJW A;  1NL4 A;  1NA0 A;  2PQN A;  3D9J A;  4ATG A;  4EZJ A;  3OAW A;  5KJK A;  2DVW A;  1BLX B;  4ANV A;  2YNQ A;  2EIL E;  2J49 A;  1N9A A;  4HXI A;  4BX8 A;  3ASF A;  3J5P A;  1NA3 A;  2OOE A;  2UY1 B;  1HF8 A;  3P2B A;  1UW4 B;  2IU1 A;  2WXO A;  4JZY A;  3C3Q A;  4J8F A;  1OWM A;  4UQX A;  4ZFH A;  5ENT D;  4U0Z A;  5KCM A;  1OWP A;  3UM2 A;  3ZXS A;  3DST A;  3NAW A;  1E8Z A;  2IQC A;  1BD8 A;  4V3I A;  5E76 A;  3CHS A;  2WXG A;  3ASG A;  1UJJ A;  4GB9 A;  3HVE A;  1TN6 A;  4L2Y A;  1DC2 A;  1Z5S C;  4O1O A;  4UWL A;  1UN9 A;  2PZI A;  2CFZ A;  2WMO A;  3SFY A;  3ULE G;  4ACK A;  4O60 A;  4FHJ A;  1OWL A;  3FU0 A;  4I6G A;  5AQA A;  4F6R D;  1FCH A;  2PM6 A;  3LPZ A;  3U64 A;  3VLE A;  4EBA G;  3NB2 A;  3FUN A;  3QK0 A;  2QYU A;  3I4R B;  3CVY A;  3TWQ A;  1LD8 A;  3SHF A;  1KT1 A;  2HYZ A;  1A5E A;  4YVO A;  2XCC A;  4U0S A;  5DBK A;  4QFV A;  2XCB A;  3ML9 A;  2VSX E;  2AXV A;  3CVN A;  1DCE A;  3Q9U C;  5IY5 E;  4APO A;  5AEN A;  4L2L A;  2I6H A;  2P58 C;  5LCW C;  3CVV A;  3MV3 B;  4NIK A;  2EIM E;  1D8D A;  4TUU A;  5HRY A;  4OVU A;  5KJL A;  3SY2 A;  4EZK A;  5A23 A;  4IRU A;  3D9N A;  1K1A A;  5AAO A;  3IHY A;  2XZD G;  3BG1 B;  1Z3Y A;  1N94 A;  1TEZ A;  3KS2 A;  4H7Y A;  3ASH A;  2R17 C;  1QZ2 A;  3QB2 A;  1FVH A;  2AXU A;  3C3O A;  1OCC E;  3LS8 A;  3MKQ B;  3PZ3 A;  1N0R A;  1D8E A;  1PY1 A;  4XIF A;  3T5V A;  1EPU A;  1KT0 A;  3EIJ A;  3EHQ A;  4L1B A;  3BG0 B;  2XRY A;  3TGO A;  1TNB A;  3E30 A;  4XEI G;  3CIA A;  4HOR A;  3C98 A;  1U3C A;  1KZP A;  1HXI A;  4YDO A;  4FUL A;  3UT7 A;  4ATZ D;  2IOS A;  5FIO A;  3P1U A;  1SZ9 A;  5LX8 A;  3FUF A;  3ASO E;  4AY5 A;  3SNX A;  5BW8 C;  4UWG A;  4U8V D;  3V79 K;  4Y6W A;  1E8Y A;  1EDU A;  4GZC A;  4HOU A;  3SI5 A;  3FTW A;  3ULQ A;  2VGX B;  1U3D A;  1MYO A;  3AG4 E;  3SF4 A;  3JXI A;  4J0U A;  3TAX A;  1JUQ A;  3FUI A;  2L9B A;  4HS2 A;  4JHR A;  3ZUV B;  1ELK A;  2I1J A;  1H0A A;  5AQ9 A;  1TNZ A;  5EDS A;  2LNI A;  2ZGD A;  2B6C A;  4YND A;  4BEP A;  2OVB A;  3FUJ A;  2NXP A;  2Y4U A;  1KPS B;  5ENS D;  2VSY A;  2OEV A;  4RG6 A;  3OXG A;  4HVB A;  4BT9 A;  4I1O B;  2XZT G;  3BQO A;  2YQ8 A;  2L0T B;  4IYP A;  2X3M A;  4FLB A;  4J7W A;  2GRO B;  3MGB A;  1EF1 C;  1OWN A;  1YCS B;  3HXF A;  2XPZ A;  3R7R A;  4DX6 D;  2LSV A;  3Q5M A;  1X5B A;  3RRN B;  2GRQ B;  4WUY A;  2QFC A;  4BSZ B;  3SFZ A;  4GA2 A;  2KC7 A;  3LJN A;  3IBE A;  1DVP A;  4CDN A;  2RFA A;  3NBN B;  4I1M A;  1OWO A;  2BKG A;  3DSU A;  4I6E A;  3RK6 A;  1P5Q A;  2V5F A;  3X2Q E;  4U04 A;  4G11 A;  5G04 C;  4UUC A;  3IV0 A;  3ZIM A;  2X6J A;  1N4S A;  3HIZ A;  2DBA A;  3HXD A;  3O4Z A;  3ZHE B;  4HLL A;  4XI9 A;  4PS3 A;  3MX3 A;  3CQC B;  4ILH B;  4DI4 A;  2WQH A;  1OUV A;  3SBS A;  4JEU A;  4HOQ A;  1E90 A;  5BXU A;  2CG2 A;  4O1P A;  4UI9 K;  2P9P G;  3HYM B;  1HU3 A;  1H6P A;  2AJA A;  3BEE A;  4GTT A;  4A55 A;  5FZS A;  5ENR D;  3I3N A;  1MX6 A;  2BED A;  3U66 A;  1N0Q A;  1AP7 A;  2ZXW E;  1SW6 A;  3E34 A;  1OCZ E;  3LY9 A;  5LFA A;  3PRE A;  1NFI E;  4EBA A;  5KBA A;  1IKN D;  3KSL A;  3L6A A;  1BI8 B;  3UKU G;  4U95 D;  3R9M A;  4XKB A;  2KZT B;  2AW6 A;  4KVM A;  3U3W A;  4KVO A;  4GA0 A;  4ILG A;  2HR2 A;  3S7J A;  3L08 A;  3PE3 A;  4KYO B;  2J8S D;  2WM9 A;  4EHM A;  4YDY A;  2J4D A;  4QQI A;  2R03 A;  3ONL A;  3CR3 A;  4TXP A;  1E7V A;  2HO1 A;  3MJW A;  1HG2 A;  1WM5 A;  2GGF A;  3FWV A;  3FTV A;  1S70 B;  4H7X A;  4N3C A;  4N3A A;  4E6H A;  5CBN A;  4CT0 A;  2IOL A;  4U96 D;  5KWD A;  4M7C A;  4JA9 A;  2DYR E;  4GTQ A;  3JUE A;  5T3R A;  1X81 A;  3DBS A;  4LRZ A;  5G05 C;  3MKQ A;  1SZA A;  2IO3 C;  3L54 A;  4BER A;  3Q15 A;  4K5C A;  5CEC B;  1IXV A;  2B0O E;  3FUK A;  4GZ5 A;  1BPO A;  4TXQ A;  2P9N G;  4B94 A;  4DPR A;  2IO2 C;  1QQE A;  2VGX A;  2GRN B;  1WG0 A;  2VTB B;  5FQ4 A;  3PUJ A;  2WXJ A;  4C0M A;  2I2O A;  2XEH A;  1SQM A;  2A4Z A;  1ELR A;  4PH4 B;  1PC2 A;  3EDT B;  3LDZ A;  4EEC A;  1UN8 A;  3CGH A;  3CKB A;  3ZKJ A;  1HS6 A;  3Q78 A;  4Q96 A;  4CYM D;  3L82 A;  1H2V C;  2A5U A;  2H6H A;  2NYJ A;  4URK A;  3E32 A;  3WXX A;  3GZ2 A;  5EX0 A;  3ZYK A;  3Q75 A;  3NOG D;  2KAT A;  4G23 A;  4LSZ E;  1ZB1 A;  4KBQ A;  2JAB A;  3TWS A;  2V4L A;  4G24 A;  3OXF A;  3UTM A;  3UIP C;  1Y6I A;  4N5Q A;  2EIK E;  3BUA A;  4A3V A;  3VTX A;  4G2V A;  3TWU A;  3PE4 A;  3E33 A;  3FH7 A;  2UY1 A;  3DSV A;  4EQF A;  1K1B A;  3DPY A;  3LVQ E;  4A1G A;  1TN8 A;  2KZT A;  3EU9 A;  2ETC A;  5BT1 A;  4I2Z A;  2P9I G;  3ABM E;  2P9U G;  4C0E A;  3UT8 A;  2R5S A;  2OND A;  3CVQ A;  3QKY A;  2WXR A;  2XPI A;  3EIQ C;  3L9T A;  4YDW A;  2P9S G;  5EX3 A;  3V2O A;  3ZYM A;  4LER A;  4BX9 A;  3GZ1 A;  2VSO E;  2BTD A;  5HQ8 A;  4ANU A;  3N71 A;  5BUZ A;  1N11 A;  3AG2 E;  5JMN D;  3CHP A;  1E8X A;  3AS5 A;  3UI2 A;  1TNO A;  2V5Q C;  3CV0 A;  2XGS A;  4FU3 A;  2HE0 A;  4TV3 A;  5FQ8 A;  2AXZ A;  3ISM C;  1RW2 A;  4XZ4 A;  4DK5 A;  2F8Y A;  1TR4 A;  1NZN A;  5D0Q D;  3KEA A;  3PDN A;  1NP7 A;  1KZO A;  2V4H C;  5B1B E;  4KXK B;  3E37 A;  3AS8 A;  5EIL A;  3TG4 A;  2WXH A;  2NSZ A;  4I6J A;  5JJ6 A;  4HNA D;  4Z68 A;  5JJT A;  5EID A;  2OEW A;  3SZ7 A;  2F0Y A;  1A17 A;  5CRU A;  4ABN A;  4J8Y A;  1MHQ A;  3Q79 A;  4LNB A;  2LAH A;  2R02 A;  4K5A B;  5T4Y A;  1N52 A;  2ZIS A;  5CCM A;  1JCS A;  4DX5 D;  3ZRH A;  3RKV A;  1N4Q A;  4YVQ C;  3LKU A;  3JXJ A;  3R9A B;  5C1D A;  2MYO A;  3FTY A;  3PZ4 A;  3B7T A;  3D9H A;  2LAI A;  4I1A A;  4GPK A;  2XS8 A;  1IQR A;  1LD7 A;  2CHZ A;  3NF1 A;  3SFX A;  4N5C A;  2FEZ A;  1QBQ A;  4K5B A;  5FQ6 A;  1IHG A;  4UWK A;  5HI7 A;  1FT1 A;  4J8E A;  2FI7 A;  2WXF A;  2J4B A;  1MX2 A;  1OT8 A;  4G26 A;  1TYQ G;  2KXP C;  3RIB A;  2OVF A;  4GCN A;  5ENQ D;  1B89 A;  3IEG A;  2QC9 A;  4AIF A;  3V31 A;  4JHJ A;  3FP3 A;  2GRM A;  3JCK C;  4I17 A;  2J07 A;  4GA1 A;  3TWR A;  2DYS E;  3CVL A;  3TWX A;  4ACL A;  2NC9 A;  4A3T A;  3HDX A;  5BV1 A;  3KEZ A;  4FP7 A;  2IJG X;  3VTY A;  1K8K G;  4CT4 A;  3TL5 A;  4CRW A;  3PEU B;  5LCW J;  3QAQ A;  4O6F A;  4DJA A;  2XPY A;  3HHM A;  4LNU D;  3FUL A;  4HOT A;  3CHR A;  1H6K A;  5B1A E;  3ZU7 B;  5G2N A;  3Q73 A;  5ENN A;  3UX4 A;  4GZ6 A;  4E85 A;  2IY0 C;  3L16 A;  3FH8 A;  3SD5 A;  4B0Z A;  4AXH A;  3T5X A;  4BWR A;  4EPZ A;  3ZEF A;  1S0P A;  4RVB A;  1N54 A;  3ZYL A;  2Y4T A;  3TWW A;  3TXN A;  1HX8 A;  3AG1 E;  5AJD A;  3L17 A;  5BXO A;  5M72 A;  2VSN A;  3S7B A;  4L23 A;  3CVU A;  3Q7A A;  3KAE A;  2WPV A;  4KZC A;  5G04 J;  5HKP A;  2OCC E;  4D10 C;  3EHN A;  2AVP A;  2VJ8 A;  5JA4 D;  3MYV A;  4MS6 A;  4A63 B;  2XGO A;  1FVF A;  3DRA A;  3FU6 A;  4UQZ A;  1Y8M A;  3PEV B;  5LOZ A;  5H7P A;  4F7A A;  1JWG A;  1H2T C;  1N4P A;  5EYL A;  3RU0 A;  1H2U A;  3FTZ A;  3CK7 A;  4GTM A;  3RJV A;  2GRP B;  1Z3X A;  4LEU A;  3AU4 A;  5FIN A;  4HI9 A;  5FJY A;  4BTA A;  2WXN A;  4WAF A;  2ION A;  1S63 A;  4FC8 A;  5T8I A;  2H6G A;  3ESK A;  3S7D A;  3DEP A;  4JHK A;  2OV8 A;  4JVS A;  2R05 A;  4J6I A;  3CSF A;  2Y3A A;  3HXC A;  4XKC A;  5EKQ D;  3O48 A;  3IXE A;  3JYS A;  1UOH A;  4F3V A;  1JCR A;  5FZQ A;  4DLQ A;  2HM8 A;  4G8L A;  4U0U A;  4P29 A;  3U9W A;  3D9O A;  2KBX A;  2I9C A;  2Y1L E;  2RG8 A;  3CQG B;  2F8X K;  3NOC D;  5D2M C;  3QDN A;  3QWP A;  2Y69 E;  4DX7 D;  3V2X A;  4LUN U;  3ABK E;  1MQS A;  2VQ2 A;  1YMP A;  4GAA A;  4WNG A;  4HLE A;  3FDH A;  4U7E B;  2L6B A;  3EHR A;  5ENO D;  3PZD A;  4KMO A;  3DWL G;  3G2U A;  5E75 A;  3BU8 A;  3TWT A;  3UIO C;  4YDE A;  3AG3 E;  3SQV A;  4N39 A;  3DSX A;  4AV7 A;  3APD A;  3B7B A;  4Q69 A;  4JW1 A;  1FT2 A;  4HI8 A;  4AVX A;  1H6O A;  5ANR A;  1LF8 A;  3PUK A;  5G55 A;  2LSU A;  2EIN E;  3TWV A;  4N2S A;  2WMN A;  1UG3 A;  4ILI A;  1N95 A;  2X6K A;  4R7L A;  4PDX A;  5ARF A;  5AQB A;  4XE0 A;  1RZ4 A;  3K9I A;  3UKR G;  3ESL A;  4X8Q A;  2WXQ A;  1OXJ A;  3JUI A;  1WDY A;  2X38 A;  4WNF A;  4BT8 A;  3VLF A;  3FH5 A;  1VDY A;  5CRV A;  2WXP A;  4B8C B;  3AU5 A;  4DX1 A;  4RQI A;  2P9L G;  5C2Y A;  3JQ0 A;  4AEZ C;  3CK9 A;  3ZHE A;  2J09 A;  3NQP A;  4U8Y D;  3FUH A;  3QWV A;  4UWH A;  1XNF A;  4J8S A;  5D0O D;  3ZXP A;  2C0L A;  5EIB E;  4BSX A;  4BY6 A;  4F1S A;  2ETA A;  4IUL A;  1SVX A;  2J9Q A;  2H6I A;  3TG5 A;  2XHE A;  4FJZ A;  4C48 B;  2KCV A;  5CEA A;  5BV0 A;  4CEM A;  2VYI A;  1D9S A;  4GPM A;  2C2L A;  5BPP A;  3EJN A;  5FTP A;  3FUM A;  3E4B A;  4JC8 A;  3NZS A;  4GYO A;  3EU5 A;  1OCO E;  3B7S A;  4CGW A;  2CFU A;  1DCQ A;  3S2A A;  4OYS A;  2QZA A;  1E7U A;  3VLD A;  4NQ0 A;  2X6H A;  3NZU A;  4DUI A;  3L13 A;  4LCT A;  3RO2 A;  3HXB A;  2E2E A;  3OTN A;  3DXM G;  3SBT B;  2KM4 A;  3QC1 A;  4NUR A;  2WXL A;  4GMR A;  3B13 A;  3RSE G;  3UM3 A;  3AS4 A;  3UQ3 A;  4NAC A;  3Q47 B;  3FEX A;  3ASN E;  3CHQ A;  3DEO A;  1MJ0 A;  4HOS A;  3JQ1 A;  4UI9 J;  5CBO A; 
#chains in the Genus database with same CATH homology
 3ZPJ A;  4GA2 A;  4PUC A;  5A6C A;  2KC7 A;  2V0P A;  2LAI A;  4I1A A;  4GPK A;  1IQR A;  2GW1 A;  2CHZ A;  2WQ7 A;  3IBE A;  3NF1 A;  4GMJ A;  4ANW A;  3Q4A B;  3CVX A;  1DVP A;  5CHE E;  4N5C A;  2YHC A;  2FEZ A;  4CDN A;  1HG5 A;  3CVW A;  1IYG A;  5FQ6 A;  5ANL A;  1IHG A;  3FHE A;  4UWK A;  1UJK A;  2EQX A;  5HI7 A;  4I1M A;  1OWO A;  2CG3 A;  4KZ0 A;  5J90 A;  3LXU X;  4B89 A;  4J8E A;  2FI7 A;  4I6E A;  3RK6 A;  3PVL A;  1P5Q A;  2V5F A;  2WXF A;  2XQ0 A;  2J4B A;  5KJM A;  1TJC A;  4U04 A;  4G26 A;  1YA0 A;  2FO7 A;  3ML8 A;  3RIB A;  2RD0 A;  4CDM A;  4G11 A;  4PS8 A;  5G04 C;  2OVF A;  1E8W A;  5FT9 A;  4UWF A;  3PRZ A;  4GCN A;  3CST A;  5CMY A;  1B89 A;  3IEG A;  1KLX A;  3IV0 A;  4AIF A;  4WWN A;  3G2W A;  3D9I A;  3FP3 A;  3ONK A;  4JHJ A;  2GRM A;  3JCK C;  4I17 A;  4JA7 A;  1W3B A;  5DIZ A;  4K03 A;  3ZIM A;  2J07 A;  2X6J A;  2C0M A;  3FU5 A;  4GA1 A;  3HIZ A;  4AY6 A;  2DBA A;  3OXL A;  4NRH B;  2PL2 A;  3ENE A;  3CVL A;  4WNE A;  4CCA A;  2ZU6 B;  3O4Z A;  3ZHE B;  2DIW A;  2NC9 A;  4ACL A;  5FZR A;  4A3T A;  3HDX A;  5BV1 A;  4XI9 A;  5JHA A;  3FTS A;  3QOU A;  4JXT A;  4MKT A;  2V8S E;  3U4T A;  3MV2 B;  5CMW A;  4U8H A;  4PS3 A;  2XGM A;  4JPS A;  2YHE A;  3MX3 A;  3CQC B;  3KEZ A;  2L6J A;  4Y6C A;  4FP7 A;  2IJG X;  4ILH B;  3GYZ A;  3VTY A;  4J8D A;  2WQH A;  4B8A A;  1OUV A;  1HE8 A;  3SBS A;  3TL5 A;  3LEW A;  3PEU B;  4CRW A;  4CT4 A;  5LCW J;  1HH8 A;  4JEU A;  4AOF A;  2IF4 A;  3QAQ A;  4O6F A;  4HOQ A;  1E90 A;  2WXK A;  2VGY A;  3B7U X;  3I4G A;  4GYW A;  4ANX A;  4CDR A;  5LP0 A;  2CG2 A;  4DJA A;  2XPY A;  3HHM A;  4UI9 K;  1DNP A;  3APC A;  3FUL A;  3MKR A;  3GW4 A;  4Q94 A;  3HYM B;  3SGH A;  1HU3 A;  4HOT A;  3B7R L;  3CHR A;  1H6K A;  1QNF A;  3BEE A;  5G2N A;  3ZYQ A;  4A55 A;  1INZ A;  5ENN A;  4BFR A;  3UX4 A;  5FZS A;  4GZ6 A;  3MZL B;  3R7Q A;  3D9P A;  1GW6 A;  3I3N A;  1HZ4 A;  4AJW A;  4E85 A;  3U66 A;  3L16 A;  3FH8 A;  3SD5 A;  4N2Q A;  4RSY A;  1JWF A;  1NA0 A;  4GCO A;  4B0Z A;  4AXH A;  3LY9 A;  3CLJ A;  3I5P A;  5LFA A;  2PQN A;  3D9J A;  3T5X A;  3L22 A;  4BWR A;  3PRE A;  4EPZ A;  4EBA A;  3ZEF A;  1S0P A;  4DI3 A;  3CHO A;  4ATG A;  4EZJ A;  3OAW A;  4RVB A;  4G1T A;  5KJK A;  1N54 A;  3ZYL A;  2Y4T A;  3L6A A;  4AM9 A;  3G2V A;  3TXN A;  2CHX A;  4M3O A;  1HX8 A;  3FU3 A;  4ANV A;  4XKB A;  2KZT B;  5AJD A;  3L17 A;  2AW6 A;  5M72 A;  4KVM A;  3U3W A;  2YIN A;  2YNQ A;  4UQY A;  4KVO A;  4RG9 A;  2J49 A;  2VSN A;  4GA0 A;  3S7B A;  4L23 A;  4ILG A;  3CVU A;  2HR2 A;  3KAE A;  2WPV A;  2E0I A;  4GZD A;  4KZC A;  3S7J A;  3L08 A;  3PE3 A;  3D9L A;  4KYO B;  5G04 J;  4PS7 A;  3SFZ A;  4HXI A;  3QJZ A;  3UPV A;  2WM9 A;  4D10 C;  4BX8 A;  3EHN A;  3ASF A;  2AVP A;  2J4D A;  1NA3 A;  2VJ8 A;  3MYV A;  4MS6 A;  2XGO A;  2OOE A;  4WWO A;  2UY1 B;  1FVF A;  1HF8 A;  3FU6 A;  3ONL A;  4UQZ A;  1Y8M A;  1UW4 B;  3CR3 A;  3P2B A;  3PEV B;  1E7V A;  2IU1 A;  2WXM A;  2HO1 A;  2WXO A;  3MJW A;  4JZY A;  3T8M A;  1HG2 A;  2X6F A;  4J8F A;  1OWM A;  5LOZ A;  4UQX A;  4F7A A;  1WM5 A;  1JWG A;  1H2T C;  2GGF A;  3FWV A;  3FTV A;  3KD7 A;  4U0Z A;  4H7X A;  1OWP A;  3ASD A;  5KCM A;  4N3C A;  3UUX A;  3ZXS A;  3RU0 A;  1H2U A;  4JEH A;  1E8Z A;  1H19 A;  2IQC A;  4K0R A;  3FTZ A;  3CK7 A;  4N3A A;  4V3I A;  5G05 J;  5ARG A;  4E6H A;  3CHM A;  5E76 A;  4CT0 A;  2IOL A;  4KT6 B;  3CHS A;  2LO6 A;  2WXG A;  3ASG A;  2X6I A;  1Z3X A;  2GRL A;  3RJV A;  3IKO B;  4LEU A;  3AU4 A;  4JA9 A;  1UJJ A;  4GB9 A;  3HVE A;  5T3R A;  3DBS A;  4L2Y A;  4LRZ A;  4FHK A;  5FJY A;  3RRU A;  4BTA A;  2WXN A;  5G05 C;  2XEV A;  4WAF A;  3CVP A;  5BNW A;  3MKQ A;  2ION A;  4FC8 A;  5T8I A;  1SZA A;  4UWL A;  4WWP A;  3ZFW A;  1UN9 A;  3L54 A;  5J08 A;  2QY7 A;  3ESK A;  2PZI A;  3FUD A;  4GZ3 A;  3S7D A;  3Q15 A;  2FBN A;  4JHK A;  2OV8 A;  4JVS A;  2CFZ A;  2WMO A;  3FEY A;  1Z6T A;  4ACK A;  4J6I A;  3CSF A;  2Y3A A;  4WND A;  4XKC A;  4FHJ A;  5EKQ D;  3FUK A;  3O48 A;  4GZ5 A;  1BPO A;  1OWL A;  3FU0 A;  4I6G A;  3JYS A;  4GU5 A;  3TJP A;  1FCH A;  3Q49 B;  2PM6 A;  4B94 A;  4DPR A;  4F3V A;  2PQR A;  3LPZ A;  3U64 A;  5FZQ A;  3VLE A;  4DLQ A;  4EBA G;  3FUN A;  3QK0 A;  2HM8 A;  3DPD A;  3PH0 C;  3I4R B;  3G2S A;  4P29 A;  4U0U A;  3U9W A;  3D9O A;  3CVY A;  1QQE A;  2VGX A;  3EHM A;  3FTU A;  2I9C A;  2VTB B;  2RG8 A;  3CQG B;  5FQ4 A;  3PUJ A;  3SHF A;  1KT1 A;  2WXJ A;  4IN3 B;  4C0M A;  1HO8 A;  1WY6 A;  2HYZ A;  2AWI A;  2I1K A;  4YVO A;  1IQU A;  3QDN A;  2I2O A;  2XCC A;  3FUE A;  4U0S A;  4BTB A;  3QWP A;  3CK8 A;  3UMV A;  1SQM A;  2A4Z A;  1ELR A;  4PH4 B;  1PC2 A;  3EDT B;  5DBK A;  3LDZ A;  2XCB A;  3FFL A;  4QFV A;  5JHB A;  4LUN U;  3ML9 A;  3RRM B;  2VSX E;  3ZGQ A;  4EEC A;  1UN8 A;  1MQS A;  2VQ2 A;  3CGH A;  3LJ3 A;  4WNG A;  4GAA A;  5AJL A;  3GZS A;  2AXV A;  2MRI A;  3CKB A;  4HLE A;  3CVN A;  3RO3 A;  3PS6 A;  1TJF A;  4A1S A;  3FDH A;  4XI0 A;  3G2T A;  1HS6 A;  4APO A;  5AEN A;  4L2L A;  4Q96 A;  2KCK A;  2I6H A;  4FLH A;  2P58 C;  4FJY A;  5LCW C;  2WXI A;  3CVV A;  1H2V C;  3MV3 B;  1WAO 1;  3PZD A;  4KMO A;  3TXM A;  2A5U A;  4TUU A;  4DLO A;  4OVU A;  3G2U A;  5FWQ A;  4URK A;  4I9C A;  4UI9 C;  5KJN A;  3WXX A;  5KJL A;  5E75 A;  3GZ2 A;  4W9R A;  5EX0 A;  3ZYK A;  2MHK A;  2VTB A;  4EZK A;  5A23 A;  2WVI A;  1ELW A;  2BUG A;  4N39 A;  4C9B B;  2KAT A;  4DI4 A;  4G23 A;  4IRU A;  3UT4 A;  4AV7 A;  3D9N A;  3APD A;  3D3M A;  4Q69 A;  4ME2 A;  5JJ7 A;  4AP2 A;  3IHY A;  4JW1 A;  4KBQ A;  3BG1 B;  2PM7 A;  2V4L A;  1Z3Y A;  3OXF A;  4G25 A;  4G24 A;  1Y6I A;  4MLP A;  4AVX A;  5ANR A;  1LF8 A;  3PUK A;  1TEZ A;  4U07 A;  3LCA A;  5G55 A;  4U63 A;  4A3V A;  3LY8 A;  3KS2 A;  4N3B A;  2LSU A;  4H7Y A;  3FTX A;  3VTX A;  3ASH A;  4I2W A;  2R17 C;  4N2S A;  4G2V A;  4FA6 A;  2WMN A;  3PE4 A;  1QZ2 A;  3QB2 A;  1FVH A;  1UG3 A;  3FH7 A;  4ILI A;  2FF4 A;  3IHV A;  3QWW A;  2AXU A;  2BF0 X;  3D9K A;  2UY1 A;  3LS8 A;  3URZ A;  2WB2 A;  2X6K A;  3MKQ B;  4R7L A;  1PY1 A;  4XIF A;  4PDX A;  4EQF A;  5ARF A;  1E96 B;  3S7F A;  3LVQ E;  3T5V A;  1EPU A;  4XE0 A;  4A1G A;  1KT0 A;  3EIJ A;  3K9I A;  4L1B A;  3BG0 B;  2XRY A;  3ESL A;  2WXQ A;  3PNL B;  3JUI A;  3TGO A;  2KZT A;  2X38 A;  4WNF A;  4BT8 A;  1ZU2 A;  3VLF A;  2IFU A;  4GML A;  5BT1 A;  3FH5 A;  4I43 A;  2FUL A;  3MCX A;  3CIA A;  1VDY A;  4HOR A;  2CHW A;  4I2Z A;  3C98 A;  1U3C A;  3CKC A;  4C0E A;  3UT8 A;  2R5S A;  1HXI A;  2OND A;  3CVQ A;  4XX5 A;  2XRZ A;  2WXP A;  3QKY A;  2WXR A;  2XPI A;  3EIQ C;  3QAR A;  4FUL A;  3AU5 A;  5FQ7 A;  3UT7 A;  4B8C B;  2JEK A;  2IOS A;  3LVR E;  4EZL A;  5EX3 A;  3APF A;  3P1U A;  3JQ0 A;  5C2Y A;  3ZYM A;  4LER A;  3LY7 A;  4AEZ C;  1L5J A;  1PAQ A;  1SZ9 A;  3CK9 A;  5LX8 A;  3ZHE A;  2J09 A;  3NQP A;  5A7D B;  4BX9 A;  2L0I A;  3FUF A;  3GZ1 A;  4AY5 A;  3D9M A;  2JLB A;  2VSO E;  3SNX A;  2BTD A;  5BW8 C;  4UWG A;  5HQ8 A;  3FUH A;  3HVE B;  3QWV A;  1XNF A;  4J8S A;  4UWH A;  3MEK A;  3N71 A;  5D0O D;  4ANU A;  5BUZ A;  4Y6W A;  2C0L A;  2ILR A;  4BY6 A;  4BSX A;  1E8Y A;  1EDU A;  4F1S A;  5AIJ A;  4GZC A;  3CHP A;  4HOU A;  2DCP A;  3SI5 A;  5CCL A;  4IUL A;  2M63 A;  3FTW A;  2J9Q A;  3TG5 A;  2XHE A;  4FJZ A;  1E8X A;  3AS5 A;  3ULQ A;  2KCV A;  3CV0 A;  2XGS A;  5BV0 A;  1HFA A;  3MA5 A;  4CEM A;  4FU3 A;  2VGX B;  4HFG A;  2VYI A;  1U3D A;  4TV3 A;  5FQ8 A;  2AXZ A;  4F53 A;  3SF4 A;  2UWJ G;  2MOW A;  1EYH A;  3QNK A;  4CGV A;  4XZ4 A;  4J0U A;  3TAX A;  2J08 A;  2C2L A;  1JUQ A;  4APF A;  4DK5 A;  5BPP A;  3EJN A;  1NZN A;  3PDN A;  4I9E A;  3FUI A;  1NP7 A;  2Q7F A;  3FUM A;  5D0Q D;  5FTP A;  3E4B A;  4KXK B;  4JC8 A;  2L9B A;  4HS2 A;  3AS8 A;  4JHR A;  3NZS A;  3ZN3 A;  3TG4 A;  2WXH A;  2NSZ A;  4GYO A;  4I6J A;  1ELK A;  2I1J A;  1H0A A;  5AYW D;  3ZVV A;  2WQ6 A;  3PNT B;  2LNI A;  5EDS A;  3B7S A;  5JJ6 A;  4YND A;  4CGW A;  4FAD A;  2CFU A;  2OVB A;  1JPL A;  3FUJ A;  3S2A A;  2R59 A;  5JJT A;  4OYS A;  2NXP A;  2Y4U A;  2VSY A;  1E7U A;  4OVV A;  3VLD A;  4NQ0 A;  3SZ7 A;  2X6H A;  4RG6 A;  3NZU A;  1A17 A;  3OXG A;  4BT9 A;  4I1O B;  4HVB A;  4L7T A;  3ZW3 A;  3L13 A;  1ZBP A;  4ABN A;  1MHQ A;  2YQ8 A;  3FY4 A;  2L0T B;  4IYP A;  4LCT A;  3RO2 A;  2X3M A;  4FLB A;  2LAH A;  5T4Y A;  2E2E A;  1N52 A;  3OTN A;  5CCM A;  3LYA A;  3SBT B;  3MGB A;  2KM4 A;  3ZRH A;  3QC1 A;  4NUR A;  4TRQ A;  2WXL A;  3RKV A;  4JL0 A;  3B13 A;  1XGW A;  1EF1 C;  1OWN A;  3CEQ A;  3AS4 A;  2XPZ A;  3UQ3 A;  3R7R A;  4YVQ C;  3LKU A;  4NAC A;  4GYY A;  2LSV A;  3Q47 B;  3FEX A;  3R9A B;  3Q5M A;  1X5B A;  3CHQ A;  5C1D A;  3FTY A;  3RRN B;  2KCL A;  4WUY A;  2QFC A;  4HOS A;  3JQ1 A;  3B7T A;  4UI9 J;  4MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...