1S0PA

Structure of the n-terminal domain of the adenylyl cyclase-associated protein (cap) from dictyostelium discoideum.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
176
Chain Sequence
b'SVKEFQNLVDQHITPFVALSKKLAPEVGNQVEQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPHVAEMRGSAEFYTNRILKEFKGVNQDQVDWVSNYVNFLKDLEKYIKQYHTTGLTWNPKGGDAKSAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl cyclase-associated protein
publication title STRUCTURE OF THE N-TERMINAL DOMAIN OF THE ADENYLYL CYCLASE-ASSOCIATED PROTEIN (CAP) FROM DICTYOSTELIUM DISCOIDEUM
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Membrane protein
total genus 66
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.330 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1s0pA01
1S0PA 1TJFA
chains in the Genus database with same CATH superfamily
1INZA 3UT8A 1O1RA 4TRQA 4BFRA 1UW4B 2L9BA 3CVNA 3G2SA 4K03A 3BG1B 3FUIA 3ULQA 4BETA 3FUDA 2WXMA 3APFA 1HS6A 3NZSA 5HI7A 4BSZB 4DUIA 4AIFA 5ENPD 3QC1A 2DZOA 1V54E 3D9JA 4I6EA 4XX5A 4UQYA 3CHPA 3LY9A 3NBNB 2ZIRA 4EZKA 2Y69E 4BY6A 1BLXB 4AEZC 1OCZE 1FPPA 2KCLA 4TUMA 1YA0A 5EX3A 4DLOA 3RKVA 3UM3A 1SQMA 1HU3A 1XNFA 2ZGGA 2YINA 4B94A 3C72A 2DIWA 4YDYA 3L16A 2X38A 2L6JA 2HE0A 4FU3A 3GW4A 3CHSA 1UN8A 2P58C 3BU8A 3CVYA 4GTTA 3TXMA 5CBNA 2AXZA 3JQ0A 5AQ9A 3FHEA 1JWFA 4L2LA 1BD8A 3V79K 3TWTA 4KZCA 3N71A 4B93B 4WNFA 3MV2B 3TWRA 3L54A 5AYWD 2LAHA 5EKQD 5D0OD 3E4BA 1KZOA 2WXOA 3DXKG 4L2YA 3MKQB 3QDNA 4YVOA 4FHJA 4AXHA 3CHOA 3V2XA 5KWDA 2QY7A 4JD2G 4HB5A 2WQ7A 1TNZA 4GPKA 2H6IA 2C0MA 4DX7D 4QFVA 3LS8A 5EDSA 5LX8A 4V3IA 3E30A 1QQEA 2R05A 2OCCE 2QC9A 2P9PG 5KNHD 4CZ2D 2YHCA 2EINE 1MQSA 2DYSE 5FQ8A 4U0SA 5KNGA 5FIOA 4CRWA 5JJTA 4O60A 1WG0A 4IULA 4NQ0A 1SW6A 3CSFA 1TN8A 2NC9A 2HO1A 3PZ2A 2IEJA 2KC7A 4G8KA 3T8MA 4UI9C 3SHFA 3T5XA 3VLDA 2J08A 2WXLA 3C3OA 3QWPA 3LJ3A 2KATA 1E8WA 4UQZA 4JA9A 1QYMA 5LCWC 2IONA 3L17A 1L5JA 2J49A 5ANLA 2WMNA 3RO2A 3B7TA 3NOCD 2VGEA 2R2LA 4HLLA 4PH4B 2BKGA 2XQ0A 1EPUA 3QB2A 1U3CA 3O48A 2R03A 1U2VG 1EYHA 1OWNA 1BI8B 3ZW3A 2MYOA 2J07A 2P9IG 2WB2A 3UINC 1OUVA 1MX4A 4HXIA 3R9AB 3FU5A 2XS1A 4G26A 3HIZA 3DSUA 3FTUA 1K1AA 2PM6A 2EIKE 3U64A 2OEWA 4KT6B 2XENA 2XEVA 4K5CA 3DWLG 3L9TA 2VTBB 1Z6TA 3R7RA 4C0EA 3SFZA 3HXBA 1K8KG 1HO8A 1ZB1A 1OWPA 3B7BA 1H6OA 3AG3E 4B0ZA 1OWLA 4ANUA 4G2VA 3QKYA 1MX2A 4DRXE 3Q15A 3ZPJA 3MEKA 3DPDA 4I9CA 4GA1A 1AWCB 3Q47B 2E0IA 5EYPF 3ASOE 1OCCE 1HE8A 4I6GA 3FUMA 3CKCA 4ATGA 3KAEA 2X6KA 3FFLA 5KJLA 4EQFA 2NSZA 2GRMA 4U95D 4HOQA 1A17A 3B7RL 4GB9A 4E85A 3FU0A 3VTXA 2MHKA 4OAVB 2A5EA 5IY5E 3Q79A 3SZ7A 4MLPA 3KS2A 1N0RA 4ANWA 1YMPA 3ISMC 3SO8A 3U3WA 4I1AA 4J6IA 4F7AA 3SI5A 5CBOA 2RFMA 2ETCA 3UM1A 4RLYA 5KJMA 4CCAA 1WAO1 2H6FA 4ZFHA 1N4PA 2XCCA 4GYWA 4AV7A 5AN8A 2KZTA 3JYSA 3HXFA 3HXEA 3Q49B 1JCSA 2CHWA 4XI9A 2L0IA 2J09A 3TJPA 3T5VA 3LCAA 4HRNA 3CVUA 4HFGA 5JJ6A 4XZ4A 4BEPA 4GTVA 2LXMA 2UWJG 4UI9J 5G04C 2F0YA 1H0AA 3E37A 5FT9A 1N95A 4GZCA 3TWSA 3AJIA 3G2TA 3D3MA 1VDYA 4RSYA 4UWFA 3ZXPA 5G2NA 5LCWJ 1ZU2A 4WWOA 5ENRD 3FUKA 4HOUA 4ZHBA 1N4RA 1LTXA 1UN9A 4F1SA 3NF1A 2XPYA 4C0MA 4GZDA 2IU1A 1KLXA 3OXLA 4YVQC 3DSWA 3V2OA 3DBSA 1N94A 3G2VA 2XEHA 2CHZA 3ZVVA 4U96D 1MYOA 4HI8A 5FQ4A 5EX0A 4YDOA 3CK9A 3FULA 2WXNA 2EILE 4XIFA 2WXJA 3CLJA 4UQXA 1TN7A 1H2UA 4IRUA 3RSEG 5EIBE 1TNYA 2EIJE 1HG5A 3F6QA 4FULA 4RG9A 3Q7AA 1V55E 4DPRA 2QFCA 3FH7A 4BWRA 3PVLA 2XHEA 3APDA 2X3MA 2XPZA 2RKKA 3Q73A 4CEMA 3ABKE 2CHXA 3FEYA 5ENTD 2KXPC 3TWWA 3CHQA 2XPIA 3FTWA 3ONLA 5DBKA 2Y3AA 4MBGA 3UM2A 1JUQA 2X6HA 2VGYA 3FH8A 3UIPC 3E34A 3OTNA 4DX2A 1HX8A 1H6PA 5D2MC 2P9UG 5CHEE 3FWVA 1O5MA 2QYJA 4M7CA 2PM7A 4KVMA 2XRZA 3ABME 3PRZA 3CGHA 4QQIA 4RQIA 3ASNE 1ZBPA 4LRZA 3UKUG 3L08A 4GMRA 1ELRA 1TJCA 2FBNA 5DIZA 1HH8A 3PZ4A 3CSTA 5KJNA 4GZ3A 1ELWA 4JVSA 1IKND 3LDZA 4I1OB 5HRYA 1E8XA 3PEUB 5BV1A 2AXVA 2J4BA 1UJKA 2M63A 4N3AA 3IEGA 3UXGA 4OVVA 4P29A 4U63A 3IXEA 3FUNA 3SFXA 3FU3A 4LERA 1HF8A 3DEOA 3PNTB 4N2QA 2WXIA 3Q9NC 3FP3A 4AP2A 3TG5A 4WNDA 3D9KA 4I17A 3NOGD 4N3BA 4EBAA 2CG3A 3MCXA 3LXUX 5G04J 1N4QA 4R7LA 4B8AA 3AS5A 4OVUA 3R9MA 4TXQA 2WXHA 3ZIMA 4UWHA 3V31A 2GW1A 4LSZE 4JHRA 3UKRG 5BUZA 3UT4A 4LNBA 3AU4A 1HXIA 4G24A 3Q4AB 5JMND 1LF8A 3CV0A 3BEEA 2UY1B 5AQAA 3CHMA 2DVWA 2V4HC 3QJZA 2FF4A 4Q94A 1OT8A 4EECA 3L22A 2OVBA 5J90A 4KMOA 3ZNGA 3ZEFA 3MKQA 4NACA 4A3VA 2F8YA 5HS0A 1SA5A 1K3ZD 3PDNA 2ZGDA 1KT0A 5BT1A 1E96B 3UIOC 1N4SA 5AQBA 4HNAD 5ARFA 4FJYA 5BNWA 1DCEA 2AWIA 3QAQA 4UWLA 5AIJA 4GTOA 2XGMA 2NYJA 3ZHEA 4E6HA 3LEWA 4GCNA 3C3RA 3LKUA 1S64A 4HS2A 3PE4A 3Q9UC 3U9WA 1ELKA 3Q5MA 3SBTB 3B7UX 3UQ3A 4GTRA 1N0QA 1TN6A 4GYOA 4PS7A 1YCSB 3ZFWA 4LEUA 4GTQA 4XEIG 5ANRA 3CKBA 3ZYLA 3PREA 5FJYA 3EIJA 3IHYA 1QNFA 1E8ZA 3ESKA 5CRUA 3T8KA 3CVXA 2RFAA 1H19A 3AAAC 2IO3C 2IJGX 1OWMA 2OV8A 5BPPA 2GGFA 4BX8A 3D9MA 3SD5A 4EPZA 5A23A 4UUCA 4HORA 3MYVA 4A63B 3I4RB 1FT1A 4BESA 5ITZF 5JHAA 4HLEA 3GYZA 4H7YA 5CERB 3UTMA 3PZ1A 3TGOA 3PS6A 3ZN3A 4KYOB 4PDXA 1OY3D 4DX5D 3C98A 5KJKA 3FEXA 4DX1A 3UMVA 3DEPA 3QNKA 2P9LG 2MOWA 2VGXB 3TWUA 3TAXA 2QYUA 1TEZA 4FLBA 1IYGA 2CFUA 4Z68A 3AG4E 3EHQA 2PL2A 4UI9K 1DVPA 2AXUA 1QBQA 4HOTA 3IV0A 4Q96A 3MKRA 3KEAA 1RW2A 3IHVA 1E7VA 2Y4UA 3SY2A 3EHNA 2VTBA 2BEDA 5KBAA 2FEZA 4AVXA 4ACKA 5CMYA 4NURA 2R59A 3I3NA 3X2QE 4U8VD 4TV3A 2I1KA 5KCMA 4DI3A 4CGWA 5CEDB 3U66A 4NIKA 1MX6A 3DSSA 3NAWA 4DI4A 2WMOA 1RZ4A 3PEVB 4I6JA 2WQ6A 2WXQA 2X6IA 4CT0A 2IOLA 1NP7A 3ML8A 2I2OA 1Z5SC 2DCPA 2C2LA 3S7DA 4MS6A 4F6RD 4I43A 3W9GA 3ESLA 3D9LA 5FZRA 5CECB 1NFIE 4BSXA 5BXUA 3UX4A 4CGVA 3O4ZA 3UT7A 5EYLA 4WNEA 2L0TB 4PUCA 5C2YA 3ASGA 4CT4A 4BT8A 3UUXA 3PZDA 1NL4A 2WQHA 2EIME 2WXRA 3RIBA 3CVVA 1JCRA 1UJJA 2QZAA 4U8YD 3QOUA 5G05C 2V8SE 3JXIA 5T8IA 4FP7A 3CQCB 2GRQB 2OEVA 5FINA 2P9KG 2LNIA 1PY1A 1MHQA 4GAAA 3NQPA 3KD7A 1U3DA 3Q75A 3ENEA 4J8EA 2LSUA 3CVWA 1O1TA 3ONKA 5FTPA 3CVPA 3HYMB 4ILIA 5LOZA 4U7EB 2DBAA 2IO2C 1NZNA 3FTSA 5M72A 3DXMG 4ILHB 3RO3A 1WDYA 2WXFA 4EZLA 1FVHA 2IQCA 4XE0A 3AG2E 3SFYA 2XZDG 3ZUVB 4J8FA 1IQUA 1D8EA 4GYYA 4ABNA 3B95A 1OCOE 4N3CA 4LNUD 4G23A 4M3OA 4G11A 5AJLA 1EF1C 4HRMB 3GZ2A 5D66A 3FUJA 3SBSA 3Q78A 4OYSA 1TYQG 2WXKA 3E33A 1GW6A 2Y1LE 3RRNB 5FZSA 2JABA 3LJNA 4J7WA 5EILA 4Q69A 4XI0A 1YYHA 4J8SA 3EU5A 1O1SA 4YDEA 1N54A 1JCQA 2VYIA 2H6GA 3G2UA 4C48B 3PNLB 4G25A 3BUAA 4GA0A 5ENOD 4L9PA 3KEZA 2VSYA 2GRLA 3EUVA 2PNNA 4PS3A 3D9HA 4HBDA 4JPSA 3ASFA 3JUEA 2XGOA 2L6BA 2PZIA 1DCQA 3B7SA 4B8CB 3HG0D 3P1UA 4ILGA 2ETBA 2AW6A 5JJ7A 1S0PA 4GZ5A 3TWVA 3CR3A 1B89A 5LFAA 4YNDA 3V30A 4HOSA 3RJVA 4XKBA 4AY5A 3QK0A 3FTZA 4O1OA 3KSLA 3T9KA 2XZTG 2F37A 1P5QA 4UWKA 3PUJA 2IY0C 1X81A 3TWQA 3FUEA 1TR4A 2ONDA 3ZRHA 3D9NA 4WWNA 4LNGA 1TNOA 1MJ0A 2LXLA 4TXPA 2VQ2A 3BQOA 4IN3B 2WXGA 2P9NG 2X6JA 1S70B 2VJ8A 3HVEA 4A1GA 2P2CP 5AQ7A 5T4YA 2FO1E 5G05J 4F3VA 1FVFA 1H6KA 5FWQA 4N39A 4Y6CA 1WM5A 1IXVA 5B1BE 2OOEA 3ULEG 5E75A 2V5QC 4ATZD 3S7BA 2E2EA 5A7DB 3ULYA 1BPOA 2YQ8A 4WAFA 1IHGA 4ANXA 4G1TA 1MZCA 3AG1E 2A5UA 4JEUA 3PE3A 1KPSB 4BT9A 5CCMA 5JHBA 3CQGB 4L7TA 3DSXA 3AS4A 4KBQA 3D9IA 3FTVA 3OXGA 3EU9A 2Y0BG 4EZJA 4L23A 3GZ1A 2H6HA 2RD0A 1OCRE 4JXTA 2NXPA 1SZ9A 1DC2A 3S7JA 2KCKA 3I5PA 2DZNA 3CVLA 5HQ8A 2LUHA 3AU5A 2DYRE 2UY1A 3FDHA 4ACLA 3ZYMA 5BXOA 3S2AA 2AJAA 3MX3A 4TXRA 4U8HA 2BF0X 4FA6A 3ZXSA 3D9OA 5C1DA 3HDXA 4ANVA 4I9EA 3DPYA 1TNUA 1FCHA 4KXKB 2BKKB 5B3SE 4GMJA 4L1BA 4A1SA 1UG3A 4JHJA 3ZKJA 4YDWA 3J5PA 1Y6IA 1NA3A 5EN5D 2PQNA 2YHEA 2FI7A 3VTYA 4A55A 3TG4A 4U0UA 4HVBA 3SF4A 5AENA 3CVQA 4A3TA 2R17C 2WM9A 2JLBA 2KCVA 4GPMA 2GROB 1E8YA 2BUGA 3ZHEB 4BERA 2J9QA 1H2VC 4I2WA 1N9AA 3BG0B 3EDTB 4LG6A 3S7FA 1WY6A 3J5QB 3RU0A 3JXJA 3ZYKA 2P9SG 3TL5A 1HG2A 3ZU7B 4BTBA 3QWWA 4WUYA 4W9RA 1E7UA 3SGHA 5CCLA 4XKCA 2J8SD 1OXJA 3E32A 2JEKA 1TJFA 4F53A 2R5SA 3PH0C 2J4DA 2I9CA 3EHRA 1LD7A 2WVIA 3URZA 5FZQA 4H7XA 2LSVA 4CDMA 2CFZA 2F8XK 3L6AA 2XRYA 1PC2A 4CDNA 5FQ6A 2ZISA 3CK7A 2VSOE 4J0UA 4JEHA 2AVPA 3KSQA 4AY6A 3IBEA 2VGXA 4NRHB 5EIDA 1A5EA 1BI7B 4EHMA 1N11A 3CK8A 4KVOA 1BU9A 3LYAA 2ZXWE 1H2TC 3P2BA 3WG7E 5ENNA 1JWGA 1EDUA 1D8DA 2V5FA 1Z3YA 1IHBA 2BTDA 4UWGA 1Q2ZA 3JUIA 1S63A 4AOFA 5FQ7A 3RRMB 2CG2A 2C0LA 3W9FA 5AJDA 4RG6A 1SA4A 4J8DA 4AJWA 3LPZA 2A4ZA 3GZSA 4N2SA 3MZLB 4FC8A 4U07A 3RK6A 4APOA 2YNQA 2I1JA 3UM0A 4RVBA 3ML9A 4K5AB 2XGSA 4GU5A 4JC8A 3CHRA 4LUNU 5ENSD 3ZGQA 4O6FA 3PUKA 3HRAA 2WXPA 4K0RA 4DK5A 3MGBA 1KZPA 4MRUA 3IKOB 2R02A 3TWXA 4PS8A 2ILRA 1HFAA 3L82A 3SQVA 4FJZA 1AP7A 1N52A 3PZ3A 2RG8A 4OAUC 1XGWA 1X5BA 4URKA 4G8LA 5HKPA 5A6CA 3CEQA 4C9BB 3LVQE 2EQXA 3K9IA 5ENQD 4I1MA 4O1PA 1D9SA 4TUUA 4CYMD 3L13A 3FTXA 2ETAA 2HYZA 2X6FA 3MA5A 1NA0A 3NB2A 4BTAA 5JA4D 2WPVA 3OXFA 2IF4A 2GRPB 5H7PA 4LCTA 4FLHA 4JA7A 1SZAA 3UI2A 1NI1A 3DRAA 2I6HA 3EHMA 3U4TA 2XEEA 1PAQA 2KZTB 5CMWA 3C5RA 5BV0A 5LP0A 1K1BA 2FO7A 3FY4A 3LY7A 3ASHA 1IQRA 4F1PA 3FU6A 4JL0A 2DWZA 1DNPA 3OAWA 4U0ZA 3EIQC 3RAUA 5AAOA 2GRRB 4JHKA 1UOHA 3Q7FA 3FH5A 5CRVA 3FTYA 4GCOA 5D0QD 2ZU6B 1LD8A 2V4LA 5E76A 3HXDA 2LO6A 3LVRE 4DJAA 5G55A 5BW8C 4AM9A 4GMLA 2LAIA 3HXCA 3WXXA 5CEAA 4HRLA 3R7QA 4Y6WA 3G2WA 5J08A 3MV3B 4N5QA 1FT2A 4U04A 4GZ6A 4JB8P 3DSTA 3QWVA 4GTPA 3FUHA 1Z3XA 3UPVA 5AARA 4B89A 4D10C 3FUFA 1TNBA 5T3RA 3VLFA 2HR2A 3APCA 2OVFA 4K5BA 1QZ2A 3EJNA 2HM8A 2KM4A 4J8YA 3NZUA 3ABLE 4APFA 1JPLA 3ZYQA 2XS8A 2MRIA 2Q7FA 4IYPA 3TXNA 1SVXA 3VLEA 3C3QA 3QARA 1HZ4A 2B0OE 4JW1A 2VSNA 1E90A 2B6CA 3CIAA 3ASDA 1OWOA 4X8QA 1G3NB 3LY8A 4FHKA 2IOSA 3DSVA 3RRUA 2VSXE 4DX6D 4CDRA 5B1AE 4BX9A 2FULA 4N5CA 4I2ZA 3SNXA 2Y4TA 4WNGA 2XCBA 3AS8A 4DLQA 2PQRA 2IFUA 4JZYA 2V0PA 4MKTA 4WWPA 4HI9A 3I4GA 4GA2A 3B13A 4GTMA 1Y8MA 3MJWA 4GTSA 3D9PA 1W3BA 5ARGA 4FADA 3JCKC 3HHMA 4ME2A 4HQDA 2GRNB 3JQ1A 1KT1A 3HVEB 4EBAG 4KZ0A 2KBXA
chains in the Genus database with same CATH topology
3G2VA 2I2OA 1INZA 3UT8A 4TRQA 1E8YA 4BFRA 2BUGA 3ZHEB 2DCPA 1UW4B 2L9BA 2C2LA 3CVNA 3G2SA 4K03A 2J9QA 1H2VC 4I2WA 2CHZA 3BG0B 3EDTB 4MS6A 3S7DA 3BG1B 3ZVVA 5FQ4A 3FUIA 5EX0A 3S7FA 3ULQA 3FUDA 1WY6A 2WXMA 3APFA 4I43A 3CK9A 3FULA 2WXNA 3RU0A 1HS6A 3NZSA 5HI7A 3ZYKA 4XIFA 3TL5A 3ESLA 1HG2A 2WXJA 4AIFA 4BTBA 3CLJA 3D9LA 3QC1A 3QWWA 4UQXA 4WUYA 5FZRA 1H2UA 4IRUA 3D9JA 4I6EA 4W9RA 1E7UA 4XX5A 1HG5A 3SGHA 4UQYA 5CCLA 3CHPA 4XKCA 4RG9A 4FULA 3LY9A 2JEKA 1TJFA 4BSXA 4F53A 2R5SA 3PH0C 4DPRA 2QFCA 4EZKA 3FH7A 4BY6A 4BWRA 3UX4A 3PVLA 2J4DA 2XHEA 3APDA 4CGVA 4AEZC 2I9CA 3O4ZA 3UT7A 4WNEA 2X3MA 2XPZA 2KCLA 1YA0A 4CEMA 2CHXA 2WVIA 5EX3A 4DLOA 2L0TB 4PUCA 3RKVA 5C2YA 3ASGA 3URZA 4CT4A 4BT8A 3FEYA 5FZQA 3PZDA 3UUXA 4H7XA 2WQHA 2WXRA 3RIBA 2LSVA 3CVVA 1SQMA 4CDMA 2CFZA 1UJJA 1HU3A 1XNFA 3CHQA 3L6AA 2XRYA 1PC2A 3QOUA 4CDNA 2YINA 5FQ6A 4B94A 2XPIA 3FTWA 3CK7A 3ONLA 2DIWA 2VSOE 5G05C 4J0UA 5DBKA 2Y3AA 2V8SE 3L16A 1JUQA 2AVPA 2X6HA 4JEHA 2VGYA 3FH8A 2X38A 2L6JA 4FU3A 4AY6A 3GW4A 3IBEA 2VGXA 5T8IA 3CHSA 4FP7A 3OTNA 1UN8A 4NRHB 3CQCB 2P58C 3CVYA 1HX8A 3CK8A 4KVOA 5CHEE 3FWVA 3TXMA 3LYAA 2LNIA 2AXZA 3JQ0A 1H2TC 3FHEA 3P2BA 1JWFA 4L2LA 5ENNA 2PM7A 4KVMA 1JWGA 1MHQA 1PY1A 4KZCA 1EDUA 2XRZA 2V5FA 3N71A 1Z3YA 4GAAA 3NQPA 3PRZA 2BTDA 4WNFA 4UWGA 3KD7A 3MV2B 1U3DA 3CGHA 3ENEA 3L54A 4J8EA 3JUIA 5AYWD 2LAHA 2LSUA 5EKQD 1ZBPA 4LRZA 5D0OD 4AOFA 3CVWA 3ONKA 3E4BA 5FQ7A 3RRMB 2CG2A 5FTPA 3CVPA 3HYMB 2C0LA 2WXOA 4ILIA 5LOZA 3L08A 2DBAA 1ELRA 4L2YA 3MKQB 1TJCA 3QDNA 1NZNA 3FTSA 2FBNA 5AJDA 5DIZA 1HH8A 4YVOA 4FHJA 3CSTA 4RG6A 5M72A 4J8DA 5KJNA 4AJWA 3LPZA 4AXHA 2A4ZA 3CHOA 3GZSA 4N2SA 4GZ3A 1ELWA 3MZLB 4FC8A 4U07A 4ILHB 4JVSA 3RK6A 2WXFA 3RO3A 4APOA 2QY7A 2YNQA 2I1JA 4EZLA 1FVHA 3LDZA 4I1OB 2IQCA 4RVBA 4XE0A 2WQ7A 1E8XA 3ML9A 2XGSA 4GU5A 4JC8A 4GPKA 2C0MA 3CHRA 3PEUB 5BV1A 2AXVA 4LUNU 2J4BA 4QFVA 3ZGQA 3LS8A 4O6FA 3PUKA 5EDSA 5LX8A 4V3IA 1UJKA 2M63A 4J8FA 3IEGA 2WXPA 4K0RA 4N3AA 4DK5A 1IQUA 1QQEA 3MGBA 4GYYA 4MRUA 4OVVA 3IKOB 4P29A 4ABNA 4U63A 2YHCA 4PS8A 2ILRA 3FUNA 1MQSA 4N3CA 5FQ8A 4G23A 1HFAA 4U0SA 4M3OA 4G11A 3FU3A 5AJLA 4CRWA 1EF1C 4LERA 4FJZA 1N52A 5JJTA 1HF8A 4IULA 3PNTB 2RG8A 4NQ0A 3GZ2A 3FUJA 3SBSA 4N2QA 2WXIA 3CSFA 4OYSA 2NC9A 1XGWA 2WXKA 1X5BA 2HO1A 3FP3A 4AP2A 3TG5A 4URKA 1GW6A 4WNDA 3D9KA 2KC7A 5A6CA 4I17A 3CEQA 3RRNB 4N3BA 5FZSA 4C9BB 3T8MA 3LVQE 2EQXA 3K9IA 4UI9C 3SHFA 4EBAA 3T5XA 2CG3A 3VLDA 2J08A 3MCXA 2WXLA 4I1MA 4Q69A 4XI0A 3QWPA 4TUUA 3LXUX 5G04J 3L13A 3LJ3A 4J8SA 2KATA 1E8WA 4R7LA 4B8AA 4UQZA 3FTXA 4JA9A 3AS5A 4OVUA 5LCWC 1N54A 2WXHA 2HYZA 2IONA 2X6FA 1L5JA 2J49A 3L17A 3MA5A 2VYIA 3ZIMA 3G2UA 4UWHA 5ANLA 2WMNA 3PNLB 4G25A 1NA0A 3B7TA 4GA0A 3RO2A 2GW1A 3KEZA 4PH4B 2VSYA 4BTAA 4JHRA 2WPVA 2XQ0A 2GRLA 3OXFA 5BUZA 1EPUA 3QB2A 3UT4A 1U3CA 2IF4A 3AU4A 3O48A 4PS3A 4LCTA 1EYHA 1HXIA 4FLHA 1OWNA 4G24A 4JPSA 3ASFA 3Q4AB 2XGOA 4JA7A 1LF8A 3CV0A 3ZW3A 3BEEA 2PZIA 2UY1B 1SZAA 3B7SA 4B8CB 2J07A 3CHMA 2I6HA 3EHMA 2WB2A 3U4TA 1OUVA 3P1UA 1PAQA 4HXIA 4ILGA 2KZTB 2AW6A 3R9AB 5CMWA 3FU5A 5JJ7A 1S0PA 4GZ5A 3CR3A 1B89A 5BV0A 5LP0A 3QJZA 5LFAA 4G26A 4YNDA 4HOSA 3HIZA 3RJVA 4XKBA 2FF4A 4AY5A 2FO7A 3FTZA 3QK0A 4Q94A 3FY4A 3LY7A 4EECA 3ASHA 3FTUA 1IQRA 1P5QA 2PM6A 3L22A 4UWKA 3FU6A 4JL0A 3PUJA 2OVBA 5J90A 3U64A 4KMOA 1DNPA 3OAWA 4KT6B 4U0ZA 3ZEFA 3FUEA 2XEVA 3MKQA 3EIQC 2ONDA 3ZRHA 3D9NA 4NACA 4WWNA 4A3VA 4JHKA 3FH5A 2VTBB 3FTYA 3PDNA 1Z6TA 4GCOA 5D0QD 3R7RA 2ZU6B 5E76A 2V4LA 1KT0A 4C0EA 3SFZA 5BT1A 2LO6A 3LVRE 1E96B 2VQ2A 4DJAA 1HO8A 4IN3B 5G55A 2WXGA 5BW8C 1OWPA 2X6JA 4AM9A 4GMLA 2LAIA 2VJ8A 4FJYA 3HVEA 5ARFA 5BNWA 3WXXA 4B0ZA 2AWIA 3QAQA 4A1GA 3R7QA 1OWLA 4UWLA 4Y6WA 5T4YA 5AIJA 4ANUA 3G2WA 2XGMA 5J08A 3ZHEA 4E6HA 3MV3B 3LEWA 4G2VA 3QKYA 4GCNA 4U04A 3Q15A 3LKUA 5G05J 4F3VA 1FVFA 4HS2A 3ZPJA 3MEKA 3PE4A 1H6KA 5FWQA 3U9WA 4GZ6A 1ELKA 4N39A 4Y6CA 3Q5MA 1WM5A 3QWVA 3DPDA 4I9CA 2OOEA 3SBTB 5E75A 3FUHA 3B7UX 3UQ3A 4GA1A 3Q47B 3S7BA 2E2EA 1Z3XA 3UPVA 2E0IA 5A7DB 4GYOA 4PS7A 1BPOA 3ZFWA 4LEUA 4B89A 4D10C 2YQ8A 3FUFA 1HE8A 4WAFA 5ANRA 3CKBA 4I6GA 3ZYLA 3PREA 5FJYA 1IHGA 3FUMA 4G1TA 3CKCA 5T3RA 4ANXA 3EIJA 3IHYA 1QNFA 3VLFA 4ATGA 2HR2A 1E8ZA 3APCA 2A5UA 4JEUA 3ESKA 2OVFA 3KAEA 3CVXA 2X6KA 3PE3A 1H19A 3FFLA 5KJLA 4BT9A 5CCMA 2IJGX 5JHBA 1OWMA 4EQFA 3CQGB 2NSZA 2GRMA 4L7TA 1QZ2A 4HOQA 2OV8A 3EJNA 1A17A 3B7RL 3AS4A 4KBQA 5BPPA 4GB9A 2GGFA 2HM8A 2KM4A 4E85A 3FU0A 3D9IA 3FTVA 4BX8A 3VTXA 3NZUA 3D9MA 3OXGA 3SD5A 2MHKA 4EPZA 5A23A 4HORA 4APFA 3MYVA 4EZJA 1JPLA 3ZYQA 4L23A 3I4RB 4MLPA 2MRIA 2Q7FA 3GZ1A 3SZ7A 3KS2A 4IYPA 3TXNA 5JHAA 4ANWA 2RD0A 4HLEA 3VLEA 3U3WA 4I1AA 4J6IA 3QARA 1HZ4A 3GYZA 4JW1A 4F7AA 4H7YA 3SI5A 4JXTA 2NXPA 1E90A 1SZ9A 2VSNA 3S7JA 2KCKA 3CIAA 3I5PA 5KJMA 3TGOA 4CCAA 3PS6A 3ASDA 1WAO1 3ZN3A 3CVLA 1OWOA 4KYOB 2XCCA 5HQ8A 3AU5A 4GYWA 4PDXA 3LY8A 3C98A 5KJKA 2UY1A 3FEXA 4FHKA 4AV7A 2IOSA 3UMVA 3FDHA 4ACLA 3QNKA 2MOWA 3ZYMA 2KZTA 3JYSA 2VGXB 3S2AA 3RRUA 3Q49B 3TAXA 3MX3A 2VSXE 2CHWA 4XI9A 1TEZA 2L0IA 4U8HA 4CDRA 2J09A 3TJPA 4FLBA 3T5VA 1IYGA 2BF0X 4FA6A 3LCAA 3CVUA 4BX9A 4HFGA 2FULA 4N5CA 4I2ZA 3ZXSA 3SNXA 2Y4TA 4WNGA 5JJ6A 2XCBA 3AS8A 2CFUA 2PQRA 4DLQA 3D9OA 2PL2A 4UI9K 4XZ4A 2IFUA 1DVPA 4JZYA 2AXUA 4HOTA 5C1DA 3HDXA 4ANVA 3IV0A 4I9EA 2V0PA 4Q96A 2UWJG 1FCHA 4KXKB 3MKRA 4MKTA 4WWPA 4UI9J 3IHVA 1E7VA 4GMJA 4L1BA 2Y4UA 3I4GA 5G04C 4GA2A 1UG3A 3B13A 3EHNA 4A1SA 2VTBA 4JHJA 1Y8MA 2FEZA 4ACKA 1H0AA 5CMYA 4NURA 4AVXA 5FT9A 1Y6IA 1NA3A 3MJWA 2PQNA 2R59A 3I3NA 2YHEA 4TV3A 2I1KA 4GZCA 2FI7A 5KCMA 3G2TA 3D3MA 3VTYA 4DI3A 4CGWA 3U66A 1VDYA 3D9PA 4RSYA 4UWFA 4A55A 1W3BA 5ARGA 3TG4A 5G2NA 4FADA 5LCWJ 3JCKC 1ZU2A 3HHMA 4U0UA 4WWOA 4HVBA 4DI4A 3SF4A 4ME2A 5AENA 3CVQA 2WMOA 3FUKA 4HOUA 3PEVB 4I6JA 1UN9A 4F1SA 4A3TA 3NF1A 2WQ6A 2WXQA 2R17C 2WM9A 2XPYA 4GZDA 2IU1A 1KLXA 4C0MA 2X6IA 4CT0A 2IOLA 3OXLA 3JQ1A 1NP7A 4YVQC 3ML8A 1KT1A 2JLBA 3HVEB 3DBSA 4EBAG 4KZ0A 2KCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0P A;  1TJF A; 
#chains in the Genus database with same CATH topology
 1INZ A;  3UT8 A;  1O1R A;  4TRQ A;  4BFR A;  1UW4 B;  2L9B A;  3CVN A;  3G2S A;  4K03 A;  3BG1 B;  3FUI A;  3ULQ A;  4BET A;  3FUD A;  2WXM A;  3APF A;  1HS6 A;  3NZS A;  5HI7 A;  4BSZ B;  4DUI A;  4AIF A;  5ENP D;  3QC1 A;  2DZO A;  1V54 E;  3D9J A;  4I6E A;  4XX5 A;  4UQY A;  3CHP A;  3LY9 A;  3NBN B;  2ZIR A;  4EZK A;  2Y69 E;  4BY6 A;  1BLX B;  4AEZ C;  1OCZ E;  1FPP A;  2KCL A;  4TUM A;  1YA0 A;  5EX3 A;  4DLO A;  3RKV A;  3UM3 A;  1SQM A;  1HU3 A;  1XNF A;  2ZGG A;  2YIN A;  4B94 A;  3C72 A;  2DIW A;  4YDY A;  3L16 A;  2X38 A;  2L6J A;  2HE0 A;  4FU3 A;  3GW4 A;  3CHS A;  1UN8 A;  2P58 C;  3BU8 A;  3CVY A;  4GTT A;  3TXM A;  5CBN A;  2AXZ A;  3JQ0 A;  5AQ9 A;  3FHE A;  1JWF A;  4L2L A;  1BD8 A;  3V79 K;  3TWT A;  4KZC A;  3N71 A;  4B93 B;  4WNF A;  3MV2 B;  3TWR A;  3L54 A;  5AYW D;  2LAH A;  5EKQ D;  5D0O D;  3E4B A;  1KZO A;  2WXO A;  3DXK G;  4L2Y A;  3MKQ B;  3QDN A;  4YVO A;  4FHJ A;  4AXH A;  3CHO A;  3V2X A;  5KWD A;  2QY7 A;  4JD2 G;  4HB5 A;  2WQ7 A;  1TNZ A;  4GPK A;  2H6I A;  2C0M A;  4DX7 D;  4QFV A;  3LS8 A;  5EDS A;  5LX8 A;  4V3I A;  3E30 A;  1QQE A;  2R05 A;  2OCC E;  2QC9 A;  2P9P G;  5KNH D;  4CZ2 D;  2YHC A;  2EIN E;  1MQS A;  2DYS E;  5FQ8 A;  4U0S A;  5KNG A;  5FIO A;  4CRW A;  5JJT A;  4O60 A;  1WG0 A;  4IUL A;  4NQ0 A;  1SW6 A;  3CSF A;  1TN8 A;  2NC9 A;  2HO1 A;  3PZ2 A;  2IEJ A;  2KC7 A;  4G8K A;  3T8M A;  4UI9 C;  3SHF A;  3T5X A;  3VLD A;  2J08 A;  2WXL A;  3C3O A;  3QWP A;  3LJ3 A;  2KAT A;  1E8W A;  4UQZ A;  4JA9 A;  1QYM A;  5LCW C;  2ION A;  3L17 A;  1L5J A;  2J49 A;  5ANL A;  2WMN A;  3RO2 A;  3B7T A;  3NOC D;  2VGE A;  2R2L A;  4HLL A;  4PH4 B;  2BKG A;  2XQ0 A;  1EPU A;  3QB2 A;  1U3C A;  3O48 A;  2R03 A;  1U2V G;  1EYH A;  1OWN A;  1BI8 B;  3ZW3 A;  2MYO A;  2J07 A;  2P9I G;  2WB2 A;  3UIN C;  1OUV A;  1MX4 A;  4HXI A;  3R9A B;  3FU5 A;  2XS1 A;  4G26 A;  3HIZ A;  3DSU A;  3FTU A;  1K1A A;  2PM6 A;  2EIK E;  3U64 A;  2OEW A;  4KT6 B;  2XEN A;  2XEV A;  4K5C A;  3DWL G;  3L9T A;  2VTB B;  1Z6T A;  3R7R A;  4C0E A;  3SFZ A;  3HXB A;  1K8K G;  1HO8 A;  1ZB1 A;  1OWP A;  3B7B A;  1H6O A;  3AG3 E;  4B0Z A;  1OWL A;  4ANU A;  4G2V A;  3QKY A;  1MX2 A;  4DRX E;  3Q15 A;  3ZPJ A;  3MEK A;  3DPD A;  4I9C A;  4GA1 A;  1AWC B;  3Q47 B;  2E0I A;  5EYP F;  3ASO E;  1OCC E;  1HE8 A;  4I6G A;  3FUM A;  3CKC A;  4ATG A;  3KAE A;  2X6K A;  3FFL A;  5KJL A;  4EQF A;  2NSZ A;  2GRM A;  4U95 D;  4HOQ A;  1A17 A;  3B7R L;  4GB9 A;  4E85 A;  3FU0 A;  3VTX A;  2MHK A;  4OAV B;  2A5E A;  5IY5 E;  3Q79 A;  3SZ7 A;  4MLP A;  3KS2 A;  1N0R A;  4ANW A;  1YMP A;  3ISM C;  3SO8 A;  3U3W A;  4I1A A;  4J6I A;  4F7A A;  3SI5 A;  5CBO A;  2RFM A;  2ETC A;  3UM1 A;  4RLY A;  5KJM A;  4CCA A;  1WAO 1;  2H6F A;  4ZFH A;  1N4P A;  2XCC A;  4GYW A;  4AV7 A;  5AN8 A;  2KZT A;  3JYS A;  3HXF A;  3HXE A;  3Q49 B;  1JCS A;  2CHW A;  4XI9 A;  2L0I A;  2J09 A;  3TJP A;  3T5V A;  3LCA A;  4HRN A;  3CVU A;  4HFG A;  5JJ6 A;  4XZ4 A;  4BEP A;  4GTV A;  2LXM A;  2UWJ G;  4UI9 J;  5G04 C;  2F0Y A;  1H0A A;  3E37 A;  5FT9 A;  1N95 A;  4GZC A;  3TWS A;  3AJI A;  3G2T A;  3D3M A;  1VDY A;  4RSY A;  4UWF A;  3ZXP A;  5G2N A;  5LCW J;  1ZU2 A;  4WWO A;  5ENR D;  3FUK A;  4HOU A;  4ZHB A;  1N4R A;  1LTX A;  1UN9 A;  4F1S A;  3NF1 A;  2XPY A;  4C0M A;  4GZD A;  2IU1 A;  1KLX A;  3OXL A;  4YVQ C;  3DSW A;  3V2O A;  3DBS A;  1N94 A;  3G2V A;  2XEH A;  2CHZ A;  3ZVV A;  4U96 D;  1MYO A;  4HI8 A;  5FQ4 A;  5EX0 A;  4YDO A;  3CK9 A;  3FUL A;  2WXN A;  2EIL E;  4XIF A;  2WXJ A;  3CLJ A;  4UQX A;  1TN7 A;  1H2U A;  4IRU A;  3RSE G;  5EIB E;  1TNY A;  2EIJ E;  1HG5 A;  3F6Q A;  4FUL A;  4RG9 A;  3Q7A A;  1V55 E;  4DPR A;  2QFC A;  3FH7 A;  4BWR A;  3PVL A;  2XHE A;  3APD A;  2X3M A;  2XPZ A;  2RKK A;  3Q73 A;  4CEM A;  3ABK E;  2CHX A;  3FEY A;  5ENT D;  2KXP C;  3TWW A;  3CHQ A;  2XPI A;  3FTW A;  3ONL A;  5DBK A;  2Y3A A;  4MBG A;  3UM2 A;  1JUQ A;  2X6H A;  2VGY A;  3FH8 A;  3UIP C;  3E34 A;  3OTN A;  4DX2 A;  1HX8 A;  1H6P A;  5D2M C;  2P9U G;  5CHE E;  3FWV A;  1O5M A;  2QYJ A;  4M7C A;  2PM7 A;  4KVM A;  2XRZ A;  3ABM E;  3PRZ A;  3CGH A;  4QQI A;  4RQI A;  3ASN E;  1ZBP A;  4LRZ A;  3UKU G;  3L08 A;  4GMR A;  1ELR A;  1TJC A;  2FBN A;  5DIZ A;  1HH8 A;  3PZ4 A;  3CST A;  5KJN A;  4GZ3 A;  1ELW A;  4JVS A;  1IKN D;  3LDZ A;  4I1O B;  5HRY A;  1E8X A;  3PEU B;  5BV1 A;  2AXV A;  2J4B A;  1UJK A;  2M63 A;  4N3A A;  3IEG A;  3UXG A;  4OVV A;  4P29 A;  4U63 A;  3IXE A;  3FUN A;  3SFX A;  3FU3 A;  4LER A;  1HF8 A;  3DEO A;  3PNT B;  4N2Q A;  2WXI A;  3Q9N C;  3FP3 A;  4AP2 A;  3TG5 A;  4WND A;  3D9K A;  4I17 A;  3NOG D;  4N3B A;  4EBA A;  2CG3 A;  3MCX A;  3LXU X;  5G04 J;  1N4Q A;  4R7L A;  4B8A A;  3AS5 A;  4OVU A;  3R9M A;  4TXQ A;  2WXH A;  3ZIM A;  4UWH A;  3V31 A;  2GW1 A;  4LSZ E;  4JHR A;  3UKR G;  5BUZ A;  3UT4 A;  4LNB A;  3AU4 A;  1HXI A;  4G24 A;  3Q4A B;  5JMN D;  1LF8 A;  3CV0 A;  3BEE A;  2UY1 B;  5AQA A;  3CHM A;  2DVW A;  2V4H C;  3QJZ A;  2FF4 A;  4Q94 A;  1OT8 A;  4EEC A;  3L22 A;  2OVB A;  5J90 A;  4KMO A;  3ZNG A;  3ZEF A;  3MKQ A;  4NAC A;  4A3V A;  2F8Y A;  5HS0 A;  1SA5 A;  1K3Z D;  3PDN A;  2ZGD A;  1KT0 A;  5BT1 A;  1E96 B;  3UIO C;  1N4S A;  5AQB A;  4HNA D;  5ARF A;  4FJY A;  5BNW A;  1DCE A;  2AWI A;  3QAQ A;  4UWL A;  5AIJ A;  4GTO A;  2XGM A;  2NYJ A;  3ZHE A;  4E6H A;  3LEW A;  4GCN A;  3C3R A;  3LKU A;  1S64 A;  4HS2 A;  3PE4 A;  3Q9U C;  3U9W A;  1ELK A;  3Q5M A;  3SBT B;  3B7U X;  3UQ3 A;  4GTR A;  1N0Q A;  1TN6 A;  4GYO A;  4PS7 A;  1YCS B;  3ZFW A;  4LEU A;  4GTQ A;  4XEI G;  5ANR A;  3CKB A;  3ZYL A;  3PRE A;  5FJY A;  3EIJ A;  3IHY A;  1QNF A;  1E8Z A;  3ESK A;  5CRU A;  3T8K A;  3CVX A;  2RFA A;  1H19 A;  3AAA C;  2IO3 C;  2IJG X;  1OWM A;  2OV8 A;  5BPP A;  2GGF A;  4BX8 A;  3D9M A;  3SD5 A;  4EPZ A;  5A23 A;  4UUC A;  4HOR A;  3MYV A;  4A63 B;  3I4R B;  1FT1 A;  4BES A;  5ITZ F;  5JHA A;  4HLE A;  3GYZ A;  4H7Y A;  5CER B;  3UTM A;  3PZ1 A;  3TGO A;  3PS6 A;  3ZN3 A;  4KYO B;  4PDX A;  1OY3 D;  4DX5 D;  3C98 A;  5KJK A;  3FEX A;  4DX1 A;  3UMV A;  3DEP A;  3QNK A;  2P9L G;  2MOW A;  2VGX B;  3TWU A;  3TAX A;  2QYU A;  1TEZ A;  4FLB A;  1IYG A;  2CFU A;  4Z68 A;  3AG4 E;  3EHQ A;  2PL2 A;  4UI9 K;  1DVP A;  2AXU A;  1QBQ A;  4HOT A;  3IV0 A;  4Q96 A;  3MKR A;  3KEA A;  1RW2 A;  3IHV A;  1E7V A;  2Y4U A;  3SY2 A;  3EHN A;  2VTB A;  2BED A;  5KBA A;  2FEZ A;  4AVX A;  4ACK A;  5CMY A;  4NUR A;  2R59 A;  3I3N A;  3X2Q E;  4U8V D;  4TV3 A;  2I1K A;  5KCM A;  4DI3 A;  4CGW A;  5CED B;  3U66 A;  4NIK A;  1MX6 A;  3DSS A;  3NAW A;  4DI4 A;  2WMO A;  1RZ4 A;  3PEV B;  4I6J A;  2WQ6 A;  2WXQ A;  2X6I A;  4CT0 A;  2IOL A;  1NP7 A;  3ML8 A;  2I2O A;  1Z5S C;  2DCP A;  2C2L A;  3S7D A;  4MS6 A;  4F6R D;  4I43 A;  3W9G A;  3ESL A;  3D9L A;  5FZR A;  5CEC B;  1NFI E;  4BSX A;  5BXU A;  3UX4 A;  4CGV A;  3O4Z A;  3UT7 A;  5EYL A;  4WNE A;  2L0T B;  4PUC A;  5C2Y A;  3ASG A;  4CT4 A;  4BT8 A;  3UUX A;  3PZD A;  1NL4 A;  2WQH A;  2EIM E;  2WXR A;  3RIB A;  3CVV A;  1JCR A;  1UJJ A;  2QZA A;  4U8Y D;  3QOU A;  5G05 C;  2V8S E;  3JXI A;  5T8I A;  4FP7 A;  3CQC B;  2GRQ B;  2OEV A;  5FIN A;  2P9K G;  2LNI A;  1PY1 A;  1MHQ A;  4GAA A;  3NQP A;  3KD7 A;  1U3D A;  3Q75 A;  3ENE A;  4J8E A;  2LSU A;  3CVW A;  1O1T A;  3ONK A;  5FTP A;  3CVP A;  3HYM B;  4ILI A;  5LOZ A;  4U7E B;  2DBA A;  2IO2 C;  1NZN A;  3FTS A;  5M72 A;  3DXM G;  4ILH B;  3RO3 A;  1WDY A;  2WXF A;  4EZL A;  1FVH A;  2IQC A;  4XE0 A;  3AG2 E;  3SFY A;  2XZD G;  3ZUV B;  4J8F A;  1IQU A;  1D8E A;  4GYY A;  4ABN A;  3B95 A;  1OCO E;  4N3C A;  4LNU D;  4G23 A;  4M3O A;  4G11 A;  5AJL A;  1EF1 C;  4HRM B;  3GZ2 A;  5D66 A;  3FUJ A;  3SBS A;  3Q78 A;  4OYS A;  1TYQ G;  2WXK A;  3E33 A;  1GW6 A;  2Y1L E;  3RRN B;  5FZS A;  2JAB A;  3LJN A;  4J7W A;  5EIL A;  4Q69 A;  4XI0 A;  1YYH A;  4J8S A;  3EU5 A;  1O1S A;  4YDE A;  1N54 A;  1JCQ A;  2VYI A;  2H6G A;  3G2U A;  4C48 B;  3PNL B;  4G25 A;  3BUA A;  4GA0 A;  5ENO D;  4L9P A;  3KEZ A;  2VSY A;  2GRL A;  3EUV A;  2PNN A;  4PS3 A;  3D9H A;  4HBD A;  4JPS A;  3ASF A;  3JUE A;  2XGO A;  2L6B A;  2PZI A;  1DCQ A;  3B7S A;  4B8C B;  3HG0 D;  3P1U A;  4ILG A;  2ETB A;  2AW6 A;  5JJ7 A;  1S0P A;  4GZ5 A;  3TWV A;  3CR3 A;  1B89 A;  5LFA A;  4YND A;  3V30 A;  4HOS A;  3RJV A;  4XKB A;  4AY5 A;  3QK0 A;  3FTZ A;  4O1O A;  3KSL A;  3T9K A;  2XZT G;  2F37 A;  1P5Q A;  4UWK A;  3PUJ A;  2IY0 C;  1X81 A;  3TWQ A;  3FUE A;  1TR4 A;  2OND A;  3ZRH A;  3D9N A;  4WWN A;  4LNG A;  1TNO A;  1MJ0 A;  2LXL A;  4TXP A;  2VQ2 A;  3BQO A;  4IN3 B;  2WXG A;  2P9N G;  2X6J A;  1S70 B;  2VJ8 A;  3HVE A;  4A1G A;  2P2C P;  5AQ7 A;  5T4Y A;  2FO1 E;  5G05 J;  4F3V A;  1FVF A;  1H6K A;  5FWQ A;  4N39 A;  4Y6C A;  1WM5 A;  1IXV A;  5B1B E;  2OOE A;  3ULE G;  5E75 A;  2V5Q C;  4ATZ D;  3S7B A;  2E2E A;  5A7D B;  3ULY A;  1BPO A;  2YQ8 A;  4WAF A;  1IHG A;  4ANX A;  4G1T A;  1MZC A;  3AG1 E;  2A5U A;  4JEU A;  3PE3 A;  1KPS B;  4BT9 A;  5CCM A;  5JHB A;  3CQG B;  4L7T A;  3DSX A;  3AS4 A;  4KBQ A;  3D9I A;  3FTV A;  3OXG A;  3EU9 A;  2Y0B G;  4EZJ A;  4L23 A;  3GZ1 A;  2H6H A;  2RD0 A;  1OCR E;  4JXT A;  2NXP A;  1SZ9 A;  1DC2 A;  3S7J A;  2KCK A;  3I5P A;  2DZN A;  3CVL A;  5HQ8 A;  2LUH A;  3AU5 A;  2DYR E;  2UY1 A;  3FDH A;  4ACL A;  3ZYM A;  5BXO A;  3S2A A;  2AJA A;  3MX3 A;  4TXR A;  4U8H A;  2BF0 X;  4FA6 A;  3ZXS A;  3D9O A;  5C1D A;  3HDX A;  4ANV A;  4I9E A;  3DPY A;  1TNU A;  1FCH A;  4KXK B;  2BKK B;  5B3S E;  4GMJ A;  4L1B A;  4A1S A;  1UG3 A;  4JHJ A;  3ZKJ A;  4YDW A;  3J5P A;  1Y6I A;  1NA3 A;  5EN5 D;  2PQN A;  2YHE A;  2FI7 A;  3VTY A;  4A55 A;  3TG4 A;  4U0U A;  4HVB A;  3SF4 A;  5AEN A;  3CVQ A;  4A3T A;  2R17 C;  2WM9 A;  2JLB A;  2KCV A;  4GPM A;  2GRO B;  1E8Y A;  2BUG A;  3ZHE B;  4BER A;  2J9Q A;  1H2V C;  4I2W A;  1N9A A;  3BG0 B;  3EDT B;  4LG6 A;  3S7F A;  1WY6 A;  3J5Q B;  3RU0 A;  3JXJ A;  3ZYK A;  2P9S G;  3TL5 A;  1HG2 A;  3ZU7 B;  4BTB A;  3QWW A;  4WUY A;  4W9R A;  1E7U A;  3SGH A;  5CCL A;  4XKC A;  2J8S D;  1OXJ A;  3E32 A;  2JEK A;  1TJF A;  4F53 A;  2R5S A;  3PH0 C;  2J4D A;  2I9C A;  3EHR A;  1LD7 A;  2WVI A;  3URZ A;  5FZQ A;  4H7X A;  2LSV A;  4CDM A;  2CFZ A;  2F8X K;  3L6A A;  2XRY A;  1PC2 A;  4CDN A;  5FQ6 A;  2ZIS A;  3CK7 A;  2VSO E;  4J0U A;  4JEH A;  2AVP A;  3KSQ A;  4AY6 A;  3IBE A;  2VGX A;  4NRH B;  5EID A;  1A5E A;  1BI7 B;  4EHM A;  1N11 A;  3CK8 A;  4KVO A;  1BU9 A;  3LYA A;  2ZXW E;  1H2T C;  3P2B A;  3WG7 E;  5ENN A;  1JWG A;  1EDU A;  1D8D A;  2V5F A;  1Z3Y A;  1IHB A;  2BTD A;  4UWG A;  1Q2Z A;  3JUI A;  1S63 A;  4AOF A;  5FQ7 A;  3RRM B;  2CG2 A;  2C0L A;  3W9F A;  5AJD A;  4RG6 A;  1SA4 A;  4J8D A;  4AJW A;  3LPZ A;  2A4Z A;  3GZS A;  4N2S A;  3MZL B;  4FC8 A;  4U07 A;  3RK6 A;  4APO A;  2YNQ A;  2I1J A;  3UM0 A;  4RVB A;  3ML9 A;  4K5A B;  2XGS A;  4GU5 A;  4JC8 A;  3CHR A;  4LUN U;  5ENS D;  3ZGQ A;  4O6F A;  3PUK A;  3HRA A;  2WXP A;  4K0R A;  4DK5 A;  3MGB A;  1KZP A;  4MRU A;  3IKO B;  2R02 A;  3TWX A;  4PS8 A;  2ILR A;  1HFA A;  3L82 A;  3SQV A;  4FJZ A;  1AP7 A;  1N52 A;  3PZ3 A;  2RG8 A;  4OAU C;  1XGW A;  1X5B A;  4URK A;  4G8L A;  5HKP A;  5A6C A;  3CEQ A;  4C9B B;  3LVQ E;  2EQX A;  3K9I A;  5ENQ D;  4I1M A;  4O1P A;  1D9S A;  4TUU A;  4CYM D;  3L13 A;  3FTX A;  2ETA A;  2HYZ A;  2X6F A;  3MA5 A;  1NA0 A;  3NB2 A;  4BTA A;  5JA4 D;  2WPV A;  3OXF A;  2IF4 A;  2GRP B;  5H7P A;  4LCT A;  4FLH A;  4JA7 A;  1SZA A;  3UI2 A;  1NI1 A;  3DRA A;  2I6H A;  3EHM A;  3U4T A;  2XEE A;  1PAQ A;  2KZT B;  5CMW A;  3C5R A;  5BV0 A;  5LP0 A;  1K1B A;  2FO7 A;  3FY4 A;  3LY7 A;  3ASH A;  1IQR A;  4F1P A;  3FU6 A;  4JL0 A;  2DWZ A;  1DNP A;  3OAW A;  4U0Z A;  3EIQ C;  3RAU A;  5AAO A;  2GRR B;  4JHK A;  1UOH A;  3Q7F A;  3FH5 A;  5CRV A;  3FTY A;  4GCO A;  5D0Q D;  2ZU6 B;  1LD8 A;  2V4L A;  5E76 A;  3HXD A;  2LO6 A;  3LVR E;  4DJA A;  5G55 A;  5BW8 C;  4AM9 A;  4GML A;  2LAI A;  3HXC A;  3WXX A;  5CEA A;  4HRL A;  3R7Q A;  4Y6W A;  3G2W A;  5J08 A;  3MV3 B;  4N5Q A;  1FT2 A;  4U04 A;  4GZ6 A;  4JB8 P;  3DST A;  3QWV A;  4GTP A;  3FUH A;  1Z3X A;  3UPV A;  5AAR A;  4B89 A;  4D10 C;  3FUF A;  1TNB A;  5T3R A;  3VLF A;  2HR2 A;  3APC A;  2OVF A;  4K5B A;  1QZ2 A;  3EJN A;  2HM8 A;  2KM4 A;  4J8Y A;  3NZU A;  3ABL E;  4APF A;  1JPL A;  3ZYQ A;  2XS8 A;  2MRI A;  2Q7F A;  4IYP A;  3TXN A;  1SVX A;  3VLE A;  3C3Q A;  3QAR A;  1HZ4 A;  2B0O E;  4JW1 A;  2VSN A;  1E90 A;  2B6C A;  3CIA A;  3ASD A;  1OWO A;  4X8Q A;  1G3N B;  3LY8 A;  4FHK A;  2IOS A;  3DSV A;  3RRU A;  2VSX E;  4DX6 D;  4CDR A;  5B1A E;  4BX9 A;  2FUL A;  4N5C A;  4I2Z A;  3SNX A;  2Y4T A;  4WNG A;  2XCB A;  3AS8 A;  4DLQ A;  2PQR A;  2IFU A;  4JZY A;  2V0P A;  4MKT A;  4WWP A;  4HI9 A;  3I4G A;  4GA2 A;  3B13 A;  4GTM A;  1Y8M A;  3MJW A;  4GTS A;  3D9P A;  1W3B A;  5ARG A;  4FAD A;  3JCK C;  3HHM A;  4ME2 A;  4HQD A;  2GRN B;  3JQ1 A;  1KT1 A;  3HVE B;  4EBA G;  4KZ0 A;  2KBX A; 
#chains in the Genus database with same CATH homology
 3G2V A;  2I2O A;  1INZ A;  3UT8 A;  4TRQ A;  1E8Y A;  4BFR A;  2BUG A;  3ZHE B;  2DCP A;  1UW4 B;  2L9B A;  2C2L A;  3CVN A;  3G2S A;  4K03 A;  2J9Q A;  1H2V C;  4I2W A;  2CHZ A;  3BG0 B;  3EDT B;  4MS6 A;  3S7D A;  3BG1 B;  3ZVV A;  5FQ4 A;  3FUI A;  5EX0 A;  3S7F A;  3ULQ A;  3FUD A;  1WY6 A;  2WXM A;  3APF A;  4I43 A;  3CK9 A;  3FUL A;  2WXN A;  3RU0 A;  1HS6 A;  3NZS A;  5HI7 A;  3ZYK A;  4XIF A;  3TL5 A;  3ESL A;  1HG2 A;  2WXJ A;  4AIF A;  4BTB A;  3CLJ A;  3D9L A;  3QC1 A;  3QWW A;  4UQX A;  4WUY A;  5FZR A;  1H2U A;  4IRU A;  3D9J A;  4I6E A;  4W9R A;  1E7U A;  4XX5 A;  1HG5 A;  3SGH A;  4UQY A;  5CCL A;  3CHP A;  4XKC A;  4RG9 A;  4FUL A;  3LY9 A;  2JEK A;  1TJF A;  4BSX A;  4F53 A;  2R5S A;  3PH0 C;  4DPR A;  2QFC A;  4EZK A;  3FH7 A;  4BY6 A;  4BWR A;  3UX4 A;  3PVL A;  2J4D A;  2XHE A;  3APD A;  4CGV A;  4AEZ C;  2I9C A;  3O4Z A;  3UT7 A;  4WNE A;  2X3M A;  2XPZ A;  2KCL A;  1YA0 A;  4CEM A;  2CHX A;  2WVI A;  5EX3 A;  4DLO A;  2L0T B;  4PUC A;  3RKV A;  5C2Y A;  3ASG A;  3URZ A;  4CT4 A;  4BT8 A;  3FEY A;  5FZQ A;  3PZD A;  3UUX A;  4H7X A;  2WQH A;  2WXR A;  3RIB A;  2LSV A;  3CVV A;  1SQM A;  4CDM A;  2CFZ A;  1UJJ A;  1HU3 A;  1XNF A;  3CHQ A;  3L6A A;  2XRY A;  1PC2 A;  3QOU A;  4CDN A;  2YIN A;  5FQ6 A;  4B94 A;  2XPI A;  3FTW A;  3CK7 A;  3ONL A;  2DIW A;  2VSO E;  5G05 C;  4J0U A;  5DBK A;  2Y3A A;  2V8S E;  3L16 A;  1JUQ A;  2AVP A;  2X6H A;  4JEH A;  2VGY A;  3FH8 A;  2X38 A;  2L6J A;  4FU3 A;  4AY6 A;  3GW4 A;  3IBE A;  2VGX A;  5T8I A;  3CHS A;  4FP7 A;  3OTN A;  1UN8 A;  4NRH B;  3CQC B;  2P58 C;  3CVY A;  1HX8 A;  3CK8 A;  4KVO A;  5CHE E;  3FWV A;  3TXM A;  3LYA A;  2LNI A;  2AXZ A;  3JQ0 A;  1H2T C;  3FHE A;  3P2B A;  1JWF A;  4L2L A;  5ENN A;  2PM7 A;  4KVM A;  1JWG A;  1MHQ A;  1PY1 A;  4KZC A;  1EDU A;  2XRZ A;  2V5F A;  3N71 A;  1Z3Y A;  4GAA A;  3NQP A;  3PRZ A;  2BTD A;  4WNF A;  4UWG A;  3KD7 A;  3MV2 B;  1U3D A;  3CGH A;  3ENE A;  3L54 A;  4J8E A;  3JUI A;  5AYW D;  2LAH A;  2LSU A;  5EKQ D;  1ZBP A;  4LRZ A;  5D0O D;  4AOF A;  3CVW A;  3ONK A;  3E4B A;  5FQ7 A;  3RRM B;  2CG2 A;  5FTP A;  3CVP A;  3HYM B;  2C0L A;  2WXO A;  4ILI A;  5LOZ A;  3L08 A;  2DBA A;  1ELR A;  4L2Y A;  3MKQ B;  1TJC A;  3QDN A;  1NZN A;  3FTS A;  2FBN A;  5AJD A;  5DIZ A;  1HH8 A;  4YVO A;  4FHJ A;  3CST A;  4RG6 A;  5M72 A;  4J8D A;  5KJN A;  4AJW A;  3LPZ A;  4AXH A;  2A4Z A;  3CHO A;  3GZS A;  4N2S A;  4GZ3 A;  1ELW A;  3MZL B;  4FC8 A;  4U07 A;  4ILH B;  4JVS A;  3RK6 A;  2WXF A;  3RO3 A;  4APO A;  2QY7 A;  2YNQ A;  2I1J A;  4EZL A;  1FVH A;  3LDZ A;  4I1O B;  2IQC A;  4RVB A;  4XE0 A;  2WQ7 A;  1E8X A;  3ML9 A;  2XGS A;  4GU5 A;  4JC8 A;  4GPK A;  2C0M A;  3CHR A;  3PEU B;  5BV1 A;  2AXV A;  4LUN U;  2J4B A;  4QFV A;  3ZGQ A;  3LS8 A;  4O6F A;  3PUK A;  5EDS A;  5LX8 A;  4V3I A;  1UJK A;  2M63 A;  4J8F A;  3IEG A;  2WXP A;  4K0R A;  4N3A A;  4DK5 A;  1IQU A;  1QQE A;  3MGB A;  4GYY A;  4MRU A;  4OVV A;  3IKO B;  4P29 A;  4ABN A;  4U63 A;  2YHC A;  4PS8 A;  2ILR A;  3FUN A;  1MQS A;  4N3C A;  5FQ8 A;  4G23 A;  1HFA A;  4U0S A;  4M3O A;  4G11 A;  3FU3 A;  5AJL A;  4CRW A;  1EF1 C;  4LER A;  4FJZ A;  1N52 A;  5JJT A;  1HF8 A;  4IUL A;  3PNT B;  2RG8 A;  4NQ0 A;  3GZ2 A;  3FUJ A;  3SBS A;  4N2Q A;  2WXI A;  3CSF A;  4OYS A;  2NC9 A;  1XGW A;  2WXK A;  1X5B A;  2HO1 A;  3FP3 A;  4AP2 A;  3TG5 A;  4URK A;  1GW6 A;  4WND A;  3D9K A;  2KC7 A;  5A6C A;  4I17 A;  3CEQ A;  3RRN B;  4N3B A;  5FZS A;  4C9B B;  3T8M A;  3LVQ E;  2EQX A;  3K9I A;  4UI9 C;  3SHF A;  4EBA A;  3T5X A;  2CG3 A;  3VLD A;  2J08 A;  3MCX A;  2WXL A;  4I1M A;  4Q69 A;  4XI0 A;  3QWP A;  4TUU A;  3LXU X;  5G04 J;  3L13 A;  3LJ3 A;  4J8S A;  2KAT A;  1E8W A;  4R7L A;  4B8A A;  4UQZ A;  3FTX A;  4JA9 A;  3AS5 A;  4OVU A;  5LCW C;  1N54 A;  2WXH A;  2HYZ A;  2ION A;  2X6F A;  1L5J A;  2J49 A;  3L17 A;  3MA5 A;  2VYI A;  3ZIM A;  3G2U A;  4UWH A;  5ANL A;  2WMN A;  3PNL B;  4G25 A;  1NA0 A;  3B7T A;  4GA0 A;  3RO2 A;  2GW1 A;  3KEZ A;  4PH4 B;  2VSY A;  4BTA A;  4JHR A;  2WPV A;  2XQ0 A;  2GRL A;  3OXF A;  5BUZ A;  1EPU A;  3QB2 A;  3UT4 A;  1U3C A;  2IF4 A;  3AU4 A;  3O48 A;  4PS3 A;  4LCT A;  1EYH A;  1HXI A;  4FLH A;  1OWN A;  4G24 A;  4JPS A;  3ASF A;  3Q4A B;  2XGO A;  4JA7 A;  1LF8 A;  3CV0 A;  3ZW3 A;  3BEE A;  2PZI A;  2UY1 B;  1SZA A;  3B7S A;  4B8C B;  2J07 A;  3CHM A;  2I6H A;  3EHM A;  2WB2 A;  3U4T A;  1OUV A;  3P1U A;  1PAQ A;  4HXI A;  4ILG A;  2KZT B;  2AW6 A;  3R9A B;  5CMW A;  3FU5 A;  5JJ7 A;  1S0P A;  4GZ5 A;  3CR3 A;  1B89 A;  5BV0 A;  5LP0 A;  3QJZ A;  5LFA A;  4G26 A;  4YND A;  4HOS A;  3HIZ A;  3RJV A;  4XKB A;  2FF4 A;  4AY5 A;  2FO7 A;  3FTZ A;  3QK0 A;  4Q94 A;  3FY4 A;  3LY7 A;  4EEC A;  3ASH A;  3FTU A;  1IQR A;  1P5Q A;  2PM6 A;  3L22 A;  4UWK A;  3FU6 A;  4JL0 A;  3PUJ A;  2OVB A;  5J90 A;  3U64 A;  4KMO A;  1DNP A;  3OAW A;  4KT6 B;  4U0Z A;  3ZEF A;  3FUE A;  2XEV A;  3MKQ A;  3EIQ C;  2OND A;  3ZRH A;  3D9N A;  4NAC A;  4WWN A;  4A3V A;  4JHK A;  3FH5 A;  2VTB B;  3FTY A;  3PDN A;  1Z6T A;  4GCO A;  5D0Q D;  3R7R A;  2ZU6 B;  5E76 A;  2V4L A;  1KT0 A;  4C0E A;  3SFZ A;  5BT1 A;  2LO6 A;  3LVR E;  1E96 B;  2VQ2 A;  4DJA A;  1HO8 A;  4IN3 B;  5G55 A;  2WXG A;  5BW8 C;  1OWP A;  2X6J A;  4AM9 A;  4GML A;  2LAI A;  2VJ8 A;  4FJY A;  3HVE A;  5ARF A;  5BNW A;  3WXX A;  4B0Z A;  2AWI A;  3QAQ A;  4A1G A;  3R7Q A;  1OWL A;  4UWL A;  4Y6W A;  5T4Y A;  5AIJ A;  4ANU A;  3G2W A;  2XGM A;  5J08 A;  3ZHE A;  4E6H A;  3MV3 B;  3LEW A;  4G2V A;  3QKY A;  4GCN A;  4U04 A;  3Q15 A;  3LKU A;  5G05 J;  4F3V A;  1FVF A;  4HS2 A;  3ZPJ A;  3MEK A;  3PE4 A;  1H6K A;  5FWQ A;  3U9W A;  4GZ6 A;  1ELK A;  4N39 A;  4Y6C A;  3Q5M A;  1WM5 A;  3QWV A;  3DPD A;  4I9C A;  2OOE A;  3SBT B;  5E75 A;  3FUH A;  3B7U X;  3UQ3 A;  4GA1 A;  3Q47 B;  3S7B A;  2E2E A;  1Z3X A;  3UPV A;  2E0I A;  5A7D B;  4GYO A;  4PS7 A;  1BPO A;  3ZFW A;  4LEU A;  4B89 A;  4D10 C;  2YQ8 A;  3FUF A;  1HE8 A;  4WAF A;  5ANR A;  3CKB A;  4I6G A;  3ZYL A;  3PRE A;  5FJY A;  1IHG A;  3FUM A;  4G1T A;  3CKC A;  5T3R A;  4ANX A;  3EIJ A;  3IHY A;  1QNF A;  3VLF A;  4ATG A;  2HR2 A;  1E8Z A;  3APC A;  2A5U A;  4JEU A;  3ESK A;  2OVF A;  3KAE A;  3CVX A;  2X6K A;  3PE3 A;  1H19 A;  3FFL A;  5KJL A;  4BT9 A;  5CCM A;  2IJG X;  5JHB A;  1OWM A;  4EQF A;  3CQG B;  2NSZ A;  2GRM A;  4L7T A;  1QZ2 A;  4HOQ A;  2OV8 A;  3EJN A;  1A17 A;  3B7R L;  3AS4 A;  4KBQ A;  5BPP A;  4GB9 A;  2GGF A;  2HM8 A;  2KM4 A;  4E85 A;  3FU0 A;  3D9I A;  3FTV A;  4BX8 A;  3VTX A;  3NZU A;  3D9M A;  3OXG A;  3SD5 A;  2MHK A;  4EPZ A;  5A23 A;  4HOR A;  4APF A;  3MYV A;  4EZJ A;  1JPL A;  3ZYQ A;  4L23 A;  3I4R B;  4MLP A;  2MRI A;  2Q7F A;  3GZ1 A;  3SZ7 A;  3KS2 A;  4IYP A;  3TXN A;  5JHA A;  4ANW A;  2RD0 A;  4HLE A;  3VLE A;  3U3W A;  4I1A A;  4J6I A;  3QAR A;  1HZ4 A;  3GYZ A;  4JW1 A;  4F7A A;  4H7Y A;  3SI5 A;  4JXT A;  2NXP A;  1E90 A;  1SZ9 A;  2VSN A;  3S7J A;  2KCK A;  3CIA A;  3I5P A;  5KJM A;  3TGO A;  4CCA A;  3PS6 A;  3ASD A;  1WAO 1;  3ZN3 A;  3CVL A;  1OWO A;  4KYO B;  2XCC A;  5HQ8 A;  3AU5 A;  4GYW A;  4PDX A;  3LY8 A;  3C98 A;  5KJK A;  2UY1 A;  3FEX A;  4FHK A;  4AV7 A;  2IOS A;  3UMV A;  3FDH A;  4ACL A;  3QNK A;  2MOW A;  3ZYM A;  2KZT A;  3JYS A;  2VGX B;  3S2A A;  3RRU A;  3Q49 B;  3TAX A;  3MX3 A;  2VSX E;  2CHW A;  4XI9 A;  1TEZ A;  2L0I A;  4U8H A;  4CDR A;  2J09 A;  3TJP A;  4FLB A;  3T5V A;  1IYG A;  2BF0 X;  4FA6 A;  3LCA A;  3CVU A;  4BX9 A;  4HFG A;  2FUL A;  4N5C A;  4I2Z A;  3ZXS A;  3SNX A;  2Y4T A;  4WNG A;  5JJ6 A;  2XCB A;  3AS8 A;  2CFU A;  2PQR A;  4DLQ A;  3D9O A;  2PL2 A;  4UI9 K;  4XZ4 A;  2IFU A;  1DVP A;  4JZY A;  2AXU A;  4HOT A;  5C1D A;  3HDX A;  4ANV A;  3IV0 A;  4I9E A;  2V0P A;  4Q96 A;  2UWJ G;  1FCH A;  4KXK B;  3MKR A;  4MKT A;  4WWP A;  4UI9 J;  3IHV A;  1E7V A;  4GMJ A;  4L1B A;  2Y4U A;  3I4G A;  5G04 C;  4GA2 A;  1UG3 A;  3B13 A;  3EHN A;  4A1S A;  2VTB A;  4JHJ A;  1Y8M A;  2FEZ A;  4ACK A;  1H0A A;  5CMY A;  4NUR A;  4AVX A;  5FT9 A;  1Y6I A;  1NA3 A;  3MJW A;  2PQN A;  2R59 A;  3I3N A;  2YHE A;  4TV3 A;  2I1K A;  4GZC A;  2FI7 A;  5KCM A;  3G2T A;  3D3M A;  3VTY A;  4DI3 A;  4CGW A;  3U66 A;  1VDY A;  3D9P A;  4RSY A;  4UWF A;  4A55 A;  1W3B A;  5ARG A;  3TG4 A;  5G2N A;  4FAD A;  5LCW J;  3JCK C;  1ZU2 A;  3HHM A;  4U0U A;  4WWO A;  4HVB A;  4DI4 A;  3SF4 A;  4ME2 A;  5AEN A;  3CVQ A;  2WMO A;  3FUK A;  4HOU A;  3PEV B;  4I6J A;  1UN9 A;  4F1S A;  4A3T A;  3NF1 A;  2WQ6 A;  2WXQ A;  2R17 C;  2WM9 A;  2XPY A;  4GZD A;  2IU1 A;  1KLX A;  4C0M A;  2X6I A;  4CT0 A;  2IOL A;  3OXL A;  3JQ1 A;  1NP7 A;  4YVQ C;  3ML8 A;  1KT1 A;  2JLB A;  3HVE B;  3DBS A;  4EBA G;  4KZ0 A;  2KCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...