1S0UA

Eif2gamma apo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
404
structure length
391
Chain Sequence
b'SQAEVNIGMVGHVDHGKTSLTKALTGVWTDRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPINIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title X-ray Structure of Translation Initiation Factor eIF2gamma: IMPLICATIONS FOR tRNA AND eIF2alpha BINDING.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 96
structure length 391
sequence length 404
ec nomenclature
pdb deposition date 2004-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s0uA01
1E6CA 1VYTA 2ZI7A 5D3QA 2AKYA 3ZJYA 1VHTA 3V00A 1GVHA 3G6EB 1CTQA 1N6PA 1ZD1A 2GESA 2O8CB 2FFAA 4AYXA 4RD0A 2JA1A 1UADA 1EX6A 1SVOA 1TQDA 4P32A 1HURA 4K1XA 3I56B 1RVDA 1DAIA 2XNDD 2A3RA 4KSBA 1K9MD 1XB2A 3RLFA 3K09C 4BLOA 2EFHB 3PEYA 1XD2B 4Z51A 1L4UA 4FMBB 1DADA 2FEOA 1E62A 2V9PA 4LY6A 3ZBTA 4FMDB 1JQJC 2CJWB 4CEIA 3NHAA 2YHSA 2J3EA 1N25A 2G1KA 4XWAA 3B9QA 3SE0A 1XTQA 2ZJ2A 4MGYR 2FFBA 2WKPA 3TLXA 4BZXA 1WBBA 1E0SA 3I4LA 2OTJB 3TUIC 2PCLA 2YOGA 3GJ8A 4NDZA 1RC8A 4B34A 1VIYA 1AGPA 2ORWA 3F0TA 3OJXA 2VSXA 1OW3B 2WJJA 5CDFE 1P4SA 4DWJA 2ZIAA 5DN6D 5JEDA 1U2RA 2ZJZA 1QVGB 4QNRA 1T0HB 4HSEA 1QFZA 4C0SA 3LLMA 4US0R 4AD8A 4O25A 2BBOA 4OKSA 5AR1A 1TL7C 5G40A 3VU9B 3GP8A 2F43B 3ZBUA 3K70B 3U6BA 1ZJ6A 1R0ZA 4DLXA 3VO1A 1Z0AA 4QHSA 1WCV1 3VQTA 1I2DA 3GLGB 2QRZA 4ZGNB 2J46A 1JEEA 2ZTSA 1IB0A 4F4JA 4KV9A 1N3BA 2EFDB 4MGZR 3WYFA 4LYJA 4A92A 5FPHA 5JLJA 4PAMA 5KSWB 4DSTA 1KDOA 2R44A 4TWZA 4JLAA 3KQNA 3GLFA 4PPNA 1GM5A 1U8YA 4P6VF 1Q3HA 5EXXA 1TQ2A 221PA 1I4DD 2QI9C 3OHMA 3NHBA 4N1AA 1XD8A 3GJ3A 3CC4B 721PA 2DWOA 3TSZA 1D2EA 2OTLB 1W36B 4Z8YA 4XVQA 3OZVA 3BRWD 3A1VA 3TH5A 2J9RA 1SVSA 5DSZA 4A1FA 2V6IA 3Q5EA 1HA3A 5DH9A 3GJ4A 1SKYB 2QTZA 2VEDA 3TR5A 4LC1A 5JEEA 2OK8A 3DKPA 3H86A 5B58C 3HDTA 2FZLA 3EXAA 3QUSA 4D0GA 4DRZA 3FPAA 4DCVA 4G5QA 2N46A 4P3YA 1M34E 4ZKEA 1LV7A 2CDNA 3HWSA 4Q5IA 2GVZC 4AYTA 1TF7A 2NO1A 5AN9A 3QG5A 2FJUA 4YDSA 1NG9A 4U5XA 4QBGB 5EE5B 4Q18A 3P20A 3AUXA 1UDWA 4EQ6B 2RC5A 1G3IA 5LBIA 2Q21A 4A8JA 2OV2A 4WVFA 3K0FA 621PA 2J0QA 1KK0A 1OIVA 3GEIA 3TVTA 3QNUA 5KDOA 4Q1CA 3KQKA 1Q1ZA 1E4VA 2AHOA 1KDPA 2SHKA 1KI6A 3OEHA 2A5DA 5DI3B 3RWOA 3K9GA 521PA 4TYWA 1SVLA 5FOSA 3KB2A 1FNBA 1Z2CA 1VYVA 1TMKA 5JJLA 2YC4C 3SZRA 2YV5A 3ES9A 2ZS8A 1ZBDA 1HE1C 1ZNWA 3FYHA 4YMWA 4AKIA 5JECA 1G3RA 1P9WA 1GAWA 1W0JD 1F2TB 1VQKB 1E0JA 1TQ6A 5E7MA 3R7WA 1DE0A 1G8FA 4WW0A 2UKDA 4URVR 1XNJA 3O8DA 1EP3B 3QEOA 2BGJA 1XMIA 3SJCA 1Z83A 2E9SA 121PA 3CRVA 3LRPA 3BFKA 4KI0A 4U7DA 3B1XA 1FUKA 4V0NA 3BGWA 3WRYC 4PZLA 1GL7A 1IY1A 1OXSC 2WSSD 2GA8A 1CR0A 4PC2A 3LX8A 4KFSA 2ORVA 5FBQB 1H42A 2ZUDA 3T5DA 4CIDA 2BM1A 2QN6A 1OYYA 4PXAA 3RHFA 4B76A 3U2QA 2XITA 2QZ4A 4HLUA 1XMVA 1SHZA 1AQYA 3IIMA 2O8BA 4OK3A 1B23P 2EW1A 4Q1AA 3THOA 1A7JA 2IYWA 4KAXA 2BF4A 2HUPA 2EQBA 1R4AA 2OT3B 2VP6A 1XCPA 2MSDB 4DUGA 1RW4A 1Q21A 2BMJA 4UQOA 1N6KA 1G21E 4HATA 4P0TA 1DAFA 1J2JA 4KJZA 4EPRA 4HB3A 3GLIE 3TAUA 2K5UA 4HAXA 2A78A 1GJRA 2ZITA 2IYYA 2WWHA 3LVRE 2F1RA 2IW3A 1QUFA 1OF1A 2G77B 4PHFA 1XEWX 1OPXA 1KY2A 5FPTA 1SXJA 1MO5A 1KD1D 2NO6A 2X19A 3OIVA 3BD9A 3LY5A 1E79A 2C9CA 4MITA 4Y0VA 1BH2A 4N3GA 3EPJA 2G0TA 2ZSAA 4PC3A 1JEDA 4ZO4A 2FDCA 4OQLA 1G20E 4MRNA 2YWGA 1KHTA 1E9RA 4BLQA 3QFTA 1KI8A 2OXCA 3PFIA 1NRJB 1II9A 1EFTA 2E87A 5TV2A 2Z4SA 2QY9A 4DQKA 2A5JA 2Q3MA 2B21A 3ZD6A 2H57A 3B1YA 3X1DA 4LPKA 2GCPA 4C0KA 2ZJAA 5G53C 3E5HA 3TNFA 1RRPA 3U44A 1LY1A 1Z22A 2PZGA 3AVUA 3CPEA 1NY5A 2O8EB 4B74A 3MMPA 3VNVA 2XTNA 2VYQA 4TQ9A 3ADBA 3K53A 4NHOA 4IVQA 4NYJR 1JA1A 3ZVMA 2ZYWX 4FI3C 2DR3A 1GIAA 3CF0A 2HLDD 1WDTA 2ZR0A 4LBWA 3CRMA 3VKWA 3AUYA 4HLQB 1JNYA 1J7KA 1ZUIA 4UNQA 3K0AB 4L9WA 4M1TA 4MKGA 4XTRA 1IY2A 2DPXA 1IN8A 2ZRAA 4Q4HB 4ZIRA 3RC8A 3P32A 4PPQA 1NF3A 3I72A 3QKSB 2DY1A 3L8ZA 1MH1A 1G3UA 2ZUBA 4MRPA 3BB3A 2IYVA 1DTSA 1YRAA 5JZVA 2RGEA 2JIZD 3UIEA 5FOWA 1QRAA 1E96A 3ETLA 2CVHA 3Q72A 2CK3A 4DLUA 3BB4A 5J4LA 2V4ZA 2JJ2D 3EX7C 2XGJA 2XNSA 1P75A 2GILA 4XD7A 3EWAA 4QBHA 2BEKA 3E1SA 2PX0A 4TT3A 4GP7A 2ZRMA 2C03A 4X8OA 2BKEA 3GLHE 2OFXA 3CXCB 4AKEA 4P4UA 4BFSA 2GJSA 3A4LA 2IEZA 1HUQA 2IHBA 4BLPA 1A8PA 3H84A 1OHHA 1CRQA 2HYDA 3CPJB 3NC1C 4PPGA 4B2IA 4DSOA 5DNYB 1DAHA 1M7GA 2YJTD 4JLDA 1U90A 2PEYA 4RFVA 1P2TA 3OESA 2ZE5A 3ND8A 2P5SA 3A8TA 4DKXA 3A37A 4EUNA 5A0FA 1W4BA 3RS4A 1TEVA 1NIJA 3DMDA 3LXXA 4URZR 2WMOB 5K8IA 1BMFD 3UMRA 2WAXA 1J99A 2OBLA 2IX3A 2VF7A 1JR3A 4G1BA 2Z0MA 5LB4A 5DYGA 3BB1A 3PG5A 1ZD8A 2GJAA 5HTKA 3B82A 2WM9B 1WF3A 3QF4A 2IYXA 4TZ6A 1KTVA 3Q5DA 2IYQA 2PJZA 4KBGA 3ZS8A 1XMSA 2C99A 3OEEA 4F38A 4Z1MD 5SZJA 2W6ID 2W2VA 4LGMA 3CONA 3K70C 4RD6A 1COWA 2P5TB 4V02A 1GKIA 5EE0A 3AF2A 2CNWA 2ODNA 1GL9B 1P5ZB 2D2FA 2IXGA 2OEPA 2AD5A 4MYUA 2D4HA 4R2HA 3QFSA 3ICQB 4M53A 1IXRC 2UZ3A 4G5RA 4QJ4A 5ANRB 2FF7A 1EP1B 2RGAA 2ZROA 1FTSA 3EPLA 5B30A 1YU9A 3PQCA 2GDJA 3REFA 4LYFA 5CIQA 3PUZA 3EZ6A 1KI4A 3VHLB 1LS1A 3VR4A 4JL5A 1IAQA 3BXZA 2J7PD 4G1VA 2PCJA 3SR0A 2GCOA 4HI0E 4I99A 3CH4B 1TTTA 1T8TA 4ZKDA 2O8CA 2ZYTX 2CCKA 1G8GA 3I5XA 3W2FA 1FL9A 2ODEA 4U02A 3PV0A 2C04A 4IDHA 2CL0X 2WJIA 2LWIA 3CZPA 3U3RA 2CCGA 3FB4A 1XD2A 1WE2A 3GJ5A 1KNXA 1J8YF 1G1MA 3GJXC 4QHTA 4D0LB 1ZRHA 3T1OA 1S1CA 1X8LA 3RWMB 1S3GA 3MFYA 1EFHA 5J4HA 2J41A 5KYKA 5P21A 2EFGA 2XAUA 3X2SA 1VQPB 3CRRA 1XPOA 1NSTA 2JJ8A 4D26A 1ZUNB 4XOIA 3IHLA 4IXNA 2AXNA 1Z6GA 1X8KA 4LHXA 3CMEB 4D6PA 2YZ2A 1KGDA 4ASUD 4Q47A 3W5HA 1TQ4A 3GLFB 4F91B 2QSZA 2QA4B 4ESVA 4B33A 3O8CA 1II8A 2PJRA 2NZ8A 2ZPTX 4RKFA 1E32A 3EC1A 2XOKD 3MWLA 2FH5B 2VP9A 3AVWA 1Z8FA 4B6FA 1GTVA 3SFVA 1XCMA 1QGAA 4BEBA 2EVWX 1NVUQ 1SQ5A 1ZIOA 2QBYA 2IYLD 3SJAA 4F4CA 4GI7A 2VP2A 3CF2A 5FTKA 4IEEA 5EE3A 4Q4LA 2QA5A 1GZSA 4MRVA 3B8HA 4RZXA 2WPDD 2QMHA 1DDGA 3HJNA 1ZCAA 1E9FA 3CB4A 1E2MA 2HDNB 1P72A 2QM8A 4URYR 3QPWA 2GNOA 2MSCB 1PJRA 3C5CA 3C5HA 1G16A 4LJ6A 2OESA 1E2IA 5HE8A 3CMAB 4A8JB 2B7CA 3K0FB 5FBWB 5IRCD 5ELXA 1G5RA 1KJWA 2JLRA 2C9YA 2QL6A 5KSOA 2QRNA 4QM6A 1CU1A 1XU4A 4LV8B 4HE6A 3ZGXA 1KI6B 2OE2A 1VG8A 4B32A 3BK7A 3QPVA 4BFUA 1ZM7A 3B1ZA 3F3YA 1GNPA 2N42A 2J0SA 5C4MA 3QI2A 1ZCBA 4HAZA 3Q8XB 4E07A 1M8PA 1I2MA 3R7WB 2D7DA 3B85A 3LO5A 5H68A 2HJGA 3R8CA 3CCJB 1U8AA 3LLUA 3TR0A 2VH5R 2IS1A 4IFEA 1EFRA 1FZQA 1SKQA 2H7VA 2RGDA 4HUTA 1N6RA 3QIAA 2AXPA 4KITB 4TTPA 2OCYC 1EWRA 3SBEA 2HCBA 5SZKB 1T9HA 5KU1A 1YI2B 1N5IA 2GF0A 1N0WA 3C7KA 4IW3B 3N2EA 1P6XA 2CL6X 2CHVA 4JBWA 1QFJA 4RSGA 4MDEA 3K70D 4IOKA 5JSZA 4O2LA 2O5VA 1OXUA 4PAQA 2O8BB 2WKRA 4FCVA 4C4PA 1RRFA 1UJ2A 1YZQA 1NMXA 2BMDA 4RFSA 2VSOA 2OXRA 1G19A 1UM8A 2HMAA 3KZ1E 4HLCA 4OQMA 3NBZC 4Q01A 2W6JA 1PUJA 3WBJA 3Q7PA 3QJYA 4NCJA 3CPWB 3TGPA 1VYUA 1KNQA 5JRZA 4O0MA 3I5YA 1DAEA 3QVVA 1N0VC 1SXJB 4LX0A 4JLPA 4M9QA 2QNRA 2WJHA 3PXGA 3RS5A 5C18A 5KPDA 1RRCA 1ZNXA 4I81A 1GKYA 5JJIA 3G82C 4C2UA 4C0QC 3QPUA 2QEXB 1W36D 1XTKA 3DKVA 1S3SA 2NOAA 2RGBA 3NTUA 1OH7A 1DG3A 4Q9HA 1S9DA 5JCZA 5HZHA 1KK3A 3GQBA 5BYJA 5JCPA 1XXHE 1S96A 2XXAA 3HPQA 3W2IA 1DS6A 2GXQA 4Y9RA 1GDDA 2QAJA 4UKDA 2XEXA 1P3JA 4JVSB 5EXSA 3Q3JB 4G5GA 2C96A 1Z2AA 3BH6A 4BFTA 3ZD7A 3IILA 4C0LA 2DFTA 2DEUA 1NLZA 4M1KA 3AVXA 4JLKA 5CYOA 3U44B 3CRW1 4DZZA 5AUNB 4BRWA 1U0JA 1ONBA 1VKJA 1NL3A 2X1VA 2ODWA 4UNSA 1H8EA 2WHXA 3UMFA 3CW2A 4D81A 4LI0A 3FHCB 2CRVA 1L7VC 4TSFD 1GFIA 2YWHA 3AVYA 1W49A 3O8BA 5FI0B 5K8TA 3RYTC 2ATXA 3IEUA 4JVMA 2IF2A 4ZIRB 1YITB 4M1OA 2BPOA 3VR5A 4TN1A 3DMNA 1R8QA 2R6AA 3QXSA 2PEZA 1J90A 1E1RD 3NC0C 3K0CA 1FNNA 3HP1A 4WZ6A 4DIEA 2Z83A 4RD1A 4TL8A 2VBCA 3NBFA 4XIGS 5AJVB 1ZD9A 1KI3A 3ICEA 1QHYA 4FN5A 3CZQA 2ZJ8A 4IRUB 2QMUA 1Q82D 4AWXA 1E69A 5BQ5A 3VX4A 1GL6A 4JVLA 1R7RA 1XCGB 3P4YA 4C0BA 1IJEA 5GV7A 1T0JB 3DO6A 4JLVA 2BSAA 2HF8A 2R8RA 1W35A 2PBRA 1AS0A 5IDVA 4BRUA 2GTPA 4Q4HA 1IXZA 2ZYUX 2IYZA 4IVPA 4B3FX 4BLSA 2EU8A 3PENA 1OB2A 1OXVA 2C9OA 3AVPA 2WWXA 1ZAKA 3SC3A 4G1UC 3CIOA 3KKQA 1NBMD 2ZRKA 4DCUA 4ZGQB 1E2JA 1XWIA 4A2QA 1Q12A 5BW8A 1CJKC 4NZYA 3PCRB 1HY3A 1GNRA 3DZDA 2ERXA 3EA5A 4PQRA 4E09A 4Q7KA 2ZRFA 1CKEA 1E9SA 1C1YA 4BFXA 1G5TA 2AWOA 2HXYA 5E95A 2FX3A 3EZ9A 1EK0A 5FOUA 5JS8A 2W0SA 1ODFA 3KKMA 4HZUA 1PVOA 2ZU6A 3TRFA 3S1AA 3QF4B 4US2R 1UEIA 4TLAA 2EWWA 2O8DA 3VX3A 1OH5A 1FFHA 4QG7A 3AVTA 1SHKA 4JSYA 4Z54A 2A5GA 3W8RA 2OG2A 1G6HA 3NBYC 1YJWB 3CX6A 5FUWA 2BBWA 3EA0A 2BIFA 1UBGA 2VIIA 4II7A 2IWHA 5E7JA 2ZRLA 2IXFA 2XTMA 3LQRA 3T1TA 4MA4A 2BWJA 2ZUCA 4OI2A 2J45A 1P60A 1AKEA 4D2IA 5KNCA 2JJ1D 5JJKA 3JQQA 3L2OB 2ZI3A 1M7HA 4P31A 4Q7JB 2RB4A 4FINA 1IQPA 4NKRA 4I1UA 3BOSA 3IPYA 5DHAA 4D0NA 5GADl 2GCOB 2ANCA 2BGIA 3CCQB 2A9KA 4B48A 1LF5A 3HU2A 2ZRJA 3FFBA 2P6RA 1X86B 4US1R 4PSAA 2IS4A 4O2RA 2BMEA 3T61A 4EPVA 5FL3A 3CO5A 1US8A 3CBQA 1HE8B 1Z07A 1EG7A 5H70A 3HU1A 4NBSA 3FHOA 2BHRA 1CIPA 4QJ5A 5KDLA 4HYYA 2IYTA 1T4GA 1G7CA 1JBKA 1E2HA 2QM7A 4IDPA 2WKQA 3U7FB 3A1SA 2VP5A 2H5EA 4YONB 2OLJA 4CZ2A 4DLVA 4FCTA 3EG5A 2PMDA 1IHUA 1N2CE 4M9XA 1AS2A 4KLZA 4TYPA 1EWYA 5JS7A 2UZIR 1K8AD 5CLLA 4LPSA 4F7WA 1LB1B 2CXXA 3W6PA 4CW7A 2WJVA 4A8JC 3CUEF 3THXA 3PITA 2GVDC 2ZSBA 2GKSA 4C0HA 3DVLA 4GPTA 4QRHA 1II8B 2Q6TA 2R62A 3CR7A 3OE7D 5CB6A 5G3YA 2VNIA 3B6EA 4M8NE 5F9HA 4OHYA 3OAAD 3FPKA 5TB5A 1ZINA 4FD2A 5FBRB 2NIPA 4KCGA 3C14C 3GJ7A 4JLMA 2GEUA 3RRNA 2CE7A 4M1SA 4OHXA 2YWEA 2BBTA 2PIAA 4ZDIA 3IBGA 4EJSA 3AM1A 1QHIA 3P26A 1N5JA 2XX3A 3OFND 4B35A 5GJVC 2QBYB 2WZQA 2PZEA 5D3MA 2QTVB 2H17A 3KJEA 4PZZA 1OKKA 4X8MA 1E98A 2NG1A 4KXFB 1OLOA 4PC6A 3H1TA 5TVKA 1HT2E 2QU8A 5EP3A 2H8KA 4C43A 2F9MA 2W83A 1P2UA 1YZGA 1VQ7B 4TL7A 1FQKA 2KBEA 1OIXA 1SULA 4LV6A 2HJVA 4DDTA 2O0HA 3LBHA 3CCSB 1CJTC 3TBKA 1PLLA 1G7TA 3THWA 4NTZA 3RC3A 2VNKA 4GP6A 2OILA 5BWMA 2GJ9A 1OH8A 5CDFA 4EFMA 3HPRA 4NPHA 1UKZA 4QGHA 2D2EA 3DDCA 2BM0A 1UKEA 2HF9A 3CNOA 4LBYA 3K9LA 2DBYA 4PGOA 1W2HA 4WOPA 4IDNA 1DAGA 5HZKA 3MUFA 5BN5A 1TEXA 1ZM2A 1GAQA 1RYFA 1ZVQA 4Q4JA 1T5LA 1RE0A 1NN3A 3VFDA 1SVKA 4L16A 1JA0A 5AUPB 1GSIA 2I4IA 1S9HA 2R6FA 2BMWA 3CD6B 1XEFA 3GJ0A 3L0IB 4Q48A 3MJRA 1RZ3A 4LHYA 3P1JA 4GL2A 2QMEA 4X8LA 421PA 4JJKA 1GRNA 2GWHA 1KSHA 3RRYA 3LD9A 2XJ4A 3CC2B 3FWYA 3OIYA 2FFHA 4HAYA 5KSZA 1L2TA 1QBKC 1Z0DA 2C2HA 3SU8A 4DDVA 3IEVA 1N6OA 1R10A 1BOFA 3EPKA 3BFVA 2ANBA 2YINC 4QL3A 2WAYA 2A7QA 5EXTA 4B71A 5JSZB 3E70C 1VQ5B 3QEJA 2WV9A 3AVOA 3L8YA 1A4RA 2AR7A 4URXR 4C3ZA 1JB1A 5FBLB 4RFSB 1YJ9B 2IK8A 2J5XA 4D4KA 3QBTA 5KUTA 1HEIA 4HUQA 4TL9A 3FFAA 3W8NA 4JBXA 2GQFA 2QTLA 3D8BA 4QC2A 4L9SA 4LZZA 1N6HA 4W7SA 4FWIB 2QP4A 2V7QA 4HDCA 4XWKA 4RZ3A 3SYLA 3E20A 4FW9A 4PO9A 1XP8A 4MGIR 1L4YA 1LF0A 1SVMA 3KXIA 1M1YE 1CQXA 4PFSA 4YMSA 1U99A 1XZQA 1M1KD 1KSFX 1NJGA 2AK3A 3SBDA 2GZAA 2Q9BA 2H1LA 2XB4A 2BCGY 2OCBA 3K9HA 2WBLC 2XXAB 1W4CA 4XSGA 4ZCLA 3QE2A 1KKLA 1SVWA 2F1JA 1PLKA 2HLDA 3HR8A 3TJZA 1PLJA 2PT5A 3OZXA 2DFKB 4FCWA 4CYMA 2JDIA 3R8FA 1NKTA 4QGGA 4ZCIA 5FR2A 5IK2A 2XSZA 3WNDA 3K0SA 1Z0FA 1QHSA 2AFIE 3OF5A 4AKGA 1W87A 1IXSB 1BJKA 3C4JA 5FL7A 3PEVA 1DARA 1KSJA 1WQ1R 2WIBA 5CJ2A 3KX2A 5FTMA 4GZLA 3BE4A 4RD2A 1T8UA 2FSGA 1YIJB 1ZUHA 3PJRA 1A2KC 1KZ7B 2FMXA 5LB2A 4XH9B 3SYNA 2V8OA 4B43A 1BX1A 1G17A 2TMKA 1YZKA 3AF4A 3OEHD 5EP2A 2WOOA 5G3ZA 3MAAC 4NH0A 4Q1BA 5AJWA 1YJNB 2VHJA 3LAWA 4A36A 2JLXA 2YVUA 1IN4A 1ZU5A 5EE9A 5JI2E 3CM0A 4N0EA 2FZ4A 3JVVA 4CF7A 4OI0A 5GJBA 3VHXA 1XE1A 1O3YA 4OHWA 2ZXUA 2RGCA 1KAOA 4IVRA 5F9FA 1W46A 4Q21A 4M9SA 1VCNA 4U9UA 2AK2A 4B3XA 4OYHA 3U5ZB 1VHLA 3L0SA 4YQFA 2CLSA 5CM8B 3QKTA 3GLIA 1W4AA 3EARA 5LD2B 2IF0A 3U7HB 1T5IA 2GXAA 1UF9A 5L3VA 1XTIA 1E9CA 5IF9A 3BERA 3DM5A 3MGCA 4HZIA 4KU4A 5J4YA 1WA5A 1X1SA 3B5JA 3LVQE 2G3YA 2VPPA 4IOMA 1YZNA 4BWYA 5B64A 1KI7A 2ECKA 3I8XA 2G9NA 1U98A 4FWTA 1F5NA 1UDXA 5AK0A 4IFBA 2QT0A 4W5WA 4DUGD 2R9VA 4XTCS 3H4MA 1NVVQ 4HLDA 4QNMA 5H8WA 1YVDA 1GNQA 3MWKA 2J0UB 1CP2A 2VO1A 2FV8A 5EZ5A 2P65A 5F3WB 3N2IA 1AS3A 4DEXA 5E7IA 5DGXA 2I3BA 2HCJB 1I4TD 2EFCB 4HZUB 2BV3A 4JLNA 4NCIA 4LJ9A 5FOXA 4MKHA 2W00A 3S1AB 4DCNA 4I1VA 2FGJA 2RGGA 3H0KA 2O8DB 2A5FA 1E79D 2P0EA 1TUEA 4M4SA 2CL7X 2B92A 4LHVA 4PO1A 1Z5ZA 3G0HA 4O3MA 4LUCA 4Q1FA 3G4SB 4CGZA 2IS2A 2P2LA 2WIAA 3UKDA 1WBDA 4G5SA 4QJ3A 4B6EA 1W5SA 4P4TA 5B2ZA 5GVSA 2ZI6A 2Q3FA 2AD1A 3OW2B 4JYCA 1GILA 2ZJYA 2IUTA 1OYWA 2GXSA 4MYCA 2VP4A 5GV8A 1UBEA 1AGRA 2Q0HA 3B78A 4ERNA 1G8YA 2FEMA 3U61B 2Q9CA 4NCHA 3ADKA 3REGA 4DB4A 1WB9A 2IEYA 5FTJA 1VPLA 2O0JA 1NVXQ 2QPTA 1QVAA 3IGFA 4DSUA 1AZTA 2Y8EA 4A0GA 3CCRB 2WWFA 4PHGA 3A4NA 3SEAA 1XPUA 4R71A 2BVNA 2LKDA 4TMZA 3DOFA 5FFMA 1US8B 3LW7A 3WNBA 3RVBA 3ND9A 4TQAA 2ZRIA 1IBRA 3L43A 3GLHA 4NE2A 3WP0A 3EAQA 1OB5A 2VHCA 5FUVA 3FTQA 4JYBA 4MGKR 4CEHA 5TY0A 5G41A 3T15A 2JATA 1R5OA 4KHZA 1DAMA 4YMTA 1D5CA 1HQYE 4S2EA 5KNDA 3W34A 4V0OA 4A4DA 5EMNA 1AIPA 4BLRA 3DOEA 1M74A 2CK3D 3R20A 4MRRA 1MT0A 2R6GA 5DLQC 1IONA 3WRXC 2WWYA 2OSBA 1W36C 3NEJA 4XD7D 1RRGA 3QBVA 4P33A 1XTSA 1YRBA 3THXB 2QG6A 5DI9A 3TW8B 1ZNZA 1MO6A 1VCMA 1H8HA 4URUR 1QHHA 2VHTA 1Z6AA 3B1WA 3N70A 1FPMA 1F6BA 3LNCA 1N5KA 1T3SA 3W2GA 1U0LA 1OHHD 5FA6A 2IYUA 4B3BA 4HE5A 2ZJOA 3BORA 1ESMA 3VO2A 3AP1A 4YAOA 3U3MA 4URWR 3AGPA 1R8SA 3QG1A 4KVAA 2D06A 3I8SA 1CJMA 3AGQA 2F3RA 5CB8A 4EJSB 3RABA 3GLGE 2QE7A 2DFLA 3GFOA 3ZVNA 4HAUA 4L4UA 5D3MB 3UMSA 3SJZA 1TX4B 3UPUA 1E2FA 1FDRA 2GBLA 2DB3A 4M0LA 2ZANA 1JR3D 4A6XA 5CITA 4ZDWA 1C9KA 3DEFA 3W3AA 1NKSA 3PIRA 5IHPA 2G83A 4ZDJA 3LV8A 3A1WA 2GCNA 3OEED 2B5OA 1P2SA 4TMWA 2RKOA 3NG1A 4ITRC 2OK7A 4DLSA 3I73A 2Z6VA 3IO5A 3THWB 2FU5C 4A0RA 1TVCA 1FOEB 1T6NA 1COWD 4KYIB 4DC9A 5HR5A 1XPRA 1QG2A 1G18A 1HTWA 3EC2A 2KE5A 2CNWD 1G41A 4CEJB 3X1XA 4KO8A 4A0FA 4G01B 1SKYE 4E5UA 2CBZA 1XEXA 2QQEA 3CRQA 5K8UA 2O8FA 2PLFA 4PANA 4RVCA 5FTNA 5A4JA 3M6AA 1ZIPA 5A5GA 2OBMA 3C8UA 2X3UA 2GJKA 4D25A 4Q4JB 2ZU0C 4AF7A 1XFAA 2H16A 4UNPA 4W9MC 1TAGA 4TLBA 4KYUA 1HV8A 2QAGA 3AF0A 3BC1A 4YLGA 5JBQA 1EWQA 4FMCF 1G5PA 2J87A 2VQSA 2RGNA 3FMIA 1JAIA 3W2EA 1XJCA 2KJQA 2GJ8A 2QEQA 2ZRGA 4G3XA 4TLEA 5DHFA 3R9XA 2WWIA 3SJBA 5EXPA 1KK1A 3AVVA 4V0LA 3CF6R 1D9XA 2ZI9A 1ZMXA 1GOTA 4CT5A 1MOZA 2WVJA 3F5FA 4ARZA 5EE1A 3KUCA 2JLQA 1DAKA 5L3RA 2BEJA 2HT1A 4IHQA 2ZRDA 2DYKA 3LBIA 2Q9AA 1OE0A 2OBNA 1QF9A 4BFVA 4A15A 2VL7A 2IXEA 4LJ7A 2QENA 4HUQB 2O52A 1FQJA 3A36A 3BBPA 2GK6A 4JMPA 3J81k 1YQTA 5EP4A 4KBFA 1U9IC 2ZREA 1VQ4B 2ZRHA 3G71B 3PEUA 4K46A 4LBZA 2KBFA 4PQYA 4DCSA 3X1YA 2YC2C 1VQOB 2XJ9A 3O47A 3VAAA 1JJ2B 2ZSDA 1E1QA 4QGFA 3GFTA 5KSYA 4EH1A 1NBME 1F60A 5BXQC 2DERA 3OJWA 1O87A 4N0DA 1XX6A 1CR4A 1A82A 2FWRA 2VP0A 5FUYA 3B60A 1K5GA 1NP6A 3T5GA 1DELA 3DZ8A 4OHZA 3MLEA 3NH6A 2ZJBA 4AG6A 5DISB 3CCUB 4OK6A 1NNEA 3I62A 3QXHA 1W0KA 5KHOC 3P27A 2REXB 3QY0A 3W2HA 4FMDF 2NTYC 2GETA 4AY2A 3TQFA 1U0HC 3AKDA 1VG9B 4MKFA 1BIFA 3U7EB 4TZ0A 2ERYA 1DVRA 4HDQB 3U6KA 2YOHA 2HT6A 1NIPA 2CHGA 5KSPA 3ADCA 3LQQA 3TSWA 4R98A 3PVSA 3ZZUA 3FKSA 4EPWA 3BH7A 4CDGA 2ONKA 4PR0A 4V0ME 1Q86D 2OAQ1 2W0MA 3UK6A 5F2EA 4YMVA 4U00A 2R6CA 5SZIA 4MKIA 5DO9A 3SFZA 1KDRA 4LSGA 2FFQA 2PL3A 2ZAMA 4RKEA 4UJ5A 5AUQA 3CR8A 4N3NA 3BJIC 1UEJA 4BFYA 1N0UA 1II0A 4AF6A 2REBA 3UG7A 1WMSA 4BUJA 1Z6XA 3PEWA 4LJ4A 5HKKA 2ZSEA 2O0KA 3RSOA 1S4QA 2B8TA 4TTRA 3W3ZB 1JR6A 1EFRD 5FPSA 4XVUA 3ZVLA 4UAJA 1U94A 4NU0A 1OFHA 2GXUA 3TVDA 5FH9A 1Z63A 4DVGA 3GLIB 3NH9A 3RNLA 1P73A 1G3MA 5H1YA 4BFZA 4DBLC 1FRQA 3THYA 3NXSA 2BCJQ 1Z6YA 1XZPA 3LDAA 1A5TA 4LOAA 4D82A 2J1LA 1F3OA 1QX4A 4RZUA 5FPYA 3VR1A 2RAPA 2BKUA 4M1WA 2OM2A 1XXHA 1FNCA 4HAWA 3ZIAA 5AUOB 1NVVR 2WWWA 3O8RA 4EPXA 2W6JD 3FVQA 4JSTA 1LVGA 3EW9A 3VTKA 3AP3A 4LJAA 3PUWA 1DG1G 1MRSA 2CE2X 5CK4A 3QQ5A 1ZM9A 5L3SA 4IDOA 3UG6A 2V1UA 1Z08A 1N6NA 2ZR9A 3LXRA 3WHLA 1Y63A 5THXA 1M6NA 1WP9A 3KFXA 3QXCA 4ESHA 2ZRCA 2QGNA 2JGNA 1Q1EA 1ZW6A 2WJYA 4K81B 5HPYB 1TF5A 5J4KA 1ANKA 3KXLA 1YZLA 4LBVA 1C4OA 2B8WA 1QVRA 1SGWA 2NPIA 4QGAA 1J8MF 2CMKA 2NO9A 3QKUA 4A9AA 2J0UA 1NJID 1NSFA 1DEKA 2XNDA 3V76A 4LJ8A 2XZLA 1KYIA 3JQPA 1X6VA 1P9NA 5UKDA 3LO8A 4C30A 4AG5A 1AA9A 4IOLA 4A6PA 5JHHB 2LCFA 2EIXA 1PUIA 2BMFA 3KKPA 4OBEA 1H8ED 2IHYA 3U3KA 1XBTA 3EIHA 4L5BA 2WOJA 2WWGA 4CRWB 1MO3A 3JZAA 3PR1A 3SNHA 3NBXX 4NL4H 3X1WA 3QVUA 1VQNB 4H1VA 4EJSC 1G9XA 2WJGA 2Z4RA 4ZI2A 2ZE6A 5DN6A 1NN0A 4KFRA 1VMAA 2C78A 3PUVA 1OGIA 3GLHB 4CEHB 1SVIA 3I92A 4QXAA 1E2PA 2VHQA 1HQCA 3OE7A 1ELOA 1ZM4A 4LJYA 2QPAA 3T06B 1TADA 2V6JA 2X8AA 3WNCA 1N8RD 5H5JA 4WAUA 5GJWC 4C0AC 4LYHA 4QFMA 3G5UA 3K9NA 4QBIA 4GZMA 4YDHB 5EUMA 3RAPR 3W90A 3WMEA 3KQHA 3IIJA 3WY9A 4DJTA 1OH6A 3CCLB 1KOFA 2QPOA 1JPJA 4Q9JA 1RJ9A 2XTZA 4TYNA 1KKMA 1Q57A 1QHHB 4UXIA 1Q44A 1AKYA 1AQUA 3ZZTA 3FDIA 1E9BA 3TIFA 5J40A 5L3QA 3BIFA 2F3TA 4BEJA 1E2EA 2X2FA 3VKHA 2KSQA 3WYAA 5JHGB 1CLUA 1E63A 3FKQA 1XJ0A 4TL6A 2XZPA 3SQXA 3GEEA 3AQ4A 1Y3AA 2F9LA 3L0OA 3NKVA 1TLLA 2V1XA 2CLCX 4AI6A 2CVFA 1F20A 4M2LA 3DL0A 3KKOA 4A2PA 3GLFE 4LDJA 1KAGA 5JMTA 3JVUA 2ZEJA 3QOFA 4D4JA 1UBFA 4TMXA 1G8PA 4GOJA 4OJKA 5EUQB 4JBYA 1JI0A 1YE8A 1QUEA 1OXXK 3CNLA 5AWFC 4ABYA 2JLWA 1G7RA 1IN6A 4M9ZA 5DE3A 4PPFA 3KL4A 5AJZA 3A4MA 4OQFA 1XEXB 3KQLA 3KDSE 1P9RA 3OIUA 3FGNA 1B0UA 1TUIA 2MMCA 2WICA 3AKCA 2ZVPX 3QENA 4WXRA 2HEIA 2VYFA 4CVNA 1DDIA 4EFLA 1XD9A 4XJXA 4DQLA 1VECA 1K6MA 4C0JA 2QUZA 4M1MA 1OXTA 4QHYA 1BQEA 2GAOA 4OHVA 1GRQA 2ZQ5A 3SHWA 3RRMA 3ZYCA 4WQMA 2QAGB 3EIQA 4BFWA 1W0JA 4NONA 4C7OA 1X3SA 3A1TA 4HLUC 4G5OA 5EQTA 3ZS9A 1GWNA 3UWOA 4ZPXA 4H9GA 5CJPA 4CEJA 3W5JA 1WXQA 4R2IA 4DXAA 4POAA 1MR3F 2IT1A 2WSSA 2FN4A 1X8JA 4JLOA 4PQFA 2IUUA 5JWHA 4ARZB 1S72B 3V4RA 2OCAA 4JKIA 2FOLA 2VNHA 2YKGA 1ZU4A 1R5NA 4TQUS 4A0HA 2IWRA 2KB0A 1E9EA 3BS4A 1ZC3A 3CX8A 1Z0IA 1YZUA 1SXJC 3TK1A 1JXOA 4DLWA 4BQSA 3K09A 4Q03A 5EP1A 1S2MA 3GD7A 4GOKA 4UXJA 1MKYA 1KO7A 1JQLB 1G8HA 2C8VA 5DYIA 1E64A 1VTKA 5KNBA 3QSYA 3EIEA 2QP3A 4FK8A 3GPLA 1ESNA 3CWQA 1S8FA 1UKYA 4GOXA 1KSGA 2F1HA 4AKHA 1YZTA 1K73D 2WMNB 2GEDA 2EYQA 4OI4A 1EP2B 4Q7MB 4EAQA 1G3QA 1KO5A 1MABB 2ASEA 3KQUA 1EX7A 5E3HA 4ON9A 4Q00A 1RPZA 1T3HA 2D3WA 2G88A 1K5DA 2AX4A 2JCSA 4MH0R 3TW4A 4BASA 1XEWY 2VRWA 2XB2A 3OZWA 1QVFB 1W34A 4TLCA 4Y0AA 1M2OB 2Z5FA 3ZZ0A 3X1ZA 4KVGA 4ACAA 4AIIA 1E2QA 4BE7B 3UATA 4PSKA 2BOVA 4AK9A 2GZDA 3AP2A 4IEIA 1FMJA 3W5IA 3FHTA 2NGRA 2HXSA 4F92B 2R6HA 1OKKD 5F98A 2RHDA 1BX0A 1OFIA 2X2EA 4LK2A 1UPTA 1R0YA 3AEZA 1E2LA 1RFLA 4B3CA 4F4IA 4FXPA 3SN6A 1JAHA 4EPTA 1VQLB 2V55B 3AF3A 4EIWA 4TYQA 3U4QB 1SXJE 3MSXA 3R9WA 1KJYA 1HYQA 1NN1A 1Z6TA 1S1MA 4GFDA 1YKSA 1VQMB 1VQ8B 4M1YA 1OFUX 4OL0A 4PAOA 3CNNA 4RCZA 1IN5A 3I32A 4WA7A 4DDUA 3SHFA 4FIDA 1VDZA 3RSLA 3LFUA 4JIMA 4L15A 1QFYA 3AKYA 4PTLA 1FX0B 3RRZA 4DLYA 2OAP1 5BN4A 1GP2A 1JECA 5C2JB 4KLNA 2ATVA 1Q1BA 1UBCA 4ILEA 3KJGA 3EWSA 3PUXA 5AJXA 3TAHA 4IOJA 3AF1A 2PZFA 1W2BB 1MO4A 4TLDA 1E4YA 1CNEA 2A5YB 4DSNA 2OLKA 3T12A 3MWYW 5TXGA 1M7BA 2JIZA 2JLSA 3EASA 1KRHA 3TSOA 5KDDA 3D31A 4Q19A 2JJ2A 3H2YA 1MRNA 3KJIA 2DFNA 2GPJA 4QOSA 4RY2A 4PC1A 1R0WA 1R2QA 2FPLA 1LNZA 2Z43A 4V03A 3THYB 1EFUA 1IY0A 2YNMA 1KI9A 2ZRPA 4MRSA 4Q66C 3FOZA 4BPRA 4Q4AA 4LJ5A 3D6TB 1FP6A 1P62B 3A58B 2EWVA 1JALA 3U3JA 1Q20A 1V43A 4D80A 3B1VA 1ZP6A 4Q02A 3BWDD 1MV5A 4LCBA 3LBNA 2RMKA 3QFCA 1GITA 1XXHB 4WZAE 2CHQA 2OO7A 2R6DA 2JASA 1SZPA 4NCNA 4NYMQ 4YC7A 3KKNA 5GVRA 3FJOA 3T35A 1OGJA 4LV5B 4KSCA 5FR1A 1BMFA 1ZC4A 1R6BX 3MJHA 4ACBA 1W1WA 2V7QD 3VMFA 5L3SB 1KMHA 4AURA 4Q9LA 3DM9B 3GMTA 4W5JA 4UJ3A 3M0EA 1R0XA 4DLRA 4EFNA 3ZLJA 5CLQA 2ZRNA 2GF9A 5TR9A 1U81A 4Z1MA 5EZ6B 1CJVC 2W6IA 1FTNA 2NO0A 2PT7A 3MD0A 4RJLA 2QP9X 4PHTA 3VR2A 4DCTA 1AM4D 1G4AE 3U3OA 2OCPA 3Q85A 1CNFA 3ZC3A 1HT1E 2ZS9A 4KFTA 3MCAA 1IM2A 4OI1A 4YHBA 2ZETA 1D2MA 2DETA 2JDID 4I1SA 4DEYA 2IA5A 4DHEA 2XSZD 1QG0A 5IK2D 3MHPA 4GBMA 1T91A 1JR3E 3UWKA 2AWNA 1PV4A 5FL7D 2CCJA 4JVNA 2PLRA 1SXJD 2B6HA 4JJZA 1BYUA 4E22A 1Z0KA 2VNJA 1CXZA 5J4VA 3QXJA 4DB2A 1D2NA 3BFXA 3CRZA 2GRJA 3GCGA 3QKRA 3D7MA 3Q9LA 4OQXA 4RCYA 1N5LA 3K1JA 4PC7A 2IC5A 1R5BA 1VCIA 2J7PA 1QZXA 3JQRA 1VG0B 3IO3A 1XMJA 2FG5A 3QXXA 4YMUA 3V9PA 4R7ZA 1DBSA 2YWFA 4GRAA 3B2EA 5TMPA 1E3MA 2D7CA 2OFOA 4YXWD 1TF2A 1PZNA 4WBSA 2KI5A 1TPZA 2A2ZA 2VTKA 2OUKA 1E9AA 3U7GA 5J47A 1KK2A 4R9UC 5KPJA 1YR6A 2GK7A 2GBLC 4B2PA 4DT1A 2QTHA 2ZE8A 2JLYA 3KB1A 1L8QA 3ADDA 5FPKA 4JT4A 2AL7A 4XWOA 4QM7A 2FGKA 3DPUA 5KO2A 2J59A 3MWJA 5LPNA 1SM4A 3KTAA 1D6JA 1NJFA 1KC8D 2JLZA 1W44A 4RZ2A 1DOAA 1ZM3A 4D4MA 4EKDA 1W7AA 2F7SA 4D4LA 1Q1QA 4RD4A 2IS6A 2G6BA 4MQBA 2W2TA 1AMOA 3L0PA 1E2GA 5FOVA 5AJYA 1RJ9B 4B44A 2ZE7A 4PO8A 4A82A 4ASUA 1Q22A 3VR6A 3AB3A 3AKEA 4G0NA 3VNUA 4KFUA 4F7DA 5GJCA 1YHQB 3GJ6A 2L0XA 3IDQA 1A1VA 1G6OA 5CYPA 3ZQJA 1GG2A 1NY6A 1P2VA 1Z47A 1F2UA 3LX5A 2XOKA 1FNDA 5FOTA 4LC0A 5L3QB 1CBUA 2FSHA 4X8HA 1Z06A 3WXMA 3RS0A 2IBMA 4EPYA 4P4SA 5CM9C 2QAGC 4JZKA 2ONJA 3TUZC 1TNDA 2WTUA 4B73A 1Z3IX 4NP6A 2BJVA 4WXPA 1V5WA 4TT3D 3JZMA 2P6NA 1I4LD 2JAQA 2RGNC 2C5LA 3F8TA 1FMLA 2DCUA 2VF8A 3EZ7A 4CEIB 4BGDA 3NDBB 2PX3A 4NYIQ 5LDDC 4GDFA 2MSEB 4OJQA 2WPDA 1Z28A 2D62A 2QROA 2VHUA 1T3LA 4DLTA 1Q81D 2EFEB 2I1VB 3I55B 4JLBA 1OJLA 1VCOA 2AFHE 2VSFA 2NMVA 3W6OA 1OFTA 2OFWA 1EGAA 4GNKA 3FMPB 3GFPA 1BO6A 4HDOB 4L8GA 1JPNA 5IT5A 3LWNA 2HYIC 3CCVB 3T34A 1KDTA 2VA8A 4MUBA 2EYUA 4YXWA 1VQ6B 5JFGA 4Q1DA 2ZVQX 3KUDA 3K0EA 1EFCA 3HR7A 4LRWA 3HYRA 3P4XA 3ASYA 1E0AA 1E2DA 2CJWA 3KJHA 1ETUA 4HAVA 5H59A 4B47A 3TQCA 3QF7A 1NMZA 3I61A 2ZRBA 3MRSA 1KI2A 4HB0A 5CIWA 2ZJ5A 3T1QA 4C7OB 1KI1A 4WIAA 1H65A 2W2XA 4HB4A 1BKDR 1Z29A 2KWIA 4LWZA 2RHMA 2ZI5A 2RH5A 1QH0A 1BS1A 3K8YA 2XZOA 1JJVA 2GHIA 1NDHA 2LKCA 1BYIA 3WP1B 1AJEA 3T1VA 1KY3A 1VIAA 1KZGB 4IDQA 1YHNA 3RS2A 2G0NA 3VU9A 3VKGA 2F43A 1GAJA 3AV0B 4PZYA 5M04A 3WMFA 4JL8A 1E2NA 4ZDKA 1FNMA 1KJZA 2FPMA 2J7KA 4IJMA 5J5CA 2VLIA 1E2KA 3GLGA 1YR8A 1KO4A 3WMGA 3SQWA 2FPKA 4QKQA 3CKLA 3LW8A 1YJ5A 5FTLA 1Q0UA 2HV8A 3MG9A 3TE6A 4MDFA 4BECA 4UNRA 5FUXA 2C77A 1NI3A 2P67A 4CT4B 1FP7A 5EJEA 4Q1EA 3SI7A 2NQ2C 1W47A 2XNJA 2R2AA 4GMDA 1CULC 1H8HD 1P7CA 1KMQA 1P61B 2BDTA 3QFRA 3N5CA 2AKAB 4MYTA 1XTJA 2ZS7A 1QG4A 2W58A 5C4GB 3CC7B 4Q9KA 1W5TA 2DWQA 1G4UR 3ONWA 1LFDB 1Z0JA 2ZAOA 2FSFA 1Q3TA 1QGYA 1KQSB 2QTFA 2UVQA 4HEJA 4ZV4A 3ZDQA 2R65A 4GSYA 3A6PC 2Q3HA 2QE7D 4I4LA 5FI1B 4DLZA 1CEEA 2IYSA 1NG1A 1VG1A 1LTQA 4K8OA 4A2WA 2G1JA 1FRNA 4JT2A 5KOYA 1GR1A 2QT1A 4Q7LA 4DDWA 1D1NA 1OIWA 1TU4A 1CR1A 1G291 3CPHA 2OZEA 3HYTA 3IQWA 4PSVA 2C98A 1MABA 1W48A 2F6RA 3Q7QA 5HXBA 2JLVA 1GUAA 1XTRA 1UMKA 1A2BA 3B13B 3UANA 5FBVB 1NN5A 2GZHA 3CWZA 2QDXA 3DHWC 3K0CC 4EQ6A 5L8VA 2RC6A 2NO7A 4Y7CA 3W5VA 1XRJA 3I1FA 3IUYA 2WSMA 1D9ZA 3OIWA 4TSFA 1CF4A 4HB2A 4JL6A 4C2TA 5SZHB 1W4RA 5DI3A 1K8RA 4QBFA 4B75A 1AZSC 1D8TA 1CS4C 3CX7A 4H1UA 5KTYA 1OV4A 1NLYA 1QDEA 1LS6A 4JLJA 5LD2C 1NMYA 5JRJA 1E94E 3U4QA 1E1RA 4V0KA 1Q7YD 3C16C 1E99A 1XDBA 1UAAA 4Z8XA 4TMTA 1FW6A 2B7BA 1F2TA 3IHWA 3OZUA 1G7SA 3B9PA 1JB9A 5BYKA 3D3QA 2F1IA 4TMVA 5BN3A 1FX0A 3W6NA 1X1RA 4Q4AB 3RDPA 1E0KA 2NZJA 4LHZA 4Q9IA 2QQ0A 1KIMA 3E2IA 4OK5A 3IBYA 4B2LA 1S0UA 5HCIA 2DHRA 4S35A 3TKLA 2QSYA 3GEHA 3M1IA 4Y9UA 2I1QA 3KXKA 4UNNA 1JJ7A 3IPXA 4JKYA 4LHWA 1ZNYA 3SS8A 2OHFA 4ZI3A 1NBMA 1B2RA 3ASZA 3HU3A 3I3SR 1TU3A 4MUAA 3CCEB 1N6LA 2O8FB 4BLTA 2X77A 4PHHA 1U8ZA 3NWJA 4NYMR 4GMXA 4UXHA 5TDHA 3BH0A 1IJFA 3EZFA 3FE2A 5JWOA 2GAAA 3ZVRA 2QMOA 2FNAA 1KMHB 1CR2A 2BJWA 5E4FA 2ZI4A 2DWPA 1J9ZA 1HH4A 5HE9A 1QHGA 1I7PA 1F48A 1OSNA 2E1RA 1E1QD 3ECCA 2IYRA 1AN0A 4JS0A 3C41J 1G64A 3FMFA 5JWRA 4RD3A 3IKJA 4EDHA 4AYWA 4BZPA 3W9YA 3EPHA 3ZQ6A 3TUJC 1U9IA 4DIDA 3NVAA 4V0MA 5B57C 1WRBA 2ODBA 3A1UA 3U60B 1NVWQ 4XSHA 3W5UA 2REOA 4ZCMA 1LW7A 1RIFA 4C9BA 3C15C 2JJ1A 1ZYUA 1RYHA 2PMKA 2QORA 1W0KD 3SOPA 2QGZA 2JEOA 3NIBA 3QKRB 2FSIA 2H92A 1IOZA 4BPBA 1EESA 3WBKA 4IKEA 1H85A 1KO1A 4M21A 5CK5A 3ZH9B 2O8EA 3R9IA 4NYJQ 1DO2A 1JXMA 2P3SA 2D74A 3CLVA 3EZ2A 2V54A 1M90D 3FKSD 2ZYVX 3KFVA 2NPFA 1UKVY 2IL1A 2ZSFA 5C1BA 3SDZA 3LH5A 3PUYA 5DIFA 3VR3A 1KO8A 2A30A 3K0AA 4LYAA 3CCMB 1EXMA 3NDPA 3TMKA 3RANA 4B3DA 4DT1B 3IQXA 4TYYA 5HCNA 5C46F 1E9DA 6Q21A 2ORIA 3QKSA 4W5HA 2VZLA 1N6IA 2N1BA 3AH8A 4MYHA 3B7GA 4FMCB 5TARA 2J0VA 3LVBA 4AC9A 5HKKD 2XNCA 1OT3A 4J0QA 3WHKA 4TTQA 3KTAB 3CH5A 1YR9A 2IUSA 4KODA 3E1YE 3RS7A 821PA 3IIKA 2ZR7A 2YOFA 1RKBA 4XVRA 3FMOB 1QHXA 4YAFA 2FE4A 2F55A 1IN7A 2JLUA 1J70A 4GT1A 1CJUC 4TMKA 1CRPA 1QHNA 4IXMA 3V4FA 3NEYA 2CLDX 4M22A 2FA9A 4E03A 2V3CC 1XJQA 4WZBE 1FUUA 4BZQA 1DO0A 3AVQA 2ZM5A 4B4DA 2CNDA 2BBSA 1F2UB 2BN4A 1XF9A 3OAAA 3BAFA 4NCKA 1AK2A 2GEVA 1YR7A 2YYZA 2AN9A 2H18A 5JI3E 1GKUB 1W2GA 4YAUA 2MMGA 3SYKA 2BC9A 3ZIAD 3WYGA 4YAWA 4OQNA 5K8LA 4NMMA 2C95A 4P4SB 3UXMA 2RGXA 1DPFA 3OFNA 1QGZA 3L82B 8OHMA 4B3GA 4F93B 1GVNB 1GRRA 3M4YA 3LA6A 2RCNA 3RS3A 4I1OA 1UFQA 4NYIR 2P6UA 4PX9A 4YALA 1NLFA 1VQ9B 3QE0A 2CEAA 2PH1A 1GO2A
chains in the Genus database with same CATH superfamily
1E6CA 1HDGO 4M89A 3H2BA 4EGCB 4Y2PA 3D5QA 4V3BA 5TRDA 5D3QA 4NCBA 1CTQA 1Z7YA 1RYEA 1XJ5A 3CZAA 4MR8B 4RC9A 1AF4A 2O8CB 2FFAA 1UADA 2DCMA 4J6EA 4R1OA 2VDPB 1CRZA 4IG9A 1ACMA 1RVDA 2FCRA 1IBCA 2OM6A 2A3RA 3G9ZA 2ZZFA 1K9MD 4MB2A 4KSBA 2O23A 2RARA 3GOHA 3K09C 4J4BA 4PYQA 3D2AA 3NUZA 4Z0TA 1B0ZA 1IVNA 1JXAA 2O8VA 1NNI1 1I36A 2VJNA 3FHJA 3HFRA 5DYNA 5TRTA 4LDZA 4F85A 5KKNB 4DF3A 4LY6A 1XYYA 2RSLA 3HAGA 3IP7A 1E61A 2O0LA 4ZVOA 5IJAA 3KCQA 5KEIA 2EJWA 3NHAA 2J3EA 2D1RA 4DYVA 3DZKA 2NV0A 5IJ9B 1SN7A 4MGYR 1R3UA 2YMLA 2I6TA 3IBCA 2YVAA 1YONA 3AZPA 2I1LA 3HB7A 3M6VA 4E51A 1BXGA 2EERA 3GJ8A 3L5OA 4D96A 3ZV4A 3TCNA 1QMPA 4I1PA 1JDUA 4LSZA 1AGPA 2LD4A 3F0TA 3T6KA 3DZFA 16PKA 1OW3B 3AI3A 3O8QB 2X2PA 4QVGA 5CDFE 2IY8A 3K32A 4M99A 4DA8A 3PXCX 4FGLA 4NCXA 2J9FB 5JEDA 3VC2A 3O3NB 2UYCA 5K4AA 3PUMA 2HA7A 1WKCA 2VRCA 4U9IS 3Q3AA 2BUBA 4AD8A 2I62A 2Q4EA 2CLFB 4EEZA 5DSXA 4G41A 5C1IA 5K4GA 2PLNA 4RVHA 2F43B 2AFHB 4DLAA 2DBQA 4EJMA 3VO1A 2J8ZA 5JR3A 1I24A 4ZWNA 4X06A 1EVLA 1EIWA 4QHSA 1WCV1 3L1IA 3RSQA 2PRKA 3JTMA 1DTEA 2O6HA 4LRUA 1JEEA 1ZSVA 2YIVX 4F4JA 4KV9A 1XN1A 2EFDB 1B0AA 1ZUNA 2JH3A 4JFAA 4D79A 5AJTA 2VJYA 4KRFA 4DSTA 4ISCA 2PHZA 4NVRA 3B1KA 1QO7A 4TWZA 2ZDQA 1JEYB 2P7IA 4POOA 4AW9A 3GLFA 2B5VA 1U8YA 1GM5A 3SR4A 2YW9A 4PGHA 1LQ2A 2O2ZA 2QI9C 2QJFA 1A7AA 4NQRA 3T1HB 2IU0A 1WS6A 4YJ2B 1XD8A 3GJ3A 5K6AC 3QIVA 3L8MA 4AF8A 4RPHA 1W36B 2IOQA 4Z8YA 2YWXA 3A1NA 4MQ4A 2ZFUA 1UC9A 3A1VA 1DT5A 4IIDA 4QLOA 5D00A 5FA8A 4HRAA 5ENZA 3TH5A 2BT4A 2PANA 4XLEA 2V6IA 4OGFA 4D3DA 5DH9A 2QTZA 2QN7A 3ENZA 3QBEA 5AKIA 1TOAA 3KWMA 2OK8A 4LC1A 5JEEA 3K5WA 1E5LA 5ER9A 5B58C 1UKAA 4MJLA 2FZLA 3F8SA 3EXAA 5J3OA 3E2MA 4LEIA 4DZRA 1JJAA 3J7AC 1NVEA 2CFSA 3FPAA 4DCVA 1OWPA 4G5QA 2JA2A 3QKIA 1M34E 2HWUA 4P12A 3KAQA 1XF1A 2CDNA 3PNBA 4Q5IA 4ZKEA 4OPVA 4ZYTA 2CEKA 3IVAA 2PXCA 4XQEA 1DNPA 2NO1A 5DCUA 3HBAA 1G60A 1NG9A 3MK31 3W8EA 4Q18A 4ZMRA 5BY2A 4XYMA 4MWSA 3PYMA 2SCUA 1JH8A 1ZWLA 3BBLA 2XDWA 2V97A 3FHLA 3K0FA 5A7GA 5IXYA 4H3SA 1KK0A 3TQHA 1GAXA 1E3QA 4O02B 5B1HA 5DLPA 3LYUA 1YULA 3QNUA 1RZUA 5IYZB 3F96A 2AHOA 3BY2A 2SHKA 3TLYA 3P9YA 1KI6A 2AVNA 4O2AF 5DI3B 3RWOA 3T9FA 1RCFA 2CXQA 5DBFA 4CCAA 3N2KB 3H3FA 4TYWA 1EGHA 5FOSA 1WO8A 1KVQA 4CKBB 1GCAA 1VHWA 1VYVA 4L9AA 4BVFA 5KYXB 1HMYA 2C9ZA 4RW0A 1QGUA 2QR3A 5BN1A 5JPDA 3HKCA 1G3RA 4X8IA 1MNAA 1P9WA 4G7WA 1VQKB 1E0JA 3CSSA 3BN3A 3IMEA 4I8XA 4JQYA 4N5MA 4D6YA 4EFNA 4EO4A 5INTA 3DKKA 1WKVA 4TXMA 1FJHA 1PVDA 4RGQA 1EP3B 2O0MA 1F9EA 3QEOA 2BGJA 2AJBA 3AF5A 3I9FA 4UW9A 5A6SB 4X7PA 3RJMA 3M3DA 4U7DA 4KI0A 2HQOA 3LWZA 3B1XA 3G0GA 3BGWA 3FZQA 3TLJA 2WYWA 3CY6A 3KQQA 3SYTA 3HVJA 1UBMS 4DIKA 2XDQA 3THSA 1CS0A 3TXAA 1H42A 4UVGA 3ASVA 2WHQA 3LXMA 3T5DA 1KQ3A 4ETNA 2X41A 1XXLA 4PXAA 1X7WA 1MJNA 3ROFA 5CRIA 2QL7A 1Z88A 2P1RA 3HRHA 4YMIA 2NUTB 4ZT7A 3WVNA 1BVYF 1J39A 4PZ0A 2WZPP 2BFPA 4J6FA 1ZONA 2QW1A 1CWUA 1AQYA 2X6TA 4YP9A 1E4OA 2Z04A 4XR6A 3I4CA 1KR2A 4KAXA 1AGNA 2OT3B 2VP6A 4DREA 1MHPA 1XCPA 2MSDB 2Q1UA 3Q38A 2BMJA 3A6FA 4R8RA 4UQOA 1G21E 4MNTA 1BN6A 4ZVRA 4S3MA 5HM8A 1G9TA 1QQ5A 3FM9A 2PR2A 1GZHB 2CUZA 1OC4A 3GDOA 3GLIE 4HAXA 3R3JA 3K9QO 2ZITA 4H7HA 5ALFA 4M46A 3D2BA 5LOVA 4PHFA 3TX6A 4IJQA 1XEWX 2FWAA 3DEKA 1TAHA 4RXUA 4JJEA 4NNPA 3OQHA 2CXSA 1E3ZA 1QKKA 4MITA 4TVBA 4Y0VA 1ODLA 1BH2A 5DNDA 4LY0A 2G0TA 2EZ9A 3UICA 5DP1A 2CJPA 3TLEA 1H3EA 4KNWA 4ZO4A 5HF9A 4YUAA 2WRZA 4OQLA 3QZUA 4XWTA 4MRNA 1QTQA 1KHTA 1PJCA 4BLQA 3EYWA 3QTBA 5KQMA 2HDWA 1KOLA 3MWEB 3E05A 5CXUA 1NRJB 2JCGA 2ZBPA 4EDFA 5E2BA 1CQJA 4ZHQB 4MICA 4DQKA 3KIPA 2B21A 1TKRA 2W2LA 2X9QA 3K5IA 2ZB3A 2ZJAA 4ROTA 5BV2P 2GJRA 1GY8A 3TNFA 1RRPA 3FX2A 1Z22A 2PZGA 1K7XB 3AVUA 2CC2A 2D8AA 1NY5A 3B3GA 3E35A 3P0FA 4RANA 4L8JA 4UUBA 3MMPA 3VNVA 2XTNA 2D1YA 4S1NA 4GSKA 2VYQA 4TQ9A 4F6CA 3K53A 4PF1A 4IVQA 5D5HA 3RHTA 4NYJR 3TD6A 1E3IA 3HB4X 4FI3C 5JXHA 1XOIA 2BM9A 2HJHA 1V5IA 4UVHA 2CZQA 4LBWA 3LHKA 5CXQA 3NDRA 4HLQB 1JNYA 5HYVA 2QLTA 4XJTA 3IMCA 5GZ3A 2WF8A 2OD2A 3AMVA 5HUHA 3JAMA 4BJ6A 2QTCA 5FBHA 4XTRA 4V39A 4ZIRA 5BUZA 3RC8A 3COZA 4YCBA 1NF3A 2UZ4A 3FR8A 1G3UA 5J5VA 4G4IA 1JIQA 1SCNE 2PFGA 3A4YA 1VQ1A 2W93A 5JISA 1TQHA 1YKGA 2JIZD 1FK8A 3UIEA 5FOWA 1DWQA 3I2FA 4OPMA 4AJEA 4D56A 4CHTA 3EISA 1DXOA 3Q72A 4ZGGA 2V4ZA 4GR9A 3AHJA 1L9XA 2BFEB 2HA5A 3N1UA 1M2GA 1Z2DA 1N9GB 3LPCA 4P8RA 1UPXA 5A1JA 2BEKA 1VLZA 3NR2A 4GP7A 1RM0A 4K2HA 4YRTA 5IABA 3G05A 3IQEA 3CZ9A 3BHJA 1NF2A 3NHJA 1O9BA 4U39A 3I6QA 4IQGA 5IN5A 3F3KA 4P4UA 4PTYA 4F21A 3A4LA 2Z98A 1HUQA 4BLPA 3BTVA 3I01M 3FNFA 3RU7A 1OHHA 1CRQA 3C98A 4DSOA 3BMXA 2XYQA 2YJTD 1KPHA 4RFVA 4ZPJA 2ZE5A 3LS2A 4NBTA 1RWNA 5JSKA 2EOAA 4DKXA 2CHFA 1YX2A 1QIHA 1GQSA 4G36A 4MRMA 4HD8A 4O4HB 3GZJA 5K1ZA 2Q3DA 1UZMA 5A0FA 1GSOA 1TC1A 2Q07A 3NTXA 5IWCA 1XAGA 1ZN2A 4DCCA 3OIFA 2G76A 2QG9A 2VAPA 4DHWA 5K8IA 4F46A 2X6YA 1JHRA 5A5DA 2LE0A 4Q3EA 2OBLA 2PS0A 1WXHA 2VF7A 1JR3A 3GN2A 4G1BA 5H02A 3WIUA 2Z0MA 4UARA 2E5FA 4BP8A 5DYGA 5MF6A 4QEZA 3DG9A 2WF5A 1ZD8A 3B82A 2WM9B 4JWKA 5FEUA 1FFXA 2J07A 4I55F 5KYTA 1SC9A 2PJZA 1L5YA 3ZS8A 2C99A 4Z1MD 1Y4SA 2F17A 3K7EA 1C7QA 5C1PA 2W2VA 3NAGA 4KK4A 4ENUA 3IQFA 4RD6A 2P5TB 2JI8A 3GO4A 3G85A 2HRBA 3EGDB 2DM6A 4ZVPA 5IANA 5CNKA 1DP4A 3UFXB 1Q5PA 2OEPA 2AD5A 3G1WA 3PI7A 4YQZA 3QFSA 4GC5A 5U4XA 3PTZA 1CZHA 2I8CA 5ANRB 4G5RA 5E6UA 1ZFNA 1SCUB 2FF7A 2ZROA 2IYPA 1U31A 2EX0A 1WD5A 4W1RA 4A91A 1JEQB 1C3OA 1YU9A 2G9RA 3B89A 3F6CA 4LYFA 5KC8A 4XIYA 1BW9B 1E58A 2BHSA 2HR1A 3QLVA 1YMUA 3SR0A 2GCOA 4H3VA 4I99A 3V4ZA 4EYQA 2AE1A 1JFRA 2O8CA 4ZVKA 4LVNA 2CCKA 4QD3A 3ND7A 1UBRS 4EO7A 5DKFA 2VAXA 4PRZA 3L0DA 4IDHA 4XLLA 2CL0X 4J9VA 5BV7A 2FEXA 1XA4A 1ZA2A 3JWJA 3GJ5A 1KNXA 1RBYA 1ESZA 3E9QA 3JQ8B 1NBEA 5KVQA 5JXGA 1H5UA 1MB2A 1U0FA 4MUIA 3VKVA 3RWMB 3UK0A 5BN5B 3ROTA 1Y1QA 2PO5A 5TVGA 3SLKA 1V9CA 5IJ9A 2WVHA 3ASSA 3MB8A 3IR6A 2A1TS 3L3BA 1Z5UA 2P4HX 3GUHA 3IMKA 5DCLA 1NSTA 1Y1KE 2YKGA 1G2QA 2HWYA 3A6LA 4B3RB 1WU7A 4J43A 3SNKA 1XZHA 4HRVA 1P17A 3CZRA 5MN4A 4PLWA 1Z6GA 1J6UA 5G0SA 1DEAA 1XDGA 3EVTA 3EODA 1L4KA 2J9FA 4G5YA 3M2TA 1TQ4A 2VHVA 4H7KA 2QSZA 2LBPA 3DWEX 1EDEA 4N0MA 1Y4DE 4JP8A 1C2YA 4MQFB 3H6KA 5F7JA 2HPAA 1EXDA 2VNSA 1FVXA 1BTOA 1E32A 1SEVA 5EJMA 3BZWA 2AFHA 3A6ZA 2QIOA 1WSBA 5AH0A 2VPWA 4HP8A 4OHMA 5FPPA 3RRJA 5L3ZA 1ECPA 4G0OA 4E6PA 3V1YA 3KZNA 1Y3HA 1UPFA 4BEBA 1R8JA 1K86A 2EVWX 3KKZA 4GBJA 4IWNA 4O5AA 4XQ9A 3WGLA 1DCKA 2GCGA 1QYVA 4JQCA 3RVRA 2IYLD 3DQZA 4LKOA 1KFBB 5C8XA 4NMWA 2VP2A 5FTKA 1SIOA 3A2NA 3WAJA 1YBVA 2A9RA 1QOPB 2QTNA 3AEUA 2PX4A 4CFYA 3RIMA 1QV7A 2FHPA 3RUPA 4DR3B 1C80A 5LNK1 5ELMA 1TJNA 1DC8A 1R9GA 2QMHA 4RZXA 4EUEA 3JQGB 4PHCA 3HDQA 1CUSA 4K6KA 1E2MA 4S2UA 2YMPA 2GWRA 3RTAA 2ZRQA 3HNRA 4L8VA 2EJVA 5ITZB 1PJRA 3C5CA 4B3TB 1U2QA 2OESA 4B4UA 3HCNA 2PXHA 1G5RA 1KJWA 4ZK6A 4LF8B 2CVZA 3Q6MA 2G5PA 1P5FA 2GHRA 5KSOA 1ISJA 1WR8A 2E89A 1CU1A 2QRNA 2NT4A 4HE6A 4QEDA 3HB0A 2OE2A 1WVGA 3ZE8A 5BNZA 2IITA 4B32A 4BQPA 5I4BA 3BULA 3GRCA 3T5TA 4H6XA 4I8IA 3ZHZA 5C8DA 4I6EA 1GNPA 4RELA 4ND2A 5C4MA 3LL4A 4QUAA 4DY4A 5BVGA 3AJRA 2MSLA 3KVVA 4E70A 5T67A 5EQDA 4TV9A 2WJZB 1I2MA 4BTLA 4M0PA 3B85A 4BYGA 1USVA 1PX2A 1FTQA 3T5MA 3SM3A 2A4MA 3LLUA 4MAFA 5REQB 2IS1A 2ZB7A 4IFEA 4MW6A 3OPYI 2GM9A 3AUFA 1SKQA 4A0QA 3O3CA 3LIIA 1EH5A 1LNSA 4DK1A 4JMLA 1R64A 2RGDA 3CPSA 1B0PA 2BFNA 4RZHA 3WJAA 1V1MB 1N6RA 3OA2A 2AXPA 4OJNA 2OCYC 4AMUA 1GTSA 3EQ7A 1EWRA 4BNFA 5LC1A 1D2AA 1L3IA 1QOZA 1T9HA 5IS2A 1QMGA 2GF0A 1N0WA 4RSGA 4IW3B 1F12A 2CL6X 1LBIA 2I2FA 2ZTHA 1QFJA 3JD1A 4MV0A 1IJKA 4IOKA 4DCOA 5CDUA 3L6CA 1ABBA 1KAQA 1MPTA 3IEIA 3PXEA 5D51S 3IESA 5JCJA 2O5VA 3UT5B 2C5AA 2YS6A 5AJUA 4WFIA 2XBUA 3LPLA 3NATA 4FCVA 4LVOA 4XJSA 2UUPA 1RRFA 3WLMA 2JRCA 1UJ2A 4HCJA 5AW5A 2BF7A 4EWLA 2PE3A 1HK7A 1WQ3A 3MQFA 1RU3A 4RFSA 4XGRA 4B45A 2HMAA 2Q50A 4EHAA 4YMLA 2BEWB 4HQ6A 4OQMA 1EE1A 4CBVA 4Q01A 1JMVA 2VJLA 4YQYA 5LMNB 3I6IA 4G1EB 1JKFA 2QD1A 3Q7PA 4X0EA 3X44A 1JF8A 1USGA 3CPWB 3EUFA 4LRXA 4O0MA 3QVVA 3PXGA 2A1TR 3TQSA 4LJLA 2ZIWB 2QNRA 2FN9A 2WJHA 3EVNA 1RRCA 2FLKA 2IH4A 4PTZA 4UU8A 5AM4A 1GKYA 5JJIA 4OUDB 2E5LB 3L4JA 1W36D 2SBTA 3CVOA 4BKUA 3IJ5A 4KQFA 3OQOA 1KK3A 2JI4A 2EKQA 5CG1A 3HYSA 4IQ8A 1VPDA 1E43A 3Q0EA 1S96A 3C3XA 2VBTA 1V5EA 4LIPD 1DS6A 5IN4A 3OPOA 3PUIA 2QAJA 3DEHA 1FXSA 1LVUA 5JSUA 1S2IA 1V41E 2PH7A 4JVSB 2HIAA 3N0TA 4MWEA 1VCHA 1RXIA 3WGMA 2C96A 4L4SA 1KAEA 4LDQA 3MTIA 4C0LA 2DFTA 2H4YA 4BKOA 1N8KA 5ECWA 4LNHA 4B6GA 3AESB 5BYBA 3U44B 2OQVA 1VLLA 2YS7A 3LMKA 1XROA 1OLXB 1ONBA 2QN8A 4NV1A 3DNFA 1MX5A 4FYWA 3G59A 2E37A 3KTFA 2EKPA 1NP3A 1NL3A 5AO9A 3A2MA 2IZOA 2VYVD 2WUEA 3UJCA 4DS3A 1H2ZA 3ZK7A 1C8VB 4MA0A 4LI0A 2M6LA 1AOXA 3MAJA 4REMA 4JENA 4JQOA 1YKFA 4R41A 1DUVG 1GFIA 2FSSA 3EC7A 3MWEA 5FI0B 1IY8A 3RYTC 2FUKA 3RG8A 5J58A 5E9QA 4B3JA 2J9GA 3G8AA 4OV6B 2JBAA 3R3HA 1C1DA 1JHPA 1NC1A 4GU5A 4E1VA 3KNZA 1KYQA 3I1YA 2D9RA 4PAWA 5DGDA 1F4LA 3HP1A 1UZLA 1VB3A 3ZE7A 1J8VA 2WVAA 3C74A 3WFJA 5J23A 1MDFA 1CZKA 2HRRA 3BGIA 2BEUA 5I9MA 4BO4A 3VZCA 4JITA 3V8QA 4O0LA 4HMOA 4KMSA 1QHYA 4N40A 4FN5A 1XVLA 1Y7TA 3NWBA 3WIVA 2ZJ8A 4RTKA 1Q82D 2V5UA 1PTJA 1Y1TA 1L4MA 1Z7BA 3CUVA 4QXRA 3VX4A 1R7RA 2IYFA 1I7DA 4AZ3A 1QS0B 4RULA 1EUZA 1GZDA 3CF4G 1T0JB 1A95A 4J0EA 4P9NA 1U8TA 4DILA 1TFUA 1K5PA 1ONOA 2HPZA 2YN4A 4WD3A 5DNEA 1AS0A 2B69A 2ZYDA 3IDAA 4K0RA 3RTEA 1PD1A 4F11A 5HP4A 2JGLA 1BLIA 1UMCA 4IVPA 4P86A 2H06A 3PENA 1OB2A 2QIPA 3RVSA 3UHFA 1X74A 2ZATA 4IS2A 3CIOA 4EB8A 3JD3A 3KKQA 4NAVA 2ZRKA 1SC6A 2JJYA 3LNTA 5BW8A 1TLFA 3WKBA 4DYDA 4YP0A 1Z13A 1JG7A 4TZ0A 1U8UA 1Y89A 3R6KA 2ERXA 1EDDA 3T9EA 5CVDA 4PQRA 3TIVA 4E09A 1E9SA 1NGSA 4N5DA 5ARDA 1Z82A 2AWOA 4HFNA 4BMCA 3EZ9A 2J30A 1Y4ZA 2W0SA 4HZUA 4LZAA 2W48A 1YRWA 1GUDA 3C3BA 3IX7A 3TRFA 3LE8A 1C5KA 2FFJA 1V6AA 3LYHA 1G0OA 4H35A 2PSDA 4LDPA 3RTDA 4F2WA 3JWIA 2O8DA 3RADC 4FB5A 1FFHA 2QW8A 3ZHBA 1IQRA 1SHKA 4JSYA 5H80A 4Z5XA 1WHSA 1U2DC 1WOMA 3FPFA 4DQXA 4ZODA 3ROQA 2KS6A 4II7A 4HGQA 2ZRLA 3LQRA 1YVPA 1VHDA 3GGDA 3P2MA 1Z2PX 2PGDA 3Q7SA 1HWYA 2BWJA 3TZKA 4OM7A 2NNLD 4B83A 5HDBB 3OQPA 4OI2A 1P60A 3UH0A 2OC9A 4XDZA 2Z3ZA 2B7LA 3TZHA 1LUAA 4QDXA 4Y98A 1E60A 4FQ7A 1OWNA 4X7RA 4YV1A 4LRSB 4PG7A 3L2OB 4FHGA 2XADA 2ZI3A 4W6QA 3NHFA 4P31A 4Q7JB 2R96A 1RAHA 3L46A 4ZALA 3WWPA 3ZQ4A 4FINA 3AHCA 4QOGA 3K6SB 5DHAA 3OD1A 3GI1A 1YGPA 3RH0A 4CUJA 2ANCA 2UVPB 2A9KA 3CCQB 3H5WA 4HWTA 2HSEA 2A6PA 2BKLA 5CVVA 3HU2A 3FFBA 2NSHA 3BYZA 5I4KA 3IVGA 4UUMA 1HZEA 1CD5A 3W4JA 1QRSA 4ER3A 1MB9A 3UFXA 3UOAB 1ZLYA 4WASA 5LM3A 3LHDA 2C0PA 3R1IA 4Q7EA 2HNAA 3B3QA 1US8A 3CBQA 4FOLA 3AXTA 1HE8B 3H19A 5JZSA 1Z07A 3DFIA 3VKFA 1JTFA 5T41A 1U4SA 1JEQA 1G8AA 4RJIA 4WY2A 1X7ZB 4BX8A 3N6VA 2EBWA 4F60A 2I2DA 5FX2A 3AINA 3QMMA 4FP9A 3DTVA 4IAOA 3TZLA 2JGFA 2VP5A 1OU4A 2CVQA 2H5EA 3CZ4A 4DR4B 4DLVA 1VFPA 1H2YA 3L7JA 3ZXXA 4EHNA 4M9XA 4YVFA 2R8PA 1I1QB 4ZCQA 1AS2A 2EKLA 2NZXA 4M55A 3JXEA 1JA9A 5CLLA 4ITUA 5C4IA 3RUHA 5A04A 4GPZA 3PLAE 4KZPA 2H85A 4ZQGA 3W6PA 4UQLA 1M2JA 3OC6A 4X7MA 3TG8A 2HU5A 3PITA 4GUAA 3THXA 3BZUA 5T4EA 4D97A 1MA3A 1W19A 3P0IA 4KPGA 1FA9A 3ONUA 1KRWA 2TYSB 1QJCA 3KB6A 3IV6A 2OZVA 4GPTA 4QRHA 2Q6TA 3CR7A 3LWDA 3OE7D 1ORHA 1KTIA 3B6EA 2Q0QA 4DJEC 4K6OA 5F9HA 4FFDA 5DNVA 1TAQA 1R4NA 1ZR2A 2OORA 1ADFA 4WGGA 5BNIA 4PFKA 3D0RA 4GVXA 4YMGA 1DV2A 2HDOA 4KL8S 5CFOA 5EIEA 4OHXA 1OTXA 2P4QA 5IT4A 2FG7C 3IBGA 5DM4A 3RJZA 3OTQA 4EJSA 4ZDIA 1G2OA 4KNVA 4WCDA 5GJVC 3WLNA 3H1GA 1YJBA 3NOOA 2B9EA 3O5AA 2QTVB 2H17A 1DWPA 4LS3A 3KEOA 5GIPE 1FRFS 1DIAA 4X8MA 5A03A 1V7QA 2G9QA 1MGOA 2NG1A 4I66A 4KXFB 1OLOA 3H1TA 2V4DA 2VDVE 5B1EA 5K01A 1GTJ1 3EEQA 3M4NA 1P2UA 4OGWA 1O89A 2E18A 3OZAA 1OIXA 4PRYA 1SULA 3AFHA 3PFKA 4PBTA 1B26A 2WP0A 3LBHA 1CJTC 3HLKA 1A72A 4ZVVA 2HO5A 1SQFA 2NNWB 3G49A 2CZGA 1CUFA 1T9DA 4IDEA 3SSNA 1GYRA 3F9CA 4NTZA 1N5DA 1Z12A 4RIIA 5ALEA 1PBTA 2I34A 3FSRA 3O73A 1AXEA 1R15A 4MTCA 4Y6OA 2JCYA 5JADA 1AXGA 5C8YF 4QIHA 4WZLA 2NUPB 1UKZA 3EGEA 1VZ2A 5IYQA 3DDCA 1ONSA 3OFSA 3QWBA 4NPHA 2GKGA 3AW9A 2HF9A 4YBRA 1I30A 3VPXA 4Z4IA 3MINA 4AZTA 7MHTA 4NJMB 1W2HA 5IZCA 3KWJA 4CCSA 2NAFA 3IQIX 3FSJX 1PEDA 1T2DA 2YNMC 2X9LA 3EQ9A 1A8UA 3L41A 3STVA 3FGOA 4MI1A 3M4ZA 1D2RA 3I0MA 1SVKA 2I4IA 2IXTA 2FK8A 3FTNA 2BMWA 5ITZA 3ZZ1A 3ZCQA 2W2KA 4RYLA 5BPHA 1ZVMA 3W06A 3VHXB 4GL2A 1P3Y1 2DFDA 2GFQA 4RDCA 2RAFA 421PA 3WYNA 1N0HA 2M1ZA 1V47A 1KSHA 4TKOB 1SXQA 2XCLA 3IJPA 4KQ2A 1DG9A 2FFHA 2A0KA 5KSZA 3KWLA 4L0CA 1VHQA 1GZVA 4BZZA 4DDVA 5KWSA 2R4TA 1E3LA 4GKVA 5EXTA 2VUSA 2CGEA 2VQ6A 1GAEO 4ZV9A 3E6AA 4B71A 3L7MA 1MAVA 1QTIA 3BD8A 3DD1A 3DDSA 5C9ZA 1I6WA 3O0TA 3V4OA 1YS6A 5BMVA 1XCBA 3EVEA 4AZ0B 3F2VA 4C4XA 3JQAA 1ML4A 1JB1A 3FG9A 3PSAA 2IK8A 4DIFA 3HYLA 1ZJ4A 3NV7A 3LSTA 2J5XA 2E1PA 2P4UA 2Z09A 3NAMA 2V7BA 3T8YA 2Q3BA 4TL9A 3LKDA 3FPJA 4MV9A 4KDFA 3U4AA 1LPPA 5K03A 5K0BA 4G5XA 3D8BA 1RI4A 3DBHA 2H52A 2ZIFA 1Y8AA 2QP4A 2NSDA 4AZWA 4XWKA 2GX6A 3JQBC 4FW9A 5F7XA 4E4YA 1L4YA 3PVCA 1IOWA 2ASVA 3KXIA 5KYWB 1WSRA 4OA8A 1YI1A 3ND5A 4NV3A 3FNGA 1T15A 1P5RA 2AK3A 1EB8A 2GZAA 4OOVA 2A5LA 2H1LA 1UXKA 3Q3GE 1UD3A 2WBLC 2OCIA 4XSGA 3RKUA 4IH9A 3BTUA 2AEJA 2P9FA 2IZZA 3HR8A 3TJZA 1PLKA 2VT7A 1SXGA 4FCWA 4GYWA 6PFKA 3K9FC 2B37A 5FR2A 1VSQA 4GOND 1E5VA 3AONB 4JP3A 3ZWAA 3K0SA 1BQ4A 2D5BA 1C9YA 2XLCA 5CT9A 5DX8A 1IY9A 5KNCH 4AKGA 4KOEC 5AFSA 1B4DA 1VP9A 2P5YA 2G7MC 3C4JA 3TSAA 1DARA 1Y0RA 1KDZA 4X6UA 3NPAA 3VDRA 4LXIA 4N9QA 1Y6GA 5MHTA 4ER6A 4RD2A 3UCEA 3OD5A 3W5DA 4UE2A 2A9VA 4Q24A 1NE2A 1CUDA 3IRUA 1YIJB 1YNOA 1BA2A 4HGOA 4CWAA 1FVOA 1S89A 4F56A 1Y1PA 3QPCA 4HTFA 2XGSA 2FEAA 2Z9BA 3OM0A 2QVXX 4LWOA 2H9AA 2QB5A 3SYNA 3E84A 4B43A 2X4DA 3GRAA 4JU8A 1GA4A 5G3ZA 5GZ6A 2WOOA 9GPBA 2UZ1B 3MAAC 3A6GA 4INOA 2GT1A 4Q1BA 3TD2A 2HSZA 4JJFA 5I7WA 2VHJA 3BXPA 4A36A 1UCFA 3KVOA 2YVUA 3NCHA 4PGGA 1ZU5A 2Y0EA 3NTLA 4A10A 2XVAA 2TECE 4N0EA 4RQTA 3MJTA 5EE9A 3NEPX 4W9NA 4N3AA 4LQLA 3S29A 2YJ4A 3VHXA 1MXHA 1O3YA 4IO1A 2IXBA 3A4VA 5ICSA 5ABPA 2XT0A 1H2EA 3OQ6A 4X90A 1KYTA 1VCNA 2ABWA 2XWSA 3U5ZB 4B3XA 3SEJA 4OQ4A 2WUDA 1EUDA 1P0IA 2FZWA 3TSYA 4XL9A 4LXTA 2NUAB 5TGTA 4G63A 3V8PA 3ZY4A 1K0FA 3K31A 5CM8B 5EWJB 4MEAA 1W4AA 5KVVA 2Z6QA 3KLBA 1T1SA 1ZX1A 1CFZA 3TL2A 3DUFA 3H99A 2GXAA 4ZZ1A 3RYHB 4G0UA 3RGGA 1MP0A 3DM5A 1EWKA 3MGCA 4CKXA 3TIGA 4KU4A 3LT5A 1AUQA 4WNCA 5B53A 1X1SA 1FP1D 4IDCA 3A7DA 3LVQE 2AX3A 3MCWA 3PKJA 4XYEA 3UOWA 2NQ8A 4DLLA 3I8XA 2G9NA 3VISA 3GH1A 1FVHA 5AK0A 1S3FA 4IFBA 5K2OA 3WGOA 1U1GA 1Z74A 2QT0A 3LKVA 1V9SA 1NW6A 2R9VA 1VJGA 5DXJA 2J3HA 1EFLA 2MWMA 3F3SA 4BNHA 1Z37A 2VO1A 5EIBC 5EZ5A 2P65A 3RIXA 4DEXA 4F3CA 2WFLB 2AZ4A 2V6BA 3KD3A 2HCJB 1V3TA 2DZDA 3IBFA 4A7PA 1I4TD 3DCYA 2BV3A 3HDGA 1YK1A 5DTIA 2PS1A 2PMCA 5L7TA 4I1VA 4G7XA 1MB0A 4OQDA 1QWOA 5FLYA 4COKA 3QPAA 1E79D 3D0KA 2ZB8A 1NVGA 1L6RA 1O6CA 1M2VA 1MA0A 2D5CA 2O48X 3R7LA 5HUQA 1F6DA 1G4HA 1OZFA 4W82A 4PABA 1Z5ZA 4ED9A 1Z26A 3O9VA 4LUCA 4FGUA 1ZR4A 4O3MA 4KQ6A 3WADA 1TRHA 4CGZA 2C59A 5DU2A 4UD2A 4AS3A 3GRUA 1GCGA 1WBDA 3N7UA 3IR5A 2YFKA 1JIUA 1W5SA 1CC1S 1DGQA 4RA9B 4H4EA 2AD1A 3OW2B 3H9BA 1RKXA 4PLVA 4AMZA 2WIDA 3R3ZA 5BR8B 1XTZA 3IUJA 4YLYA 2PQMA 4FFMA 3KUUA 1ZITA 4QLAA 4ZZ0A 3HSKA 2V96A 3G0OA 4Y1EA 5JZOA 1L1EA 4XIIA 2DXIA 1YAJA 2MR5A 2PT6A 3BGDA 1J9EA 3GAMA 4DL9A 1YS4A 1THZA 3O95A 4MAMA 3REGA 2BH2A 1XYVA 4GM0A 3WLPA 2C2OA 5FTJA 1D7OA 3CKMA 1QVAA 1SNYA 5KTRA 1P7ZA 1AZTA 1JKJA 1NRKA 1MBZA 2I3AA 2WWFA 5E6SB 4WFQA 1KIFA 1OFVA 2QD2A 4PHGA 1OI3A 5K5EA 2WHRA 4TMZA 3HZHA 3U16A 3DDUA 3L0BA 3IV7A 2JKVA 3G2OA 3GBSA 1U7HA 3ND9A 4AJHA 2J4DA 4AS1A 2F1KA 2AW3A 3WP0A 1WTCA 3EAQA 2OOKA 1NW7A 3FTQA 2V31A 3GJTA 2IUFA 2PVSA 1C7IA 3DMTC 4ZOAA 2JATA 3DB1A 1Q9SA 5EZYA 5TEWA 2HAEA 1L8XA 5FNZA 4ZQFA 4GP9A 1HQYE 3ESDA 2X4IA 3NVKI 3C3AA 1AIPA 4HIZA 3DOEA 1PX0A 3SVLA 2ZBDA 1T1JA 1XA0A 2R6GA 1J2RA 2PD6A 3EMDA 4D74A 5AM3A 1IONA 3WRXC 3CHYA 1F0KA 3GK3A 1ORIA 3QBVA 4P33A 1XTSA 1N34B 4R54A 4NCAA 1VIVA 2ZQZA 4GZ6A 5JBIA 4M0KA 3ZOKA 1QHHA 3PF9A 3N70A 1FPMA 3LNCA 1N5KA 1SR8A 4C6SA 2HPHA 4I1YA 1KKUA 1X7ZA 1ISGA 1JQ3A 2FWIA 3E9NA 4J03A 3SEQA 1VFNA 1FSPA 3U3MA 2ZVDA 4YT8A 3V7WA 3AGPA 1R8SA 1OJ7A 3GVHA 4GKBA 4KVAA 3S1LA 1DJMA 4YRGA 1CJMA 2JEZA 1VMDA 4FBMA 1LJLA 2F3RA 3WB2A 5LQDA 2I7DA 4HDRB 3GLGE 2HFKA 2CVOA 2BELA 3UMSA 5HWSA 1T4MA 1CDZA 3WL4A 4AUKA 3WDMA 4M0LA 2ZANA 5LDGA 3PQ7A 4A6XA 1SD5A 1EHCA