1S0QA

Native bovine pancreatic trypsin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pancratic bovine Trypsin native and inhibited with Benzamidine from synchotron data.
rcsb
molecule keywords Trypsinogen
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0qA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1s0qA02
3SNBA 1FUJA 1EB1H 2Q6FA 1ZYOA 1IQKA 3BIVH 1KDQA 2FI3E 1CGIE 2P59A 5FX6A 1AQ7A 4D76A 4A5TS 1C1VH 1GI5A 1T8MA 2Q6DA 2P16A 1GI9B 1LVYA 1C5QA 1GDNA 4JZFH 1DY8A 1GMDG 1SGIB 1MTWA 1TGSZ 3LIWA 4K1EA 3GCHC 1TAWA 2A32A 3VPKA 3L33A 2P95A 2Z9KA 2FX4A 3Q3YA 5JBBS 4CHAB 4YT6H 1J15A 5ESTE 2ZU1A 2P8OC 2JKHA 3E8LA 1Y3XA 1BTYA 5A2MH 1V2LT 3DT0H 1U6QA 3ZZ7A 3RXFA 4DOQA 1GBMA 3ZVEA 1NC6A 3UTUH 3KL6A 3T29A 4NFFA 1EJNA 3UR6A 1EP5A 3I29A 1L1NA 1QFKH 1V2RT 2EEKA 1CE5A 5C2ZA 1VZQH 1MAYA 1GBFA 1BTXA 1EOJA 1WTGH 3GY6A 2A7JA 4MLFB 3TK6A 2ZFRH 1HIAB 1NFUA 4Q80A 4KTSA 3B8JA 2THFB 1Y3VA 1Y3UA 2NWNA 2BLQA 4NWKA 4B2AA 1ANCA 4FUCA 1MQ6A 2O9QA 1HAXB 2QIQA 1ELCA 1C2JA 4DJZB 1IQHA 4BAHB 1JOUB 1MD7A 2H2ZA 1CT0E 2ZTZA 3FAOA 1G9IE 1TGBA 3RXUA 2NU4E 1K9OE 1FY8E 4AFZA 2PW8H 3LGWA 1MH0A 1P9UA 1F0RA 4MPWA 2BDAA 4XE4A 2AS9A 4OS4A 2A31A 1D9IA 1INCA 2OC7A 5BRRE 1QB9A 3R3GB 1MKWH 2P8OB 1P9SA 1PQ5A 4RKJB 2Y80A 5DJ7A 4NGAH 3RXVA 3NUMA 4YOGA 1HRTH 1NFXA 5DGJA 4D8NA 1CBWC 1H9IE 2FOBA 1EUFA 2V35A 3LGIA 2V3OH 2BY8X 3BF6H 1B5GH 5AHGH 1NM6A 2ZDAH 1OWKA 4U32A 5ETXA 4UFFH 1W0YH 1FY3A 3ZVBA 2A5KA 1EP6A 1TA6A 4NIXA 5F8XA 3MHWU 1BJVA 1FV9A 4F49A 1EZUC 1QURH 5A8YA 3A88A 4ESTE 2BLOA 2DE9A 2GMTC 5DP8A 3RXQA 3URDA 2JH0D 3TITA 3SJOA 1JXPA 2A4RA 3BTFE 3URCA 3P17H 1TFXA 2GKVE 2OQUA 3BIUH 3ATLA 4Y8ZA 2FYQA 3BEFB 2BDCA 2PSYA 5LH8A 1YPHC 1MCVA 1T8OA 3LH1A 4X8VH 1GMDF 1EATA 2W26A 4Y7AA 3OX7U 4ABGA 1MQ5A 1AFQB 2VNTA 1TMTH 2ANWA 3SUDA 1BMMH 2Y7XA 1KLJH 1Y5AT 1Z8RA 2H9EH 1LPKB 1AN1E 3ZZ3A 1O3AA 5FHTA 3QDZB 1S6HA 1CBWB 5CE1A 1FIZA 1SFQB 2HGTH 3TGJE 4TPYA 3Q77A 1LDTT 1UK2A 1EZQA 4BAMB 3SI3H 5EGMA 2BVRH 2QXHA 2XW9A 4FU9A 3TK9A 4Y7BA 5T6GA 1SGDE 1LHGH 2H5CA 1SGFA 3RXMA 1FNIA 4K1TA 1NT1A 5GDSH 1QNJA 2VINA 1FY4A 1AU8A 5C1YA 3MU4A 3NK8A 3RXBA 4UONA 3SJ8A 1EAWA 3BN9A 3PROA 2FOHA 3PTNA 2FESH 1NY22 3T26A 3VEQB 2BD5A 2VIWA 1XUKA 1F5LA 2UUJB 2J38A 3T2NA 2VIQA 3MH4A 2A4QA 5L2ZH 8GCHG 2PSXA 3RXKA 3HGPA 1FI8A 1O2VA 4FXGH 4E05H 4YESB 4A1XA 1PQAA 3KQDA 4CRCA 2TRMA 1N1LA 2Z3DA 1C2HA 1VITG 2C3SA 2ANMH 1WCZA 2WINI 3P92A 2ZU5A 4ABEA 1HJ8A 2IJOB 4ZAEA 1GI6A 2BYAX 2SFAA 1K1OA 3K6ZA 3M5OA 2FZZA 1W0ZU 3RXAA 1GBAA 1GMCG 2FOGA 5JB9S 1HAVA 1EPTC 5A0BA 3CS7A 4O97A 2BXUH 2BD7A 1C5TA 3F6UH 1LTOA 1YPJH 2R0LA 9LPRA 4HZHA 2LNCA 1CQQA 1GI3A 2HVXA 1YPGH 1ELBA 2FOFA 1A2CH 1KXDA 1C2KA 3HKIB 1LHCH 1ZSJA 2O8TA 1N8OC 2AH4X 2AYWA 3CS0A 3U98H 1E36B 3V0XA 1T8LA 3GY3A 1BBRE 5GIBA 2UWLA 2A5IA 1TPOA 3H7TA 1C2EA 1NFYA 1ETRH 2G5NA 3AW1A 3I77A 2TGTA 1O5FH 1LVOA 3W95A 5C1XA 4OS7A 1TALA 1O3BA 2OTVA 3LOXA 4ABIA 2WUBA 1AVGH 1QA7A 2STAE 1TX7A 2HOBA 1ZHPA 1XUIA 3FP8E 2PR3A 3ATWA 1DANH 3GY2A 2GV7A 4Q7YA 2SGQE 4Y76A 4SGAE 1FPHH 3I78A 4ISLA 4I8GA 1XKAC 1P0SH 2VWNA 4KP0A 4NFEA 2BZ6H 1BMLA 1TE0A 4D7FA 1UTOA 4NWLA 2ZA5A 1W8BH 2ZTXA 1D3TB 1A3EH 3QO6A 2WPLS 4YM9A 1V2MT 4Y11E 1XMNB 3U9AH 1KTTB 2XWBI 3KN2A 1SGFG 3EE0B 3U1JB 3BTTE 1GI2A 1K1NA 3BG8A 2GT7A 2YNBA 4JYTA 3S0NA 2GGVB 4LXBH 1FONA 1YCPH 1IQEA 2WYJA 1F0UA 2BQ6B 1ABJH 1UHBB 6LPRA 1ELDE 4FUDA 1PYTD 1O30A 2H6MA 3EA7A 4I31A 1OWJA 3MU8A 2F9NA 1DLEA 1ZTJA 4BNRA 1O2SA 1TGNA 1E34B 1OP2A 2OC8A 5JB8S 1AWFH 4YLUA 3M37A 1ID5H 1WTHD 3KEEA 1QBVH 3T62A 2HRVA 4MNXA 1JWTA 4Y6DA 3UFAA 1O2PA 3R0FA 1ZGVA 2F9BH 2K1QA 1O2YA 4ABBA 1GJ4H 4WJG2 1P3CA 1V2VT 3RXDA 1XVOA 1DM4B 4GAWA 1G3EA 3OY6U 3GDUA 1GHBG 1C5SA 1VCQA 3A8BA 1DWDH 3V13A 4WY3A 1HFDA 4Y71A 2OBQA 2ESTE 4Y8XA 2Z6BD 3LC3A 5F6MA 1W3CA 3TH2H 3MO3A 2FODA 3A8AA 1EOLA 1CVWH 1FPCH 3SU3A 1F0TA 1YC0A 4AB8A 6GCHG 4D9RA 7ESTE 1PQ7A 1BBRK 1P03A 5EU8A 1SSXA 1O3CA 3TU7H 4PROA 1ETTH 2ALVA 2KAIA 3BEIB 1FY5A 1WSSH 3A86A 2A7CA 1ANDA 1MCTA 3HGNA 1GJ7B 1S5SA 2ZG0H 2VWOA 1THSH 3BTWE 3S9BA 3TJNA 5C3NA 3LPRA 1GL0E 1BCUH 1IAUA 3RC6A 3KHVA 2C8YB 4WWYA 3RXJA 2A1DB 3MTYA 2VU8E 2XYAA 2CF8H 1T8NA 2PKAB 2FOAA 4MNWA 2B8OH 1QB1A 1AUTC 1C2MA 1AE8H 1GHVH 1VR1H 1SGYE 1RRKA 1XX9A 1XKBC 1SB1H 4NA7A 1EX3A 2ZHFH 2OD3B 4O9VA 1KIGH 1O3JA 1SR5C 5EW2H 3BTQE 4A1VA 2J92A 2ZO3H 3F9HA 1EKBB 4CR5A 1EASA 1OSSA 1RJXB 1QL7A 2EI6A 1PPBH 2NU1E 1BOQA 1TBRH 2TGAA 1C5PA 3K65B 3OYPA 3NCLA 3EDXB 2BLVA 4A92A 3PO1B 1OPHB 2ZDVH 4K1SA 4U30A 1MBMA 2PTCE 1W13U 1W7XH 3HKJB 1C2FA 1O2HA 3DD2H 2BVSH 1C4U2 1C2DA 2SNVA 1O2UA 4ASHA 1DY9A 3SU4A 2QYIA 4TPIZ 1NRRH 2BQ7B 1DVAH 2PHBA 3SNDA 2CF9H 1SGTA 2QCYA 2AIPA 1D6WA 1HAHH 1UTPA 4NZQA 1O5EH 5LPRA 2Z94A 1TWXB 1XM1A 1S0RA 4AORA 2ZU2A 3NPSA 5FPSA 3VGCC 1C5RA 1OWEA 1TLDA 1LO6A 5DP3A 1S81A 2ZFFH 4TYDA 1KDQB 1LHDH 2ZHQH 2AFQB 2ANYA 4IN1A 1SLVB 1ZPBA 2P94A 1P06A 3PV4A 2BX4A 2GT8A 4MTBA 1MKXK 3D62A 2DUCA 3PMJA 3SU1A 1AUJA 3BTHE 4I8LA 3UUZA 1WU1A 1GHBF 2ZGBH 1J16A 1UO6A 3N7OA 1GL1A 1GJBB 1P01A 2YNAA 3E16B 4ZUHA 1QL9A 1HLTH 2QY0B 1MTNB 1BDAA 2ZCLP 2AMQA 3JZ2B 4H4FA 5C5OA 1VJ9U 1EB2A 1ZR0A 4ZKSU 2VWLA 1MTVA 2RG3A 1GBLA 1UCYH 4Z6AH 2C4FH 3LJOA 5DK1A 2O8LA 1C9TA 3M3SA 1NO9H 3M3TA 1O36A 2ZFTA 5JYIA 3ENSB 1ORFA 3MNBA 4JYVH 1EJMA 1AD8H 2WPKS 2F3CE 3FANA 3Q3XA 2ASUB 2AGIX 2GDEH 1SLUB 4OS1A 1E0FD 1UTMA 2ZPQA 1BT7A 2BTCE 3ZZ9A 1ZGIA 3TGIE 1RD3B 3P8GA 4B75A 3SO3A 1O3NA 1C1QA 2RA3A 3EYDA 1C1MA 1AKSB 1JIRA 1ELEE 4O03A 3A82A 3PWBA 3LGTA 1HYLA 1Y3YA 4GHQA 3GY8A 1TQ0B 1WQSA 5DPAA 2QGRA 2FI5E 2ZHEH 1TX6A 5EQRA 3BG4C 3QWCH 3O8CA 1K1JA 4UFGH 1UTNA 1Z1JA 3S7HB 5HYOA 2OXSA 2PV9B 3E6PH 1SGRE 1NTPA 2VWMA 4IN2A 4SGBE 1C1WH 1ANBA 1LPZB 1AZ8A 3UNSA 2ULLA 3HPTB 3NXPA 2ZNKH 1DITH 1DFPA 4IC6A 2H9TH 2HNTC 3TK5A 3LGVA 1K2I1 2HPPH 1IQGA 1GBCA 2G8TA 4ABFA 2ZPRA 1QJ7B 3KQBA 3UOPA 4ZKNU 1A46H 3RM0H 5L6NH 1O38A 3SI4H 4LK4A 3GY7A 1DSUA 1RIWC 3A85A 1ZHMA 4I8KA 1O2IA 2EC9H 1C1OA 4XOJA 1O2QA 4FU8A 1SMFE 1DWCH 2ZC9H 2ZQ2A 1FQ3A 1C5VA 4CRFA 1DOJA 5GWZA 2GZ7A 1A61H 1KY9A 1LKBA 4QT8C 5JDUB 5EXMA 1O2NA 1TGCA 1SVPA 5FCRA 5J4QA 1W14U 4I7YH 4CRGA 1O0DH 1TBQH 3QZRA 1O2GH 1P2KA 3E0PB 1AI8H 1ZJDA 3UPEA 1O5CB 1O32A 4Y79A 5C5NA 1CT2E 2PGQB 1AVWA 4HI3A 3ZV9A 3A7YA 4H6TA 4IMZA 2Q1JA 1GMHG 3GDVA 4NA8A 1K21H 3GCHB 2PFEA 3PTBA 1BB0B 1DE7H 1GI8B 1GBTA 5TCCA 3SV9A 3QN7A 3A89A 1ZJKA 1AZZA 1MAXA 1H4WA 4DG4A 3OTJE 1C5MD 6CHAC 5EOKA 1SFIA 1ZPZA 3QTVH 4X2VA 5IDKA 4GUXA 4H6SB 3H7OA 2ZU3A 4WH8A 1SGEE 1NU9A 1O33A 1NU7B 5AF9H 1TRNA 3RU4E 1ZTKA 2XBVA 3MH5A 3RXRA 1TOCB 3LC5A 1O2RA 1D3DB 1RIWB 1TMBH 4NIWA 1BRBE 1S84A 1HXFH 4OS2A 3A7VA 1GJ9B 4DY7B 2D2DA 2BVXH 3F9FA 1ZSKA 2O8UA 2G51A 1P11E 4JK5A 1O3LA 2C8WB 1T4VH 4BXSA 1BHXF 4CRDA 5L2YH 1A5GH 4XBBA 1TNIA 3Q3KA 5IYTA 2AMDA 3RXIA 1JBUH 1GHWH 1BTWA 1FLEE 1HIAA 2EI7A 2Z3CA 2ZGHA 5E2PA 1SPJA 2XRCA 3RMNH 3SJ9A 2Z9IA 1MZAA 3MNCA 1C2LA 1CU1A 3U69H 3SU5A 1KSNA 2JH6D 3BTGE 1NS3A 1DICA 3E0NB 4B71A 1C1TA 3M5MA 1CHOG 2TBSA 3BTKE 1IQLA 1G32B 2GCHG 4CR9A 4X8SH 1IOEA 5FBEA 5BPEA 4IMQA 2R9PA 3QZQA 4DIHH 3RXCA 3B23B 3ELAH 1D6RA 1TNHA 4MNYA 5FAHA 1P2MA 4BAKB 1C1SA 4VGCC 1H1BA 1GJAB 2VIDA 1PFXC 1GI1A 5HM2A 4NIYA 1NFWA 2OCVB 1SQOA 4FVDA 4A6LA 2G00A 2P3TB 4BAQB 1BQYA 3ODDA 4GSOA 1QY6A 3OY5U 3ZVDA 2HALA 5JBTA 4WF8A 4A1TA 4B74A 3U1IB 2XXLA 1ZLRA 3AAUA 4MVNA 1TIOA 1C5OH 4XSKU 1V2QT 4GCHG 3TIUA 4ZKRU 3MU0A 3TJUA 3ZZCA 4GPGA 3A84A 4BANB 5LGOA 5T6FA 5ABWA 1PPZA 4XBCA 1T31A 1QL8A 1EXFA 1PPFE 1F5KU 2GP9B 2GMTB 3P8NA 3QUMP 4NZLA 1NESE 2FP7B 5GXPA 3P70B 4HGCA 1JRSA 4ZHAA 2EA3A 4LZ1H 3PM3A 3KF2A 2BDIA 1NRPH 3BEUA 1S6FA 1ZHRA 5EODA 5I25A 3VB7A 1O3OA 4YOIA 1J17T 1GMHF 1MMJN 4CH8B 5FPTA 3SUFA 1A0JA 1GVKB 2B7DH 1LVBA 2DE8A 1V2JT 4DW2U 3STJA 4B73A 5A0CA 1SC8U 3M7TA 2AEIH 2UWPA 3SV2H 1T4UH 1O3GA 3AASA 2ZCKP 4JK6A 3SGAE 9ESTA 4JZEH 4XBDA 1ZPCA 5E0HA 2R0KA 1W7GH 4OS6A 4JMYA 1QQUA 2SNWA 2VVUA 1F2SE 1RFNA 3LDXH 2BMGB 1YKTA 4K8YA 3F9GA 8LPRA 4CRAA 2QN5T 1FAKH 4AFUA 4WMEA 7GCHG 3SZNA 1KXCA 2P3UB 2D8WA 2BD9A 2R2MB 3SNAA 1ZSLA 3HK6B 1IQIA 1WOFA 1MUEB 2FI4E 1GDQA 1IQFA 1C5XB 2JETC 3BTDE 1KLIH 1UK4A 5PTPA 5DO4H 1P2IA 1CHOF 3SORA 3FZDA 3ATIA 1IQNA 1VCWA 1Q31A 3SV8A 5DP5A 3ZZ4A 1EQ9A 5EW1H 4GLYA 1AMHA 1WUNH 1J8AA 3TVJB 1GDUA 2GCHF 1ELAA 1OYTH 2ZIQH 3NKKA 5I46H 2G5VA 3ZVFA 1C1PA 2F9PA 2V6NA 1ESAA 1JMOH 2PWXA 3K2UA 1FIWA 1Z71A 1C5WB 4ZHMU 3AW0A 4J2YB 4X0WU 4YTAA 1XUJA 4FUEA 1T7CA 1BRUP 3ZZ5A 3MNSA 1SBWA 1VGCC 2XWAA 1C2IA 1BMAA 4CH2B 3GY4A 2H9HA 3A7WA 4I33A 1QRZA 1K28D 4E7NA 5FXLA 2PUQH 3SU6A 1EPTB 1TPAE 2UWOA 3OU0A 1EAUA 4DCDA 1CT4E 4X1QU 1WV7H 4GCHF 5TJXA 2PUXB 3S9AA 1YPMH 1W12U 3GDSA 3A8CA 2C90B 2WPMS 3UWIA 3VB5A 1N8OB 5EG4A 1A0HB 3O8DA 3MO9A 3RP2A 2KAIB 2FLRH 1SLWB 3STIA 1WQVH 3U8RH 1Z1IA 3C1KA 1AY6H 2JETB 3IG6B 3ATKA 1ARBA 1PPEE 1F92A 1DDJA 1W11U 4FUJA 4WMFA 2CHAC 2GTBA 3VB6A 3LGYA 3BV9B 2BD8A 2P3FH 1O35A 1C1UH 1Z6JH 3KIDU 3UQOA 2ZPSA 3AVZA 4X6OA 1O2ZA 2FTLE 1H9LB 2BDGA 4RSPA 3E1XB 4IC5A 3A7TA 1O5DH 1CHGA 3GYMA 1GBKA 1P02A 2H1UA 1MTSA 1SGNE 1VGCB 5CHAC 1TX8A 4AFQA 1K1MA 3M36A 4YLQH 1J14A 1G2MA 3SUEA 5EPYA 1XVMA 3LKWA 4CRBA 1G2LA 4UFDH 1TONA 2WPIS 2AMPA 1SI5H 2IN2A 1DWEH 2W3KA 1SQTA 2O8MA 3SNEA 2Y6TA 1YCPK 3FVFB 3CP7A 2ODPA 3DFJA 3MI4A 4BTUB 2RCEA 2B9LA 3S7KB 8KME2 7GCHF 2Z7FE 2ZDKA 3RLWH 2NU3E 1QBNA 5DKMA 3MO6A 1UHBA 2Y82A 1WBGB 2FS8A 3PMBB 4CREA 1FZZA 1PPGE 4JZ1A 4ZXXH 1KXEA 1O2WA 2BM2A 1LKAA 2G52A 4DVAU 5JBAS 1WAYB 1HAZB 1KXFA 4UFEH 1NRNH 3W94A 4MG3A 1O2MA 2UUKB 4MPXA 1ELTA 2CHAB 1H9HE 1O5GH 1HJAC 1TRMA 1DUEA 1IQJA 1B7XB 1P2QA 2IPHA 3ODFA 1GBBA 3RXTA 1ZOMA 1IQMA 1RS0A 1Z8IB 4AFSA 3U8TH 1ZTLA 3RLYH 1BTPA 1O3IA 3ESTA 2A2XH 4HFPB 5EPNA 2A0QB 1RTFB 5E2OA 3PLPA 5CHAB 5EQQA 1BA8B 3A8DA 2ZZUH 2FXRA 4X2WA 2C8XB 1KLTA 1LCYA 3VXEH 2EI8A 2M5TA 1C1RA 1HNEE 1PYTC 1TNGA 2FO9A 2Q6GA 2ZHDA 1UVOA 1EAXA 4F4OC 3SU0A 1QCPA 4B76A 1EJAA 1NRQH 1QJ1B 1KTSB 4AGJA 2ZGJA 2IOTA 3UR9A 1G3BA 1A0LA 1K1LA 2OC0A 2RDLA 1CA0C 1TB6H 3DHKH 3A7XA 1NZQH 2VIVA 1UCYE 2FWWA 2SGFE 3GCTG 2FMJA 3VB4A 1O3MA 3A7ZA 2WPHS 1SHHB 3MMGA 1SHYA 5C67A 1SGQE 1DXWA 3UIRA 1YYY1 3LT3A 4R0IA 1YM0A 2XC5A 1AWHB 1Y3WA 4Z0KA 1V2KT 4X8TH 4KGAA 3SBKA 5ESBA 1CSOE 1ARCA 4INHA 1HAPH 1EZXC 1M9UA 1QTFA 1E35B 2PKAA 4FUHA 4UDWH 1F5RA 4AG2A 5K7RA 1HJAB 2PKSC 3SQHE 1TRYA 1LMWB 1A4WH 1SGPE 2FOMB 1Q2WA 2CXVA 1UTJA 3LONA 2D1JA 2FX6A 4OGXA 5E0JA 5AVDA 4AYVB 1UTQA 2QF0A 5FBIA 2J95A 1ESBA 1GJ8B 1BZXE 3D65E 1AO5A 4BTIB 1RGQA 4FU7A 5K0HA 4IW4E 4XDEA 3RDZA 2I6QA 1P04A 2WPJS 2ODQA 1O3EA 3T28A 1O34A 5L30H 4CHAC 4K2YA 1P8VC 1FDPA 1S83A 2TPIZ 3M5LA 4X6NA 5FPYA 1K22H 1FN6A 3GOVB 4X8UH 2GV6A 4INLA 5DP7A 4JYUH 3ITIA 1SQAA 3EAJA 4ABJA 2ZGXH 2J4IA 3F9EA 4DIIH 1HGTH 1L4DA 3PWCA 2Y5FA 1O2XA 3Q76A 3RU4D 3KGPA 1DT2A 1SLXB 2CMYA 2VH0A 3C27B 1GBDA 2AGGX 2PTNA 1LVMA 5SGAE 4MNVA 3TNSA 1UVSH 3UNQA 3VGCB 3H5CB 1D3QB 2BX3A 1N6YA 1UVTH 2QXGA 3VFEA 5A8XA 1HAOH 1P09A 2SGDE 4JZDH 2XCNA 1JIMA 2XBXA 2XCFA 3IWMA 3L6PA 3SGBE 1O2TA 2BD2A 2V3HH 1C4Y2 1C5NH 1LQEA 4NA9H 3HATH 1LHEH 1UMAH 2QA9E 1F7ZA 2SGPE 4B2CA 1UCYK 1LPGB 6ESTA 5DP9A 1AVXA 1NROH 3GCNA 2ZKSA 3ZVAA 1K1IA 3IITA 1VITH 5T3HA 2ZI2H 1P2JA 3FFGA 1B0EA 1P2OA 3MOCA 3RXEA 3ZVCA 1OP8A 2HNTE 1QRXA 2QF3A 1THPB 4CBOA 3A87A 3FZZA 4NCYA 3EQ0H 2BD4A 3SU2A 2NU0E 2ZWLH 3GCTF 4ZHLU 3RXPA 5B6OA 1G37A 4J1YA 3VB3A 1TYNA 4I8HA 4D9QA 3UWJH 1DX5M 2PGBB 2G4UA 3MWIU 5FX5A 1AFEH 2BXTH 3RM2H 3GYLB 2STBE 3A83A 4GHTA 2VVCA 1O3FA 5DP6A 1GI4A 1PJPA 1TNLA 2AGEX 4FUGA 1O2JA 2VGCC 3SN8A 1AKSA 1XUHA 2A4GA 2ZDMA 2FM2A 1A7SA 3M7QA 3BG4B 3MFJA 1Y8TA 4DT7B 1QIXB 2Y5HA 1XXDA 1Z8GA 2R2WU 1YP9A 5DP4A 3B9FH 2Y7ZA 1O3DA 1O31A 5EXNA 2CV3A 3RMMH 4ISHH 2A45B 3RU4T 3O8BA 1O3HA 1FMGA 1L0ZA 1XUFA 1AFQC 1MD8A 2FPZA 2G81E 1S0QA 4IBLH 3ZZDA 1CGHA 2BDYA 1A1RA 1ZMJA 2SGAA 1E37B 3LU9B 2W5EA 2HPQH 2Z3EA 2ZU4A 3V7TA 5A09A 5A0AE 3TJOA 1A5HA 1YPLH 3M3VA 2BB4A 1DLKB 2WV5A 1TNKA 2VIPA 1GI7B 1C5ZB 1AGJA 2GDDA 2BLWA 3V12A 2GZ9A 3RXSA 3PB1E 2QC2A 1G3CA 4RKOB 1YBWA 2RA0A 4ISOA 2CGAA 4RN6A 1HAYB 1ZMNA 5HXFA 1GVZA 4JCNA 4U2WA 1PQ8A 1Z8JB 1Y5BT 1GI0A 2UUYA 4FUIA 1D4PB 4E06H 3BTEE 4D7GA 4AGKA 2VGCB 3RXLA 5HMAA 4MQAA 4X1NU 1GHZA 1TBZH 1O3PB 2BDBA 1LQDB 2O8WA 1OS8A 2XNIA 4X1PU 1MTUA 3PMAB 1PPHE 1RTKA 3A81A 3ZZ6A 1YPHE 1V2TT 2F83A 2BDHA 4UE7H 1MKWK 1YLCA 6CHAB 4TWYA 4ABDA 1HV7A 1DS2E 2XC4A 5F8TA 1ZZZA 4TY6A 4LOYH 4K60A 4ABAA 1O5AB 3A80A 4MPUA 2ZDNA 1HJ9A 3RC4A 4KTUA 4WMDA 4X1SU 1OX1A 3ZYDA 1KYNA 1BTHH 4YZUA 1DUAA 1QQ4A 2B0FA 3ZVGA 1O37A 2XBWA 1KXAA 2ALPA 1NRSH 1HAVB 3ATMA 2J94A 1X7AC 1SOTA 2Y5GA 4FUBA 1GHYH 2QV1A 3SQEE 2FOEA 3UOUA 2F9VA 4TWWA 2BOKA 2OP9A 1J9CH 2AIQA 3UNRA 1V2OT 4GVUA 5H4IB 7LPRA 1QHRB 4KTCA 4NG9H 2BY5X 4TY7A 2FLBH 3SHCH 1GWAA 4BTTB 1THRH 3LJJA 1CGJE 2Y81A 5G4BA 1L4ZA 1FAXA 1D3PB 2FEQH 3M7UA 2GCTC 4WXVA 8ESTE 1DWBH 3MH7A 1GBIA 1QRWA 3PYHA 2BY9X 3FP7E 4YT7H 3MYWA 3AAVA 1QB6A 4ZKOU 4YOJA 1BJUA 3TNTA 1ZRKA 2VIOA 4VGCB 4AN7A 4CBNA 1TABE 2WUCA 3ZZAA 1EAIA 3P8OA 5GPIB 3SJKA 3E91A 2GVFA 1MU8B 2ZP0H 1YCPM 2BZAA 1F0SA 2A2QH 1TPPA 2ZTYA 1C5UA 2C8ZB 3ZZ8A 1MZDA 1AB9C 2ILNA 3PMHB 4AZ2B 5J4SA 1GJCB 3P6ZB 3QX5H 1ZMLA 1FY1A 2QXIA 2VH6A 1O2LA 2VVVA 1HAIH 4X2XA 3KNXA 1L2EA 3EA8A 2XC0A 4ZXYH 2ZGCA 2ZFPH 2JH5D 5F03A 1SOZA 1UTKA 1Z6EA 4O3TA 1WYKA 5C1UA 4AOQA 3SV7A 3SNCA 1GBEA 3DUXH 3MNXA 2BD3A 2G55A 1QA0A 1GJ5H 5JPMH 1HDTH 3MH6A 1H8DH 1V2UT 1JRTA 3DA9B 1CA8B 2GCTB 3GISB 2GX4A 3EA9A 2ZQ1A 3F1SB 4INKA 5HGGA 1V2ST 3EGKH 1C4V2 3D49H 3SJIA 3T27A 2VB0A 2TGDA 2HLCA 2ZDLA 3UREA 4FVBA 2R3UA 4NSVA 1Q3XA 1W2KH 1YLDA 3RMOH 1OYQA 5JBCS 4MPVA 1OXGA 2OLGA 4AX9H 3DFLA 1GG6C 1OP0A 3KQCA 1ESTA 2QXJA 3S69A 1ETSH 3QLPH 4ISNA 1AB9B 3G01A 4KELA 5GCHG 1RXPA 2TGPZ 4JZIA 3SGQE 1MBQA 1G30B 1NPMA 1TGTA 2ZF0H 3RC5A 1C5YB 2OINA 4BAOB 3RMLH 1ANEA 5AFZH 1IHSH 2ZECA 1A3BH 4I8JA 1BBRH 3KCGH 3RXGA 4U01A 5E0GA 4LZ4B 2J34A 4KKDA 3QK1A 2A4OA 1GHAG 3M61U 4UEHH 4XFQA 4B1TA 3NWUA 4ZH8A 1ZRBA 3LH3A 3UY9A 1DPOA 2F9UA 2FTMA 7KMEH 1BHXB 2H5DA 3RXHA 2OUAA 3RUOA 3U8OH 1ELFA 2G4TA 1XXFA 2Z9GA 4ZMAH 1HCGA 1G36A 2BOHB 5C20A 3M35A 5F8ZA 2BY7X 3D23A 3SHAH 1QBOA 2J9NA 2W7UA 4K3JA 2ZEBA 5E8EH 8GCHF 2FDAA 1LHFH 1YPKH 3QGJA 3QGNB 4Y10E 1HPGA 2F9OA 1GG6B 5EXLA 4A7IB 2CJIA 4DGJA 1W10U 2ZFSA 1VITF 1TNJA 2GD4B 1O39A 1V2PT 2PLXA 3KQEA 3K6YA 3MU1A 3Q00A 1TA2A 3T5FH 1Y5UT 1GBJA 1HBTH 1EPTA 4YO9A 5AFYH 4K69A 1S82A 1HB0B 5DG6A 1HXEH 1SG8B 1HUTH 1GMCF 2FIRH 1PPCE 2R3YA 1A5IA 3TGKE 1C1NA 3SV6A 3PO1C 3QTOH 2C93B 3FP6E 1C9PA 1GPZA 4NIVA 1CO7E 1DXPA 1KXBA 1P05A 1GBHA 1YF4A 4AYYB 3GICB 1QJ6B 1VCPA 2FYRA 2YOLA 4OS5A 5A8ZA 2P93A 1P10A 2OQ5A 2GZ8A 4Q7ZA 4BOHA 5FCKA 2F91A 1UVPA 4ISIH 4Y8YA 4AB9A 1P12E 2WV4A 2HWLB 3L3TA 2AERH 1ELGA 2QAAA 5EQSA 4X6PA 2XTTB 1OKXA 1QR3E 4NSYA 1SL3A 1HAGE 4R8TB 2ODYB 1BTUA 3HK3B 4K8BA 1Z7KA 1OWDA 1S85A 2UUFB 2HNTF 4Q7XA 2I6SA 1C5LH 2XBYA 1P2NA 5LPFA 3TH4H 1MKXH 4B2BA 1YGCH 1IHTH 4E7RG 2FOCA 1SGCA 1OWIA 2ZHWH 4UD9H 4O3UA 1O3KA 3ZV8A 4WXIA 1BIOA 1Y59T 5GCHF 3UQVA 4M7GA 3F68H 5T6DA 5CMXH 1MTNC 1UVUH 3GY5A 1ABIH 1K1PA 3LGUA 1GVLA 1FN8A 4IS5A 3RXOA 1GGDC 1BUIA 3TJVA 1G3DA 1TMUH 3GCOA 3PLKA 1H8IH 4H42U 3K9XB 2ZFQH 1O2KA 2ANKH 3SUGA 1GCTC 1UJ1A 4THNH 4Y0YE 3S9CA 4ZROA 1TPSA 4WVPE 4AG1A 4WH6A 3BTME 3O8RA 1BRAA 1GHAF 1TOMH 3TLOA 3T25A 3SOSA 1GJDB 1B0FA 2Z9LA 1L1JA 2OBOA 2NU2E 1AHTH 2Z9JA 1V2NT 1AE5A 1OWHA 1BTZA 1E38B 4ABHA 4OGYA 5TCAA 2SGEE 1P3EA 1V3XA 2FS9A 1UK3A 1C2GA 1EZSC 1DSTA 3TPIZ 2WYGA 3P8FA 1TQ7B 1OOKB 4MDSA 4FUFA 1RTLA 1ELVA 4Q2KA 3MU5A 3BSQA 4Y0ZE 4X2YA 1YPEH 3PLBA 2A5AA 5HM9A 3E3TA 1QGFA 1AIXH 2W7SA 2BQWB 3E90B 2J2UA 3M5NA 1P57B 3OSYA 1L1GA 2V0BA 1FJSA 1BRCE 1BMNH 3SW2B 2A7HA 5GJ4B 1GHXH 1NN6A 1T32A 1O5BB 2CN0H 3P95A 4I32A 4IGDA 1GCDA 1CA0B 1O2OA 1V2WT 5LPEA 3VXFH 4X1RU 3WY8A 4K5ZA 4BXWA 1MU6B 1UTLM 1GGDB 3JZ1B 3NZIA 2B5TB 1VJAU 2BHGA 3ZYEA 2OC1A 3ZZBA 2D26C 1FXYA 6GCHF 2TIOA 1ACBE 3V3MA 3CENA 4HTCH 1GCTB 2ZCHP 1XUGA 2W3IA 4X6MA 1GJ6A 2VJ1A 1BITA 2BY6X 4DURA 2LPRA 1V6DA 3TH3H 2PKSB 1N6XA
chains in the Genus database with same CATH superfamily
3SNBA 1FUJA 1EB1H 2Q6FA 1ZYOA 1IQKA 3BIVH 1KDQA 1NBMD 2FI3E 1CGIE 2P59A 5FX6A 1AQ7A 4D76A 4A5TS 1C1VH 1GI5A 1T8MA 2Q6DA 2P16A 4I86A 1GI9B 1LVYA 2LELA 2WV9A 1C5QA 1GDNA 4JZFH 1DY8A 1GMDG 1SGIB 1MTWA 1TGSZ 3LIWA 4K1EA 3GCHC 1TAWA 2A32A 3VPKA 3L33A 2P95A 2Z9KA 2FX4A 3Q3YA 3KQ5A 5JBBS 4CHAB 4YT6H 1J15A 2KCAA 5ESTE 2ZU1A 2P8OC 2KR7A 2JKHA 3E8LA 1Y3XA 1BTYA 5A2MH 1V2LT 3DT0H 1U6QA 3ZZ7A 3RXFA 4DOQA 3F2FA 1GBMA 3ZVEA 1NC6A 3UTUH 3KL6A 3T29A 4NFFA 1EJNA 3UR6A 1EP5A 1S6LA 3I29A 1L1NA 1QFKH 1V2RT 2EEKA 1CE5A 5C2ZA 1VZQH 1MAYA 1GBFA 1BTXA 1EOJA 1WTGH 3GY6A 2A7JA 4MLFB 3TK6A 2ZFRH 1HIAB 1NFUA 4Q80A 4KTSA 3B8JA 3UAIC 2THFB 1Y3VA 1Y3UA 2NWNA 2BLQA 3DCLA 4NWKA 4B2AA 1ANCA 4FUCA 1MQ6A 2O9QA 1HAXB 2QIQA 1ELCA 1C2JA 4DJZB 1IQHA 1UW7A 4XRNA 4BAHB 1JOUB 1MD7A 2H2ZA 1CT0E 2ZTZA 3FAOA 1G9IE 1TGBA 3RXUA 2NU4E 1K9OE 1FY8E 4RT0A 4AFZA 2PW8H 3LGWA 1MH0A 1P9UA 1F0RA 3F0OA 4MPWA 2BDAA 4XE4A 2AS9A 2QF5A 4OS4A 2A31A 1D9IA 1INCA 2OC7A 5BRRE 1QB9A 3R3GB 1MKWH 2P8OB 1P9SA 1PQ5A 4RKJB 2Y80A 5DJ7A 4NGAH 3RXVA 3NUMA 4YOGA 1HRTH 1NFXA 5DGJA 4D8NA 1CBWC 1H9IE 2FOBA 1EUFA 4RI0A 2V35A 3LGIA 1OHHD 2V3OH 2BY8X 3BF6H 1K0HA 1B5GH 5AHGH 1NM6A 2ZDAH 1OWKA 4U32A 5ETXA 4UFFH 1W0YH 1FY3A 3ZVBA 2A5KA 1EP6A 1TA6A 4NIXA 5F8XA 3MHWU 1BJVA 1FV9A 4F49A 1EZUC 1QURH 5A8YA 3A88A 4ESTE 2BLOA 2DE9A 2GMTC 5DP8A 1YLNA 3RXQA 3URDA 2JH0D 3TITA 3SJOA 1JXPA 2A4RA 3BTFE 3URCA 3P17H 1TFXA 2GKVE 2OQUA 3BIUH 3ATLA 4Y8ZA 2FYQA 3BEFB 2BDCA 2PSYA 5LH8A 4Q4LA 1YPHC 1MCVA 1T8OA 3LH1A 4X8VH 1GMDF 1EATA 2W26A 4Y7AA 3OX7U 4ABGA 1MQ5A 1AFQB 2VNTA 1TMTH 2ANWA 3AK5A 3SUDA 1BMMH 2Y7XA 1KLJH 1Y5AT 1Z8RA 2H9EH 1LPKB 3OAAD 1AN1E 3ZZ3A 1O3AA 4Z1MD 5FHTA 3QDZB 1S6HA 1CBWB 5CE1A 1FIZA 1SFQB 2HGTH 3TGJE 4TPYA 3Q77A 1LDTT 1UK2A 1EZQA 4BAMB 3SI3H 5GNDA 5EGMA 2BVRH 2QXHA 2XW9A 4FU9A 3TK9A 4Y7BA 5T6GA 1SGDE 1LHGH 2H5CA 1SGFA 3RXMA 1FNIA 4K1TA 1NT1A 5GDSH 1QNJA 2VINA 1FY4A 1AU8A 5C1YA 3MU4A 3NK8A 3RXBA 4UONA 3SJ8A 1EAWA 3BN9A 2J98B 3PROA 2FOHA 3PTNA 2FESH 1NY22 3T26A 3VEQB 2BD5A 2OK5A 2VIWA 1XUKA 1F5LA 2UUJB 2J38A 3T2NA 2VIQA 3MH4A 2A4QA 5L2ZH 8GCHG 3SZEA 2PSXA 4TSFD 3RXKA 3HGPA 1FI8A 1O2VA 4FXGH 4FETA 4E05H 4YESB 4A1XA 1PQAA 3KQDA 4CRCA 2TRMA 1N1LA 2Z3DA 1C2HA 1VITG 2C3SA 2ANMH 1WCZA 2WINI 3OTPA 3P92A 2ZU5A 4ABEA 1HJ8A 2IJOB 4ZAEA 1GI6A 2BYAX 2SFAA 1K1OA 3K6ZA 3M5OA 3PRDA 2FZZA 1W0ZU 3RXAA 1GBAA 1YY3A 1GMCG 2FOGA 5JB9S 1HAVA 1EPTC 5A0BA 3CS7A 4O97A 2BXUH 2BD7A 1C5TA 3F6UH 1LTOA 1YPJH 2R0LA 9LPRA 4HZHA 2LNCA 1CQQA 1GI3A 2HVXA 1YPGH 1ELBA 2AHME 2FOFA 1A2CH 1KXDA 1C2KA 3HKIB 4YXWD 1LHCH 1ZSJA 2O8TA 1N8OC 2AH4X 2AYWA 3CS0A 3U98H 1E36B 3V0XA 1T8LA 3GY3A 1BBRE 5GIBA 2UWLA 2A5IA 1TPOA 2XNDD 3H7TA 1C2EA 1NFYA 1ETRH 2G5NA 3AW1A 3I77A 2TGTA 1O5FH 1LVOA 3W95A 5C1XA 4OS7A 1TALA 1O3BA 2OTVA 3LOXA 4ABIA 2WUBA 1AVGH 1QA7A 2STAE 1TX7A 2HOBA 1ZHPA 1XUIA 3FP8E 2PR3A 3ATWA 1DANH 3GY2A 2GV7A 4Q7YA 2SGQE 4Y76A 4SGAE 1FPHH 3I78A 4ISLA 4I8GA 1XKAC 1P0SH 2VWNA 4KP0A 4NFEA 2BZ6H 1BMLA 1TE0A 4D7FA 1UTOA 4NWLA 2ZA5A 1W8BH 2ZTXA 1D3TB 1A3EH 3QO6A 2WPLS 4YM9A 1V2MT 4Y11E 1XMNB 3U9AH 1KTTB 2XWBI 3KN2A 1SGFG 3EE0B 3U1JB 3BTTE 2CK3D 1GI2A 1K1NA 3BG8A 2GT7A 2YNBA 4JYTA 3S0NA 2KZ4A 3SYJA 2GGVB 4LXBH 1FONA 1YCPH 1IQEA 2WYJA 1F0UA 2BQ6B 1ABJH 1UHBB 6LPRA 1ELDE 4FUDA 1PYTD 1O30A 2H6MA 3EA7A 4I31A 1OWJA 3MU8A 2F9NA 2KCYA 1DLEA 1ZTJA 4BNRA 1O2SA 1TGNA 1E34B 2XOKD 1OP2A 2OC8A 5JB8S 1AWFH 4YLUA 3M37A 1ID5H 1WTHD 3KEEA 4F55A 1QBVH 3T62A 2HRVA 4MNXA 1JWTA 4Y6DA 3UFAA 1O2PA 3R0FA 4P02A 1ZGVA 2F9BH 3WWBA 2K1QA 1O2YA 4ABBA 1GJ4H 4WJG2 1P3CA 1V2VT 3RXDA 1XVOA 1DM4B 4GAWA 1G3EA 3OY6U 3GDUA 1GHBG 1C5SA 1VCQA 3A8BA 1DWDH 3V13A 3UB0A 4WY3A 1HFDA 5KGOA 4Y71A 1FX0B 1E1QD 2OBQA 2ESTE 4Y8XA 2Z6BD 3F0PA 3LC3A 5F6MA 1W3CA 3TH2H 3MO3A 2FODA 3A8AA 1EOLA 1CVWH 1FPCH 3SU3A 1F0TA 1YC0A 4AB8A 6GCHG 4D9RA 7ESTE 1PQ7A 1BBRK 5C0TA 1P03A 5EU8A 1SSXA 1O3CA 3TU7H 4PROA 1ETTH 2ALVA 2KAIA 3BEIB 1FY5A 1WSSH 3A86A 2A7CA 1ANDA 1MCTA 3HGNA 3OFND 1GJ7B 1S5SA 2ZG0H 2VWOA 1THSH 3BTWE 3S9BA 3KYFA 3TJNA 5C3NA 3LPRA 1GL0E 1BCUH 1IAUA 3RC6A 3KHVA 2C8YB 4WWYA 3RXJA 2A1DB 3MTYA 2VU8E 2XYAA 2CF8H 1T8NA 2PKAB 2FOAA 4MNWA 2B8OH 1QB1A 2J97A 1AUTC 1C2MA 1AE8H 1GHVH 1VR1H 1SGYE 5DN6D 1RRKA 1XX9A 1XKBC 1SB1H 4NA7A 1EX3A 2ZHFH 2OD3B 4O9VA 1KIGH 1O3JA 1SR5C 5EW2H 3BTQE 4A1VA 2J92A 2ZO3H 3F9HA 1EKBB 4Q63A 4CR5A 1EASA 1OSSA 1RJXB 1QL7A 2EI6A 1PPBH 2NU1E 1BOQA 1TBRH 2TGAA 1C5PA 3K65B 3OYPA 3NCLA 3EDXB 2BLVA 4A92A 3PO1B 1OPHB 2ZDVH 4K1SA 4U30A 1MBMA 2PTCE 1W13U 1W7XH 3HKJB 1C2FA 1O2HA 3DD2H 2BVSH 1C4U2 1C2DA 2SNVA 1O2UA 4ASHA 2EY4C 1DY9A 3SU4A 2QYIA 4TPIZ 2YMSC 1NRRH 2BQ7B 1DVAH 2PHBA 3SNDA 2CF9H 1SGTA 2QCYA 2AIPA 1D6WA 1HAHH 1H8HD 1UTPA 4NZQA 1O5EH 5LPRA 2Z94A 1TWXB 1XM1A 1S0RA 4AORA 2ZU2A 3NPSA 5FPSA 3VGCC 1C5RA 1OWEA 1TLDA 1LO6A 5DP3A 1S81A 2ZFFH 3F2GA 4TYDA 1KDQB 1LHDH 2ZHQH 2AFQB 2ANYA 4IN1A 1SLVB 1ZPBA 2P94A 4B6EA 1P06A 3PV4A 2BX4A 2GT8A 4MTBA 1MKXK 3D62A 2DUCA 3PMJA 3SU1A 1AUJA 3BTHE 4I8LA 3UUZA 1WU1A 1GHBF 2ZGBH 1J16A 1UO6A 3N7OA 1GL1A 1GJBB 1P01A 2YNAA 3E16B 4ZUHA 1QL9A 1HLTH 2QY0B 1MTNB 1BDAA 2ZCLP 2AMQA 3JZ2B 4H4FA 5C5OA 1VJ9U 1EB2A 1ZR0A 4ZKSU 2VWLA 1MTVA 2RG3A 1GBLA 1UCYH 4Z6AH 2C4FH 3LJOA 5DK1A 2O8LA 1C9TA 3M3SA 1NO9H 3M3TA 1O36A 2ZFTA 5EIYA 5JYIA 5HIZA 3ENSB 1ORFA 2W6ID 3MNBA 4JYVH 1EJMA 5F53A 4ACAA 1AD8H 2WPKS 2F3CE 3FANA 3Q3XA 2ASUB 2AGIX 2GDEH 1SLUB 4OS1A 1E0FD 1UTMA 2ZPQA 1BT7A 2BTCE 3ZZ9A 2YMSB 1ZGIA 3TGIE 1RD3B 3P8GA 4B75A 3SO3A 1O3NA 1C1QA 2RA3A 3EYDA 1C1MA 1AKSB 1JIRA 1ELEE 4O03A 3A82A 3PWBA 3LGTA 4M9FA 1HYLA 1Y3YA 4GHQA 1MABB 3GY8A 1TQ0B 1WQSA 5DPAA 2QGRA 2FI5E 2ZHEH 1TX6A 5EQRA 3BG4C 3QWCH 3O8CA 1K1JA 4UFGH 1UTNA 1Z1JA 3S7HB 5HYOA 2OXSA 2PV9B 3E6PH 1SGRE 1NTPA 2VWMA 4IN2A 4SGBE 1C1WH 1ANBA 1LPZB 1AZ8A 3UNSA 4RT1A 2M2AA 2ULLA 3HPTB 2ZNKH 3NXPA 1DITH 1DFPA 4IC6A 2H9TH 2HNTC 3TK5A 3OEHD 3LGVA 1K2I1 2HPPH 1IQGA 1GBCA 2G8TA 4ABFA 2ZPRA 1QJ7B 3KQBA 3UOPA 4ZKNU 1A46H 3RM0H 5L6NH 1O38A 3SI4H 4LK4A 3GY7A 1DSUA 1RIWC 3A85A 1ZHMA 4I8KA 1O2IA 2EC9H 1C1OA 4XOJA 1O2QA 4FU8A 1SMFE 1DWCH 2ZC9H 2ZQ2A 1FQ3A 1C5VA 4CRFA 1DOJA 5GWZA 2GZ7A 1A61H 1KY9A 1E1RD 1LKBA 4QT8C 5EXMA 5JDUB 1O2NA 1TGCA 1SVPA 5FCRA 5J4QA 1W14U 4I7YH 4CRGA 2L6OA 1O0DH 1TBQH 3QZRA 1O2GH 1VKYA 1P2KA 3E0PB 1AI8H 1ZJDA 3UPEA 1O5CB 1O32A 4P00A 4Y79A 5C5NA 1CT2E 2PGQB 1AVWA 4HI3A 3ZV9A 3A7YA 4H6TA 4IMZA 2Q1JA 1GMHG 3GDVA 4NA8A 1K21H 3GCHB 2PFEA 3PTBA 1BB0B 1DE7H 1GI8B 1GBTA 5TCCA 3SV9A 3QN7A 3A89A 1ZJKA 1AZZA 1MAXA 1H4WA 4DG4A 3OTJE 1C5MD 6CHAC 5EOKA 1SFIA 1ZPZA 3QTVH 4X2VA 5IDKA 4GUXA 4H6SB 3H7OA 2ZU3A 4WH8A 1SGEE 1NU9A 1O33A 1NU7B 2QE7D 5AF9H 1TRNA 3RU4E 1ZTKA 2XBVA 3MH5A 3RXRA 1TOCB 4F48B 3LC5A 1O2RA 1D3DB 1RIWB 1TMBH 4NIWA 1BRBE 1S84A 1HXFH 4OS2A 3A7VA 1GJ9B 4DY7B 2D2DA 2BVXH 3F9FA 1ZSKA 2O8UA 2G51A 1P11E 4JK5A 1O3LA 2C8WB 1T4VH 4BXSA 1BHXF 4CRDA 5L2YH 1A5GH 4XBBA 3OE7D 1TNIA 3Q3KA 5IYTA 2AMDA 3RXIA 1JBUH 1GHWH 1BTWA 1FLEE 1HIAA 2EI7A 2Z3CA 2ZGHA 5E2PA 1SPJA 2XRCA 3RMNH 3SJ9A 2Z9IA 1MZAA 3MNCA 1C2LA 1CU1A 3U69H 2KM0A 3SU5A 1KSNA 2JH6D 3BTGE 1NS3A 1DICA 3E0NB 4B71A 1C1TA 3M5MA 1CHOG 2TBSA 3BTKE 1IQLA 1G32B 2GCHG 4CR9A 4X8SH 1IOEA 5FBEA 5BPEA 4IMQA 2R9PA 3QZQA 4DIHH 3RXCA 3PV5A 3U28C 3B23B 3ELAH 2IJD1 1D6RA 1TNHA 4MNYA 5FAHA 1P2MA 4BAKB 1C1SA 4VGCC 1H1BA 1GJAB 2VIDA 1PFXC 1GI1A 5HM2A 4NIYA 1NFWA 2OCVB 1SQOA 4FVDA 4A6LA 2G00A 2P3TB 4BAQB 1BQYA 3ODDA 4GSOA 1SQRA 1QY6A 3OY5U 3ZVDA 2HALA 1W0JD 5JBTA 4WF8A 4A1TA 4B74A 3U1IB 2XXLA 1ZLRA 3AAUA 4MVNA 1TIOA 1C5OH 4XSKU 1V2QT 4GCHG 3TIUA 4ZKRU 3MU0A 3TJUA 3ZZCA 4GPGA 3A84A 4BANB 5LGOA 5T6FA 5ABWA 1PPZA 4XBCA 1T31A 1QL8A 1EXFA 1PPFE 1F5KU 2GP9B 2GMTB 3P8NA 3QUMP 4NZLA 1NESE 2FP7B 5GXPA 3DSGA 3P70B 4HGCA 1JRSA 4ZHAA 2EA3A 4LZ1H 3PM3A 3KF2A 2BDIA 1NRPH 3BEUA 1S6FA 1ZHRA 5EODA 5I25A 3VB7A 1O3OA 4YOIA 1J17T 1GMHF 1MMJN 4CH8B 4XD7D 5FPTA 1E79D 3SUFA 1A0JA 1GVKB 2B7DH 1LVBA 2DE8A 1V2JT 4DW2U 3STJA 4B73A 5A0CA 1SC8U 1H8ED 3M7TA 2AEIH 2UWPA 3SV2H 1T4UH 1O3GA 3AASA 2WHXA 2ZCKP 4JK6A 3SGAE 9ESTA 4JZEH 4XBDA 1ZPCA 5E0HA 2R0KA 1W7GH 4OS6A 4JMYA 1QQUA 2SNWA 2VVUA 1F2SE 1RFNA 3LDXH 2BMGB 1YKTA 4K8YA 3F9GA 8LPRA 4CRAA 2QN5T 1FAKH 4AC9A 4WMEA 4AFUA 7GCHG 3SZNA 1KXCA 2P3UB 2D8WA 2BD9A 2R2MB 3SNAA 1ZSLA 3HK6B 1IQIA 1WOFA 1MUEB 2KFWA 2FI4E 1GDQA 1IQFA 1C5XB 2JETC 3BTDE 1KLIH 1UK4A 5PTPA 5DO4H 1P2IA 2J98A 3NRLA 1CHOF 3SORA 3FZDA 3ATIA 1IQNA 1VCWA 1Q31A 3SV8A 5DP5A 3ZZ4A 1EQ9A 5EW1H 4GLYA 1AMHA 1WUNH 1J8AA 3TVJB 1GDUA 2GCHF 1ELAA 1OYTH 2ZIQH 3NKKA 5I46H 2G5VA 2WPDD 1C1PA 3ZVFA 2F9PA 2V6NA 1ESAA 1COWD 1JMOH 2PWXA 3K2UA 1FIWA 1Z71A 1C5WB 4ZHMU 3AW0A 4J2YB 4X0WU 4YTAA 1XUJA 4FUEA 1T7CA 1BRUP 3ZZ5A 2LP6A 3MNSA 1SBWA 1VGCC 2XWAA 1C2IA 1BMAA 4CH2B 3GY4A 2H9HA 3A7WA 4I33A 1QRZA 1K28D 2RDEA 4E7NA 5FXLA 2PUQH 3SU6A 1EPTB 1TPAE 2UWOA 3OU0A 1EAUA 4DCDA 3N7DA 1CT4E 4X1QU 1WV7H 4GCHF 5TJXA 2PUXB 3S9AA 1YPMH 1W12U 3GDSA 3A8CA 2C90B 2WPMS 3UWIA 3VB5A 1N8OB 5EG4A 1A0HB 3O8DA 3MO9A 3RP2A 2KAIB 2RFKC 2FLRH 1SLWB 3STIA 1WQVH 3U8RH 1Z1IA 3C1KA 1AY6H 2JETB 3IG6B 3ATKA 1ARBA 1PPEE 1F92A 3VG8A 1DDJA 1W11U 4FUJA 4WMFA 2CHAC 2GTBA 3VB6A 3LGYA 3BV9B 2BD8A 2P3FH 1O35A 1C1UH 5EJ1A 1Z6JH 3KIDU 3UQOA 2ZPSA 3AVZA 4X6OA 1O2ZA 2FTLE 2HLDD 1H9LB 2BDGA 4RSPA 3E1XB 4IC5A 3A7TA 1O5DH 1CHGA 3GYMA 1GBKA 1P02A 2H1UA 1MTSA 1SGNE 1VGCB 5CHAC 3WW7A 1TX8A 4AFQA 1K1MA 3M36A 4YLQH 1J14A 1G2MA 3SUEA 5EPYA 1XVMA 3LKWA 4CRBA 1G2LA 4UFDH 1TONA 2WPIS 2AMPA 1SI5H 4HG6A 2IN2A 1DWEH 2W3KA 3OEED 1SQTA 2O8MA 3SNEA 2Y6TA 1YCPK 3FVFB 1YWUA 3CP7A 2ODPA 5HIYA 3DFJA 3MI4A 5C0UA 4BTUB 2RCEA 4FOUC 2B9LA 3S7KB 8KME2 7GCHF 2Z7FE 2ZDKA 3GS9A 3RLWH 2NU3E 1QBNA 5DKMA 3MO6A 1UHBA 2Y82A 1WBGB 2FS8A 3PMBB 4CREA 1FZZA 1PPGE 4JZ1A 4ZXXH 1KXEA 1O2WA 2BM2A 1LKAA 2G52A 4DVAU 5JBAS 1WAYB 1HAZB 1KXFA 4UFEH 1NRNH 3W94A 4MG3A 1O2MA 2JIZD 2UUKB 4MPXA 1ELTA 2CHAB 1H9HE 1O5GH 1HJAC 1TRMA 1DUEA 1IQJA 1B7XB 1P2QA 2IPHA 3ODFA 1GBBA 3RXTA 1ZOMA 1IQMA 1RS0A 1Z8IB 4AFSA 3U8TH 1ZTLA 3RLYH 1BTPA 1O3IA 3ESTA 2A2XH 1EFRD 2JJ2D 4HFPB 5EPNA 2A0QB 1RTFB 5E2OA 3PLPA 5CHAB 5EQQA 1BA8B 3A8DA 2ZZUH 2FXRA 4X2WA 2C8XB 1KLTA 1LCYA 3VXEH 2EI8A 2M5TA 1C1RA 1HNEE 1PYTC 1TNGA 2FO9A 2Q6GA 2ZHDA 1UVOA 1EAXA 4F4OC 3SU0A 1QCPA 4B76A 1EJAA 1NRQH 1QJ1B 1KTSB 4AGJA 5CHBA 2ZGJA 2IOTA 3UR9A 1G3BA 1A0LA 1K1LA 2OC0A 2RDLA 1CA0C 1TB6H 4DT4A 3DHKH 3A7XA 1NZQH 2VIVA 1UCYE 2FWWA 2SGFE 3GCTG 2FMJA 3VB4A 1O3MA 3A7ZA 2WPHS 1SHHB 3MMGA 1SHYA 5C67A 1SGQE 1DXWA 3UIRA 1YYY1 3LT3A 4R0IA 1YM0A 2XC5A 1AWHB 1Y3WA 4TT3D 4Z0KA 1V2KT 4X8TH 4KGAA 3SBKA 5ESBA 1CSOE 1ARCA 4INHA 1HAPH 1EZXC 1M9UA 1QTFA 1E35B 2K0QA 2PKAA 4FUHA 4UDWH 1F5RA 4AG2A 5K7RA 1HJAB 2PKSC 3SQHE 1TRYA 1LMWB 1A4WH 3EE7A 1SGPE 2FOMB 1Q2WA 2CXVA 1UTJA 3LONA 2D1JA 2FX6A 2WZQA 4OGXA 5E0JA 5AVDA 4AYVB 1UTQA 2QF0A 5FBIA 2J95A 1ESBA 1GJ8B 1BZXE 4ACBA 5IK2D 3D65E 1AO5A 4BTIB 1RGQA 3FO8D 3KYGA 4FU7A 5K0HA 4IW4E 2PP6A 4XDEA 3RDZA 2I6QA 1P04A 2WPJS 2ODQA 1O3EA 3T28A 1O34A 5L30H 3WWFA 4CHAC 4K2YA 1P8VC 1FDPA 1S83A 2TPIZ 3M5LA 4X6NA 5FPYA 1K22H 1FN6A 3GOVB 4X8UH 2GV6A 4INLA 5DP7A 4JYUH 3ITIA 1SQAA 3EAJA 4ABJA 2ZGXH 2J4IA 3F9EA 4DIIH 1HGTH 1L4DA 3PWCA 2Y5FA 1O2XA 3Q76A 3RU4D 3KGPA 1DT2A 1SLXB 2CMYA 2VH0A 3C27B 1GBDA 2AGGX 2PTNA 1LVMA 5KEDA 5SGAE 4MNVA 4OM9A 3TNSA 1UVSH 3UNQA 3VGCB 3H5CB 1D3QB 5T1VA 2BX3A 1N6YA 1UVTH 2QXGA 3VFEA 5A8XA 1HAOH 1P09A 2SGDE 4JZDH 3W1EA 2XCNA 1JIMA 2XBXA 2XCFA 3IWMA 3L6PA 3SGBE 1O2TA 2BD2A 2GJGA 2V3HH 1C4Y2 1C5NH 1LQEA 4NA9H 3HATH 1LHEH 1UMAH 2QA9E 1F7ZA 2SGPE 4B2CA 1UCYK 2KCOA 1LPGB 6ESTA 5DP9A 1AVXA 1NROH 3GCNA 2ZKSA 3ZVAA 1K1IA 3IITA 1VITH 5T3HA 2ZI2H 1P2JA 3FFGA 1B0EA 1P2OA 3MOCA 3RXEA 3ZVCA 1OP8A 2HNTE 1QRXA 2V3MA 2QF3A 1THPB 4CBOA 3A87A 4ZCNA 3FZZA 4NCYA 3EQ0H 2BD4A 3SU2A 2NU0E 3N7EA 2ZWLH 3GCTF 4ZHLU 3RXPA 5B6OA 1G37A 4J1YA 3VB3A 1TYNA 4I8HA 4D9QA 3UWJH 1DX5M 2PGBB 2G4UA 3MWIU 5FX5A 1AFEH 2BXTH 3RM2H 3GYLB 2STBE 3A83A 4GHTA 2VVCA 1O3FA 5DP6A 1GI4A 1PJPA 1TNLA 2AGEX 4FUGA 1O2JA 2VGCC 3SN8A 1AKSA 1XUHA 2A4GA 2ZDMA 2FM2A 1A7SA 3M7QA 3BG4B 2QF4A 3MFJA 1Y8TA 1WXRA 4DT7B 1QIXB 2Y5HA 5DSFA 1XXDA 1Z8GA 2R2WU 1YP9A 5DP4A 3B9FH 2Y7ZA 1O3DA 1O31A 5EXNA 4ASUD 2CV3A 3RMMH 4ISHH 2A45B 3RU4T 3O8BA 1O3HA 1FMGA 1L0ZA 1XUFA 1AFQC 1MD8A 2FPZA 2G81E 1S0QA 2F43B 4IBLH 3ZZDA 1CGHA 2BDYA 1A1RA 1ZMJA 2SGAA 1E37B 3LU9B 2W5EA 2HPQH 2Z3EA 2ZU4A 3V7TA 5A09A 5A0AE 2L74A 3TJOA 1A5HA 1YPLH 3M3VA 2BB4A 1DLKB 2WV5A 1TNKA 2VIPA 1GI7B 1C5ZB 1AGJA 2GDDA 2BLWA 3V12A 2GZ9A 3RXSA 3PB1E 1NBME 2QC2A 1G3CA 4RKOB 1YBWA 2RA0A 4ISOA 2CGAA 4RN6A 1HAYB 1ZMNA 1WDIA 5HXFA 5C94A 1GVZA 4JCNA 4U2WA 1PQ8A 1Z8JB 1Y5BT 1GI0A 2UUYA 4FUIA 1D4PB 4E06H 3BTEE 4D7GA 4AGKA 2VGCB 3RXLA 5HMAA 4MQAA 4X1NU 1GHZA 1TBZH 1O3PB 2BDBA 1LQDB 2O8WA 1OS8A 2XNIA 4X1PU 1MTUA 3PMAB 1PPHE 1RTKA 3A81A 3ZZ6A 1YPHE 1V2TT 2J5UA 2F83A 2BDHA 4UE7H 1MKWK 1YLCA 6CHAB 4TWYA 4ABDA 1HV7A 1DS2E 2XC4A 5F8TA 1ZZZA 4TY6A 4LOYH 4K60A 4ABAA 1O5AB 3DSPA 3A80A 3H09A 4MPUA 2ZDNA 1HJ9A 3RC4A 4KTUA 4WMDA 4X1SU 1OX1A 3ZYDA 1KYNA 1BTHH 4YZUA 1DUAA 1QQ4A 2B0FA 3ZVGA 1O37A 2XBWA 1KXAA 2ALPA 1NRSH 1HAVB 3ATMA 2J94A 1X7AC 1SOTA 2Y5GA 4FUBA 1GHYH 2QV1A 3SQEE 2FOEA 3UOUA 2F9VA 4TWWA 2BOKA 2OP9A 1J9CH 2AIQA 3UNRA 1QZ8A 1V2OT 4GVUA 5H4IB 7LPRA 2V7QD 1QHRB 4KTCA 4NG9H 2BY5X 4TY7A 2FLBH 3SHCH 1GWAA 3FN8A 4BTTB 1THRH 3N99A 3LJJA 1CGJE 2F4LA 2Y81A 5G4BA 1L4ZA 1FAXA 1D3PB 2FEQH 3M7UA 2GCTC 4WXVA 8ESTE 1DWBH 3MH7A 5FL7D 1GBIA 1QRWA 3PYHA 2BY9X 3FP7E 4YT7H 3MYWA 3AAVA 1QB6A 4ZKOU 2EQNA 4YOJA 1BJUA 3TNTA 1ZRKA 5EJZA 2VIOA 4VGCB 4AN7A 4CBNA 1TABE 2WUCA 3ZZAA 1EAIA 3P8OA 5GPIB 3PV2A 3SJKA 3E91A 2GVFA 1MU8B 2ZP0H 1YCPM 2KCPA 2BZAA 1F0SA 2A2QH 1TPPA 2ZTYA 5EJLA 1C5UA 2C8ZB 3ZZ8A 1MZDA 1AB9C 2ILNA 3PMHB 4AZ2B 5J4SA 1GJCB 3P6ZB 3QX5H 1ZMLA 1FY1A 2QXIA 2VH6A 1O2LA 2VVVA 1HAIH 4X2XA 3KNXA 1L2EA 3EA8A 2XC0A 4ZXYH 2ZGCA 2ZFPH 2JH5D 5F03A 1SOZA 1UTKA 1Z6EA 4O3TA 1WYKA 5C1UA 4AOQA 3SV7A 3SNCA 1GBEA 3DUXH 3MNXA 2BD3A 2G55A 1QA0A 1GJ5H 5JPMH 1HDTH 3MH6A 1H8DH 3CNRA 1V2UT 1JRTA 3DA9B 1CA8B 2GCTB 3GISB 2GX4A 3EA9A 2ZQ1A 3PRBA 3F1SB 4INKA 5HGGA 1V2ST 3EGKH 1C4V2 3D49H 3SJIA 3T27A 2VB0A 2TGDA 2HLCA 2ZDLA 3UREA 4FVBA 2R3UA 3F2HA 1Q3XA 1W2KH 1YLDA 4NSVA 3RMOH 1OYQA 5JBCS 4MPVA 1OXGA 2OLGA 4AX9H 3DFLA 1GG6C 1OP0A 3KQCA 1ESTA 1BMFD 2QXJA 3S69A 1ETSH 3QLPH 1W0KD 4ISNA 1AB9B 3G01A 4KELA 5GCHG 1RXPA 5KECA 2TGPZ 4JZIA 3SGQE 1MBQA 1G30B 1NPMA 1TGTA 2ZF0H 3RC5A 1C5YB 2OINA 4BAOB 3RMLH 1ANEA 5AFZH 1IHSH 2ZECA 1A3BH 4I8JA 3MQKC 1BBRH 1SKYE 3KCGH 3RXGA 4U01A 5E0GA 4LZ4B 2J34A 4KKDA 3QK1A 2A4OA 1GHAG 2JDID 3M61U 4UEHH 4XFQA 4B1TA 3NWUA 4ZH8A 1ZRBA 3LH3A 3UY9A 1DPOA 2F9UA 2FTMA 7KMEH 1BHXB 2H5DA 3RXHA 2JJ1D 2OUAA 3RUOA 3U8OH 1ELFA 2G4TA 2HVYB 1XXFA 2Z9GA 4ZMAH 5C17A 1HCGA 1G36A 2BOHB 5C20A 3ZIAD 3M35A 5F8ZA 2BY7X 3D23A 3SHAH 1QBOA 2J9NA 2YMSD 2W7UA 3DSOA 4K3JA 2ZEBA 5E8EH 8GCHF 2FDAA 2IPQX 1LHFH 1YPKH 3QGJA 3QGNB 4Y10E 1HPGA 2F9OA 1GG6B 5EXLA 4A7IB 2CJIA 4DGJA 1W10U 2ZFSA 1VITF 1TNJA 2GD4B 1O39A 1V2PT 2PLXA 3KQEA 3K6YA 3MU1A 3Q00A 1TA2A 3T5FH 1Y5UT 1GBJA 1HBTH 1EPTA 4YO9A 5B6LA 5AFYH 4K69A 1S82A 1HB0B 5DG6A 1HXEH 1SG8B 1HUTH 1GMCF 2FIRH 3FKSD 1PPCE 2R3YA 1A5IA 3TGKE 1C1NA 3SV6A 3PO1C 3QTOH 2C93B 3FP6E 1C9PA 1GPZA 4NIVA 1CO7E 1DXPA 1KXBA 1P05A 1GBHA 1YF4A 4AYYB 3GICB 1QJ6B 1VCPA 1KMHB 2FYRA 2YOLA 4OS5A 5A8ZA 2P93A 1P10A 2OQ5A 2GZ8A 4Q7ZA 4BOHA 5FCKA 2F91A 1UVPA 4ISIH 4Y8YA 4AB9A 1P12E 2WV4A 2HWLB 3L3TA 2AERH 1ELGA 2QAAA 5EQSA 4X6PA 2XTTB 1OKXA 1QR3E 4NSYA 1SL3A 1HAGE 4R8TB 2ODYB 1BTUA 3HK3B 4K8BA 1Z7KA 1OWDA 1S85A 2UUFB 2HNTF 4Q7XA 2I6SA 3FOAA 1C5LH 2XBYA 1P2NA 5LPFA 3TH4H 1MKXH 4B2BA 1YGCH 1IHTH 4E7RG 2FOCA 1SGCA 1OWIA 3F3BA 2ZHWH 4UD9H 4O3UA 1O3KA 3ZV8A 4WXIA 1BIOA 1Y59T 5GCHF 3UQVA 4M7GA 3F68H 5T6DA 5CMXH 1MTNC 1UVUH 3GY5A 2VBCA 1ABIH 1K1PA 3LGUA 1GVLA 1FN8A 4IS5A 3RXOA 1GGDC 1BUIA 2WSSD 3TJVA 1G3DA 1TMUH 3GCOA 3PLKA 1H8IH 4H42U 3K9XB 2ZFQH 1O2KA 2ANKH 3SUGA 1GCTC 1UJ1A 4THNH 4Y0YE 3S9CA 4ZROA 1TPSA 4WVPE 4AG1A 4WH6A 4B6FA 3BTME 3O8RA 1BRAA 1GHAF 1TOMH 3TLOA 3T25A 3SOSA 1GJDB 1B0FA 2Z9LA 1L1JA 2OBOA 2NU2E 1AHTH 2Z9JA 1V2NT 1AE5A 1OWHA 1BTZA 1E38B 4ABHA 4OGYA 5TCAA 2SGEE 1P3EA 1V3XA 2FS9A 1UK3A 2W6JD 1C2GA 1EZSC 1DSTA 3TPIZ 2KX4A 2WYGA 3P8FA 1TQ7B 1OOKB 4MDSA 4FUFA 1RTLA 1ELVA 4Q2KA 3MU5A 3BSQA 4Y0ZE 4X2YA 1YPEH 3PLBA 2A5AA 5HM9A 2K8IA 3E3TA 1QGFA 1AIXH 2W7SA 2BQWB 3E90B 2J2UA 3M5NA 1P57B 3OSYA 1L1GA 2V0BA 1FJSA 1BRCE 1BMNH 3SW2B 2A7HA 5GJ4B 1GHXH 1NN6A 1T32A 1O5BB 2CN0H 3P95A 4I32A 4IGDA 1GCDA 1CA0B 5HKKD 1O2OA 1V2WT 5LPEA 3VXFH 4X1RU 3WY8A 4K5ZA 4BXWA 1MU6B 1UTLM 1GGDB 3JZ1B 3NZIA 2B5TB 1VJAU 2BHGA 3ZYEA 2OC1A 3ZZBA 2D26C 1FXYA 6GCHF 2TIOA 1ACBE 5CDFE 3V3MA 3CENA 4HTCH 1GCTB 2ZCHP 1XUGA 2W3IA 4X6MA 1GJ6A 2VJ1A 1BITA 2BY6X 4DURA 2LPRA 1V6DA 3TH3H 2PKSB 1N6XA
chains in the Genus database with same CATH topology
3SNBA 1FUJA 1EB1H 2Q6FA 1ZYOA 1IQKA 3BIVH 1KDQA 2FI3E 1CGIE 2P59A 5FX6A 1AQ7A 4D76A 4A5TS 1C1VH 1GI5A 1T8MA 2Q6DA 2P16A 1GI9B 1LVYA 1C5QA 1GDNA 4JZFH 1DY8A 1GMDG 1SGIB 1MTWA 1TGSZ 3LIWA 4K1EA 3GCHC 1TAWA 2A32A 3VPKA 3L33A 2P95A 2Z9KA 2FX4A 3Q3YA 5JBBS 4CHAB 4YT6H 1J15A 5ESTE 2ZU1A 2P8OC 2JKHA 3E8LA 1Y3XA 1BTYA 5A2MH 1V2LT 3DT0H 1U6QA 3ZZ7A 3RXFA 4DOQA 1GBMA 3ZVEA 1NC6A 3UTUH 3KL6A 3T29A 4NFFA 1EJNA 3UR6A 1EP5A 3I29A 1L1NA 1QFKH 1V2RT 2EEKA 1CE5A 5C2ZA 1VZQH 1MAYA 1GBFA 1BTXA 1EOJA 1WTGH 3GY6A 2A7JA 4MLFB 3TK6A 2ZFRH 1HIAB 1NFUA 4Q80A 4KTSA 3B8JA 2THFB 1Y3VA 1Y3UA 2NWNA 2BLQA 4NWKA 4B2AA 1ANCA 4FUCA 1MQ6A 2O9QA 1HAXB 2QIQA 1ELCA 1C2JA 4DJZB 1IQHA 4BAHB 1JOUB 1MD7A 2H2ZA 1CT0E 2ZTZA 3FAOA 1G9IE 1TGBA 3RXUA 2NU4E 1K9OE 1FY8E 4AFZA 2PW8H 3LGWA 1MH0A 1P9UA 1F0RA 4MPWA 2BDAA 4XE4A 2AS9A 4OS4A 2A31A 1D9IA 1INCA 2OC7A 5BRRE 1QB9A 3R3GB 1MKWH 2P8OB 1P9SA 1PQ5A 4RKJB 2Y80A 5DJ7A 4NGAH 3RXVA 3NUMA 4YOGA 1HRTH 1NFXA 5DGJA 4D8NA 1CBWC 1H9IE 2FOBA 1EUFA 2V35A 3LGIA 2V3OH 2BY8X 3BF6H 1B5GH 5AHGH 1NM6A 2ZDAH 1OWKA 4U32A 5ETXA 4UFFH 1W0YH 1FY3A 3ZVBA 2A5KA 1EP6A 1TA6A 4NIXA 5F8XA 3MHWU 1BJVA 1FV9A 4F49A 1EZUC 1QURH 5A8YA 3A88A 4ESTE 2BLOA 2DE9A 2GMTC 5DP8A 3RXQA 3URDA 2JH0D 3TITA 3SJOA 1JXPA 2A4RA 3BTFE 3URCA 3P17H 1TFXA 2GKVE 2OQUA 3BIUH 3ATLA 4Y8ZA 2FYQA 3BEFB 2BDCA 2PSYA 5LH8A 1YPHC 1MCVA 1T8OA 3LH1A 4X8VH 1GMDF 1EATA 2W26A 4Y7AA 3OX7U 4ABGA 1MQ5A 1AFQB 2VNTA 1TMTH 2ANWA 3SUDA 1BMMH 2Y7XA 1KLJH 1Y5AT 1Z8RA 2H9EH 1LPKB 1AN1E 3ZZ3A 1O3AA 5FHTA 3QDZB 1S6HA 1CBWB 5CE1A 1FIZA 1SFQB 2HGTH 3TGJE 4TPYA 3Q77A 1LDTT 1UK2A 1EZQA 4BAMB 3SI3H 5EGMA 2BVRH 2QXHA 2XW9A 4FU9A 3TK9A 4Y7BA 5T6GA 1SGDE 1LHGH 2H5CA 1SGFA 3RXMA 1FNIA 4K1TA 1NT1A 5GDSH 1QNJA 2VINA 1FY4A 1AU8A 5C1YA 3MU4A 3NK8A 3RXBA 4UONA 3SJ8A 1EAWA 3BN9A 3PROA 2FOHA 3PTNA 2FESH 1NY22 3T26A 3VEQB 2BD5A 2VIWA 1XUKA 1F5LA 2UUJB 2J38A 3T2NA 2VIQA 3MH4A 2A4QA 5L2ZH 8GCHG 2PSXA 3RXKA 3HGPA 1FI8A 1O2VA 4FXGH 4E05H 4YESB 4A1XA 1PQAA 3KQDA 4CRCA 2TRMA 1N1LA 2Z3DA 1C2HA 1VITG 2C3SA 2ANMH 1WCZA 2WINI 3P92A 2ZU5A 4ABEA 1HJ8A 2IJOB 4ZAEA 1GI6A 2BYAX 2SFAA 1K1OA 3K6ZA 3M5OA 2FZZA 1W0ZU 3RXAA 1GBAA 1GMCG 2FOGA 5JB9S 1HAVA 1EPTC 5A0BA 3CS7A 4O97A 2BXUH 2BD7A 1C5TA 3F6UH 1LTOA 1YPJH 2R0LA 9LPRA 4HZHA 2LNCA 1CQQA 1GI3A 2HVXA 1YPGH 1ELBA 2FOFA 1A2CH 1KXDA 1C2KA 3HKIB 1LHCH 1ZSJA 2O8TA 1N8OC 2AH4X 2AYWA 3CS0A 3U98H 1E36B 3V0XA 1T8LA 3GY3A 1BBRE 5GIBA 2UWLA 2A5IA 1TPOA 3H7TA 1C2EA 1NFYA 1ETRH 2G5NA 3AW1A 3I77A 2TGTA 1O5FH 1LVOA 3W95A 5C1XA 4OS7A 1TALA 1O3BA 2OTVA 3LOXA 4ABIA 2WUBA 1AVGH 1QA7A 2STAE 1TX7A 2HOBA 1ZHPA 1XUIA 3FP8E 2PR3A 3ATWA 1DANH 3GY2A 2GV7A 4Q7YA 2SGQE 4Y76A 4SGAE 1FPHH 3I78A 4ISLA 4I8GA 1XKAC 1P0SH 2VWNA 4KP0A 4NFEA 2BZ6H 1BMLA 1TE0A 4D7FA 1UTOA 4NWLA 2ZA5A 1W8BH 2ZTXA 1D3TB 1A3EH 3QO6A 2WPLS 4YM9A 1V2MT 4Y11E 1XMNB 3U9AH 1KTTB 2XWBI 3KN2A 1SGFG 3EE0B 3U1JB 3BTTE 1GI2A 1K1NA 3BG8A 2GT7A 2YNBA 4JYTA 3S0NA 2GGVB 4LXBH 1FONA 1YCPH 1IQEA 2WYJA 1F0UA 2BQ6B 1ABJH 1UHBB 6LPRA 1ELDE 4FUDA 1PYTD 1O30A 2H6MA 3EA7A 4I31A 1OWJA 3MU8A 2F9NA 1DLEA 1ZTJA 4BNRA 1O2SA 1TGNA 1E34B 1OP2A 2OC8A 5JB8S 1AWFH 4YLUA 3M37A 1ID5H 1WTHD 3KEEA 1QBVH 3T62A 2HRVA 4MNXA 1JWTA 4Y6DA 3UFAA 1O2PA 3R0FA 1ZGVA 2F9BH 2K1QA 1O2YA 4ABBA 1GJ4H 4WJG2 1P3CA 1V2VT 3RXDA 1XVOA 1DM4B 4GAWA 1G3EA 3OY6U 3GDUA 1GHBG 1C5SA 1VCQA 3A8BA 1DWDH 3V13A 4WY3A 1HFDA 4Y71A 2OBQA 2ESTE 4Y8XA 2Z6BD 3LC3A 5F6MA 1W3CA 3TH2H 3MO3A 2FODA 3A8AA 1EOLA 1CVWH 1FPCH 3SU3A 1F0TA 1YC0A 4AB8A 6GCHG 4D9RA 7ESTE 1PQ7A 1BBRK 1P03A 5EU8A 1SSXA 1O3CA 3TU7H 4PROA 1ETTH 2ALVA 2KAIA 3BEIB 1FY5A 1WSSH 3A86A 2A7CA 1ANDA 1MCTA 3HGNA 1GJ7B 1S5SA 2ZG0H 2VWOA 1THSH 3BTWE 3S9BA 3TJNA 5C3NA 3LPRA 1GL0E 1BCUH 1IAUA 3RC6A 3KHVA 2C8YB 4WWYA 3RXJA 2A1DB 3MTYA 2VU8E 2XYAA 2CF8H 1T8NA 2PKAB 2FOAA 4MNWA 2B8OH 1QB1A 1AUTC 1C2MA 1AE8H 1GHVH 1VR1H 1SGYE 1RRKA 1XX9A 1XKBC 1SB1H 4NA7A 1EX3A 2ZHFH 2OD3B 4O9VA 1KIGH 1O3JA 1SR5C 5EW2H 3BTQE 4A1VA 2J92A 2ZO3H 3F9HA 1EKBB 4CR5A 1EASA 1OSSA 1RJXB 1QL7A 2EI6A 1PPBH 2NU1E 1BOQA 1TBRH 2TGAA 1C5PA 3K65B 3OYPA 3NCLA 3EDXB 2BLVA 4A92A 3PO1B 1OPHB 2ZDVH 4K1SA 4U30A 1MBMA 2PTCE 1W13U 1W7XH 3HKJB 1C2FA 1O2HA 3DD2H 2BVSH 1C4U2 1C2DA 2SNVA 1O2UA 4ASHA 1DY9A 3SU4A 2QYIA 4TPIZ 1NRRH 2BQ7B 1DVAH 2PHBA 3SNDA 2CF9H 1SGTA 2QCYA 2AIPA 1D6WA 1HAHH 1UTPA 4NZQA 1O5EH 5LPRA 2Z94A 1TWXB 1XM1A 1S0RA 4AORA 2ZU2A 3NPSA 5FPSA 3VGCC 1C5RA 1OWEA 1TLDA 1LO6A 5DP3A 1S81A 2ZFFH 4TYDA 1KDQB 1LHDH 2ZHQH 2AFQB 2ANYA 4IN1A 1SLVB 1ZPBA 2P94A 1P06A 3PV4A 2BX4A 2GT8A 4MTBA 1MKXK 3D62A 2DUCA 3PMJA 3SU1A 1AUJA 3BTHE 4I8LA 3UUZA 1WU1A 1GHBF 2ZGBH 1J16A 1UO6A 3N7OA 1GL1A 1GJBB 1P01A 2YNAA 3E16B 4ZUHA 1QL9A 1HLTH 2QY0B 1MTNB 1BDAA 2ZCLP 2AMQA 3JZ2B 4H4FA 5C5OA 1VJ9U 1EB2A 1ZR0A 4ZKSU 2VWLA 1MTVA 2RG3A 1GBLA 1UCYH 4Z6AH 2C4FH 3LJOA 5DK1A 2O8LA 1C9TA 3M3SA 1NO9H 3M3TA 1O36A 2ZFTA 5JYIA 3ENSB 1ORFA 3MNBA 4JYVH 1EJMA 1AD8H 2WPKS 2F3CE 3FANA 3Q3XA 2ASUB 2AGIX 2GDEH 1SLUB 4OS1A 1E0FD 1UTMA 2ZPQA 1BT7A 2BTCE 3ZZ9A 1ZGIA 3TGIE 1RD3B 3P8GA 4B75A 3SO3A 1O3NA 1C1QA 2RA3A 3EYDA 1C1MA 1AKSB 1JIRA 1ELEE 4O03A 3A82A 3PWBA 3LGTA 1HYLA 1Y3YA 4GHQA 3GY8A 1TQ0B 1WQSA 5DPAA 2QGRA 2FI5E 2ZHEH 1TX6A 5EQRA 3BG4C 3QWCH 3O8CA 1K1JA 4UFGH 1UTNA 1Z1JA 3S7HB 5HYOA 2OXSA 2PV9B 3E6PH 1SGRE 1NTPA 2VWMA 4IN2A 4SGBE 1C1WH 1ANBA 1LPZB 1AZ8A 3UNSA 2ULLA 3HPTB 3NXPA 2ZNKH 1DITH 1DFPA 4IC6A 2H9TH 2HNTC 3TK5A 3LGVA 1K2I1 2HPPH 1IQGA 1GBCA 2G8TA 4ABFA 2ZPRA 1QJ7B 3KQBA 3UOPA 4ZKNU 1A46H 3RM0H 5L6NH 1O38A 3SI4H 4LK4A 3GY7A 1DSUA 1RIWC 3A85A 1ZHMA 4I8KA 1O2IA 2EC9H 1C1OA 4XOJA 1O2QA 4FU8A 1SMFE 1DWCH 2ZC9H 2ZQ2A 1FQ3A 1C5VA 4CRFA 1DOJA 5GWZA 2GZ7A 1A61H 1KY9A 1LKBA 4QT8C 5JDUB 5EXMA 1O2NA 1TGCA 1SVPA 5FCRA 5J4QA 1W14U 4I7YH 4CRGA 1O0DH 1TBQH 3QZRA 1O2GH 1P2KA 3E0PB 1AI8H 1ZJDA 3UPEA 1O5CB 1O32A 4Y79A 5C5NA 1CT2E 2PGQB 1AVWA 4HI3A 3ZV9A 3A7YA 4H6TA 4IMZA 2Q1JA 1GMHG 3GDVA 4NA8A 1K21H 3GCHB 2PFEA 3PTBA 1BB0B 1DE7H 1GI8B 1GBTA 5TCCA 3SV9A 3QN7A 3A89A 1ZJKA 1AZZA 1MAXA 1H4WA 4DG4A 3OTJE 1C5MD 6CHAC 5EOKA 1SFIA 1ZPZA 3QTVH 4X2VA 5IDKA 4GUXA 4H6SB 3H7OA 2ZU3A 4WH8A 1SGEE 1NU9A 1O33A 1NU7B 5AF9H 1TRNA 3RU4E 1ZTKA 2XBVA 3MH5A 3RXRA 1TOCB 3LC5A 1O2RA 1D3DB 1RIWB 1TMBH 4NIWA 1BRBE 1S84A 1HXFH 4OS2A 3A7VA 1GJ9B 4DY7B 2D2DA 2BVXH 3F9FA 1ZSKA 2O8UA 2G51A 1P11E 4JK5A 1O3LA 2C8WB 1T4VH 4BXSA 1BHXF 4CRDA 5L2YH 1A5GH 4XBBA 1TNIA 3Q3KA 5IYTA 2AMDA 3RXIA 1JBUH 1GHWH 1BTWA 1FLEE 1HIAA 2EI7A 2Z3CA 2ZGHA 5E2PA 1SPJA 2XRCA 3RMNH 3SJ9A 2Z9IA 1MZAA 3MNCA 1C2LA 1CU1A 3U69H 3SU5A 1KSNA 2JH6D 3BTGE 1NS3A 1DICA 3E0NB 4B71A 1C1TA 3M5MA 1CHOG 2TBSA 3BTKE 1IQLA 1G32B 2GCHG 4CR9A 4X8SH 1IOEA 5FBEA 5BPEA 4IMQA 2R9PA 3QZQA 4DIHH 3RXCA 3B23B 3ELAH 1D6RA 1TNHA 4MNYA 5FAHA 1P2MA 4BAKB 1C1SA 4VGCC 1H1BA 1GJAB 2VIDA 1PFXC 1GI1A 5HM2A 4NIYA 1NFWA 2OCVB 1SQOA 4FVDA 4A6LA 2G00A 2P3TB 4BAQB 1BQYA 3ODDA 4GSOA 1QY6A 3OY5U 3ZVDA 2HALA 5JBTA 4WF8A 4A1TA 4B74A 3U1IB 2XXLA 1ZLRA 3AAUA 4MVNA 1TIOA 1C5OH 4XSKU 1V2QT 4GCHG 3TIUA 4ZKRU 3MU0A 3TJUA 3ZZCA 4GPGA 3A84A 4BANB 5LGOA 5T6FA 5ABWA 1PPZA 4XBCA 1T31A 1QL8A 1EXFA 1PPFE 1F5KU 2GP9B 2GMTB 3P8NA 3QUMP 4NZLA 1NESE 2FP7B 5GXPA 3P70B 4HGCA 1JRSA 4ZHAA 2EA3A 4LZ1H 3PM3A 3KF2A 2BDIA 1NRPH 3BEUA 1S6FA 1ZHRA 5EODA 5I25A 3VB7A 1O3OA 4YOIA 1J17T 1GMHF 1MMJN 4CH8B 5FPTA 3SUFA 1A0JA 1GVKB 2B7DH 1LVBA 2DE8A 1V2JT 4DW2U 3STJA 4B73A 5A0CA 1SC8U 3M7TA 2AEIH 2UWPA 3SV2H 1T4UH 1O3GA 3AASA 2ZCKP 4JK6A 3SGAE 9ESTA 4JZEH 4XBDA 1ZPCA 5E0HA 2R0KA 1W7GH 4OS6A 4JMYA 1QQUA 2SNWA 2VVUA 1F2SE 1RFNA 3LDXH 2BMGB 1YKTA 4K8YA 3F9GA 8LPRA 4CRAA 2QN5T 1FAKH 4AFUA 4WMEA 7GCHG 3SZNA 1KXCA 2P3UB 2D8WA 2BD9A 2R2MB 3SNAA 1ZSLA 3HK6B 1IQIA 1WOFA 1MUEB 2FI4E 1GDQA 1IQFA 1C5XB 2JETC 3BTDE 1KLIH 1UK4A 5PTPA 5DO4H 1P2IA 1CHOF 3SORA 3FZDA 3ATIA 1IQNA 1VCWA 1Q31A 3SV8A 5DP5A 3ZZ4A 1EQ9A 5EW1H 4GLYA 1AMHA 1WUNH 1J8AA 3TVJB 1GDUA 2GCHF 1ELAA 1OYTH 2ZIQH 3NKKA 5I46H 2G5VA 3ZVFA 1C1PA 2F9PA 2V6NA 1ESAA 1JMOH 2PWXA 3K2UA 1FIWA 1Z71A 1C5WB 4ZHMU 3AW0A 4J2YB 4X0WU 4YTAA 1XUJA 4FUEA 1T7CA 1BRUP 3ZZ5A 3MNSA 1SBWA 1VGCC