1S0QA

Native bovine pancreatic trypsin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pancratic bovine Trypsin native and inhibited with Benzamidine from synchotron data.
rcsb
molecule tags Hydrolase
molecule keywords Trypsinogen
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0qA02
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 3I78A 8KME2 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 1UJ1A 1ORFA 2KAIB 3D62A 4CHAB 1NFWA 3F1SB 2HOBA 1ZOMA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 2NU0E 1FZZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 1TLDA 1D3QB 1UK4A 1MTNC 1QL9A 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 8GCHF 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 2JETC 1IQJA 5HM2A 4CRAA 1BRAA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 5EODA 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 1AKSA 1QL8A 1SL3A 1XKBC 2ZTZA 1JIMA 1C1QA 3FZDA 1KTTB 3UUZA 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 5FX5A 1XUFA 4D9QA 1KYNA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1DXWA 1DICA 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1Z8GA 3LT3A 4MQAA 1MTWA 1HNEE 3ZZDA 3A84A 2KAIA 2Z9JA 1C4U2 4ZXYH 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 1AWFH 4JZEH 1FIZA 1TPSA 1B0FA 2J92A 3A80A 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 4ZKSU 1O39A 3O8RA 1C9TA 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1AKSB 1GJCB 1HJAB 4FUCA 3KIDU 5C3NA 2ZFQH 2VH6A 3LGWA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A 1QA7A 1SPJA 1KIGH 1NN6A 2G00A 1GMCG 1QRWA 1UTMA 1LTOA 1S6FA 1XUHA 1SHHB 3KCGH 1SQOA 1AVGH 1FI8A 3NKKA 3UNRA 2LNCA 1RD3B 2V0BA 4DGJA 3M3TA 1M9UA 2H1UA 4B75A 4TWWA 3GCOA 2PFEA 3TNTA 3Q77A 5DPAA 3E0PB 3MH4A 1IQEA 2XC0A 3TGKE 1OOKB 1GBFA 1UTLM 2O8LA 2Q6FA 1ANDA 1T8NA 3LGVA 1DLEA 3GCTF 4JYUH 4MPXA 1QNJA 1TONA 2OLGA 1N8OB 1GJ8B 1MZDA 3AAVA 5T6FA 3RXQA 2GV7A 1S0QA 2FP7B 1J14A 1GJAB 4JK6A 2RA3A 1JRSA 5CHAB 2BD3A 4AORA 3TGIE 2RG3A 2ZI2H 5GWZA 2ALVA 5DP5A 3DA9B 4SGAE 5DP4A 5GXPA 1O3DA 4XSKU 1SGTA 1DFPA 4CRGA 1AGJA 2XWAA 2WV4A 1PQ7A 1O3BA 4H42U 1Z1IA 5K7RA 2A4RA 1IAUA 3TVJB 1GI2A 2AGEX 3KQCA 1FDPA 5FPYA 3RC5A 1C2MA 1HXEH 1KTSB 2ZPQA 4A6LA 4UFGH 1A4WH 4K1TA 1HAOH 2H9HA 1TBQH 2ZHFH 2XCNA 4AYVB 1UTPA 5EXMA 5JYIA 1XXDA 3M7UA 1J8AA 2BOKA 3SORA 1OWEA 1C2HA 3CENA 3EGKH 3BEUA 4PROA 4ABJA 2AMQA 2ODYB 2Y7XA 1EKBB 1H9HE 1C1RA 4YOIA 1THSH 1QHRB 3PMJA 3V3MA 2ZHEH 5EG4A 1C1MA 4A1VA 2GMTB 3L33A 2GZ7A 3BTWE 3P8GA 1Q3XA 1OP8A 4GHQA 5E0GA 1FY3A 2OC0A 2RA0A 1CA8B 1D3PB 5AHGH 4WMFA 2TGAA 3UQOA 3SJIA 3ZZ9A 3URDA 1FJSA 2QCYA 2ZGJA 4GHTA 4K2YA 3DFLA 1F0SA 5EPYA 4F49A 2G8TA 4IN2A 2ZU1A 3HGNA 1ELGA 4O03A 1YF4A 1EP6A 4FVDA 3W94A 1GVKB 1LHGH 3TNSA 1W0YH 1LVMA 3IITA 5TJXA 1D4PB 1LVBA 3MU4A 3P6ZB 3PYHA 4ZXXH 1TNKA 1O2UA 4Y8XA 2VU8E 3TU7H 4ABBA 2A7JA 1HAXB 1GI5A 1F0RA 1A0HB 4ZROA 2UUYA 2XTTB 2A2XH 2J95A 2SGAA 3E3TA 1HV7A 2FDAA 2ZGBH 2VNTA 3LKWA 4JZIA 2YNBA 1GMCF 4XBCA 1TX7A 2A0QB 4AG2A 3Q3KA 2ZF0H 2XBXA 1O2NA 1AUTC 3UIRA 3ZVDA 3A7WA 1TNIA 4LOYH 3E90B 1IHTH 4E7RG 4AYYB 5EPNA 2RCEA 2XCFA 1K1OA 1BTPA 5A0BA 3QX5H 4INHA 3BTQE 2ZDKA 1C5NH 4OGYA 4FXGH 4X8VH 1KSNA 3F9GA 3VFEA 5DKMA 2HPPH 1V2KT 1G30B 2ZFSA 2XC5A 1ELVA 1PJPA 1CGJE 1SGIB 2BDHA 4I31A 3GISB 9ESTA 2BDAA 1ELFA 2BQWB 1QY6A 2QXGA 1OPHB 2SGQE 3S9CA 2A31A 3UR9A 1OP0A 3SU3A 1L4DA 1GI7B 1ESAA 3VGCC 1ELEE 3TIUA 2WPLS 2NU4E 3M61U 1RIWB 1P2JA 1QL7A 1BMNH 2W3KA 4K69A 1BRCE 5T6DA 1TMTH 2GCHG 4M7GA 3V7TA 1P2MA 1TPAE 2AMPA 2CXVA 3VXFH 1CT4E 1TGCA 1OS8A 5L2YH 1AE5A 3K6YA 2VINA 3DD2H 3CS0A 5H4IB 1ZJKA 2FX6A 4BAMB 1O5DH 1SQAA 2O8MA 3ZZCA 1V2TT 1MQ6A 4ABHA 4IN1A 1OSSA 2A45B 3SQHE 5HGGA 1TE0A 2BDGA 4FUFA 3T28A 1YLCA 1XUIA 2BY8X 3UTUH 2GKVE 1RS0A 1O3JA 2ZDAH 4MNXA 1AD8H 2C8YB 2GDDA 3RXHA 3HPTB 1TABE 1S82A 2VB0A 4X8SH 5DP8A 4MNYA 1HAVA 1DY8A 3F9FA 3Q3YA 4AB8A 1FONA 2G55A 5IYTA 3N7OA 5E2OA 1UK3A 1O2MA 5CHAC 3VB6A 1Y5UT 1UO6A 2IJOB 4A1XA 1IQLA 2XNIA 1GCTC 3GY4A 1YPEH 2OD3B 1SGCA 3RMMH 4JZFH 1O2IA 3CP7A 4OS5A 5FPTA 1EB1H 1E35B 1UCYE 1YPLH 2WPKS 3W95A 1P02A 4YT6H 1GI4A 2JETB 1SGFG 4UE7H 2A5IA 5A09A 1GJ5H 3ZVAA 3UWJH 3KQDA 1CSOE 2F9BH 1EOLA 3SI4H 1QB6A 1D9IA 4A7IB 1MBMA 1OWIA 2GD4B 3SU4A 3BIVH 3A7XA 1GBBA 3V0XA 1P01A 1O3IA 4IMZA 3SNEA 2FOCA 1YCPK 4X8UH 1TPOA 3MYWA 1RJXB 4NIYA 3B23B 1SVPA 4NSVA 2A32A 2GDEH 4FUHA 3RXLA 1TOMH 1P0SH 4XBDA 3H7TA 1ESBA 1EXFA 4X6MA 4CBNA 3TGJE 2STAE 1QBVH 2WPMS 3IG6B 3QUMP 3SO3A 5F8ZA 4B1TA 4LZ1H 3PLPA 3E91A 4K60A 4Q2KA 3UOUA 2P8OC 4FU9A 3LC3A 5I25A 1GHWH 1WTGH 3OSYA 1LQDB 2BYAX 5FAHA 1C1NA 1F2SE 5HXFA 2GCTC 4YTAA 3BV9B 3AW1A 1A5GH 2BY9X 1K1MA 4ISOA 1G9IE 3FZZA 4JZ1A 5EQSA 3BTME 4UEHH 3MH6A 1ZHMA 1ELAA 2VIQA 2FMJA 3ZYEA 5LPEA 4J2YB 2OTVA 1YPGH 1BZXE 1K1JA 1NY22 1GCTB 4WMEA 1O5BB 2PW8H 4H6TA 3VEQB 3LGTA 5FCKA 3SV6A 1L1JA 5LPRA 1G2MA 2P8OB 1PPZA 3QGJA 4Q80A 3ATLA 1MZAA 1SGDE 3K65B 1S83A 1HAHH 1O2VA 1V2VT 1O35A 1BMAA 2FOAA 2BLQA 4XDEA 4B71A 3SN8A 1DWCH 2JH5D 1WOFA 3EA9A 2GV6A 4U32A 2VIDA 4NA7A 1IQGA 1LHCH 3S7HB 2ZECA 1SGPE 2P3UB 3S9AA 3OY5U 3A7TA 1G3DA 1GDQA 3PTNA 2DE8A 3KGPA 2C8WB 3D65E 4B2CA 2G81E 1YGCH 1Y5AT 3SNAA 5SGAE 2QF3A 1GGDC 1DWBH 5BPEA 1DLKB 1IQHA 4GPGA 2WINI 3MTYA 2WUCA 3QTOH 5GJ4B 4JCNA 4Y0ZE 1TQ0B 2BOHB 2W7SA 3GCHB 1V6DA 5A8YA 2GP9B 4Y8ZA 1SGRE 3Q3XA 3SGBE 4WF8A 3ELAH 2UWLA 5K0HA 2ZTYA 2H2ZA 1U6QA 5ABWA 3EA7A 1UTOA 1ZSLA 1V2ST 2FLRH 1Z1JA 2BY7X 5C1YA 1WAYB 3M5NA 1AUJA 2B7DH 2ZCHP 1A0LA 2ANWA 2OP9A 2AEIH 5AVDA 1O3CA 3ZVBA 2BD9A 1C2KA 3A81A 3MU5A 1LPGB 3T25A 1ABIH 3LH1A 4DT7B 1N1LA 3SJ8A 1O2WA 1BOQA 1TYNA 1D6RA 1YP9A 4TWYA 1O2RA 4ISIH 3G01A 5T3HA 2O9QA 1DX5M 1QFKH 4MNWA 3ZZ6A 1LO6A 1CO7E 1T4UH 4Y8YA 2ZU5A 4ZHMU 3SQEE 7LPRA 1P2NA 2ZDMA 1HAYB 2NU2E 4WJG2 3SV9A 1BTXA 2NU3E 1G2LA 4FVBA 3P95A 1O3OA 4D8NA 1TMUH 3QN7A 7ESTE 2ZC9H 4UDWH 1GDNA 3KQEA 4JZDH 3PM3A 1F92A 1MD7A 1GCDA 3K6ZA 1SSXA 1RTFB 4NWKA 3QO6A 4NSYA 3VB4A 4ABFA 2A4QA 1GJ6A 1D3TB 2TGDA 3MHWU 4OS6A 3URCA 1TNLA 3U1JB 2QXJA 5DP7A 2A1DB 3I77A 1WUNH 2QXHA 4H4FA 2Y7ZA 3QGNB 4MDSA 1EPTA 2BXTH 3B9FH 4WH6A 2JH0D 2V3OH 2Z3EA 2FI5E 2FOHA 6LPRA 5E0JA 4FUGA 1GL1A 4LXBH 2ZQ1A 5FX6A 3ZZ8A 1TMBH 1NZQH 3MH5A 1MKWK 1DDJA 1AE8H 3SU6A 3UPEA 1KXCA 1FIWA 5EW1H 5FPSA 3M7TA 3PTBA 1TRMA 2ESTE 1C2EA 1GBHA 1SB1H 2PHBA 1K1IA 1NU9A 2HGTH 1T32A 2VVVA 4GSOA 2NU1E 2BVXH 1D3DB 4WWYA 3ZZ5A 1GI8B 3SJKA 5FCRA 4AG1A 1SLWB 1YPHC 1ZSKA 2DE9A 2SGEE 3ZVCA 5DK1A 2W5EA 2ODPA 2ZEBA 2R0LA 1QBOA 2HPQH 1E38B 2J38A 1C1OA 2Q1JA 3E1XB 3OYPA 1OWKA 1BBRH 1SLUB 3PWBA 1OWDA 1K1PA 2W3IA 2ANMH 3HATH 1G3CA 3ZZAA 1DE7H 1T8LA 2R2MB 2Z6BD 3C27B 2J9NA 3A8CA 4A5TS 2FIRH 1EZQA 4QT8C 4Z6AH 3GDSA 4GUXA 1MD8A 2H5CA 4O9VA 1AB9B 1FUJA 2FOFA 2HVXA 1KY9A 1KLJH 1OWJA 1NC6A 1FY4A 1XUGA 1Y3XA 4B76A 1RXPA 3GCHC 4ISLA 2ZU3A 1MTUA 1BTYA 1P11E 2OC1A 4OS4A 2CJIA 5C1UA 4E06H 1ZTJA 1IHSH 1C2GA 4I8GA 3VGCB 2SGDE 2FOEA 1PQ5A 2CHAB 8ESTE 1XMNB 3BG4B 3TK9A 4THNH 1GJ7B 2K1QA 1O5EH 2VGCC 3E0NB 1YYY1 4NA8A 2D26C 4KKDA 1FY5A 1P8VC 3SHCH 1G37A 1DSTA 1K22H 5ESTE 4AFUA 4NGAH 4DG4A 1H9IE 1TA6A 3EQ0H 2W26A 3V12A 1AQ7A 1O3FA 4WXIA 2HNTF 1O2KA 3UNQA 3LGYA 4ZKRU 1MCVA 3TITA 4MPUA 5CMXH 2XYAA 4DW2U 1NU7B 4AGKA 4FUJA 3M7QA 3MH7A 2ZWLH 2D2DA 1ZMLA 4ZHAA 1LPZB 1C5QA 4I8JA 4GVUA 3SBKA 2WPHS 2Y82A 1GGDB 1NS3A 1AHTH 4CR5A 3M3SA 3TH2H 1J15A 4TY6A 4XE4A 3VB7A 2F91A 4AX9H 4INKA 3ZV8A 2W7UA 1BHXF 1NPMA 1S85A 3BSQA 1ARCA 1KLTA 2PSXA 2VWOA 2XW9A 4CR9A 3A87A 1Z8RA 4YZUA 1N8OC 1LHDH 3U8RH 1HIAA 1ETTH 1L0ZA 1QJ1B 1VCPA 2GCTB 3RC4A 1DSUA 1TFXA 1TGTA 2QN5T 3R3GB 4YT7H 3B8JA 5L30H 2XBVA 4MVNA 3SUDA 1Z7KA 3A7VA 3AW0A 3KN2A 1W2KH 2A5KA 2PTCE 4BANB 4IC6A 2EI8A 4NZQA 1GWAA 2EEKA 3MO6A 1PYTC 2FOGA 3F9HA 1GMHF 1LVYA 3KHVA 4Y79A 3FP8E 2I6SA 3QK1A 2ZGXH 3UREA 3UOPA 1H9LB 2VJ1A 1FQ3A 3GOVB 3E6PH 1FN6A 1W12U 5FXLA 1O2YA 3KF2A 2Y5GA 3A8AA 3M5MA 1AI8H 1WQVH 3RXCA 1INCA 1N6YA 2ZFRH 3PV4A 4Y6DA 3OU0A 4WXVA 1NFYA 3RXSA 1DT2A 1KXAA 2Z94A 2BD4A 5C5NA 1H1BA 4CHAC 1WYKA 1P2IA 1BCUH 1LQEA 1EQ9A 3ZVGA 2FZZA 1OYTH 3FP6E 1W7XH 1P2OA 2OCVB 4HFPB 4LZ4B 2BX4A 1EAWA 3GY8A 6GCHG 1S0RA 3RXDA 4ZKNU 2D8WA 3SU5A 4SGBE 1O3PB 1RFNA 2NWNA 2UUFB 1W3CA 1UTQA 2C3SA 4DIIH 3BTTE 1OWHA 1VCWA 1KXDA 1AN1E 2SNWA 1O2SA 3P8NA 2AFQB 3BTKE 5C2ZA 1GBEA 2PR3A 3FAOA 1F5RA 4GLYA 5GCHF 1G36A 3PO1C 3UNSA 3H5CB 2ZKSA 1ID5H 3GYLB 1DPOA 1NFXA 2Y81A 2ZP0H 3AASA 4ISNA 2BVSH 3MI4A 1V2WT 3GCNA 1EASA 2FM2A 2BQ7B 2BD7A 2FESH 1C1PA 3Q76A 3ZVFA 1HUTH 1A5HA 1HRTH 3D49H 1EAXA 2ZHDA 2TGTA 4X6NA 1MTSA 4GCHG 3RLYH 2G4TA 2BD8A 5I46H 1W11U 4OS2A 5EW2H 3RXTA 1TX6A 1UHBA 4ABDA 3QZRA 1OKXA 1NTPA 1PQAA 2UWOA 4K8BA 1ZMNA 4MG3A 1EX3A 1SGYE 3O8CA 2IOTA 1AVWA 1BTZA 1OXGA 1GBTA 1RTLA 4NCYA 4NFFA 2WPIS 1AZ8A 1G3EA 1SOTA 1VJAU 1ELTA 2ZO3H 3QWCH 4MPWA 3V13A 1EPTC 2P95A 2Y5HA 2CMYA 1RTKA 1BJVA 2O8WA 3BG8A 2G51A 2BQ6B 1V2OT 4I32A 2VVCA 4X2VA 4U01A 5EOKA 5J4SA 1O0DH 2YOLA 3PLBA 1YPHE 5LH8A 1TAWA 1MKXK 5IDKA 2AS9A 1FPCH 4IGDA 1J17T 1NRNH 3A89A 4ABAA 2XXLA 2GVFA 1FV9A 1QURH 4K5ZA 2OBOA 3MO9A 3MNSA 1OX1A 1DY9A 1V2MT 3ZVEA 2V6NA 1UTNA 5A8ZA 4U2WA 2CV3A 1A46H 3SUEA 1BTHH 2ZNKH 5L2ZH 4DJZB 3RXMA 4FUIA 1ZPCA 3M3VA 3SUFA 3VPKA 1HFDA 1WU1A 1IOEA 4X2WA 3GDUA 2HWLB 4Q7ZA 3P17H 2GZ8A 3ATKA 1A7SA 1ELBA 1C5PA 1FAKH 1HJ8A 1YBWA 5C1XA 1O33A 4ISHH 2C90B 3BTHE 2QYIA 3SW2B 3T27A 4MPVA 2PSYA 1YLDA 5JPMH 7KMEH 3DUXH 4DIHH 1JXPA 1EPTB 1Z8IB 3RXVA 1ZRKA 2BMGB 1BUIA 1GJ4H 2Z9LA 4MTBA 5JB9S 2BXUH 1ETRH 1EZXC 3U98H 1C2IA 2J34A 2H6MA 1AFQC 1DANH 1FN8A 4Y0YE 1GI0A 1NT1A 1C5VA 5F6MA 3ATWA 1FY1A 2EI6A 3EDXB 3BIUH 4VGCC 1C1TA 1ANBA 1FXYA 2BY6X 2ZFTA 1UCYK 4Y7AA 3GICB 4HI3A 1QQUA 4Z0KA 1PYTD 1BDAA 3H7OA 4Q7XA 3PMBB 1TB6H 5GCHG 3HKJB 1E36B 1FAXA 1W10U 3NCLA 5C67A 1GDUA 1LHEH 2ZDNA 1GJ9B 1HLTH 2BZAA 3LDXH 1GJDB 3EYDA 2BB4A 3M35A 3RXRA 1GG6C 2R3UA 3JZ1B 2FPZA 1UK2A 1SLVB 2CHAC 2ZHWH 1UVOA 5JDUB 3A88A 1DWDH 4XBBA 2M5TA 1G3BA 4BTTB 1C5XB 1Q2WA 3P92A 1ZHRA 1V2PT 3RU4D 3OX7U 2XBWA 2A5AA 3BTDE 1A3BH 5EXLA 4F4OC 2ZHQH 2ZZUH 3KL6A 4I8HA 3SI3H 4ABGA 1TA2A 3RDZA 2R3YA 4YLUA 5CE1A 2VWLA 1X7AC 2P3TB 1C1UH 2ZGHA 3UY9A 1QRXA 4TYDA 2ANKH 2WUBA 1DS2E 1QCPA 2ZA5A 4ZMAH 1HIAB 1AZZA 2VWNA 2PLXA 5TCAA 3ODFA 3BTGE 1ANEA 3PMAB 1JWTA 1O2GH 1D6WA 2ZIQH 1MCTA 5DG6A 2VIWA 1TNGA 3JZ2B 1V2LT 2ZGCA 3GY6A 1YPMH 2C8ZB 1EATA 3LH3A 3T62A 1PPHE 1QRZA 1SFQB 1BIOA 2J2UA 3EE0B 3AVZA 2EA3A 1DOJA 2FEQH 3RMOH 1IQNA 1EZSC 3DFJA 4AFQA 1O2LA 3GY5A 3KNXA 3NUMA 2BLWA 3MNBA 1SHYA 4WH8A 1CHGA 2FS8A 1B7XB 1F5LA 1ZHPA 1O2JA 1TGBA 4UONA 1XX9A 4CH8B 5LPFA 1O2HA 2B5TB 2XRCA 1BA8B 5E0HA 2EC9H 3TPIZ 1SGEE 1GI3A 4FUEA 5JBTA 4NA9H 1Z71A 3ZV9A 1CHOG 1ZTKA 1SG8B 1G32B 1KXBA 5A0AE 3OTJE 1P03A 2BLOA 1ZGVA 4IS5A 2OC8A 1PQ8A 1ZPZA 3ODDA 1O30A 4X6OA 4I8LA 3HGPA 1T8OA 1F0TA 3F9EA 1CE5A 4WY3A 1GI6A 1CGHA 1SBWA 4ABEA 2G5NA 4TY7A 5A0CA 2FTLE 1FPHH 1CHOF 4X8TH 4X1RU 5GDSH 2HALA 3RLWH 4BOHA 1HJAC 1EZUC 2ZCKP 1P2QA 1GHVH 4OS7A 5C5OA 1C5ZB 4ZKOU 4ZAEA 1BHXB 1GHXH 2BLVA 2EI7A 1RRKA 3E8LA 2ZFFH 5E8EH 3PMHB 2FX4A 4IW4E 3MO3A 3DHKH 5TCCA 1Z8JB 4K3JA 1UVTH 1Y3YA 1THPB 2FYQA 1C5SA 3CS7A 1QR3E 4ABIA 4MLFB 3T26A 2QIQA 1LKBA 4AB9A 1GMDF 2Z9KA 4D76A 1TIOA 4YLQH 4OS1A 1VZQH 1BMLA 3TK5A 1TX8A 1PFXC 4OGXA 1F0UA 1P3CA 4NIVA 2G4UA 3S0NA 1NO9H 1GJBB 2P93A 1DM4B 1Z6JH 4MNVA 1HJ9A 1EAUA 4J1YA 2Q6GA 3T5FH 1K1LA 1ETSH 3L6PA 1SGQE 1O2ZA 1NRRH 2FI4E 2BD5A 1C5LH 2VH0A 2FWWA 2A7HA 2GT7A 3ZZ3A 4D9RA 7GCHG 2QA9E 2ILNA 5F03A 2OQUA 1W7GH 4B74A 1KXFA 2FLBH 2H9TH 4NIXA 3MOCA 1NROH 3RM0H 1GHAF 2PKAA 1PPCE 1P09A 1C5MD 2PV9B 3D23A 5JBCS 5EQQA 2VVUA 3BTFE 3MU1A 3BEIB 2SGPE 3RXFA 1W13U 1V2QT 3O8DA 1GVLA 4CH2B 1AFQB 1A61H 1O5GH 1LDTT 3DT0H 1MTNB 4XOJA 3S9BA 4FUDA 1IQKA 2BDYA 1UVPA 5DO4H 1LCYA 4RKJB 2F83A 3GY7A 4BAQB 5HYOA 3LU9B 1WBGB 2HNTE 1HCGA 3BEFB 2AERH 1WV7H 1E37B 2BTCE 5GIBA 1FNIA 2FOMB 2OBQA 1WQSA 1UCYH 1SQTA 4B2BA 2CN0H 1O3MA 1MBQA 3ZZBA 3A8BA 1UMAH 1HAZB 1P04A 4NG9H 1BQYA 1FMGA 3RP2A 4AFZA 1O2PA 1C1WH 2G5VA 2GT8A 1CBWB 4U30A 2AGGX 4K1SA 3LPRA 1T8MA 3ZYDA 5DGJA 1MTVA 1NFUA 1QB1A 1YPKH 2FO9A 1GBMA 3RM2H 1O2TA 3GY3A 4CREA 4B2AA 4AOQA 3ZZ7A 1WTHD 1Y5BT 1WSSH 3LGUA 2BM2A 3ATIA 2TPIZ 3STJA 1LMWB 3MMGA 1TNHA 1O3LA 2UUJB 2WYGA 3MNXA 4IBLH 3RXUA 1Q31A 1TGNA 3ATMA 4KP0A 1SR5C 2Z7FE 1N6XA 1SC8U 3SGQE 1ZTLA 3HKIB 2BD2A 3A8DA 2AYWA 1W8BH 2G52A 1ZJDA 2ODQA 3QDZB 4HGCA 4UD9H 4CRDA 3K2UA 4LK4A 3SV8A 2AIQA 1GMDG 1OYQA 2PKSC 3R0FA 3TLOA 5E2PA 2JH6D 2UUKB 4X1QU 1DUEA 1GHBF 1S84A 4BNRA 1O31A 1L1GA 2FODA 1BTUA 3U8TH 2FTMA 2TIOA 1TQ7B 1O36A 4Y71A 2SGFE 2GTBA 2QC2A 3TH4H 1H8IH 2D1JA 4R8TB 4GAWA 2FI3E 3RU4E 1CBWC 3A86A 1Y3VA 5DP3A 3MU0A 1K21H 2PGBB 1P12E 1C2LA 4DVAU 3RMLH 3O8BA 3U9AH 3LJOA 4YESB 5PTPA 2I6QA 2H9EH 1CT2E 1A1RA 1O38A 4IC5A 1J16A 2R9PA 1C2FA 2GZ9A 2B8OH 1LKAA 4KTUA 1ZYOA 2Z3DA 5DP9A 2YNAA 3A82A 2ZTXA 1TBRH 1BBRE 1HDTH 5DJ7A 1BT7A 1TBZH 4UFDH 1TPPA 1O3HA 3RUOA 1Y3WA 1MU8B 2OINA 4CRCA 1AY6H 5F8XA 1HAIH 1V3XA 1BJUA 2VIPA 3OY6U 1BTWA 2FS9A 1QGFA 1QTFA 5ETXA 4YO9A 1Y59T 5DP6A 3TJOA 3SU0A 1GPZA 1XKAC 3BTEE 1GG6B 1O5CB 1SGNE 3FP7E 5EXNA 5C20A 4K1EA 2GCHF 1HXFH 1O5FH 4X2YA 3RXEA 1O32A 3NWUA 4Y11E 2GX4A 1VCQA 3UQVA 1KDQA 2PUXB 4Y7BA 1YCPH 2A4OA 2J94A 1CA0B 3FANA 1HB0B 2FXRA 1L1NA 4HZHA 4RN6A 2QV1A 1W0ZU 2B9LA 4AFSA 1V2NT 5JB8S 4JYVH 3F68H 7GCHF 2QXIA 4O97A 1P06A 3VB5A 3BG4C 3RXJA 4YM9A 3TJNA 1EB2A 1HGTH 2VIOA 5EU8A 2F9OA 4KGAA 4ESTE 1BRUP 5EQRA 1PPGE 4RKOB 3BF6H 1XUKA 1ACBE 1JOUB 2R2WU 1P57B 5FHTA 1TOCB 1GBCA 3RXGA 1C5RA 1MQ5A 3RMNH 4TPIZ 1CGIE 2A7CA 4JK5A 8GCHG 1CT0E 6ESTA 1L4ZA 4DURA 1UTJA 1QA0A 1VGCC 3M5OA 2OC7A 3SZNA 1TALA 1BBRK 1VITH 1C5UA 2H5DA 3GCTG 3TK6A 1A0JA 1EJMA 1VR1H 4DCDA 1KXEA 3TJUA 2ALPA 3NZIA 5EGMA 1MMJN 4O3UA 1S81A 3MFJA 1F5KU 1L2EA 5T6GA 3GYMA 5G4BA 4Y10E 3M5LA 3HK3B 2WV5A 1SMFE 1K1NA 1AO5A 3P8FA 2LPRA 1ZLRA 3C1KA 1QBNA 2QY0B 2IN2A 1XUJA 1QQ4A 3SV2H 1QJ6B 1C1VH 1XXFA 1AVXA 4VGCB 2BDIA 1NRQH 3U8OH 1GBDA 1GHBG 3LIWA 2TBSA 2PKSB 3GY2A 3LC5A 4JMYA 4ASHA 3PROA 1MKXH 5BRRE 3VXEH 2SFAA 1FY8E 3PB1E 1NRPH 1YC0A 1A2CH 1DVAH 3SNBA 2F9PA 1GVZA 1DWEH 5HM9A 3SNCA 3NXPA 4I8KA 4D7FA 3EA8A 1ZGIA 1O2OA 1O3KA 4O3TA 2BHGA 2CGAA 1VGCB 1CVWH 1QIXB 1CU1A 2PGQB 1QJ7B 1C2JA 2O8TA 4FUBA 1O3NA 2Y80A 2GGVB 3KQBA 1C4Y2 3ENSB 4BAOB 2ZU2A 3P8OA 1BB0B 4Q7YA 3NK8A 1O3EA 3UR6A 1ZZZA 3ESTA 2STBE 1Z6EA 4GCHF 4NWLA 1ABJH 1LVOA 3SV7A 1NESE 2RDLA 4WMDA 1TWXB 2UWPA 1AB9C 3SOSA 4ZHLU 3UFAA 2O8UA 3STIA 3GDVA 1DXPA 3RXKA 3PWCA 1W14U 4XFQA 1PPFE 1XVMA 4DOQA 1EUFA 4E05H 2ZPSA 1IQFA 2ZG0H 4CRBA 1HAGE 3S69A 2P94A 1NM6A 1V2RT 3HK6B 3RXOA 1ZSJA 2F9NA 3NPSA 4X2XA 2AIPA 2ZPRA 1TGSZ 4AGJA 5A8XA 1S6HA 1F7ZA 2IPHA 1CQQA 1KDQB 1T7CA 4NFEA 1GBJA 4UFEH 1YPJH 1E0FD 2AGIX 1HYLA 3KEEA 1JMOH 1MUEB 4X0WU 2HRVA 5AFYH 1GHYH 3ZZ4A 1P10A 1EOJA 4TPYA 1GBAA 4X1NU 4B73A 1SLXB 3SGAE 1WCZA 5HMAA 3IWMA 5ESBA 3F6UH 2JKHA 2C8XB 4KELA 3SU2A 4BAKB 3BN9A 1O5AB 1GI1A 2ASUB 2F9UA 4X6PA 3RC6A 4BXWA 1MKWH 2FYRA 4K8YA 1T31A 2J4IA 2DUCA 3P70B 3PO1B 5JBAS 1C4V2 1ZR0A 2C93B 1DUAA 1JIRA 3UWIA 1BRBE 1GBIA 1UVSH 3Q00A 3T29A 1C5WB 2VIVA 1C5OH 8LPRA 2TGPZ 1HBTH 2CF9H 4AZ2B 1RGQA 2WPJS 4I7YH 1C9PA 3TJVA 2A2QH 1SI5H 4YOJA 1PPBH 1GMHG 1KLIH 3E16B 2Z9GA 1DITH 2VGCB 1YM0A 2P59A 1JBUH 3MU8A 4INLA 1YKTA 2XWBI 5AFZH 2BZ6H 1EJNA 1S5SA 2OQ5A 1SOZA 1J9CH 4HTCH 1SGFA 4WVPE 1P05A 2WYJA 4ZUHA 1O3GA 3MNCA 1NRSH 4FU7A 4CRFA 1AMHA 1EAIA 3A85A
chains in the Genus database with same CATH superfamily
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 2LP6A 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 2LELA 3I78A 8KME2 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 1UJ1A 1ORFA 2KAIB 3D62A 4CHAB 1NFWA 3F1SB 2HOBA 1ZOMA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 2NU0E 1FZZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 4RT1A 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 3F0PA 1TLDA 1D3QB 1UK4A 1MTNC 1QL9A 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 8GCHF 1E1RD 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 2JETC 1NBME 1IQJA 5HM2A 4CRAA 1BRAA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 5EODA 2WSSD 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 3AK5A 1AKSA 1QL8A 1SL3A 3PRBA 1XKBC 2ZTZA 1JIMA 1C1QA 3FZDA 1KTTB 3UUZA 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 3CNRA 1XUFA 5FX5A 4D9QA 1KYNA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1DXWA 1DICA 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1VKYA 1Z8GA 3LT3A 4MQAA 1MTWA 1HNEE 3ZZDA 3A84A 2KAIA 2Z9JA 1C4U2 4ZXYH 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 3WW7A 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 1FX0B 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 1AWFH 4JZEH 1FIZA 1TPSA 1B0FA 2J92A 3A80A 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 5HIZA 4ZKSU 1O39A 3O8RA 3DSGA 1C9TA 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1AKSB 1GJCB 1HJAB 4FUCA 3KIDU 5C3NA 2ZFQH 2VH6A 3LGWA 5EJZA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A 1QA7A 1SPJA 4F48B 1KIGH 1NN6A 2G00A 1GMCG 1QRWA 1UTMA 1LTOA 1S6FA 1XUHA 1SHHB 3KCGH 1SQOA 1AVGH 1FI8A 2VBCA 3NKKA 3UNRA 2LNCA 3KYFA 3F2HA 1RD3B 2V0BA 4DGJA 3M3TA 1M9UA 2H1UA 4B75A 4TWWA 3GCOA 2PFEA 3TNTA 3Q77A 4RT0A 5DPAA 3E0PB 3MH4A 1IQEA 2XC0A 3TGKE 1OOKB 1GBFA 1UTLM 2O8LA 2Q6FA 3F2GA 1ANDA 1T8NA 3LGVA 1DLEA 3GCTF 4JYUH 4MPXA 1QNJA 1TONA 2OLGA 1N8OB 1GJ8B 1MZDA 3AAVA 5T6FA 3RXQA 2GV7A 1S0QA 2FP7B 1J14A 1GJAB 4JK6A 2RA3A 1JRSA 5CHAB 2BD3A 4AORA 3TGIE 2RG3A 2ZI2H 5GWZA 2ALVA 5DP5A 3DA9B 4SGAE 5DP4A 5GXPA 3F3BA 1O3DA 4XSKU 1SGTA 1DFPA 4CRGA 1AGJA 2XWAA 3OEHD 2WV4A 1PQ7A 1O3BA 4H42U 5DN6D 1Z1IA 5K7RA 2A4RA 1IAUA 3TVJB 1GI2A 2AGEX 3KQCA 4RI0A 1FDPA 5FPYA 3RC5A 1C2MA 1HXEH 1KTSB 2ZPQA 4A6LA 4UFGH 1A4WH 2WPDD 4K1TA 4I86A 1HAOH 2H9HA 1TBQH 2ZHFH 5F53A 2XCNA 4AYVB 1UTPA 5EXMA 5JYIA 1XXDA 3M7UA 1J8AA 2BOKA 3SORA 1OWEA 1C2HA 3CENA 3EGKH 3UB0A 3BEUA 4PROA 4ABJA 2AMQA 2ODYB 2Y7XA 1EKBB 3N99A 1H9HE 1C1RA 5B6LA 4YOIA 1THSH 1QHRB 2W6ID 3PMJA 3V3MA 2ZHEH 5EG4A 1C1MA 4A1VA 2GMTB 3L33A 2GZ7A 3BTWE 3P8GA 1Q3XA 1OP8A 4GHQA 5E0GA 2RFKC 1FY3A 2OC0A 2RA0A 1CA8B 1D3PB 5AHGH 4WMFA 2TGAA 3UQOA 3SJIA 3ZZ9A 3URDA 1FJSA 2QCYA 2V3MA 2ZGJA 4GHTA 4K2YA 3DFLA 1F0SA 2F43B 3EE7A 5EPYA 4F49A 2G8TA 4IN2A 2ZU1A 3HGNA 1QZ8A 1ELGA 4O03A 1YF4A 1EP6A 4FVDA 3W94A 1GVKB 1LHGH 3TNSA 2XOKD 1W0YH 1LVMA 3IITA 5TJXA 1D4PB 1LVBA 3MU4A 3P6ZB 3PYHA 4ZXXH 1TNKA 1O2UA 4Y8XA 2VU8E 3TU7H 4ABBA 2A7JA 1HAXB 1GI5A 1F0RA 1A0HB 1MABB 4ZROA 2UUYA 2A2XH 2XTTB 2J95A 2SGAA 3E3TA 1HV7A 2FDAA 2ZGBH 2VNTA 3LKWA 4JZIA 3DSOA 2YNBA 1GMCF 4XBCA 2EQNA 1TX7A 2A0QB 4AG2A 3Q3KA 2ZF0H 2XBXA 1O2NA 1AUTC 3UIRA 3ZVDA 3A7WA 5FL7D 1TNIA 4LOYH 3E90B 1IHTH 4E7RG 4AYYB 5EPNA 2RCEA 1K1OA 2XCFA 1BTPA 5A0BA 3QX5H 4INHA 3BTQE 2ZDKA 1C5NH 4OGYA 4FXGH 4X8VH 1KSNA 3F9GA 3VFEA 5DKMA 2HPPH 1V2KT 1G30B 2ZFSA 2XC5A 1ELVA 1PJPA 1CGJE 1SGIB 2BDHA 4I31A 3GISB 9ESTA 2BDAA 1ELFA 3FN8A 2BQWB 1QY6A 2QXGA 1OPHB 2SGQE 3S9CA 2A31A 3UR9A 1OP0A 3SU3A 1L4DA 1GI7B 1ESAA 3VGCC 1ELEE 3TIUA 2WPLS 2NU4E 3M61U 1RIWB 1P2JA 1QL7A 1BMNH 2W3KA 4K69A 1BRCE 5T6DA 1TMTH 4ZCNA 2GCHG 4M7GA 5C94A 3V7TA 1P2MA 1TPAE 2AMPA 2CXVA 3VXFH 1CT4E 1TGCA 1OS8A 5L2YH 1AE5A 3K6YA 2VINA 3DD2H 3CS0A 5H4IB 1ZJKA 2FX6A 4BAMB 1O5DH 1SQAA 2O8MA 3ZZCA 1V2TT 1MQ6A 4ABHA 4IN1A 1OSSA 2A45B 3SQHE 5HGGA 5IK2D 1TE0A 2BDGA 4FUFA 3T28A 1YLCA 1S6LA 1XUIA 3WWBA 2BY8X 3UTUH 2GKVE 1RS0A 1O3JA 2ZDAH 4MNXA 1AD8H 2C8YB 2GDDA 3RXHA 3HPTB 1TABE 1S82A 2VB0A 4X8SH 5DP8A 4MNYA 1HAVA 1DY8A 3F9FA 3Q3YA 4AB8A 1FONA 2F4LA 2G55A 5IYTA 3N7OA 5E2OA 1UK3A 1O2MA 5CHAC 3VB6A 1Y5UT 1UO6A 2IJOB 4A1XA 1IQLA 2XNIA 1GCTC 3GY4A 1YPEH 2OD3B 3OEED 1SGCA 3RMMH 4JZFH 1O2IA 3CP7A 4OS5A 5FPTA 1EB1H 1E35B 1UCYE 1YPLH 2WPKS 3W95A 1P02A 4YT6H 1GI4A 2JETB 1SGFG 4UE7H 2A5IA 5A09A 1GJ5H 3ZVAA 3UWJH 3KQDA 1CSOE 2F9BH 5EJ1A 1EOLA 3N7EA 3SI4H 1QB6A 1D9IA 2CK3D 4A7IB 1MBMA 1OWIA 2GD4B 3SU4A 3BIVH 3A7XA 1GBBA 3V0XA 1P01A 1O3IA 4IMZA 3SNEA 2FOCA 1YCPK 4X8UH 1TPOA 3MYWA 1RJXB 4NIYA 3B23B 1SVPA 4NSVA 2A32A 2GDEH 4FUHA 3RXLA 1TOMH 1P0SH 4XBDA 3H7TA 1ESBA 1EXFA 4X6MA 4CBNA 3TGJE 2STAE 1QBVH 2WPMS 3IG6B 3QUMP 3SO3A 5F8ZA 3WWFA 4B1TA 4LZ1H 3PLPA 3E91A 4K60A 4Q2KA 3UOUA 2P8OC 4FU9A 3LC3A 5I25A 1GHWH 1WTGH 3OSYA 1LQDB 2BYAX 5FAHA 1C1NA 1F2SE 5HXFA 2GCTC 4YTAA 3BV9B 1COWD 3AW1A 1A5GH 2BY9X 1K1MA 4ISOA 1G9IE 3FZZA 4JZ1A 5EQSA 3BTME 4UEHH 3MH6A 1ZHMA 1ELAA 2VIQA 2FMJA 3ZYEA 5LPEA 4J2YB 2OTVA 1YPGH 1BZXE 1K1JA 1NY22 1GCTB 4WMEA 1O5BB 2PW8H 4H6TA 3VEQB 3LGTA 5FCKA 3SV6A 1L1JA 5LPRA 1G2MA 2P8OB 1PPZA 3QGJA 4Q80A 3ATLA 1MZAA 1SGDE 3K65B 1S83A 1HAHH 1O2VA 5KEDA 1V2VT 1O35A 1BMAA 2FOAA 2BLQA 4XDEA 4B71A 5CDFE 3SN8A 1DWCH 2JH5D 1WOFA 3EA9A 2GV6A 4U32A 2VIDA 4NA7A 1IQGA 1LHCH 3S7HB 2ZECA 1SGPE 2PP6A 2P3UB 3S9AA 3OY5U 3A7TA 1G3DA 1GDQA 3PTNA 2DE8A 3KGPA 2C8WB 3D65E 4B2CA 2G81E 1YGCH 1Y5AT 3SNAA 5SGAE 2QF3A 1GGDC 1DWBH 5BPEA 1DLKB 1IQHA 3DCLA 4GPGA 2WINI 3MTYA 2WUCA 3QTOH 5GJ4B 4JCNA 4Y0ZE 1TQ0B 2BOHB 2W7SA 3GCHB 1V6DA 5A8YA 2GP9B 4Y8ZA 1SGRE 3Q3XA 3SGBE 4WF8A 3ELAH 2UWLA 5K0HA 2ZTYA 2H2ZA 1U6QA 5ABWA 3EA7A 1UTOA 1UW7A 1V2ST 1ZSLA 1Z1JA 2BY7X 2FLRH 5C1YA 1WAYB 3M5NA 1AUJA 2B7DH 2ZCHP 3U28C 1A0LA 2ANWA 2OP9A 2AEIH 3KQ5A 5AVDA 1O3CA 3ZVBA 2BD9A 1C2KA 3A81A 3MU5A 1LPGB 3T25A 1ABIH 3LH1A 4DT7B 1N1LA 3SJ8A 1O2WA 2KFWA 1BOQA 1TYNA 1D6RA 1YP9A 4TWYA 1O2RA 4ISIH 2OK5A 3G01A 5T3HA 2O9QA 1DX5M 1QFKH 4MNWA 3ZZ6A 1LO6A 1CO7E 1T4UH 4Y8YA 2ZU5A 4ZHMU 3SQEE 7LPRA 1P2NA 2ZDMA 1HAYB 2NU2E 3OTPA 4WJG2 3SV9A 1BTXA 2NU3E 1G2LA 4FVBA 3P95A 1O3OA 4D8NA 1TMUH 3QN7A 7ESTE 2ZC9H 2QE7D 4UDWH 1GDNA 3KQEA 4JZDH 5GNDA 3PM3A 2KCAA 1F92A 1MD7A 1GCDA 3K6ZA 1SSXA 1RTFB 4NWKA 3QO6A 4NSYA 3VB4A 4ABFA 2A4QA 1GJ6A 1D3TB 2TGDA 3MHWU 4OS6A 3URCA 1TNLA 3U1JB 2QXJA 5DP7A 2A1DB 3I77A 1WUNH 2QXHA 4H4FA 2Y7ZA 3QGNB 4MDSA 1EPTA 2BXTH 3B9FH 4WH6A 2JH0D 2V3OH 2Z3EA 2FI5E 2FOHA 6LPRA 5E0JA 4FUGA 1GL1A 4LXBH 2ZQ1A 5FX6A 3ZZ8A 1TMBH 1NZQH 3MH5A 2YMSB 1MKWK 1DDJA 1AE8H 3SU6A 3UPEA 1KXCA 1FIWA 5EW1H 5FPSA 3M7TA 1OHHD 3PTBA 1SKYE 1TRMA 2ESTE 1C2EA 1GBHA 1SB1H 2PHBA 1K1IA 1NU9A 2HGTH 1T32A 2VVVA 4GSOA 2NU1E 2BVXH 1D3DB 4WWYA 3ZZ5A 1GI8B 3SJKA 5FCRA 3F2FA 4AG1A 1SLWB 1YPHC 1ZSKA 2DE9A 2SGEE 3ZVCA 5DK1A 2W5EA 2ODPA 2ZEBA 2R0LA 1QBOA 2HPQH 1E38B 2J38A 4XD7D 1C1OA 2Q1JA 3E1XB 3VG8A 3OYPA 1OWKA 1BBRH 1SLUB 3PWBA 1OWDA 1K1PA 2W3IA 2ANMH 3HATH 1G3CA 3ZZAA 1DE7H 1T8LA 2R2MB 2Z6BD 3C27B 1E1QD 2J9NA 3A8CA 4A5TS 2FIRH 1EZQA 4QT8C 4Z6AH 3GDSA 4GUXA 1MD8A 2H5CA 4O9VA 1AB9B 1FUJA 2FOFA 2HVXA 4Z1MD 1KY9A 1KLJH 1OWJA 1NC6A 1FY4A 1XUGA 1Y3XA 4B76A 1RXPA 3GCHC 2KCOA 2ZU3A 4ISLA 1MTUA 1BTYA 1P11E 2OC1A 4OS4A 2CJIA 5C1UA 4E06H 1ZTJA 2KZ4A 1IHSH 1C2GA 4I8GA 3VGCB 2SGDE 2FOEA 1PQ5A 2CHAB 8ESTE 1XMNB 3BG4B 3TK9A 4THNH 1GJ7B 2K1QA 1O5EH 2VGCC 3E0NB 1YYY1 4NA8A 2D26C 5KECA 4KKDA 1FY5A 1P8VC 3SHCH 1G37A 1DSTA 1K22H 5ESTE 4AFUA 4NGAH 4DG4A 1H9IE 1TA6A 3EQ0H 2W26A 3V12A 1AQ7A 1O3FA 4WXIA 2HNTF 1O2KA 3UNQA 2M2AA 3LGYA 4ZKRU 1MCVA 3TITA 4MPUA 5CMXH 2XYAA 4DW2U 1NU7B 4AGKA 4FUJA 3M7QA 3MH7A 2ZWLH 2D2DA 1ZMLA 4ZHAA 1LPZB 1C5QA 4I8JA 4GVUA 3SBKA 2WPHS 2Y82A 1GGDB 5HKKD 1NS3A 1AHTH 4CR5A 3M3SA 3TH2H 1J15A 4TY6A 4XE4A 3VB7A 2F91A 4AX9H 4INKA 3ZV8A 2W7UA 1BHXF 1NPMA 1S85A 3BSQA 1ARCA 1KLTA 2PSXA 2VWOA 2XW9A 4CR9A 3A87A 1Z8RA 4YZUA 1N8OC 1LHDH 3U8RH 1HIAA 1ETTH 1L0ZA 1QJ1B 1VCPA 2GCTB 3RC4A 1DSUA 1TFXA 1TGTA 2QN5T 3R3GB 4YT7H 3B8JA 5L30H 2XBVA 4MVNA 3SUDA 1Z7KA 3A7VA 3AW0A 3KN2A 1W2KH 2A5KA 2PTCE 4BANB 4IC6A 1EFRD 1WXRA 2EI8A 4NZQA 1GWAA 2EEKA 4P00A 3MO6A 1PYTC 2FOGA 4AC9A 3NRLA 3F9HA 1GMHF 1LVYA 3KHVA 4Y79A 3FP8E 2I6SA 3QK1A 2ZGXH 3UREA 3UOPA 1H9LB 2VJ1A 1FQ3A 3GOVB 3E6PH 1FN6A 1W12U 5FXLA 1O2YA 3KF2A 2Y5GA 3A8AA 3M5MA 1AI8H 1WQVH 3RXCA 1INCA 5T1VA 1N6YA 2ZFRH 3PV4A 4Y6DA 3OU0A 4WXVA 1NFYA 3RXSA 1DT2A 1KXAA 2Z94A 2BD4A 5C5NA 1H1BA 4CHAC 1WYKA 1P2IA 1BCUH 1LQEA 1EQ9A 3ZVGA 2FZZA 1OYTH 3FP6E 1W7XH 1P2OA 1W0JD 2OCVB 4HFPB 4LZ4B 2BX4A 1EAWA 3GY8A 3PRDA 6GCHG 1S0RA 3FKSD 3RXDA 4ZKNU 3OFND 2D8WA 3SU5A 4SGBE 1O3PB 1RFNA 2NWNA 2UUFB 1W3CA 1UTQA 2C3SA 4DIIH 3BTTE 1OWHA 1VCWA 1KXDA 1AN1E 2SNWA 1O2SA 3P8NA 2AFQB 3BTKE 5C2ZA 1GBEA 2PR3A 3FAOA 1F5RA 4GLYA 5GCHF 1G36A 3PO1C 3UNSA 3H5CB 2ZKSA 1ID5H 3GYLB 1DPOA 1NFXA 2Y81A 2ZP0H 3AASA 4ISNA 2BVSH 3MI4A 1V2WT 3GCNA 3SZEA 1EASA 2FM2A 2BQ7B 2BD7A 2FESH 1C1PA 3Q76A 3ZVFA 1HUTH 1A5HA 1HRTH 3D49H 1YWUA 1EAXA 2ZHDA 2TGTA 4X6NA 1MTSA 4GCHG 3RLYH 2G4TA 2V7QD 2BD8A 5I46H 1W11U 4OS2A 5EW2H 3RXTA 1TX6A 1UHBA 4ABDA 3QZRA 1OKXA 1NTPA 1PQAA 2UWOA 4K8BA 1K0HA 4F55A 1ZMNA 4MG3A 1EX3A 1SGYE 3O8CA 2IOTA 2GJGA 1AVWA 1BTZA 1OXGA 1GBTA 1RTLA 2QF5A 4NCYA 4NFFA 2WPIS 1AZ8A 1G3EA 1SOTA 1VJAU 1ELTA 2ZO3H 3QWCH 4MPWA 3V13A 1EPTC 2P95A 2Y5HA 2CMYA 1RTKA 1BJVA 2O8WA 3BG8A 2G51A 2BQ6B 1V2OT 4I32A 5C17A 2VVCA 4X2VA 4Q4LA 4U01A 5EOKA 5J4SA 1O0DH 2YOLA 3PLBA 1YPHE 5LH8A 1TAWA 1MKXK 5IDKA 2AS9A 1FPCH 2KM0A 1J17T 1NRNH 3A89A 4IGDA 2XXLA 4ABAA 2GVFA 1FV9A 1QURH 4K5ZA 2OBOA 2JIZD 1YY3A 3MO9A 3MNSA 1OX1A 1DY9A 1V2MT 3ZVEA 2V6NA 1UTNA 5A8ZA 4U2WA 2CV3A 1A46H 3SUEA 1BTHH 2ZNKH 5L2ZH 4DJZB 5DSFA 3RXMA 4FUIA 1ZPCA 3M3VA 3SUFA 3VPKA 1HFDA 1WU1A 3SYJA 1IOEA 2KR7A 4X2WA 3GDUA 2HWLB 4Q7ZA 3P17H 2GZ8A 3ATKA 2WZQA 1A7SA 1ELBA 1WDIA 1C5PA 2K0QA 1FAKH 1HJ8A 1YBWA 5C1XA 1O33A 4ISHH 4OM9A 2C90B 3BTHE 2QYIA 3SW2B 3T27A 4MPVA 2PSYA 1YLDA 5JPMH 7KMEH 3DUXH 4DIHH 1JXPA 1EPTB 1Z8IB 3RXVA 1ZRKA 2BMGB 1BUIA 1GJ4H 2Z9LA 4MTBA 5JB9S 2BXUH 4DT4A 1ETRH 1EZXC 3U98H 1C2IA 2J34A 2H6MA 1AFQC 1DANH 1FN8A 4Y0YE 1GI0A 1NT1A 1C5VA 5F6MA 3ATWA 1FY1A 2EI6A 3EDXB 3BIUH 4VGCC 1C1TA 5EIYA 2WV9A 1ANBA 1FXYA 2BY6X 2ZFTA 1UCYK 4Y7AA 3GICB 4HI3A 1QQUA 4Z0KA 1H8HD 1PYTD 1BDAA 3H7OA 2J98B 4Q7XA 3PMBB 1TB6H 5GCHG 3HKJB 1E36B 1FAXA 1W10U 3NCLA 5C67A 1GDUA 1LHEH 2ZDNA 1GJ9B 1HLTH 2BZAA 3LDXH 1GJDB 3EYDA 2BB4A 3M35A 3RXRA 1GG6C 2R3UA 3JZ1B 2FPZA 1UK2A 1SLVB 2CHAC 2ZHWH 1UVOA 5JDUB 3A88A 1DWDH 4XBBA 2M5TA 1G3BA 4BTTB 1C5XB 1Q2WA 3P92A 1ZHRA 1V2PT 3RU4D 3OX7U 2XBWA 2A5AA 3BTDE 1A3BH 3FO8D 5EXLA 4F4OC 2ZHQH 2ZZUH 2JJ2D 3KL6A 4I8HA 3SI3H 4ABGA 1TA2A 3RDZA 2R3YA 4YLUA 5CE1A 2VWLA 1X7AC 2P3TB 1C1UH 2ZGHA 3UY9A 1QRXA 4TYDA 2ANKH 3KYGA 2WUBA 1DS2E 1QCPA 2ZA5A 4ZMAH 1HIAB 1AZZA 2VWNA 2PLXA 5TCAA 3ODFA 3BTGE 1ANEA 3PMAB 1JWTA 1O2GH 1D6WA 2ZIQH 1MCTA 5DG6A 2VIWA 1TNGA 3DSPA 3JZ2B 1V2LT 2ZGCA 3GY6A 2KCPA 1YPMH 2C8ZB 1EATA 3LH3A 2YMSC 3T62A 1PPHE 1QRZA 1SFQB 1BIOA 2J2UA 3EE0B 3AVZA 2EA3A 1DOJA 2FEQH 3RMOH 1IQNA 1EZSC 3DFJA 4AFQA 1O2LA 3GY5A 3KNXA 3NUMA 2BLWA 3MNBA 1SHYA 4WH8A 1CHGA 2FS8A 5C0UA 1B7XB 1F5LA 1ZHPA 1O2JA 1TGBA 4UONA 1XX9A 3GS9A 4CH8B 5LPFA 4XRNA 1O2HA 2B5TB 2XRCA 1BA8B 5E0HA 2EC9H 3TPIZ 1SGEE 1GI3A 4FUEA 5JBTA 4NA9H 1Z71A 3ZV9A 1CHOG 1ZTKA 1SG8B 1G32B 1KXBA 5A0AE 3OTJE 1P03A 2BLOA 1ZGVA 4IS5A 2OC8A 1PQ8A 1ZPZA 3ODDA 1O30A 4X6OA 4I8LA 3HGPA 1T8OA 1F0TA 3F9EA 1CE5A 4WY3A 1GI6A 1CGHA 1SBWA 4ABEA 2G5NA 4TY7A 5A0CA 3PV2A 2FTLE 1FPHH 1CHOF 4X8TH 4X1RU 5GDSH 2HALA 3RLWH 4BOHA 5HIYA 1HJAC 1EZUC 2ZCKP 1P2QA 1GHVH 3F0OA 4OS7A 5C5OA 1C5ZB 4ZKOU 1H8ED 4ZAEA 1BHXB 1GHXH 2BLVA 2EI7A 1RRKA 3E8LA 2ZFFH 5E8EH 2JJ1D 3PMHB 2FX4A 4IW4E 4Q63A 3MO3A 3DHKH 5TCCA 1Z8JB 4K3JA 1UVTH 1Y3YA 1THPB 2FYQA 1C5SA 3CS7A 1QR3E 4ABIA 4MLFB 3T26A 2QIQA 1LKBA 4AB9A 1GMDF 2Z9KA 3UAIC 4D76A 1TIOA 4YLQH 4OS1A 1VZQH 5C0TA 1BMLA 3TK5A 1TX8A 1PFXC 4OGXA 1F0UA 1P3CA 4NIVA 2G4UA 3S0NA 1NO9H 1GJBB 2P93A 4FETA 1DM4B 1Z6JH 4MNVA 1HJ9A 1EAUA 4J1YA 2Q6GA 3T5FH 1K1LA 1ETSH 3L6PA 1SGQE 1O2ZA 1NRRH 2FI4E 2BD5A 1C5LH 2VH0A 2FWWA 2A7HA 2GT7A 3ZZ3A 4D9RA 7GCHG 2QA9E 2ILNA 5F03A 2OQUA 1W7GH 3W1EA 4B74A 1KXFA 2FLBH 2H9TH 4NIXA 3MOCA 1NROH 3RM0H 1GHAF 2PKAA 4B6FA 1PPCE 1P09A 1C5MD 2PV9B 3D23A 5JBCS 5EQQA 2VVUA 3BTFE 3MU1A 3BEIB 2SGPE 4FOUC 3RXFA 1W13U 1V2QT 3O8DA 1GVLA 4CH2B 1AFQB 1A61H 2HVYB 2J97A 1O5GH 1LDTT 3DT0H 1MTNB 4XOJA 3S9BA 4FUDA 1IQKA 2BDYA 3OE7D 1UVPA 5DO4H 1LCYA 4RKJB 2F83A 3GY7A 4BAQB 5HYOA 3LU9B 2RDEA 1WBGB 2HNTE 1HCGA 3BEFB 2AERH 1WV7H 1E37B 2BTCE 5GIBA 1FNIA 2FOMB 2OBQA 1WQSA 1UCYH 1SQTA 4B2BA 2CN0H 1O3MA 1MBQA 3ZZBA 3A8BA 1UMAH 1HAZB 1P04A 4NG9H 1BQYA 4ACAA 1FMGA 3RP2A 4AFZA 1O2PA 1C1WH 2G5VA 2GT8A 1CBWB 2IPQX 3FOAA 3N7DA 2AGGX 4U30A 4K1SA 3LPRA 1T8MA 3ZYDA 5DGJA 1MTVA 1NFUA 1QB1A 1YPKH 2FO9A 1GBMA 3RM2H 1O2TA 2L74A 3GY3A 4CREA 4B2AA 4AOQA 3ZZ7A 1WTHD 1Y5BT 1WSSH 3LGUA 2BM2A 3ATIA 2TPIZ 3STJA 1LMWB 3MMGA 1TNHA 1O3LA 2UUJB 2WYGA 3MNXA 4IBLH 3RXUA 1Q31A 1TGNA 3ATMA 4KP0A 1SR5C 2Z7FE 1N6XA 1SC8U 3SGQE 1ZTLA 3HKIB 2BD2A 3A8DA 2AYWA 1W8BH 2G52A 1ZJDA 2ODQA 3QDZB 4HGCA 4UD9H 4CRDA 3K2UA 4LK4A 3SV8A 2AIQA 1GMDG 1OYQA 2PKSC 3R0FA 3TLOA 5E2PA 2JH6D 2UUKB 4X1QU 3H09A 1DUEA 1GHBF 1S84A 4ACBA 4BNRA 2AHME 1W0KD 1O31A 1L1GA 2FODA 1BTUA 3U8TH 2FTMA 2TIOA 1TQ7B 1O36A 4Y71A 2SGFE 2GTBA 2QC2A 3TH4H 1H8IH 2D1JA 4R8TB 2YMSD 4GAWA 2FI3E 3RU4E 4YXWD 1CBWC 3A86A 1Y3VA 5DP3A 3MU0A 1K21H 2PGBB 1P12E 1C2LA 4DVAU 3RMLH 3O8BA 3U9AH 3LJOA 4YESB 5PTPA 2I6QA 2H9EH 1CT2E 1A1RA 1O38A 4IC5A 1J16A 2R9PA 1C2FA 2GZ9A 2B8OH 1LKAA 4KTUA 1ZYOA 5EJLA 2JDID 2Z3DA 5DP9A 1E79D 2YNAA 2K8IA 3A82A 2ZTXA 1TBRH 1BBRE 1HDTH 5DJ7A 1BT7A 1TBZH 4UFDH 1TPPA 1O3HA 3RUOA 1Y3WA 1MU8B 2OINA 5CHBA 4CRCA 1AY6H 5F8XA 1HAIH 1V3XA 1BJUA 2VIPA 3OY6U 1BTWA 2FS9A 1QGFA 1QTFA 5ETXA 4YO9A 1Y59T 3PV5A 5DP6A 3TJOA 2KCYA 3SU0A 1GPZA 1XKAC 3BTEE 1GG6B 1SQRA 1O5CB 1SGNE 3FP7E 5EXNA 5C20A 4K1EA 2GCHF 1HXFH 1O5FH 4X2YA 3RXEA 1O32A 3NWUA 4Y11E 2GX4A 1VCQA 3UQVA 1KDQA 2PUXB 4Y7BA 1YCPH 2A4OA 2J94A 1CA0B 3FANA 1HB0B 2FXRA 1L1NA 4HZHA 4RN6A 2QV1A 1W0ZU 2B9LA 4AFSA 1V2NT 5JB8S 4JYVH 3F68H 7GCHF 2QXIA 4O97A 1P06A 3VB5A 2WHXA 3BG4C 4P02A 3RXJA 4ASUD 3TJNA 4YM9A 1EB2A 1HGTH 2VIOA 5EU8A 2F9OA 4KGAA 4ESTE 1BRUP 5EQRA 1PPGE 1NBMD 4RKOB 3BF6H 1XUKA 1ACBE 1JOUB 2R2WU 1P57B 5FHTA 1TOCB 1GBCA 3RXGA 1C5RA 1MQ5A 3RMNH 4TPIZ 1CGIE 2A7CA 4JK5A 8GCHG 1CT0E 6ESTA 1L4ZA 4DURA 1UTJA 1QA0A 1VGCC 3M5OA 2OC7A 2J98A 3SZNA 1TALA 1BBRK 1VITH 2XNDD 1C5UA 2H5DA 3GCTG 3TK6A 1A0JA 1EJMA 1VR1H 4DCDA 1KXEA 3TJUA 2ALPA 3NZIA 5EGMA 1MMJN 4O3UA 1S81A 3MFJA 1F5KU 1L2EA 5T6GA 3GYMA 5G4BA 4Y10E 3M5LA 3HK3B 2WV5A 1SMFE 2L6OA 1K1NA 1AO5A 3P8FA 2LPRA 1ZLRA 3C1KA 1QBNA 2QY0B 2IN2A 1XUJA 1QQ4A 3SV2H 3OAAD 1QJ6B 1C1VH 1XXFA 1AVXA 4VGCB 2BDIA 1NRQH 3U8OH 1GBDA 1GHBG 3LIWA 2TBSA 2PKSB 3GY2A 3LC5A 4JMYA 4ASHA 3PROA 1MKXH 1YLNA 5BRRE 3VXEH 2SFAA 1FY8E 3PB1E 1NRPH 1YC0A 3MQKC 1A2CH 1DVAH 3SNBA 2F9PA 1GVZA 1DWEH 5HM9A 4HG6A 3SNCA 3NXPA 4I8KA 4D7FA 3EA8A 1ZGIA 1O2OA 1O3KA 4O3TA 2BHGA 2CGAA 1VGCB 1CVWH 1QIXB 1CU1A 2PGQB 1QJ7B 1C2JA 2O8TA 4FUBA 1O3NA 2Y80A 2GGVB 3KQBA 1C4Y2 3ENSB 4BAOB 2ZU2A 3P8OA 1BB0B 4Q7YA 4TT3D 3NK8A 1O3EA 3UR6A 1ZZZA 3ESTA 2HLDD 2STBE 1Z6EA 4GCHF 4NWLA 1ABJH 1LVOA 3SV7A 1NESE 2RDLA 4WMDA 1TWXB 2UWPA 1AB9C 3SOSA 4ZHLU 3UFAA 2O8UA 3STIA 3GDVA 1DXPA 3RXKA 3PWCA 1W14U 4XFQA 1PPFE 1XVMA 4DOQA 1EUFA 4E05H 2ZPSA 1IQFA 2ZG0H 4CRBA 1HAGE 2W6JD 3S69A 2P94A 1NM6A 1V2RT 3HK6B 3RXOA 1ZSJA 2F9NA 3NPSA 4X2XA 2AIPA 2ZPRA 1TGSZ 4AGJA 5A8XA 1S6HA 1F7ZA 2IPHA 1CQQA 1KDQB 1T7CA 4NFEA 1GBJA 4UFEH 2J5UA 1BMFD 5KGOA 1YPJH 1E0FD 2AGIX 1HYLA 3KEEA 1JMOH 1MUEB 4X0WU 2HRVA 5AFYH 1GHYH 3ZZ4A 1P10A 2QF4A 1EOJA 4TPYA 1GBAA 4X1NU 4B73A 1SLXB 3SGAE 1WCZA 5HMAA 3IWMA 5ESBA 2IJD1 3F6UH 2JKHA 2C8XB 4KELA 3SU2A 4BAKB 3BN9A 1O5AB 1GI1A 2ASUB 2F9UA 4X6PA 3RC6A 4BXWA 4B6EA 1MKWH 2FYRA 4K8YA 1T31A 2J4IA 2DUCA 3P70B 3PO1B 5JBAS 1C4V2 1ZR0A 2C93B 1DUAA 1JIRA 2EY4C 3UWIA 1BRBE 1GBIA 1UVSH 3Q00A 3T29A 1C5WB 2VIVA 1C5OH 8LPRA 2TGPZ 1HBTH 2CF9H 4AZ2B 1RGQA 2WPJS 4I7YH 1C9PA 3TJVA 2A2QH 1SI5H 4YOJA 1PPBH 1GMHG 1KLIH 3E16B 4TSFD 2Z9GA 1DITH 1YM0A 2VGCB 2P59A 1JBUH 3MU8A 4INLA 1YKTA 2XWBI 4M9FA 5AFZH 1KMHB 3ZIAD 2BZ6H 1EJNA 1S5SA 2OQ5A 1SOZA 1J9CH 4HTCH 1SGFA 4WVPE 1P05A 2KX4A 2WYJA 4ZUHA 1O3GA 3MNCA 1NRSH 4FU7A 4CRFA 1AMHA 1EAIA 3A85A
chains in the Genus database with same CATH topology
4D7GA 1ANCA 3M36A 3QZQA 2THFB 3TH3H 3RXBA 2BX3A 2OUAA 1O2QA 5J4QA 1C1SA 2BY5X 1K9OE 2Z9IA 3A7ZA 3I78A 8KME2 3S7KB 4ZH8A 1ZPBA 3K9XB 1O2XA 1UVUH 3SUGA 4DY7B 2ZDVH 1C5YB 3RU4T 5AF9H 2XBYA 3M37A 1TRYA 2F9VA 2ZQ2A 4YOGA 1P2KA 5GPIB 1AWHB 3L3TA 4IMQA 1UJ1A 1ORFA 2KAIB 3D62A 4CHAB 1NFWA 3F1SB 2HOBA 1ZOMA 2B0FA 1BMMH 1OP2A 3RXIA 2VWMA 1H4WA 1XM1A 2NU0E 1FZZA 1GI9B 2CF8H 2HNTC 6CHAB 2PUQH 1GBLA 4A1TA 3SU1A 4JYTA 4E7NA 3U1IB 1MAYA 2OXSA 1B5GH 3SJ9A 1TLDA 1D3QB 1UK4A 1MTNC 1QL9A 3QTVH 1ELCA 4R0IA 1VJ9U 5FBEA 8GCHF 9LPRA 1T4VH 1LHFH 3LOXA 3VB3A 4NIWA 3I29A 2JETC 1IQJA 5HM2A 4CRAA 1BRAA 5F8TA 1CA0C 2Y5FA 1XVOA 3PLKA 2ZFPH 2Q6DA 5EODA 2HLCA 3SJOA 2C4FH 4BTUB 1AU8A 2AMDA 2R0KA 2GMTC 5A2MH 1GHAG 4H6SB 1HAPH 4NZLA 1ZRBA 4Y76A 2A4GA 3SHAH 2SNVA 1AKSA 1QL8A 1SL3A 1XKBC 2ZTZA 1JIMA 1C1QA 3FZDA 1KTTB 3UUZA 1UTKA 1GHZA 1GL0E 1P3EA 2Z3CA 1K28D 1MAXA 1HAVB 3EAJA 5FX5A 1XUFA 4D9QA 1KYNA 2F3CE 2PTNA 1MH0A 2V3HH 1RIWC 5LGOA 1DXWA 1DICA 1VITG 1TNJA 4I33A 4X1PU 1P9UA 3ITIA 1EP5A 1E34B 1YCPM 1ZMJA 1C2DA 1H8DH 2ZU4A 1THRH 1Z8GA 3LT3A 4MQAA 1MTWA 1HNEE 3ZZDA 3A84A 2KAIA 2Z9JA 1C4U2 4ZXYH 4KTSA 1K2I1 4AN7A 2BDCA 3A83A 1TRNA 1VITF 1B0EA 2PKAB 6CHAC 1UHBB 3AAUA 4BXSA 6GCHF 3SNDA 5FBIA 1O3AA 2P3FH 3QLPH 4UFFH 2QAAA 4KTCA 1O37A 2P16A 1ELDE 2TRMA 3LJJA 4BAHB 3T2NA 1IQIA 1LPKB 2XC4A 2ZDLA 1BITA 3U69H 1GBKA 4X1SU 1A5IA 1FLEE 1JRTA 1AFEH 2QF0A 3A7YA 5L6NH 3RXAA 2FOBA 4BTIB 1Y3UA 1Y8TA 2ULLA 1MU6B 1A3EH 1AWFH 4JZEH 1FIZA 1TPSA 1B0FA 2J92A 3A80A 2BVRH 1ARBA 1IQMA 3LGIA 1AIXH 1SFIA 4ZKSU 1O39A 3O8RA 1C9TA 2ANYA 5JBBS 3RXPA 3LONA 2AH4X 1C5TA 4CBOA 3FFGA 2Y6TA 2QGRA 3WY8A 1V2UT 1EJAA 1HPGA 2BDBA 1V2JT 3MWIU 1ESTA 1QB9A 2V35A 2PWXA 1AKSB 1GJCB 1HJAB 4FUCA 3KIDU 5C3NA 2ZFQH 2VH6A 3LGWA 5B6OA 3FVFB 4FU8A 1PPEE 4RSPA 4A92A 2ZCLP 1P9SA 1O34A 1QA7A 1SPJA 1KIGH 1NN6A 2G00A 1GMCG 1QRWA 1UTMA 1LTOA 1S6FA 1XUHA 1SHHB 3KCGH 1SQOA 1AVGH 1FI8A 3NKKA 3UNRA 2LNCA 1RD3B 2V0BA 4DGJA 3M3TA 1M9UA 2H1UA 4B75A 4TWWA 3GCOA 2PFEA 3TNTA 3Q77A 5DPAA 3E0PB 3MH4A 1IQEA 2XC0A 3TGKE 1OOKB 1GBFA 1UTLM 2O8LA 2Q6FA 1ANDA 1T8NA 3LGVA 1DLEA 3GCTF 4JYUH 4MPXA 1QNJA 1TONA 2OLGA 1N8OB 1GJ8B 1MZDA 3AAVA 5T6FA 3RXQA 2GV7A 1S0QA 2FP7B 1J14A 1GJAB 4JK6A 2RA3A 1JRSA 5CHAB 2BD3A 4AORA 3TGIE 2RG3A 2ZI2H 5GWZA 2ALVA 5DP5A 3DA9B 4SGAE 5DP4A 5GXPA 1O3DA 4XSKU 1SGTA 1DFPA 4CRGA 1AGJA 2XWAA 2WV4A 1PQ7A 1O3BA 4H42U 1Z1IA 5K7RA 2A4RA 1IAUA 3TVJB 1GI2A 2AGEX 3KQCA 1FDPA 5FPYA 3RC5A 1C2MA 1HXEH 1KTSB 2ZPQA 4A6LA 4UFGH 1A4WH 4K1TA 1HAOH 2H9HA 1TBQH 2ZHFH 2XCNA 4AYVB 1UTPA 5EXMA 5JYIA 1XXDA 3M7UA 1J8AA 2BOKA 3SORA 1OWEA 1C2HA 3CENA 3EGKH 3BEUA 4PROA 4ABJA 2AMQA 2ODYB 2Y7XA 1EKBB 1H9HE 1C1RA 4YOIA 1THSH 1QHRB 3PMJA 3V3MA 2ZHEH 5EG4A 1C1MA 4A1VA 2GMTB 3L33A 2GZ7A 3BTWE 3P8GA 1Q3XA 1OP8A 4GHQA 5E0GA 1FY3A 2OC0A 2RA0A 1CA8B 1D3PB 5AHGH 4WMFA 2TGAA 3UQOA 3SJIA 3ZZ9A 3URDA 1FJSA 2QCYA 2ZGJA 4GHTA 4K2YA 3DFLA 1F0SA 5EPYA 4F49A 2G8TA 4IN2A 2ZU1A 3HGNA 1ELGA 4O03A 1YF4A 1EP6A 4FVDA 3W94A 1GVKB 1LHGH 3TNSA 1W0YH 1LVMA 3IITA 5TJXA 1D4PB 1LVBA 3MU4A 3P6ZB 3PYHA 4ZXXH 1TNKA 1O2UA 4Y8XA 2VU8E 3TU7H 4ABBA 2A7JA 1HAXB 1GI5A 1F0RA 1A0HB 4ZROA 2UUYA 2XTTB 2A2XH 2J95A 2SGAA 3E3TA 1HV7A 2FDAA 2ZGBH 2VNTA 3LKWA 4JZIA 2YNBA 1GMCF 4XBCA 1TX7A 2A0QB 4AG2A 3Q3KA 2ZF0H 2XBXA 1O2NA 1AUTC 3UIRA 3ZVDA 3A7WA 1TNIA 4LOYH 3E90B 1IHTH 4E7RG 4AYYB 5EPNA 2RCEA 2XCFA 1K1OA 1BTPA 5A0BA 3QX5H 4INHA 3BTQE 2ZDKA 1C5NH 4OGYA 4FXGH 4X8VH 1KSNA 3F9GA 3VFEA 5DKMA 2HPPH 1V2KT 1G30B 2ZFSA 2XC5A 1ELVA 1PJPA 1CGJE 1SGIB 2BDHA 4I31A 3GISB 9ESTA 2BDAA 1ELFA 2BQWB 1QY6A 2QXGA 1OPHB 2SGQE 3S9CA 2A31A 3UR9A 1OP0A 3SU3A 1L4DA 1GI7B 1ESAA 3VGCC 1ELEE 3TIUA 2WPLS 2NU4E 3M61U 1RIWB 1P2JA 1QL7A 1BMNH 2W3KA 4K69A 1BRCE 5T6DA 1TMTH 2GCHG 4M7GA 3V7TA 1P2MA 1TPAE 2AMPA 2CXVA 3VXFH 1CT4E 1TGCA 1OS8A 5L2YH 1AE5A 3K6YA 2VINA 3DD2H 3CS0A 5H4IB 1ZJKA 2FX6A 4BAMB 1O5DH 1SQAA 2O8MA 3ZZCA 1V2TT 1MQ6A 4ABHA 4IN1A 1OSSA 2A45B 3SQHE 5HGGA 1TE0A 2BDGA 4FUFA 3T28A 1YLCA 1XUIA 2BY8X 3UTUH 2GKVE 1RS0A 1O3JA 2ZDAH 4MNXA 1AD8H 2C8YB 2GDDA 3RXHA 3HPTB 1TABE 1S82A 2VB0A 4X8SH 5DP8A 4MNYA 1HAVA 1DY8A 3F9FA 3Q3YA 4AB8A 1FONA 2G55A 5IYTA 3N7OA 5E2OA 1UK3A 1O2MA 5CHAC 3VB6A 1Y5UT 1UO6A 2IJOB 4A1XA 1IQLA 2XNIA 1GCTC 3GY4A 1YPEH 2OD3B 1SGCA 3RMMH 4JZFH 1O2IA 3CP7A 4OS5A 5FPTA 1EB1H 1E35B 1UCYE 1YPLH 2WPKS 3W95A 1P02A 4YT6H 1GI4A 2JETB 1SGFG 4UE7H 2A5IA 5A09A 1GJ5H 3ZVAA 3UWJH 3KQDA 1CSOE 2F9BH 1EOLA 3SI4H 1QB6A 1D9IA 4A7IB 1MBMA 1OWIA 2GD4B 3SU4A 3BIVH 3A7XA 1GBBA 3V0XA 1P01A 1O3IA 4IMZA 3SNEA 2FOCA 1YCPK 4X8UH 1TPOA 3MYWA 1RJXB 4NIYA 3B23B 1SVPA 4NSVA 2A32A 2GDEH 4FUHA 3RXLA 1TOMH 1P0SH 4XBDA 3H7TA 1ESBA 1EXFA 4X6MA 4CBNA 3TGJE 2STAE 1QBVH 2WPMS 3IG6B 3QUMP 3SO3A 5F8ZA 4B1TA 4LZ1H 3PLPA 3E91A 4K60A 4Q2KA 3UOUA 2P8OC 4FU9A 3LC3A 5I25A 1GHWH 1WTGH 3OSYA 1LQDB 2BYAX 5FAHA 1C1NA 1F2SE 5HXFA 2GCTC 4YTAA 3BV9B 3AW1A 1A5GH 2BY9X 1K1MA 4ISOA 1G9IE 3FZZA 4JZ1A 5EQSA 3BTME 4UEHH 3MH6A 1ZHMA 1ELAA 2VIQA 2FMJA 3ZYEA 5LPEA 4J2YB 2OTVA 1YPGH 1BZXE 1K1JA 1NY22 1GCTB 4WMEA 1O5BB 2PW8H 4H6TA 3VEQB 3LGTA 5FCKA 3SV6A 1L1JA 5LPRA 1G2MA 2P8OB 1PPZA 3QGJA 4Q80A 3ATLA 1MZAA 1SGDE 3K65B 1S83A 1HAHH 1O2VA 1V2VT 1O35A 1BMAA 2FOAA 2BLQA 4XDEA 4B71A 3SN8A 1DWCH 2JH5D 1WOFA 3EA9A 2GV6A 4U32A 2VIDA 4NA7A 1IQGA 1LHCH 3S7HB 2ZECA 1SGPE 2P3UB 3S9AA 3OY5U 3A7TA 1G3DA 1GDQA 3PTNA 2DE8A 3KGPA 2C8WB 3D65E 4B2CA 2G81E 1YGCH 1Y5AT 3SNAA 5SGAE 2QF3A 1GGDC 1DWBH 5BPEA 1DLKB 1IQHA 4GPGA 2WINI 3MTYA 2WUCA 3QTOH 5GJ4B 4JCNA 4Y0ZE 1TQ0B 2BOHB 2W7SA 3GCHB 1V6DA 5A8YA 2GP9B 4Y8ZA 1SGRE 3Q3XA 3SGBE 4WF8A 3ELAH 2UWLA 5K0HA 2ZTYA 2H2ZA 1U6QA 5ABWA 3EA7A 1UTOA 1ZSLA 1V2ST 2FLRH 1Z1JA 2BY7X 5C1YA 1WAYB 3M5NA 1AUJA 2B7DH 2ZCHP 1A0LA 2ANWA 2OP9A 2AEIH 5AVDA 1O3CA 3ZVBA 2BD9A 1C2KA 3A81A 3MU5A 1LPGB 3T25A 1ABIH 3LH1A 4DT7B 1N1LA 3SJ8A 1O2WA 1BOQA 1TYNA 1D6RA 1YP9A 4TWYA 1O2RA 4ISIH 3G01A 5T3HA 2O9QA 1DX5M 1QFKH 4MNWA 3ZZ6A 1LO6A 1CO7E 1T4UH 4Y8YA 2ZU5A 4ZHMU 3SQEE 7LPRA 1P2NA 2ZDMA 1HAYB 2NU2E 4WJG2 3SV9A 1BTXA 2NU3E 1G2LA 4FVBA 3P95A 1O3OA 4D8NA 1TMUH 3QN7A 7ESTE 2ZC9H 4UDWH 1GDNA 3KQEA 4JZDH 3PM3A 1F92A 1MD7A 1GCDA 3K6ZA 1SSXA 1RTFB 4NWKA 3QO6A 4NSYA 3VB4A 4ABFA 2A4QA 1GJ6A 1D3TB 2TGDA 3MHWU 4OS6A 3URCA 1TNLA 3U1JB 2QXJA 5DP7A 2A1DB 3I77A 1WUNH 2QXHA 4H4FA 2Y7ZA 3QGNB 4MDSA 1EPTA 2BXTH 3B9FH 4WH6A 2JH0D 2V3OH 2Z3EA 2FI5E 2FOHA 6LPRA 5E0JA 4FUGA 1GL1A 4LXBH 2ZQ1A 5FX6A 3ZZ8A 1TMBH 1NZQH 3MH5A 1MKWK 1DDJA 1AE8H 3SU6A 3UPEA 1KXCA 1FIWA 5EW1H 5FPSA 3M7TA 3PTBA 1TRMA 2ESTE 1C2EA 1GBHA 1SB1H 2PHBA 1K1IA 1NU9A 2HGTH 1T32A 2VVVA 4GSOA 2NU1E 2BVXH 1D3DB 4WWYA 3ZZ5A 1GI8B 3SJKA 5FCRA 4AG1A 1SLWB 1YPHC 1ZSKA 2DE9A 2SGEE 3ZVCA 5DK1A 2W5EA 2ODPA 2ZEBA 2R0LA 1QBOA 2HPQH 1E38B 2J38A 1C1OA 2Q1JA 3E1XB 3OYPA 1OWKA 1BBRH 1SLUB 3PWBA 1OWDA 1K1PA 2W3IA 2ANMH 3HATH 1G3CA 3ZZAA 1DE7H 1T8LA 2R2MB 2Z6BD 3C27B 2J9NA 3A8CA 4A5TS 2FIRH 1EZQA 4QT8C 4Z6AH 3GDSA 4GUXA 1MD8A 2H5CA 4O9VA 1AB9B 1FUJA 2FOFA 2HVXA 1KY9A 1KLJH 1OWJA 1NC6A 1FY4A 1XUGA 1Y3XA 4B76A 1RXPA 3GCHC 4ISLA 2ZU3A 1MTUA 1BTYA 1P11E 2OC1A 4OS4A 2CJIA 5C1UA 4E06H 1ZTJA 1IHSH 1C2GA 4I8GA 3VGCB 2SGDE 2FOEA 1PQ5A 2CHAB 8ESTE 1XMNB 3BG4B 3TK9A 4THNH 1GJ7B 2K1QA 1O5EH 2VGCC 3E0NB 1YYY1 4NA8A 2D26C 4KKDA 1FY5A 1P8VC 3SHCH 1G37A 1DSTA 1K22H 5ESTE 4AFUA 4NGAH 4DG4A 1H9IE 1TA6A 3EQ0H 2W26A 3V12A 1AQ7A 1O3FA 4WXIA 2HNTF 1O2KA 3UNQA 3LGYA 4ZKRU 1MCVA 3TITA 4MPUA 5CMXH 2XYAA 4DW2U 1NU7B 4AGKA 4FUJA 3M7QA 3MH7A 2ZWLH 2D2DA 1ZMLA 4ZHAA 1LPZB 1C5QA 4I8JA 4GVUA 3SBKA 2WPHS 2Y82A 1GGDB 1NS3A 1AHTH 4CR5A 3M3SA 3TH2H 1J15A 4TY6A 4XE4A 3VB7A 2F91A 4AX9H 4INKA 3ZV8A 2W7UA 1BHXF 1NPMA 1S85A 3BSQA 1ARCA 1KLTA 2PSXA 2VWOA 2XW9A 4CR9A 3A87A 1Z8RA 4YZUA 1N8OC 1LHDH 3U8RH 1HIAA 1ETTH 1L0ZA 1QJ1B 1VCPA 2GCTB 3RC4A 1DSUA 1TFXA 1TGTA 2QN5T 3R3GB 4YT7H 3B8JA 5L30H 2XBVA 4MVNA 3SUDA 1Z7KA 3A7VA 3AW0A 3KN2A 1W2KH 2A5KA 2PTCE 4BANB 4IC6A 2EI8A 4NZQA 1GWAA 2EEKA 3MO6A 1PYTC 2FOGA 3F9HA 1GMHF 1LVYA 3KHVA 4Y79A 3FP8E 2I6SA 3QK1A 2ZGXH 3UREA 3UOPA 1H9LB 2VJ1A 1FQ3A 3GOVB 3E6PH 1FN6A 1W12U 5FXLA 1O2YA