1S0UA

Eif2gamma apo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
404
structure length
391
Chain Sequence
SQAEVNIGMVGHVDHGKTSLTKALTGVWTDRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPINIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title X-ray Structure of Translation Initiation Factor eIF2gamma: IMPLICATIONS FOR tRNA AND eIF2alpha BINDING.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 96
structure length 391
sequence length 404
ec nomenclature
pdb deposition date 2004-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s0uA01
3K8YA 2X77A 5L3QB 1GL7A 1W0JD 3R7WA 4M1MA 5AK0A 1P72A 2FWRA 1BOFA 2GEDA 2QU8A 5HE9A 3ZD6A 5GADl 4O2RA 3L0SA 1B2RA 1U2RA 3TSZA 5EE5B 4TYYA 2FF7A 1E96A 4DB2A 2V7QA 3PEWA 3I56B 2BBWA 1E2LA 4OK3A 2EU8A 4WQMA 1U9IC 2YV5A 3I5YA 4ACAA 1W36D 3W5VA 3NH6A 1TQ4A 5LB4A 1CF4A 3GLGB 3OZUA 1P2TA 4GOJA 2NO9A 3OJXA 1VQOB 4D26A 2IHYA 4OI1A 5KSPA 4A15A 4HB2A 5CK5A 3RRNA 3ONWA 2IK8A 3I3SR 1T3SA 4U5XA 1N3BA 4DHEA 3RC8A 5JBQA 2Z0MA 2PT7A 2OBLA 4D0NA 3V00A 1DPFA 1G6OA 2IYXA 3RS4A 3CR7A 2AD1A 2GILA 1QHHB 1T0HB 1E9RA 4KV9A 4TMWA 1NN5A 3VR6A 4PAQA 4LJ9A 3WMEA 5HKKA 4JLAA 1XTSA 2JJ2A 2NOAA 4IOKA 1AZSC 4BLOA 4CRWB 3IPYA 2QP4A 4UQOA 3FOZA 2PJRA 1QFJA 3AGPA 3CRRA 3M1IA 1Q82D 4NCHA 3TJZA 2Q9CA 4DLYA 3EPLA 4L9SA 1M74A 4N0EA 1XPOA 1Y3AA 1UM8A 3RHFA 4YMTA 2YVUA 1SVKA 3VNUA 5DI3B 2IX3A 1OB2A 3CD6B 1W87A 2H7VA 2R44A 5FR2A 4LPKA 5HTKA 4LV5B 3CCUB 2GF0A 1FX0A 1Q20A 3FJOA 2EIXA 1G8FA 2V1XA 3W90A 2IT1A 3LA6A 1VQ7B 1P62B 2QN6A 1QHIA 1RRGA 1VMAA 2D62A 3QKRA 4A0RA 1MABA 2HJVA 1PVOA 1F3OA 1KDRA 2XX3A 5KOYA 2VYQA 1FTSA 1TPZA 1E64A 4JLJA 2KBEA 3KUDA 1J99A 1VG0B 1HTWA 2FPKA 3WHKA 3DO6A 4H1UA 1RIFA 1P75A 4MRSA 1GRRA 5LB2A 4B43A 1CLUA 1S9DA 2IC5A 3FMFA 3G0HA 2PCLA 3QNUA 1NVUQ 1M7GA 1H8EA 3ECCA 4DSNA 1KSFX 4E5UA 3T61A 2FEOA 1E69A 1N6KA 3FB4A 4QHTA 4XVRA 1KAGA 4PZLA 4Q7LA 3THWA 3JVVA 3K70C 1ZAKA 4PAMA 2ZE8A 4M53A 2OBNA 4QNMA 5GJCA 1RJ9B 4P4SA 3U7HB 2BWJA 2XITA 3AP1A 1F6BA 3W6NA 3VR1A 1NKSA 2W2TA 4PQRA 2RGGA 2YC4C 1TLLA 2IF2A 2ZVQX 4D2IA 1KGDA 3BK7A 1FFHA 3SFVA 2O8EA 4M8NE 5A5GA 1C1YA 2RGNA 4KFSA 2FFHA 1E9EA 2VLIA 5EUQB 3X1WA 4D81A 2IYUA 4XTCS 5J4YA 3SJAA 2D3WA 4NYMQ 3KQHA 3U60B 1VQ6B 4KXFB 4B3FX 4B2LA 3EC1A 2AR7A 4KODA 4R98A 2A9KA 3EASA 4MKGA 2GAOA 4G5OA 5CLLA 2ZRKA 3CRMA 1AA9A 5JECA 1W46A 2WWYA 3DMDA 4DQLA 1LFDB 4M4SA 3W3AA 1XXHA 2B21A 3S1AA 5LBIA 4D6PA 3TBKA 1NIJA 3B13B 1W36B 1YHQB 1XJCA 4QHYA 3C7KA 2QE7D 4JKYA 4TSFD 1JA1A 1M2OB 1XD8A 4P6VF 2OTJB 4I1VA 5JWRA 2WWFA 1GFIA 3BD9A 1VQ5B 3QQ5A 1SVLA 3CX6A 3IEUA 4LHXA 1UADA 2QMEA 1XCMA 3ZVRA 4EFNA 2JLYA 4G1VA 2GRJA 1JJVA 3BJIC 1FDRA 3LAWA 4QG7A 2XNJA 1ZNWA 1G3RA 2UKDA 1XEXA 2C96A 4KAXA 1KRHA 3NEYA 5L3SB 3T34A 3NBYC 3QG1A 1G21E 5JLJA 1QZXA 3GEHA 4MITA 5CITA 4N1AA 4II7A 2J87A 1M7BA 2FNAA 2BF4A 1UBEA 1YZKA 3KL4A 5FPHA 1XE1A 2QAGA 3FPAA 4KI0A 1U8YA 3AP2A 1EXMA 4DLTA 4I1OA 3MWYW 4V0LA 2ZROA 4HEJA 1OH6A 3C4JA 5ANRB 2YWHA 5BN5A 1E79D 3OFND 2QT1A 3A4NA 4IVQA 4YMVA 2AXPA 3GFPA 1GP2A 2DEUA 3O8BA 3PCRB 1GG2A 3D7MA 2V3CC 2XTNA 3U3KA 3I5XA 1G6HA 1KI8A 3GLFA 1E2GA 4M1TA 3A6PC 4G01B 3CNLA 2D74A 4LYHA 2OO7A 2ANBA 2JLRA 1DO2A 4DDTA 1QX4A 1KI4A 4LCBA 2D4HA 5HE8A 2P6RA 1VCMA 3AVXA 4NZYA 3GLIE 3UK6A 2VHQA 2GCNA 2BSAA 4QFMA 3B1WA 2XSZA 1DO0A 3QXHA 2FSFA 2HXYA 1MT0A 1EWQA 4AKGA 2IEYA 5H70A 1KO8A 3EX7C 4GP7A 1JXMA 4NCJA 1TU3A 2ZE6A 1PUJA 1DAMA 2XJ9A 4NTZA 1OFUX 2J46A 4LX0A 3JQQA 4DZZA 1F48A 1ZUHA 1QHNA 1R6BX 1SGWA 2I1QA 5EE0A 1KAOA 3TH5A 4R9UC 3CC4B 2QROA 4QGAA 1GKYA 1S1CA 3PUVA 5DHFA 1JJ7A 5UKDA 1VYTA 1DAIA 1IOZA 2R9VA 3W2FA 2VHUA 3OZVA 2WKPA 4WZAE 5FOXA 1GAWA 3TUIC 3IHLA 2ZRPA 4BUJA 3KB2A 2R65A 5AUOB 1DE0A 1HQCA 4TLCA 2IWRA 4AURA 4PO9A 2ONJA 2CCKA 4IDPA 3W9YA 3CB4A 1O3YA 3VR3A 4DUGA 4QJ3A 4JL8A 5B57C 1CULC 5JHGB 1W5TA 5J4KA 4PZYA 2BV3A 2HF9A 4Z8XA 2W83A 2QT0A 3U6BA 1E0JA 1QHSA 3B1VA 3R9IA 2G9NA 3RANA 4IHQA 2YOGA 2DR3A 2V54A 3BFKA 1RRCA 3LV8A 2CJWA 1G1MA 1A2BA 3DKPA 1KO7A 1UDXA 1G8GA 3SS8A 4B76A 4HZUB 2IS6A 1EK0A 1ZNYA 3FWYA 3N2EA 5L3QA 4BFXA 5HZHA 1GOTA 5FTKA 2OAP1 4BFYA 1OXSC 5SZJA 1II0A 2ZRMA 3K9HA 4PPFA 1VYUA 1P2SA 2BMWA 1HE1C 4RFSA 1FZQA 2WOOA 4TTRA 5AJYA 4TN1A 1U99A 2IEZA 3IPXA 1KO5A 4C0SA 2OCBA 3TMKA 4NE2A 3RWMB 4DLRA 1QFZA 1Q1BA 3OAAA 4FMBB 4IXNA 1ZD8A 1BKDR 1N6HA 1ZNZA 2BKEA 3B5JA 3KJGA 3GLGA 4NYJR 5JJIA 1DOAA 4YAFA 3DEFA 1LTQA 4ILEA 2W00A 1E2FA 4NU0A 1KHTA 4TL6A 3QKTA 1KY3A 3T1QA 4E07A 2OUKA 4RKEA 2EFEB 2D7DA 1TUIA 4LBZA 2J41A 4LY6A 1PLLA 2OCAA 1X1RA 4HI0E 4M9XA 4B44A 3MWJA 4JBXA 2BMEA 1QHHA 5CYPA 2ODEA 2RB4A 2FSHA 2XJ4A 1GO2A 5BW8A 2NPIA 1OIVA 1VCOA 5D3MB 2GK7A 4C0JA 4O25A 4Q18A 5FL7D 5AJVB 1SXJC 4DLSA 2CNDA 4OJQA 1F5NA 4E03A 4K46A 5M04A 4BFVA 2QTVB 4HE5A 2VTKA 4B2PA 2ZI4A 3TK1A 1P9RA 2PZGA 4URYR 1Q21A 1E1RD 2FV8A 2HT6A 4RD1A 5DI3A 4KITB 4X8MA 1QFYA 4FMCB 4O0MA 4LYAA 3TUJC 1FUKA 3BWDD 1K5DA 3AF0A 5JFGA 2GBLC 4YQFA 1FTNA 2EFGA 3IO3A 1R4AA 2R6FA 2JDIA 3LLMA 4DQKA 3U3MA 2O0KA 4PHFA 2PMKA 2VP5A 3JVUA 3ZJYA 1KI6B 2GCPA 4YXWD 3N5CA 1E2PA 1G41A 3GLIB 3FMIA 2QEQA 2QEXB 1KK1A 3EZ6A 2JIZA 1EFRA 1XMVA 2YZ2A 2ZETA 3I61A 1OB5A 4EFMA 2PMDA 4PQFA 5CJ2A 1D2EA 4AWXA 3DVLA 1KQSB 1DAKA 1UBFA 3H1TA 1OJLA 5AJWA 5FBVB 3PENA 5D3QA 1GRQA 2CK3A 2BDTA 4OHVA 1Y63A 3U4QB 4L4UA 4QOSA 3TW4A 1WA5A 2FH5B 3WP1B 4AIIA 3RS5A 3SZRA 3L43A 3WYFA 5EQTA 2WWXA 5JRZA 3NBZC 4JLBA 2A78A 5CLQA 4BE7B 2A5JA 4A8JB 3W6OA 2Z6VA 1Q3HA 4C9BA 4M22A 3ZZ0A 4C4PA 2R6AA 3IIMA 5DO9A 1NKTA 1AZTA 3NKVA 4TLEA 1M6NA 1S96A 1GL6A 3QEJA 3SDZA 4X8LA 1NJID 1TQDA 4G3XA 2JLVA 5KDOA 3CXCB 5CB6A 1AQYA 2RMKA 3F3YA 4U00A 2Z4SA 2ZUCA 4MRPA 2ODWA 1P2VA 3SOPA 3LW8A 2J9RA 1VTKA 1FQKA 2HXSA 3CRQA 3UXMA 2F3RA 3OEHD 3SN6A 1UBGA 1K8AD 4LZZA 1OXTA 4ITRC 1P9NA 4PSAA 2VHCA 3TSOA 3ZBTA 3UATA 4JT2A 2DFTA 2QTHA 2RGAA 3CF0A 5FPTA 4ZO4A 2PZFA 4MYTA 1LS6A 1Z6YA 1N5JA 1VPLA 4AKHA 1JJ2B 3K0AB 4M1YA 4JL5A 5A0FA 4BRUA 4YHBA 2F1RA 2H57A 5K8LA 5FOSA 1ZM9A 1HY3A 2ZE5A 3KJIA 4A0HA 1JI0A 3A37A 3BOSA 2IYVA 2EFCB 2TMKA 4LV8B 1TF7A 4TLBA 3KQLA 4YONB 1II8B 1WCV1 1X1SA 2FOLA 3V4RA 2X1VA 2G0NA 3LD9A 5L3RA 4LHWA 2QQEA 4Q4HB 4AG5A 1E9AA 5C2JB 3VO2A 5KPJA 3THYA 2FN4A 5FI0B 4US0R 2QTZA 4PC7A 1UEJA 2WIBA 3NDPA 3R9WA 1KI7A 3LX5A 1NMXA 4A6PA 4FW9A 4A8JC 1X3SA 1W0KD 4UNPA 1EWYA 5JCPA 1SVSA 2NZJA 2W2VA 3P1JA 2RGCA 3ETLA 4B4DA 2HT1A 1N5IA 4L9WA 3CCVB 4KCGA 5E7IA 4OI2A 2C95A 2PH1A 1NNEA 2QPAA 1D2MA 3C5CA 2BM0A 3T5DA 3CMAB 2FU5C 3MLEA 3SI7A 1T9HA 2RAPA 2YINC 1KNXA 3HWSA 4LWZA 1IONA 1ZIOA 1QG2A 2GVZC 2FZLA 3AVUA 2ZYVX 5JHHB 1IN7A 1JALA 2ZR0A 2DB3A 3ZYCA 3W2IA 2ZR9A 2R6HA 4NCIA 3ZVNA 4AYWA 5EXPA 5JRJA 4D0GA 3ZVLA 1NVVR 2CCGA 2OCYC 3GJ5A 1CR1A 1KO1A 2ATVA 2ATXA 2QRNA 4CGZA 4A82A 1OXVA 1SVMA 2H17A 2J59A 4OK6A 4EPWA 1KC8D 1D1NA 1RRFA 1Z6TA 2ZQ5A 4BWYA 1WBBA 1IXSB 2QMHA 3ZS8A 2BM1A 1KI3A 2VH5R 3EIHA 5LD2B 5JI2E 1PJRA 1UKVY 4FMDF 1DAEA 1Z3IX 5KSZA 2ZRGA 4CW7A 1XU4A 2P2LA 2F1JA 3ASZA 3B1ZA 2EQBA 4WVFA 3IQXA 5BYKA 1EESA 3VKGA 4V03A 4X8OA 5AR1A 4RY2A 5J4HA 1TEVA 1S72B 2ZSDA 4EPTA 3RRZA 1OGJA 4GOKA 4TL9A 3WP0A 1RYFA 4BEJA 3SBEA 1YRAA 1CR2A 4MGZR 3CRVA 1P9WA 1EFUA 4JYCA 5JSZB 5TDHA 3GLGE 4IRUB 1FPMA 4HAWA 3B82A 3ASYA 2XNDD 2A30A 4QBGB 2ZU6A 4D80A 5C4MA 1D9XA 1IAQA 2ZI3A 1GIAA 1XZPA 3VR5A 3IEVA 4AF7A 4PO1A 3QSYA 2OTLB 4JT4A 4XTRA 2O8CB 2QG6A 4YAWA 1UFQA 3U7EB 5JMTA 2AFHE 2AN9A 3E1SA 4JVSB 2VF7A 4CDGA 2GZDA 2KE5A 2MMCA 1XB2A 1J2JA 1JAHA 4IDOA 4MA4A 5FI1B 3EARA 3KKMA 3SQXA 2QE7A 3PVSA 2KI5A 3KUCA 5CIQA 4KFTA 3VO1A 1MO4A 1MH1A 3CNOA 1VKJA 4EDHA 1W4RA 4G1UC 4BLTA 1WF3A 1VQNB 3U3OA 1S0UA 4Y7CA 4PHTA 4Q19A 2FA9A 2JA1A 4QGFA 4BZPA 3B60A 4W5HA 1KI2A 1NN1A 1SHKA 3K0SA 2BJWA 1IM2A 4KYUA 3RS3A 5FBQB 3QG5A 3KQNA 2FJUA 1OFHA 4E22A 3F0TA 1GJRA 2ONKA 4FIDA 3V9PA 1U81A 2V4ZA 3QFSA 3Q8XB 5HR5A 1KMQA 3C5HA 3X1ZA 4JL6A 2NO1A 4B3XA 2O8DB 1GWNA 3B6EA 1XEWX 2HLDA 3RRYA 3VU9A 1E4VA 4DB4A 1ZM2A 1IHUA 3TSWA 4C7OB 3UG7A 3KZ1E 4P0TA 4YALA 1NN0A 3M4YA 4BASA 1OIXA 1P5ZB 2NG1A 1T3HA 4NYIQ 3IBGA 3X2SA 1E79A 3OFNA 2OILA 2Y8EA 1NIPA 5G41A 5G3YA 3A1VA 4C0KA 3JQRA 4JZKA 2YNMA 1XTIA 2C9YA 3LQQA 4K1XA 4OQLA 3AQ4A 3SJCA 3C41J 1V43A 5IHPA 2PCJA 1RE0A 3K0CA 5CJPA 5D3MA 1NI3A 4ABYA 4LI0A 2VF8A 1G5RA 2FGKA 4OHZA 5AUQA 4B6EA 5FOWA 3VKHA 2V55B 2AKYA 2VNKA 1A5TA 1OYYA 1JEDA 1YU9A 4HAVA 5H1YA 1W4CA 1ZCBA 4QKQA 2Q3MA 5J5CA 4LJ8A 3IHWA 4ASUD 1PV4A 4M1WA 5DYIA 3P20A 1U0HC 3IUYA 4GI7A 2EFHB 4DCVA 3QKSB 1YJ9B 1BX1A 1QDEA 1DBSA 3GJ8A 4BRWA 4D4MA 1KI6A 3M6AA 4TYPA 4A1FA 4HB4A 4I99A 4DKXA 2QL6A 2REOA 3GLIA 1ODFA 2VQSA 1LV7A 2ZJ8A 1DTSA 1FNMA 5FUXA 4KLNA 3KQKA 3R8CA 4PPGA 2QA4B 5L3VA 1K6MA 3TR5A 1XJ0A 3FHCB 4GRAA 4JLMA 1IBRA 2CHVA 3U44A 4QXAA 2PX0A 2IA5A 2NTYC 3A36A 4PX9A 1ZD9A 1VDZA 3GQBA 3U4QA 1MR3F 3CRW1 5CM9C 4IDNA 1G3IA 4DIDA 1X8LA 3LFUA 1GVHA 5LPNA 4R71A 3LXXA 2ZYTX 2BGJA 1AKYA 1E0KA 4XVQA 1HT1E 1Z0JA 1J8MF 1YZUA 3SR0A 1GILA 2QQ0A 2EW1A 1SHZA 3GJXC 4ZV4A 1NSTA 1IN6A 1M8PA 2IYLD 5CDFE 4Y9UA 3U2QA 1OKKD 2REXB 1G3UA 2VA8A 4I4LA 1VHTA 3QBVA 3VFDA 1I4LD 2RGDA 1OH8A 4A2QA 1W44A 3NTUA 2GWHA 2YC2C 5KSYA 3K70B 3I32A 3TVDA 2CRVA 3P32A 3X1XA 1X8KA 2OLKA 4BZQA 2OCPA 4PQYA 1XCPA 3CZPA 1KJZA 1SZPA 3D6TB 2ZSEA 4QHSA 4F93B 5BXQC 1XTJA 3LBIA 3QXXA 3H4MA 2GDJA 3LDAA 1H8HD 1VQMB 1LF5A 1CXZA 3OIYA 1N6NA 3BB4A 4TQUS 1K8RA 4CYMA 2DYKA 1CP2A 1JAIA 4IOMA 5FPYA 4MYUA 1P60A 1DADA 4B32A 1JR6A 1GL9B 5F9HA 3G4SB 1M90D 3EIQA 5DHAA 3A1UA 3K0AA 3I62A 4MKIA 5EE1A 4AKIA 4YDHB 3T1TA 3E5HA 4RD4A 4HDOB 3CRZA 1CNEA 1ZINA 4IOLA 1W4AA 5TARA 5KUTA 1II8A 1L7VC 4FCTA 3ZIAD 4E09A 5GJBA 1GKUB 1QRAA 2G0TA 1T5LA 4LGMA 4DDUA 2OM2A 4Q4HA 4HUQB 1E9SA 4OQMA 5TMPA 1OXUA 3HPQA 3TKLA 1YJWB 3O8RA 5DN6D 1CEEA 1KDOA 3CCQB 4BFSA 4Z51A 1CKEA 3B7GA 4ZDJA 2QZ4A 1R5OA 5BN4A 1QGZA 2OAQ1 4IFBA 5FPKA 5K8UA 4FI3C 5C4GB 2WWWA 2CXXA 2RH5A 4MGKR 1KIMA 1KMHB 1YE8A 1S3GA 4ZDWA 1J9ZA 4I1UA 1GNPA 2DFLA 5FL3A 4D25A 3HP1A 2FSGA 1P73A 3GJ6A 4LYJA 3EZ9A 4ZIRB 4XVUA 1JBKA 1E98A 2P3SA 3AKYA 3THOA 2J7KA 3WYGA 2W6ID 2AK3A 2W58A 3FDIA 1BX0A 4TYWA 3W2EA 2AX4A 1SXJE 2EWWA 1LVGA 2J3EA 4FINA 3U61B 5FTNA 1RZ3A 1AS3A 2XTMA 1CS4C 2GEVA 1NLFA 1UMKA 3T15A 1E9CA 2QGNA 3K0FA 1I4DD 1OHHD 3MJRA 4NHOA 1T6NA 2VSFA 1UPTA 2GZAA 2XZOA 2O0HA 2QY9A 2D2EA 5IT5A 2GHIA 3BB3A 3WNDA 1W2GA 4CZ2A 1R5BA 2CBZA 4QL3A 3LH5A 3W8RA 4QRHA 4ZCIA 1DELA 4LYFA 2WKRA 1SXJD 1BS1A 1UJ2A 4IVPA 2GA8A 1A7JA 1G4AE 2IYYA 2FX3A 3AF4A 2ZUDA 2FDCA 1US8B 2WMNB 3U7FB 3NVAA 1FMJA 1YZQA 1ZMXA 2O8FB 1KSHA 3DL0A 2JLWA 3OEED 5B2ZA 5JSZA 2J1LA 1GNRA 1IQPA 3UIEA 3L2OB 4GSYA 4QC2A 2P5SA 2NZ8A 2PZEA 3HYRA 1IJEA 1YIJB 2O8CA 4EJSC 3EA5A 3IKJA 2RGBA 4YLGA 5JZVA 3FMOB 2ZRHA 3RLFA 2REBA 2C04A 1KK0A 5LDDC 1J70A 3IBYA 2WHXA 4L16A 1M1KD 4TTQA 3GJ4A 3SYKA 5DSZA 1VQ9B 2D06A 1CR0A 4OQNA 2X8AA 4A2WA 1QUFA 1GR1A 4IOJA 3C16C 4HAXA 4ZCMA 1ZUIA 4EPXA 1QG0A 2AHOA 3RAPR 2C2HA 3CCLB 1R0XA 3FE2A 1R5NA 2H18A 4KVGA 2B8TA 2W6JA 4MQBA 3TQFA 4F7DA 2IBMA 2QTLA 1DAGA 3K1JA 3PEUA 1T0JB 2ZI9A 4BGDA 2JLUA 1W34A 3KDSE 4BLPA 4LC0A 1XEWY 2B6HA 2CMKA 2HMAA 1Z29A 2ANCA 4WOPA 2GESA 4U02A 1M1YE 2DCUA 2F3TA 3SC3A 3I73A 2WSSA 2XB4A 1VG9B 3HU3A 4BEBA 1NBMD 4XD7A 5J4LA 2ZRDA 4LJYA 1Q1ZA 4JIMA 4Q01A 4MRRA 1NG1A 1W0KA 2IYRA 4LSGA 2O8DA 4C0QC 1VQ4B 1JPJA 1GTVA 1G291 4C7OA 4LDJA 4NH0A 1Z2CA 3KTAB 2VBCA 2G88A 5CM8B 2ZANA 3FHOA 4G5RA 3U7GA 4WW0A 3FHTA 3R9XA 1KYIA 4UNQA 1U9IA 5E7JA 1QGYA 1YR7A 5EP2A 2RC5A 1KOFA 1KKMA 1TEXA 2YHSA 2EYUA 3BFXA 2OFOA 3OE7D 4QNRA 1BO6A 1GDDA 1NN3A 2BEJA 4RD2A 1FNBA 4ZDIA 2PEZA 2QNRA 3I92A 1A82A 4FD2A 4QM6A 4WZBE 2HV8A 4LK2A 2P0EA 2G1KA 2I1VB 4XOIA 5E7MA 4CEHB 1VYVA 3CC7B 2X2EA 3FFAA 3MWLA 1SKYB 4IJMA 3LVRE 4WXRA 1YKSA 4Q7JB 3WBKA 3B85A 1CJMA 1NP6A 3JQPA 1OV4A 3NEJA 4KFRA 1KI1A 4AC9A 5BN3A 3HJNA 2SHKA 3EZ7A 2QI9C 4DXAA 2PT5A 2R6GA 1J90A 3QKSA 1VHLA 4KLZA 1SXJB 1G19A 4BFWA 5HXBA 2V8OA 3WRXC 2RC6A 1E99A 1Z0IA 3LNCA 5H8WA 2OFXA 1H42A 4UXJA 1Q81D 4B2IA 3R20A 1NL3A 1DEKA 2J0SA 2XOKA 2BCGY 3BBPA 2BMDA 2E87A 2NIPA 4YC7A 4PHGA 5KHOC 4FCVA 3K9GA 4AY2A 2XNDA 1XNJA 2A7QA 2DFKB 4B35A 1OH5A 3B9QA 4R2IA 1UDWA 4IDQA 3BH7A 1FMLA 3WXMA 3QPWA 2W2XA 2QMOA 2PLRA 2B8WA 3GJ0A 4DDVA 2Q9BA 4CEIB 1BQEA 4B34A 2QORA 4M9SA 1XD2B 2G6BA 2PX3A 3F5FA 3AVQA 1DARA 1XMIA 3GEEA 4M1OA 5L8VA 1XFAA 3BGWA 721PA 3RSOA 4IEIA 2H5EA 1B0UA 1MV5A 1NJGA 1Z2AA 2F1IA 2VP6A 1S8FA 2WSMA 3QXJA 3OW2B 2VP4A 5EZ6B 2VNHA 5HKKD 1J7KA 4F4CA 3FKSD 2JJ1A 2YWEA 4NCKA 4OL0A 4Q4AB 3EAQA 2FGJA 5SZIA 4B74A 4AKEA 2ZRNA 4IVRA 4DCTA 1UF9A 3WNCA 1E94E 3IQWA 4TWZA 4V0OA 4C0BA 3A8TA 2C5LA 4Y0AA 1AGPA 4PTLA 3G82C 4BLSA 3UPUA 2GJAA 4G0NA 4TT3D 3KKPA 1PLKA 5KPDA 2QRZA 4HLUC 2O5VA 4A9AA 4B6FA 2F9LA 2P6UA 4FWIB 1G7CA 2ODNA 4Q4JB 1D9ZA 3FGNA 2GXAA 5EZ5A 4DT1B 1C9KA 1ZRHA 1G4UR 5IF9A 2GPJA 1Z0FA 4HB3A 1N25A 2NO7A 4JSTA 1ZJ6A 3JZMA 3DPUA 3AVOA 5EP1A 1COWA 3LRPA 1KJWA 4WBSA 4KJZA 1NVWQ 1TNDA 3EWSA 2VEDA 2GNOA 1OSNA 2OG2A 3VR4A 4V0MA 1MRSA 1H8ED 1U8AA 2QGZA 1SVIA 4HUQA 3ICQB 5B30A 2WWGA 2XAUA 4Q7KA 4EAQA 1AS0A 2VRWA 2IL1A 4A6XA 4MUAA 4PANA 4LJAA 4QBHA 5GJWC 4BPRA 1QHXA 3IDQA 2N42A 4GNKA 4PO8A 4ZI3A 1HUQA 2V6IA 1GRNA 3Q85A 1Z28A 2FEMA 2VIIA 4F92B 1ANKA 4DLXA 2JAQA 1E4YA 3BERA 1N0VC 1DAHA 1KMHA 2HCBA 4N0DA 2WM9B 1L4YA 1ZNXA 2DFNA 1R7RA 2WPDD 2FSIA 2JLSA 4WXPA 3SYNA 1W1WA 4ASUA 4KBFA 4C0LA 5E4FA 1RJ9A 2YOHA 4OBEA 1KD1D 4V02A 4ZIRA 5JEDA 2VNJA 1MOZA 3JZAA 3QVVA 3BS4A 4GZLA 4W5WA 4ESHA 2PBRA 2BMJA 1NY5A 3DMNA 4JYBA 2IHBA 2MMGA 3QVUA 4BZXA 3GPLA 5KYKA 4ZCLA 2BHRA 3QE2A 2J7PD 3KJHA 4M9ZA 4YMWA 3GCGA 3ZVMA 2CVFA 1OGIA 3EPJA 5IDVA 3AB3A 1W0JA 1QBKC 1G9XA 1G8PA 4V0KA 1GM5A 3D31A 2C8VA 3AKEA 1FP6A 3AF2A 2ZSFA 3PEVA 4B75A 1E2HA 1VECA 1ZU5A 1Q22A 1CTQA 1E9DA 2I3BA 3X1DA 5EJEA 3ZBUA 1YHNA 5HZKA 1Q57A 4XWKA 1EX6A 5H68A 2QAJA 4EH1A 5KO2A 1OIWA 1TX4B 3A1WA 4W5JA 1S4QA 1BH2A 4M0LA 2ZYWX 2VSOA 4Q1AA 5GV8A 2F9MA 5ELXA 1I7PA 4KBGA 2Q3FA 4ZKEA 4P32A 4AK9A 2O8FA 4JLVA 2YOFA 1OKKA 2ZJAA 3WRYC 2FFAA 2QSYA 3QJYA 4PFSA 221PA 3BORA 1XF9A 3MWKA 3T1VA 3PUXA 4CF7A 3HPRA 3PITA 4RZXA 3LXRA 2J45A 4LOAA 3RWOA 4J0QA 2JJ8A 1SQ5A 5L3SA 4Q1FA 3AEZA 5G53C 5JS7A 1XX6A 2OXRA 2OFWA 3B2EA 3EPHA 3B8HA 5KU1A 1Z6XA 2CEAA 3CZQA 2BN4A 4LHZA 1II9A 2HYIC 5CDFA 4GBMA 3UWOA 4MGIR 3T5GA 4GDFA 2N46A 1Q86D 1W5SA 2ERYA 4FMCF 4PPNA 4A4DA 2IS1A 1YZTA 2GKSA 3MMPA 3QEOA 3SYLA 2YWFA 5EXSA 4K81B 5TB5A 3EPKA 4TMTA 3V4FA 2XZLA 3I72A 4EPVA 4P3YA 2IUUA 2AWNA 2Q9AA 4LPSA 4Q9JA 1EG7A 5F98A 1DS6A 1KDPA 2Q21A 1N6PA 5JJKA 1ZM4A 1OFTA 4NYJQ 1Q0UA 3NDBB 4OHXA 4JLPA 4M2LA 1L2TA 1IY2A 3IILA 5AUPB 2ZRJA 3IIJA 4LBWA 2XXAB 1ZM7A 4KU4A 1XWIA 4PHHA 3NXSA 5FOUA 4HE6A 1QF9A 1ZVQA 2QTFA 2Z83A 3AP3A 2R2AA 3GD7A 3RVBA 4DSOA 2H8KA 3CPEA 2CLCX 1IY0A 1AMOA 5DN6A 1NLYA 1SVOA 3KKOA 3THWB 1G8YA 2ZI7A 4DSUA 3AGQA 5AUNB 3RYTC 1R0YA 1NY6A 4PC1A 1RVDA 2QENA 2ZJYA 4C2UA 3DKVA 2GJKA 4TTPA 2GCOB 2ZS9A 1VQ8B 4LJ5A 2DWPA 2BEKA 2GXSA 4UNSA 1X86B 2VYFA 3DZDA 1Z6GA 1WQ1R 3EWAA 4PSVA 1W7AA 1CJKC 3EXAA 2CNWD 4RJLA 1AS2A 3OESA 1XBTA 1NLZA 4RCYA 1TQ6A 4G5QA 4Z54A 1G3QA 4ARZB 1WB9A 3SBDA 4DUGD 1RKBA 4UXIA 4A36A 4GMXA 3W5JA 4D4KA 2IUSA 2IXGA 4R7ZA 3QUSA 3OIVA 4GL2A 3TVTA 1XXHB 1K9MD 1TMKA 2WIAA 4Z1MD 4Q66C 2N1BA 1VCNA 4TZ6A 3NG1A 1OHHA 2BJVA 2IYTA 1NG9A 3KJEA 1WP9A 1RC8A 1E32A 2OE2A 1WBDA 1CU1A 2KJQA 2DERA 4QJ4A 3C15C 2ZYUX 4EIWA 4OQFA 2XTZA 2JLZA 4GMDA 4GFDA 1TADA 3AV0B 3IGFA 1GAJA 4IKEA 1SXJA 3FTQA 1GITA 4HYYA 2WWHA 3AF1A 4MH0R 4TSFA 1XTRA 1Z47A 4URZR 4CIDA 2IUTA 3WHLA 5DI9A 2OESA 4HZUA 3CLVA 1RRPA 1CBUA 1FQJA 3RNLA 4FK8A 1G64A 4ZDKA 4N3GA 4PC6A 2GBLA 3BH0A 1TU4A 4XH9B 2BGIA 1F2TB 4OJKA 1OH7A 2XB2A 2JLXA 1JR3D 1KJYA 3TQCA 3CBQA 4DLZA 2ZJ5A 2BC9A 1XTKA 4F4JA 2RGNC 3WMGA 4V0ME 3BC1A 1XD2A 3FYHA 2IWHA 4PC3A 3PIRA 2VZLA 3W2HA 4OQXA 2K5UA 3QBTA 3DDCA 1OE0A 5B58C 4UNNA 3VNVA 4DSTA 4Z8YA 3OIUA 4KSBA 4HB0A 2ZXUA 2EYQA 1N8RD 3M0EA 2KB0A 2JEOA 5KTYA 3OZXA 4LRWA 5EE9A 2DWOA 4C2TA 4Q4AA 1W48A 2CE7A 1GUAA 3HR8A 1UKEA 2IS4A 1E62A 1AJEA 1YQTA 3UKDA 3GMTA 1EX7A 2G83A 4Q5IA 1P7CA 4Y9RA 4MYHA 4PR0A 2ZI6A 1TF2A 4F4IA 1HH4A 1Z5ZA 1Z06A 2ORVA 4BQSA 1ZD1A 3AKCA 4NL4H 3I8SA 2CL0X 1KSGA 521PA 1JNYA 1U8ZA 3TRFA 421PA 1QHYA 2WTUA 4DLWA 4LUCA 1D8TA 3H86A 4DLUA 1CNFA 2OZEA 2QDXA 2LCFA 2VHTA 3L8ZA 3QY0A 4GP6A 1NBMA 3CCEB 3A4MA 4FCWA 4ZI2A 2WKQA 2IW3A 2HCJB 2GXQA 5FH9A 3FPKA 1ELOA 1E1QD 2QMUA 1T91A 821PA 4DT1A 4NYMR 4P4TA 3BAFA 1DAFA 2R8RA 4UNRA 1XPUA 3VAAA 2FFBA 2DWQA 2CE2X 2MSCB 2WJVA 3SHWA 4U7DA 3MHPA 1KTVA 3LVBA 3CR8A 5TVKA 4C0AC 3L0IB 2ASEA 2J0QA 3LX8A 3C14C 3H2YA 2QAGC 1WDTA 2PJZA 2G3YA 2NQ2C 4RSGA 1TTTA 4MRVA 3CC2B 4POAA 5HCIA 3OE7A 1AK2A 1HQYE 3I8XA 5FOTA 3AF3A 4WIAA 4MDEA 2GVDC 4BPBA 5DE3A 2Q3HA 2ZEJA 3E20A 2VO1A 2XNSA 3AVPA 1XPRA 1E9BA 2P67A 4TL8A 4LJ7A 1BYIA 3ND8A 3QI2A 1QGAA 1SVWA 5JEEA 1ETUA 3DHWC 5JWHA 5A4JA 3LO8A 1TL7C 2J0UB 2QP9X 2CVHA 1IN5A 3AH8A 2WBLC 1FRQA 1F2UB 2JATA 3MSXA 4AF6A 1D6JA 5DGXA 4ACBA 1CRQA 3ADKA 2QSZA 3QOFA 1Z22A 2RKOA 4LJ4A 2PLFA 1ZM3A 2FPLA 1ESMA 1Q1EA 4URWR 5FPSA 4A8JA 3REGA 3CF6R 1EP2B 1D5CA 2B7BA 3LVQE 4P31A 3ZZTA 1J8YF 8OHMA 4TQAA 4RFSB 4XIGS 3UMFA 4EQ6B 1TQ2A 1G3MA 3T12A 3CX8A 4JVNA 1CJUC 3E70C 3CCJB 1TAGA 1ZP6A 2ORIA 1E2EA 3PR1A 4XSGA 4M1SA 3REFA 3TE6A 4JLOA 4RZ3A 4D82A 3W5IA 2RGXA 2WJYA 1MO3A 2YKGA 1WMSA 4UXHA 2IYWA 1E0SA 1YR8A 2R62A 4QJ5A 3TW8B 4OI4A 1NJFA 4Q1DA 3P4XA 1IXRC 3G5UA 3R8FA 4P33A 5IK2D 5FBLB 4KHZA 1H85A 3W5UA 2ZIAA 3FVQA 4C0HA 5JS8A 1HURA 4LJ6A 4EUNA 3V76A 2JLQA 5SZKB 3Q3JB 4S35A 1ESNA 4MKFA 3OHMA 1EFTA 2BPOA 2ZRFA 1R8QA 5GVSA 2OK8A 2DHRA 2WV9A 3FKSA 1F60A 4Q9HA 2UVQA 4KYIB 1YZLA 1ZC4A 2VP9A 4U9UA 2AWOA 1N0UA 3AM1A 4XSHA 4FWTA 5JWOA 1G5TA 4YAUA 3H84A 3TLXA 5DLQC 4F7WA 3ZD7A 2C03A 3W34A 3LW7A 1L4UA 1P3JA 4TT3A 1Z0DA 4RFVA 2RHMA 3NHBA 4TL7A 1Z0KA 3TAHA 1XDBA 2HEIA 2RCNA 5FL7A 4NONA 3HU2A 2OK7A 4MRNA 4JMPA 4BFZA 4MUBA 3SEAA 1N6LA 5FBRB 1YR9A 4BFTA 2ZU0C 1YI2B 1IN4A 1XCGB 1O87A 3L82B 2ZRLA 3PEYA 3UMRA 1A2KC 4Q7MB 2E1RA 1E1RA 1VQPB 1G20E 3MAAC 2WAXA 1RW4A 3EW9A 3SJBA 3SFZA 5E95A 4IXMA 1SM4A 4EJSB 1SKYE 2NMVA 1P61B 1LF0A 5EP3A 1ZBDA 2BBTA 1K5GA 5AJZA 4DC9A 1S1MA 3AVTA 5KDLA 4AYXA 4JLDA 1PZNA 1ZIPA 3P26A 3CPWB 4L5BA 1B23P 2D2FA 3K09C 4I81A 3SNHA 4YXWA 2CLDX 2XXAA 1NVXQ 3BE4A 4WAUA 2WJIA 1OXXK 1YR6A 3MJHA 1DVRA 2KBFA 1UBCA 3A1TA 5J47A 1BJKA 1BYUA 1KO4A 2YYZA 4PAOA 3K9NA 1U0JA 2MSEB 2ZRAA 3GFOA 3NC1C 4A0GA 4ZKDA 4G1BA 2J0VA 2GCOA 5DIFA 2BMFA 3HU1A 1I2MA 3KFVA 2R6DA 4DDWA 1AKEA 5FTJA 2F6RA 1G8HA 2HF8A 1EGAA 3CO5A 2WPDA 3KFXA 4B3GA 1EP3B 1G18A 1QG4A 2ZTSA 2ZSAA 2CCJA 1XRJA 3PJRA 1Q12A 4B3CA 2C9CA 1G17A 4PSKA 4W7SA 3CIOA 1U0LA 1P6XA 3LLUA 4HDQB 4ARZA 3EC2A 4DCSA 4IEEA 4ZPXA 2ZI5A 3CM0A 4QGGA 1E2JA 4Q9LA 1M7HA 1OYWA 2AK2A 2J7PA 3ES9A 3CWQA 2WZQA 2P65A 4JVLA 3ZLJA 4TZ0A 2GXUA 3MFYA 2NO0A 4AD8A 3I55B 1RYHA 1R0ZA 3DOFA 2RGEA 4NBSA 2OSBA 1XZQA 4RKFA 1AGRA 2KWIA 3MCAA 1ZYUA 4DWJA 1HA3A 4C3ZA 1FNCA 1L8QA 5JI3E 4PZZA 1E63A 3OEHA 4XWAA 2UZ3A 5GJVC 1UKZA 2AFIE 2GEUA 3A1SA 3CPJB 1A1VA 2NGRA 4UKDA 3EZ2A 1NBME 2WICA 3LO5A 4FN5A 4C30A 2WVJA 2W0MA 3AUYA 4CT4B 1HYQA 3THYB 1G16A 2XZPA 3TNFA 2VNIA 2AL7A 4YMSA 4PC2A 4RD0A 4TYQA 4DBLC 3IO5A 1F2TA 3N70A 1E9FA 1W2HA 1BMFD 2HLDD 4DJTA 1IB0A 2V6JA 4D4LA 2AKAB 5KNBA 4Q03A 3CMEB 3BH6A 4B73A 2GTPA 4TMXA 3CONA 4DRZA 1NMYA 1RPZA 3FKQA 4BLRA 4A2PA 3CWZA 3UWKA 3VHXA 2DBYA 3O8CA 3GLHE 2QPTA 2NO6A 3MRSA 1ZU4A 4XWOA 3OJWA 1MRNA 3RSLA 4CT5A 3B1XA 4EFLA 3G71B 2PL3A 2OBMA 2FMXA 2Q0HA 1EFCA 3BRWD 1H65A 5HCNA 1XJQA 1BIFA 3L0PA 1Z8FA 1NF3A 3T06B 4NKRA 5BQ5A 1W36C 5FA6A 3ZDQA 1QVFB 4MKHA 2QPOA 4AG6A 2C99A 4URUR 4GOXA 1Z63A 6Q21A 5KNDA 4XJXA 3TR0A 1EFHA 3WY9A 2IYSA 3L0OA 1LNZA 3L8YA 2CL6X 5DH9A 1W47A 1NSFA 1TVCA 5F3WB 2QUZA 1EP1B 1M34E 2IYQA 3NIBA 4WZ6A 3W3ZB 1KZGB 3CH5A 3DM5A 4LHVA 3P27A 3ZZUA 4HLDA 5FR1A 4B33A 5DNYB 1QHGA 2VL7A 3ND9A 1LB1B 4L8GA 4PPQA 3W8NA 3O8DA 3PUWA 1G7TA 2ZUBA 3VX3A 4CVNA 1GVNB 3D8BA 4DLVA 1F20A 4HAUA 3QIAA 3FFBA 1U94A 4Q1CA 4DIEA 1VIAA 4DVGA 1QVRA 2V7QD 4S2EA 1N0WA 4LBYA 2CNWA 3EG5A 3NC0C 4GT1A 5KSOA 3DM9B 4NP6A 1YRBA 4D0LB 3LY5A 3B9PA 2DY1A 1N5KA 5CIWA 3GEIA 3C8UA 2ZS7A 3KKQA 2OHFA 4JLNA 1KK3A 2RHDA 3NHAA 4HAZA 2J0UA 5SZHB 1LS1A 2H1LA 3Q7QA 1JXOA 2ZVPX 4A92A 4M21A 3QF4B 4Z1MA 3SQWA 2XEXA 1IY1A 1D2NA 1F2UA 3MGCA 4OKSA 3VTKA 5E3HA 3F8TA 5FOVA 1FRNA 4YDSA 2WJJA 3ZS9A 1U90A 5DISB 4CEJB 4DCUA 3WBJA 1G5PA 4BFUA 4JVMA 4H9GA 1E2IA 1P2UA 2LKCA 2VP0A 1A8PA 3ZC3A 2FE4A 2Z43A 4QGHA 2OV2A 2JJ2D 5GVRA 3UANA 4IFEA 3QFRA 1VQLB 3SHFA 5KDDA 1OFIA 4EQ6A 4KFUA 4D4JA 1FW6A 3VHLB 3LBHA 3CCSB 2CDNA 1FOEB 1UEIA 1OW3B 2G77B 5J4VA 2BCJQ 1VG8A 4KO8A 4US1R 5C1BA 4K8OA 2OT3B 4OHYA 2ZAOA 3VU9B 1JR3A 3AUXA 4UAJA 3K09A 5C46F 5JJLA 3CPHA 1OLOA 3TUZC 3W2GA 1JB9A 5B64A 3ZQJA 1KY2A 1WE2A 2A2ZA 2O52A 3QKUA 1KI9A 4UJ3A 1X6VA 3MD0A 2FG5A 5FUYA 2Q6TA 5H5JA 2ZRIA 2GZHA 4JLKA 1ZC3A 1E0AA 1AQUA 4F91B 1AN0A 5CK4A 2GJ8A 2YJTD 2VSXA 2IXEA 2J5XA 1N2CE 2ZR7A 2F43B 2QBYB 1CQXA 2O8BB 3W6PA 4W9MC 2D7CA 2C77A 1W2BB 1Z07A 1GKIA 2HDNB 2QA5A 1R0WA 3CUEF 3GLHB 4YMUA 4NDZA 2F55A 3TIFA 3J81k 2DPXA 1JQJC 2GK6A 3K53A 1OF1A 2F7SA 2ZJZA 1DG1G 4LC1A 4JBWA 3T35A 2PEYA 2EFDB 1E1QA 1Z0AA 1VCIA 2ORWA 3THXB 1T3LA 1YJNB 2ZS8A 1XXHE 4EJSA 2I4IA 5BWMA 1ZUNB 4Q9IA 2X3UA 1TUEA 3DZ8A 1Q1QA 3EZFA 4KVAA 5DYGA 1OT3A 1XMJA 1YZNA 1R2QA 2QP3A 3KQUA 4H1VA 3B1YA 1VQKB 1YITB 3CKLA 3R7WB 5FFMA 3GJ7A 1P4SA 3AKDA 2LKDA 3U44B 4HZIA 1AM4D 2GJ9A 4DEYA 3SU8A 5TXGA 4Q4LA 5EMNA 2ZREA 3T1OA 3EA0A 4RZ2A 1AIPA 3RC3A 2ZM5A 2Z5FA 3WYAA 5KSWB 1CIPA 3QXCA 5J40A 3WMFA 3DOEA 1FNNA 3NBFA 2ZE7A 3RABA 2ECKA 4HATA 2Z4RA 3CF2A 2H16A 4IDHA 3MUFA 1ZW6A 1T8TA 3ADCA 5F9FA 2GF9A 2BBOA 2JASA 4FMDB 3K0CC 1GZSA 3ICEA 2EWVA 1UKYA 3LWNA 5HPYB 4BLQA 4HDCA 4ERNA 4KSCA 3KKNA 2YWGA 2PIAA 4JJZA 2KSQA 1KZ7B 1N6RA 1US8A 3P4YA 4TYNA 4US2R 3ADBA 3QFCA 2XNCA 2WMOB 1Q44A 3PV0A 4JS0A 2EVWX 3VMFA 1I4TD 1WRBA 3EIEA 3MG9A 121PA 1XP8A 4B71A 2C78A 4TMVA 3I4LA 4R2HA 1T4GA 1SKQA 2ODBA 3GLFE 1Z6AA 4NYIR 5FTLA 4YAOA 2HUPA 3E1YE 4TQ9A 5GV7A 2IS2A 1EWRA 4URVR 2HJGA 3PUYA 1E2NA 4HSEA 4QM7A 2ZJ2A 5FUWA 1E2MA 1IN8A 1KKLA 2V9PA 3PQCA 4EPYA 5JCZA 2C9OA 2B92A 2WWIA 3OIWA 1H8HA 2X19A 2W6JD 3QFTA 2GJSA 1FX0B 4G5SA 2ZAMA 4Q47A 621PA 5TV2A 5IK2A 3RS0A 3HDTA 2AD5A 3H0KA 2F1HA 4QBFA 4JBYA 1X8JA 2JGNA 4ON9A 3QKRB 1S3SA 2WJHA 1MABB 2XGJA 3K0EA 2NPFA 2WSSD 1FUUA 4Q00A 1Z83A 3RS7A 2ZPTX 4XD7D 2B7CA 1TF5A 4L15A 2FFQA 2X2FA 1MO6A 3NBXX 4Q9KA 4NCNA 2GQFA 2XSZD 3GJ3A 1JQLB 3ZIAA 4O3MA 1JPNA 4RD3A 2W0SA 3SJZA 1K73D 5AJXA 5K8TA 1Z08A 2IYZA 4A0FA 3NWJA 4IW3B 2ZRBA 1LW7A 3OF5A 3VR2A 3QXSA 4Q02A 2OXCA 4OI0A 4JJKA 2LWIA 3UMSA 3I1FA 3QENA 3VX4A 4HLQB 3VKWA 4RD6A 2ZJBA 3AVYA 2WAYA 4Q1BA 3UG6A 4P4SB 2CHQA 3LBNA 1OPXA 2BBSA 3KTAA 5AWFC 5C18A 1LY1A 2A5GA 2P6NA 3FMPB 3KX2A 1JA0A 3Q7PA 5TR9A 2O8EB 3QPVA 3Q9LA 4UJ5A 4HLCA 3U5ZB 1MO5A 1S9HA 1MKYA 5FBWB 3U6KA 1GNQA 1KSJA 3K0FB 1CJVC 4RZUA 1HT2E 2L0XA 1QVGB 4FXPA 2W6IA 4OK5A 3GP8A 1HV8A 3X1YA 3AVVA 2HYDA 2H92A 2DETA 2AXNA 4CEHA 5EXTA 2R6CA 2E9SA 3S1AB 4M1KA 2BIFA 2UZIR 4Y0VA 2BVNA 4ZGQB 4B3BA 4BECA 4HUTA 1QUEA 3GFTA 2O0JA 3HYTA 5KNCA 1N6OA 4EKDA 2ZITA 1W35A 4LBVA 3Q5DA 1YJ5A 3CCRB 2XOKD 3A58B 3KXIA 3E2IA 1R10A 2A5DA 1XTQA 4HLUA 3ADDA 1RFLA 3BIFA 1JR3E 4JKIA 1SULA 1JECA 3U3JA 2ERXA 1NDHA 4RVCA 3CNNA 1HE8B 4NMMA 1VG1A 4DEXA 1XEXB 1HEIA 2A5YB 1G7SA 2QM8A 1PLJA 1PUIA 4B48A 1NRJB 1S2MA 4PXAA 3U3RA 3ZH9B 2VP2A 3OEEA 4MYCA 3G6EB 4O2LA 5IRCD 1ZCAA 3OAAD 1CJTC 2WOJA 3D3QA 1Q7YD 3QF7A 3NH9A 3PG5A 5G3ZA 1E3MA 4EPRA 4PGOA 5BYJA 1G7RA 4I1SA 3CH4B 2CL7X 1E2DA 1N5LA 2OEPA 2QAGB 3OZWA 3PUZA 5H59A 2ZRCA 3QF4A 4CEIA 3HR7A 3KXKA 3TGPA 4LHYA 2JJ1D 3BXZA 3CW2A 3BB1A 3KB1A 1DDIA 2ZSBA 4MDFA 4Q48A 4CEJA 3K70D 4HAYA 5K8IA 1JB1A 4N3NA 2G1JA 2ZJOA 3QE0A 1GAQA 2A5FA 1YVDA 3GLFB 1NMZA 1FNDA 5LD2C 5EXXA 1E2KA 2FZ4A 4LV6A 5FUVA 3LQRA 4Q1EA 2VPPA 4TMZA 4M9QA 1XD9A 5P21A 4GZMA 2JCSA 3O47A 2FPMA 2IF0A 3N2IA 4GPTA 4X8HA 2GETA 1CRPA 3VQTA 3RDPA 5TY0A 1CR4A 5AN9A 3KXLA 1KK2A 3B78A 5F2EA 1R8SA 1BMFA 4AYTA 3K9LA 3TAUA 4Q21A 2C98A 1DDGA 1COWD 4OYHA 4Q4JA 4QBIA 2CLSA 4TLDA 1W4BA 1KNQA 5THXA 2JDID 2BOVA 2P5TB 2MSDB 2QM7A 3CX7A 4URXR 2OLJA 4DCNA 4B47A 1KDTA 1FP7A 1XMSA 2JIZD 1EFRD 1GSIA 1E2QA 2CHGA 5EE3A 1IJFA 4WA7A 3QPUA 3SE0A 1ONBA 3IIKA 3Q5EA 1QH0A 4ESVA 2WJGA 4V0NA 5FTMA 3RS2A 1Q3TA 4RCZA 2F43A 3A4LA 3BFVA 1QVAA 1C4OA 1FL9A 2QBYA 2O8BA 1T5IA 4ZGNB 5EUMA 1T8UA 2A3RA 2CK3D 1XEFA 4TMKA 1IXZA 1JEEA 4MGYR 3GLHA 3W5HA 2IXFA 2VHJA 3PFIA 4C43A 1U98A 5EP4A 1N6IA 3PXGA 3WNBA 1VIYA 5G40A 1WXQA 3ZGXA 4B3DA 5CB8A 3Q72A 4OHWA 1YZGA 4NPHA 4AI6A 4JSYA 5CYOA 1I2DA 3CCMB 4F38A 1W49A 4TLAA 2B5OA 1E6CA 3THXA 1V5WA 2GAAA 4P4UA 3AVWA 1NVVQ 3RRMA 1UAAA 2BKUA 2V1UA 3ZQ6A 4G5GA 1DG3A 2CJWB 1A4RA
chains in the Genus database with same CATH superfamily
1Y9DA 1SCBA 3L46A 5ALOA 4JSRA 4URHA 5TQ0B 2DHEA 1H2ZA 1KEWA 3LBAA 4M1MA 1YVPA 1P72A 3KEGA 3HFRA 3ZD6A 4O2RA 2P3QA 1LBQA 2PL9A 2FCRA 3EVDA 3L0SA 1HYEA 2FF7A 4PGAA 4DB2A 4G1EB 2V7QA 3PEWA 4QJBA 1EWVA 2EU8A 5AXAA 4BIMA 4K6MA 4WQMA 4GH5A 3D4LA 3P94A 3I5YA 4OH7A 5D87A 2WQZA 3H0EA 1NAIA 4CCSA 2C4TA 2B4QA 4OMCA 4D9GA 3IB3A 3W5VA 2PBZA 3DAYA 4BUZA 5JALA 2JARA 4N54A 4MDHA 1E9VA 3GLGB 2GPTA 4GOJA 1CF4A 4Y98A 5LN1A 4XJTA 3K72B 5JAPA 4ZTZB 4RMNA 4OI1A 4DCOA 1TK2A 1EZ4A 3LDHA 4UAUA 2G82A 4JDPA 5J1SB 5KKCA 4KO2S 3LUJA 3IAEA 1GY8A 1JDZA 2YH2A 1G6OA 1H6AA 5F1PA 3ZBQA 3H2ZA 4QOHA 3PPIA 4CNQA 2AD1A 3ZWOA 3DBIA 3ITKA 2CEKA 2HWYA 1G55A 3ONVA 3SF8A 1MORA 1Z38A 3VR6A 4GF5A 5HKKA 5A9RA 3F7MA 4JLAA 2JJ2A 2GO1A 5IYZB 4K9OA 4NE7A 3VVBA 4RA6A 5ARDA 3U26A 5ADUS 1SZJG 4WFIA 3CRRA 2OHIA 2J30A 4TRRA 1XMPA 3KQSA 5K3SA 1Q82D 1Z0SA 3EPLA 1M74A 4N0EA 2VH2A 4R1TA 1HLPA 4XLFA 1GNLA 4JLUA 3UC9A 3H1EA 4FFDA 1RLOA 3RHFA 3JW8A 3ZU5A 7REQA 2Q62A 4NCXA 2XT0A 3IVXA 1TAUA 1W87A 2H7VA 3L40A 5CA1A 5KIAA 1WS6A 1F0YA 2R85A 1DWPA 2J5BA 1CRZA 1C1XB 2GF0A 2Q3BA 2XUHA 1Q20A 3FJOA 3CE9A 1G8FA 2V1XA 4JB3A 4LTDA 4R40A 4F8YA 5U4XA 3ABOB 5FDFA 3EN0A 4BNJA 5JD4A 1P62B 1QYCA 2J5RA 1I5EA 4RMGA 4O4IF 5JLAA 1VMAA 3DAOA 1QE3A 2GAFA 3AY3A 1NB0A 5J5VA 1MABA 5F4OA 1LK0A 1YXMA 2G08A 1F3OA 1KDRA 2R4QA 3R5KA 2VYQA 1PVOA 1TT7A 4K6CA 2KBEA 2WUGA 2IHVA 4H1UA 1W5AA 4KIUA 2IYEA 2WP8J 4MRSA 1GRRA 4F45A 4B43A 2Y27A 3JQAD 3FMFA 1AZWA 1L5HA 1LV8A 1ZD4A 3AJDA 4CKEA 2VJNA 5KYUB 3D81A 3KQHA 1H8EA 2VT2A 1U3FA 3EVGA 3RO7A 1KSFX 4NAHA 1N6KA 1R6DA 1Z4JA 4WFQA 5D3ZA 3UWDA 5B55A 4XZ3A 3UT6A 2QAIA 1K88A 1MO2A 4KDRA 4PZ9A 5TPZD 1C81A 3WHIA 3JVVA 5BPHA 5LP6A 1I6WA 3OFSA 3K70C 3P5SA 5EMJA 5MHTA 4M53A 2O19A 5K3BA 2XTJA 5GZ3A 4KREA 1YC5A 2YVKA 1A9SA 3U7HB 2XITA 1M10A 1XZMA 4W1QA 1A5SB 2TMYA 1N2CA 3D8NA 3PUIA 4AMBA 1TLLA 3DQQA 1CWUA 2MINB 3R1IA 4DR4B 4D2IA 1Q7GA 1FFHA 5AKYA 1YSCA 2BY4A 2FRVA 1XEAA 5A5GA 1EXNA 2AC4A 4UMEA 1YLOA 3X1WA 1R74A 2IYUA 3QWIA 1FVHA 5J4YA 1PW5A 4MS4A 5FNVA 3SQOA 2LIVA 2R8EA 3DE0X 5HQ3B 13PKA 4KXFB 4N40A 3RTEA 4M49A 1WNFA 1GQQA 4YRSA 3VUEA 2J4FA 4N01A 4QT4A 3QP9A 4NY1A 5HIMA 1T1SA 1P4AA 1A7AA 3RARA 5DHRA 4DQLA 1EDBA 3UAXA 4UM9B 1C9YA 1AMNA 1UFKA 3DE3X 5T4HA 3W3AA 4RDXA 2EKBA 1D04A 1VKNA 3B13B 1QYIA 4S3MA 2C7RA 3RSSA 1W36B 2BSQA 4PYNA 3C7KA 4TSFD 4H4DA 4QX6A 2Y99A 1XD8A 1JQEA 2LGJA 4PYKA 2ZXHA 4I1VA 4G63A 4TT8A 4CF3A 4D9BA 4A23A 4EAAA 4L8YA 2ZVJA 4H4CA 3M5WA 1J7JA 2E2WA 2QMEA 3PQ4A 2PXCA 4L73A 5GY7A 2GRJA 5HOEA 4BKMA 2BGLA 1WXWA 3BJIC 3JARB 1HMYA 5G0WA 1L0BA 3BQNB 1ZL0A 2Z2JA 3ADPA 1FDRA 3ED5A 3O93A 3QI7A 3BNWA 4NJEA 5K6AA 1I0LA 1SIBE 3M6FA 4N47A 1KEKA 1YS1X 2WUDA 3NEYA 4NMHA 3WLOA 2GTIA 5FD8A 4YRBA 5L3SB 3RJ5A 3K16A 3LPCA 3EJWA 4OQEA 4R83A 2Q9UA 1X70A 3E3OA 3CVOA 5E2IA 1QZXA 3GEHA 2PRZA 3KO8A 1WCXA 4JU8A 2SBTA 4N1AA 2FI1A 1QIKA 3U4MA 2HR1A 4B4OA 1UOPA 2J87A 2BF4A 1DINA 1EAMA 1XE1A 1O8BA 1RPTA 3OQPA 4LF8B 2R751 1U8YA 3EWNA 4IRXA 3EWIA 4EG5A 4A1OA 1JXAA 5KYGA 4O5AA 3MWYW 3VSEA 1OH6A 3C4JA 4MUIA 3RY8A 4CDMA 3EH2A 1MEOA 3VZBA 5JIBA 2B9VA 1J0AA 1GPDG 3QNMA 2BFFA 3NXKA 4IVQA 2A7XA 5TQ2A 2AXPA 2NZXA 1CUDA 2DEUA 1C0EA 2E48A 2BFAA 3D7MA 4K9KA 4C08A 2V3CC 1FYWA 2XTNA 4CG0A 3MEQA 3NWEA 3I5XA 2BZGA 2WHYA 4C4SA 4FSXA 4AS2A 1A1SA 3GLFA 1E2GA 1LC3A 4M1TA 1JT9A 1BCSB 1SHUX 1O89A 4GKKB 5BMVF 1NC3A 2ANBA 5JZSA 1DO2A 1YQWA 2WIGA 4FNOA 4ZQFA 5JJ5A 2OQIA 2CSXA 1R18A 2PUGA 2P6RA 4E70A 3UK6A 1HQKA 2DQ4A 2GCNA 4ARVA 1YL6A 1EA7A 2XSZA 5PGMA 4E08A 3MXOA 3SZMA 1GKLA 2WKSA 4DK1A 1PSZA 1Q83A 2HXYA 3KQMA 4CMBA 3L7CA 2X9NA 5FP0A 4EX6A 1EWQA 3RH0A 5HWSA 3QYFA 1KO8A 4QTYA 4HXFB 4XX0B 4OP7A 2WSLA 2X0EA 1KBOA 4YP7A 5DBIA 3FYCA 2ZE6A 2X1HA 1DAMA 2FPXA 2Q1YA 4IBOA 4ZEVA 1Q92A 2QR5A 2JVJA 3OU6A 5FBKA 2HD4A 4O02B 4B4VA 3A1PA 1KJ9A 3JQQA 1J0EA 1FFDA 1HE4A 3M83A 1CY1A 2H4ZA 3FUTA 1ZUHA 4TLMB 5EYPB 1P8AA 1Z36A 4H7FA 3WYDA 2I1QA 5EE0A 1JA9A 3FOBA 2OBXA 3F7OA 4WZTA 4R9UC 3CC4B 2X8KA 3OEYA 5J2TA 1DJPA 5REQB 5IU6A 3ZJTA 1YQEA 1N78A 1GTL1 5FQNA 1RXYA 1GKYA 2YS6A 3WV5A 5DHFA 3IODA 3HHEA 4Q9DA 5AXBA 1W88A 2R9VA 5JDIA 1IOZA 2WKPA 5IBPA 4CQMB 5LIRA 1Z4NA 1V16A 3KB2A 2R65A 1DE0A 2CNKA 4PM4A 1TKRA 4JJEA 3ZY2A 3QOYA 2J9FA 3AT1A 2CCKA 4ZT2A 4DVJA 4ZZ0A 3BMOA 4IDPA 3AJ8A 3OC6A 3KXDA 1P4JA 4DUGA 2V5VA 1AUQA 1GGJA 3RK0A 1FRVA 5FUQA 1CULC 1W5TA 2YYYA 3MJDA 4HJRA 1PUXA 2HF9A 2BELA 1ZK2A 1RYYA 5CCEA 5BSKA 3OF2A 1YK0A 4R6XA 2GM4A 3R9IA 4QGSA 2G9NA 3O7MA 3BKWA 3RANA 5CLIA 2W6PA 4IHQA 3S1SA 2NNWB 3AINA 3BFKA 4KN9S 2P4EA 2HA3A 4EUHA 1BXRB 5IM5A 1NI4B 1G1MA 5EPEA 3SS8A 3LYAA 1WD7A 2QUAA 3RD5A 4RO0A 1EK0A 3L93A 1Z2EA 4YJ2B 3SBOA 3ZBPA 4EKIA 5SZJA 2VRCA 5K45A 3CEMA 2ZRMA 3PNBA 2PMCA 4EI8A 3M5PA 4MUFA 4W5QA 2VYND 2IEZA 4MI9A 1EK2A 2XYRA 5TEWA 4CF6A 1A9YA 4Y2TA 1Q5PA 3FAZA 3WLLA 1UD4A 4I7EA 4EJ6A 5BP7A 3G0CA 2QD3A 3KR1A 4ZYZA 3RIEA 1NX6A 3S3TA 4KO4S 3S8YA 1PG5A 4IXNA 1N6HA 1C30A 3KZOA 3VYTB 4CLDA 3HDJA 1UK8A 1DOAA 5IAAA 3IJRA 4XUCA 1A97A 1LTQA 4ILEA 1I24A 1ZHFA 4R2KA 3TCKA 1KHTA 5DFAA 1TCBA 4TVBA 4PS0A 4TL6A 4JI0B 2OUKA 3ZHYA 2E6KA 2ZSUA 3JWIA 5E4TA 5ADVA 1JKIA 5E9JA 1DKMA 1RSZA 3I6QA 4HI0E 5F73A 3MWJA 2WTBA 4JU9A 2C4VA 2EDAA 1N8NA 2G8LA 5HNKA 1CUJA 4H7KA 1E59A 5C8YB 1V8PA 3AIOA 4PYIA 5FPQA 4I9FA 1DC3A 4XCVA 2FSHA 1YBFA 3PIIA 3GIWA 3Q2OA 5BW8A 1OIVA 1VCOA 3I2KA 3VXKA 3CVUA 4DADA 1Y5LA 2EJBA 4Q18A 2JCYA 5AJVB 3RF7A 5HRAA 2WMYA 1N2EA 4PRYA 3E84A 5I5EA 1ZH8A 4MKXA 4OJQA 1JTEA 3DCJA 4BFVA 2QTVB 4HE5A 2BEWA 4CCWA 1GZ6A 1YDMA 2ZI4A 3TK1A 4BTVA 2BEUB 3F5MA 3KVYA 4EVSA 1B43A 3Q3EA 4RD1A 1TOAA 4A26A 2E85A 3VSBA 1AK1A 1E7SA 2AOWA 2CLIB 1NWHA 1IAVA 3BSYA 4GC9A 3ROMA 4ENPA 2C4WA 5IM4F 2GBLC 2VDRB 1FTNA 1LU9A 1NT4A 1DUIA 2JKZA 3TS1A 4AROA 2AZ4A 1YVUA 2R6FA 5AESA 2JDIA 3GP3A 1KETA 4DQKA 3U3MA 5I7VA 4PHFA 3MTJA 1KI6B 2GCPA 2CBGA 1IIRA 3DCNA 3CRNA 2QEXB 4ABTA 5T67A 1EFRA 1XCLA 1LLCA 4HXYA 2Y1KA 4NFHA 5KNBD 1OB5A 1G66A 4FBMA 1GCAA 2Q8QA 1FMTA 4L3OA 2ZB8A 4CQLA 2MSWA 2EZ4A 4ALMA 5HIKA 5EPOA 4R69A 1H2EA 1CVIA 5K3DA 2AI1A 2VBSA 1EHYA 3TO5A 3PENA 5FBVB 3SXJA 5CXQA 3LRTA 1GRQA 4X5OA 5AVZA 4L5IA 3SIXA 4BQRA 5KREA 1H0KA 1Y63A 2Q4DA 1K3UB 4L4UA 4IDBA 4QOSA 3EGXA 2JJMA 3RVQA 4HVAA 4AIIA 2IODA 2UDPA 4GLJA 1D2GA 1EDZA 3WYFA 3A3GA 5B6IA 1GPKA 3DE4X 3QYPA 2G76A 3UB3A 2VA9A 3V34A 2XUAA 5CA0A 3P9YA 1D6SA 1TW3A 4IIJA 2GCEA 1NXTA 5EIHA 3U62A 4C9BA 4MQEA 4WV3A 4D3DA 2GM3A 4C4PA 4DUYB 1Z2PX 3Q0IA 1I7DA 1NKTA 4YCDA 3NKVA 3JALB 1M6NA 3DC2A 3GWZA 3SDZA 3HKEB 3PX2A 1TQDA 2JLVA 1FU4A 2X8LA 1TTQB 3CXCB 4PLTA 2EZ8A 1AQYA 4RZIA 1KEEB 1XZFA 2A9QA 2G9RA 3DF9A 3SVZA 4B45A 5HG0A 4HNVA 1RQ2A 2YZMA 3S7ZA 3GLRA 1X7YB 5E6RA 3ZGYA 1X3LA 3H9JA 1UK7A 2ODWA 4CJXA 4KZKA 2GZSA 2HXSA 1PEAA 2NSLA 2W8ZA 3JYHA 2V4UA 4KZPA 3KPVA 4QOGA 4XPZA 4ZZ2A 3DEIA 4GHWA 3TLZA 4D4IA 1MIHA 3OEHD 3QLUA 3FKJA 1D0IA 4ITRC 1JWLA 1P9NA 2VHCA 4UM8B 1C2YA 4DPMA 4WN3A 1M2OA 4XD2A 1TZBA 1XZDA 4UDXX 3K71B 4X1YB 4ZFNA 2N9UA 1BRMA 2Y4NA 3B3JA 3GELA 4C20A 4AKHA 1SQ0A 5FOSA 3MTGA 1HY3A 2JS7A 2ZE5A 2A9VA 3HUDA 2CJFA 4A0HA 5AVSA 4R2LA 2TMKA 2Y0PA 1TF7A 2A1UA 3FM9A 1II8B 2C2ZA 2ZUUA 4KIFA 3QBEA 3C87A 2QF7A 3GAAA 1QO0A 3LD9A 3QLTA 4HX9A 2VDNB 1VLYA 3A6ZA 5L3RA 3TFQA 4LDZA 2QQEA 1E9AA 4RQBA 2VAMA 4X9XA 4KN8A 3UJDA 1X13A 5MN6A 5BUZA 5LQMA 4C7BA 2FN4A 5FI0B 1ZIXA 2HB6A 1WOMA 1JP7A 3KVRA 1C29B 2WIBA 3R9WA 1NMXA 1WSWA 2W11A 4A6PA 4LDPA 3PGA1 4FYYA 4A8JC 1I7NA 3SJUA 3HABA 3L8DA 4NFLA 1W0KD 3WLRA 4YROA 3E1GA 5JCPA 3LJKA 4TMYA 2W2VA 3B89A 3P1JA 3VYSB 2XMQA 4H59A 2KVOA 1HWYA 4B4DA 3ETLA 3D26A 1FYXA 1PS0A 1U2DA 3H05A 3JAWB 3NHRA 2QD2A 2F8MA 3IJ5A 3FNRA 4QPCA 4WKBA 3RU9A 3V32A 1AQJA 2I22A 1E3SA 1M2JA 1GNSA 1YNOA 3C5CA 2BM0A 2VTDA 3FY4A 1GQ2A 2FZCA 4MCAA 4NV0A 5DNAA 4XEUA 1KE2A 3OZIA 5FJIA 2Z1MA 2YINC 4J0HA 4UU8A 3J81A 3GR6A 1OI4A 4AJOA 4HZGA 5JHHB 1V1MA 1IN7A 3D7KA 1JALA 2ZR0A 1NOIA 5M3BA 1SZCA 4OXRA 4AYWA 1THZA 2GNPA 3THSA 4DW8A 2R4UA 2FMKA 5EHXA 3DFUA 5CT5A 4B6GA 5A0TA 2CCGA 1X0XA 3GJ5A 4MKZA 1W25A 3DE1X 1RYBA 3O2SB 2QRNA 2EP8A 3NM6B 4CGZA 2QUHA 2I87A 4Z9BA 4I9GA 2J59A 4EPWA 1D6NA 3CV3A 1NHWA 4NE9A 1D03A 4MVJE 2ZQ5A 3DXXA 3E1KA 1WBBA 1IXSB 1H22A 1SRRA 2VH5R 3HZOA 4Q9NA 3UPTA 5TLSA 1DSSG 1RLJA 2E4XA 3AHIA 2GASA 4KBYA 5I7AA 3ROPA 3ZV3A 5CGQB 3TIGA 4EF5A 1Z3IX 5DTMA 5KSZA 2ZRGA 2P2LA 4AB1A 1VFNA 3CLSC 3KSMA 3C1TA 2XQGA 4V03A 5T6BA 5AR1A 2IU3A 2V7XA 4XM0A 4EPTA 3FDZB 3G8DA 1OGJA 4TL9A 5A05A 3W8DA 3DWGA 3WP0A 3QSGA 4X1IB 2AEEA 1PJ8A 1SC9A 1CR2A 3CW8X 3ITNA 4JYCA 4EG0A 2IGTA 1DIHA 1C4WA 5C51B 3GLGE 3L1JA 2K4MA 2XF8A 3RLIA 3J7AC 1FPMA 3B82A 3ASYA 2XNDD 1FCJA 4BVHA 3O26A 2QX8A 3WO0A 1D9XA 3EYAA 3EUFA 1XDSA 3T0FA 3RF6A 3SKXA 1DO8A 4PO1A 2OTLB 2X5OA 2I3GA 4JT4A 4XTRA 16PKA 1QHEA 2MSNA 3U7EB 1UFQA 3ME5A 2NU8B 3OZEA 3AC0A 4JVSB 4Y6QA 3T3EA 5IC4A 4N03A 1OI2A 1RM3A 2MMCA 5D1HA 4CDGA 1LBIA 5BSFA 4IDOA 1T5DX 3PF9A 2IV2X 2O2ZA 3C7CB 4KXYA 2GBPA 2GKOA 1A7KA 3PUNA 3SS7X 4BNNA 2B7LA 2WYUA 3ASPA 3GDWA 2AG8A 2JI9A 3PVSA 4C29A 3K1AA 3AMVA 4F2DA 1MO4A 4FYJA 1MH1A 3L4BC 4LXQA 4TN5A 3ZE8A 4JQSA 1UPUA 1PJ6A 4EDHA 1WOOA 2QRLA 4M0CA 1RBZA 3E5MA 5CDTA 4JXKA 1P1RA 3DGFC 4BZPA 4O4JA 4ZT3A 3H3XA 4W5HA 1Y7TA 1PFGA 1A4IA 1LPNA 3DP9A 3MCUA 1GGFA 1SHKA 4YIKA 5AVOA 3X1KA 3FUWA 3K0SA 1PR5A 2UZ4A 5D7BA 3DDUA 3IP1A 3RS3A 1SG0A 3KQNA 5COQA 4N7RA 2OGTA 5I9NA 1WSBA 3INGA 1WZIA 3R6LA 2P6MA 3QA3E 1F0NA 3LXMA 4FIDA 4KB5A 5KJFA 3UVEA 2X4GA 1IEVA 3NHWA 3EFOB 1Z8HA 2A0WA 5LIPA 5KNCH 1Z4MA 5AHOA 1ISHA 1F38A 2HLDA 1XEWX 4B9EA 1K66A 1G2OA 3HN2A 4ME6A 3RVNA 3DLBA 1I0IA 1IHUA 6AT1A 2JFVA 1SD5A 3KAPA 3KZ1E 3ONDA 2JAHA 1NN0A 3M4YA 4KJXA 5JE8A 1PZXA 2NG1A 4L50A 4XIJA 4NYIQ 4OBBA 5DBEX 3IBGA 5HMMA 1ZK4A 1E79A 3A6KA 5CA0F 3W5AA 1G21A 2Q46A 2Y8EA 5IABA 3QEBZ 3NWPA 1CE8A 3A1VA 4XUDA 4JZKA 2BZ0A 1A9RA 4L5YA 2C9YA 2OBYA 4OQLA 3AQ4A 4W5TA 3OPYA 3AEYA 4LZAA 1O5TA 1V43A 1LX7A 1VMEA 5D3MA 3C8HA 3T9EA 2SCUB 4YN3A 3JVIA 2YY6A 3U3ZA 2FGKA 1U7DA 4OHZA 5DM70 1ZQ9A 3KALA 3D3NA 5FOWA 3W4KA 2WU8A 1HI9A 1A5TA 3JVEA 4K3VA 4W9NA 5IKXA 4RTMA 1PX2A 4HAVA 3PQ7A 4Z9YA 2B8JA 3TEMA 2Q3MA 5J5CA 1BMTA 1UZNA 4Z99A 1T9DA 2Z8YM 3UH0A 2VDMB 1A2OA 3A4VA 5FX2A 2ZSHA 4GI7A 3BSFA 3TAXA 3UMMA 4J1NA 2KX7A 3KWLA 3GCWA 1USIA 1ODTC 5DNVA 4CODB 1JIIA 4OUDB 3C6BA 1H3NA 2VXOA 4HOYA 1JFRA 2VF4X 4F9FA 1D4FA 4E22A 4G9GA 3W5BA 3M6AA 2Z95A 4MW1A 4I99A 1T2DA 4LFCB 4JYZA 4H0NA 1ZLYA 4QT0A 1LV7A 3BJZA 1I1OA 1T3TA 2ZJ8A 4DMUB 3ANMA 3HY6A 3O31A 4YP5A 3WGOA 4UCFA 5FUXA 2YJ3A 4BVLA 4REMA 1U28C 1QG6A 3H9UA 3Q39A 1K6MA 3A1NA 3TR5A 1LLQA 4MHSA 4OQDA 4E1VA 1RC1A 3BJRA 4WN9B 2OBRA 3RASA 2Q5EA 2XWBF 1ZD9A 3ANXA 1VDZA 3PKIA 5L3ZA 3LL4A 3UOAB 4RLHA 1L3BA 1JHAA 2FW6A 3CRW1 5CM9C 1VHWA 4Y1RA 4DIDA 4JYAB 1X8LA 2H9IA 3GGDA 2JFOA 5TQJA 1FZTA 1YA4A 2P9GA 4ISBA 3TPFA 3SHTA 1E0KA 3EOBI 3SZLA 1J56A 3IHTA 5JMWA 3N2GA 1GILA 1IN6A 3CKKA 2HV9A 4XLEA 5AICA 1FEZA 3U2QA 1XVLA 1V0FA 2FKAA 4WZAA 3PEFA 4JROA 2AZMA 1USGA 2REXB 1TT5A 2W2KB 3MF4A 3QBVA 5JAQA 1X19A 3HWRA 4BV9A 1JG7A 5IYPA 1I4LD 1H4QA 4MICA 1PT9A 5KSYA 3UPDA 4G84A 2XUKA 3JQ6A 2AFHB 3I32A 2QM0A 3DYIA 4HWPA 3X1XA 1YRQA 4BZQA 1DT3A 4HPXB 2ZSJA 3G8CA 1NU6A 2VHYA 1PGNA 4IGIA 1TO1E 2JN9A 1SPXA 3QX9A 4NU6A 1QR6A 1ZOOA 1JHDA 1VFPA 1XTJA 4JQZA 5GONB 4HS4A 3LBIA 4C88A 2C20A 2GDJA 3H4MA 1PIWA 4LECA 1VQMB 2ICAA 2PFSA 3OIYA 4L4SA 4EITA 1HSOA 1AVTA 4PFQA 5JVDF 1H9CA 1JAIA 4L07A 4Z4VA 4O33A 6ABPA 1P60A 3B3AA 3L8CA 1DADA 3AHFA 1PQYA 1EA5A 1WDWB 3EDRA 4MP6A 4B32A 3G4SB 1JR6A 2WE7A 1FFSA 2FZKA 2AGVA 3K0AA 2XE4A 3E9NA 4HGOA 2PNJA 3R0QA 4RD4A 2PUCA 2PYIA 4ZU3A 2W8BA 3CRZA 1OXMA 1CNEA 1ONOA 2C2OA 4Y2VA 1OASA 3OOSA 2NV6A 3ANSA 4DTIA 2RKWA 1NRKA 1EQUA 2KS6A 5KTNA 2G0TA 4DDUA 2HK9A 2B4AA 3JD2A 3E0XA 4YYEA 4HUQB 1N7HA 1EM8A 1E9SA 5ALDA 5TMPA 3CVWA 2VBUA 2XVXA 2BGUA 1NM5C 3EVNA 1H2XA 3IQIX 2BFBB 4OHUA 2FN7A 4BNYA 3JAMA 1JEQA 2PUTA 1MDBA 1VGVA 4NZMA 4X44A 3LIPA 2RGRA 2B2NA 1M1NB 1R5OA 4PGGA 5DGTA 3B48A 4IFBA 4MV7A 1IM8A 4TZTA 2V9CA 1QIIA 2OMEA 3OP4A 4RH3A 2RH5A 3LT2A 2Y1WA 1KMHB 4MGKR 4RNCA 2Q7XA 1YE8A 1H23A 5L40A 1O4WA 3BJEA 2WF7A 4EHNA 4F71A 1DNPA 2DFLA 4D25A 2ZR8A 1C41A 4HYTA 1P73A 4EA6A 1UM9A 4G56A 3KT8A 2PLAA 3FPHA 2V6GA 3U13A 5K2OA 3V1LA 1UBSB 2O20A 3IJEB 1U4NA 4RBNA 2W6ID 5EJFA 2AK3A 2VYVD 5A4AA 5BNIA 4XQGA 3FDIA 2WTAA 3ASQA 3JSAA 1BX0A 4RF5A 4BGVA 3W2EA 3N39C 2EWWA 1EEXB 4TX1A 4YAKA 4YYZA 2DIEA 3D54D 1SBTA 3HCWA 2VJLA 4FINA 1Z6PA 3U61B 1AS3A 1ZPDA 1WXFA 3QOXA 1C3VA 4S12A 1HG1A 5JDCC 4PZAA 3R4VA 1UMKA 1Q91A 5I9MA 4JA2A 1GZVA 1W5EA 3MGAA 4NHOA 1V11A 4S1PA 1P81A 1T6NA 1LI4A 2GZAA 1DV2A 2WVAA 2QY9A 3HRKA 2D2EA 4P25A 1W1UA 4CZ2A 1D1TA 1OVGA 2Q5QA 3T3HA 1GZ5A 4JUAA 4NH4A 2I9KA 1J22A 1SU4A 1BEZA 4CKWB 2C0CA 4BX2A 1GLNA 3UZUA 1E3WA 2GA8A 4ZAGA 2IYYA 3BXFA 3ICVA 3O4IA 3QE4A 1TGVA 4P53A 3WYBA 3I0ZA 3VO8A 3AOEC 5EWMA 1ZMXA 4G25A 1KSHA 3Q8WA 1GPJA 5JCJA 1QK3A 1JKFA 4E5PA 3DOJA 3QMWA 4N5LA 2YHBA 2IHNA 2P5SA 3I6BA 3IMCA 1QAOA 3FCAA 2O14A 2E0IA 2W2NA 2E21A 5KAPA 4JMLA 1ORTA 3EYWA 3SLGA 4CV2A 5DB4A 1IZ9A 5JNRA 1MMFB 1VJ0A 2RGBA 3DV0B 4YLGA 2IW1A 3QM1A 5JZVA 3DP7A 2VJJA 1R4NA 3MVEA 1KK0A 1HZEA 1TTHA 3FLAA 1JSZA 1M8KA 2E82A 1LEHA 3N58A 1PV2A 1SVNA 3RK4A 2GCGA 3DULA 3MQ4A 1VQ9B 4N7MA 4H17A 5EZYA 3T7RA 3K94A 1JQ3A 2CUTA 2ILVA 2PKCA 4OQNA 4B6PA 2WABA 3FPEA 3C16C 1DT5A 5LOVB 4PGFA 1ZUIA 2A57A 2G70A 1QG0A 4NMLA 3UMJA 4BP8A 5AFSA 2GPYA 3FE2A 2H18A 1MOQA 4RL4A 4KVGA 1QQAA 3TW0A 3FPPA 2W6JA 2OZKA 2VKQA 2XW6A 3AB8A 1DBQA 3NGMA 4MQBA 4KPEC 1VZ2A 2ZI9A 2JLUA 1WF6A 1W34A 1QIDA 3V1UA 4LC0A 1ODSA 2B6HA 1R16A 3V7NA 1Z29A 2DUMA 5K3OA 1SCNE 2JGDB 3N8GA 1RWWA 4WEOA 1T2AA 4WECA 1EFVA 5CBPA 1M1YE 2F3TA 3H6HA 3CG4A 2XB4A 1VG9B 4Y9DA 2B3DA 3GEPA 1ORDA 4WKCA 5CTAA 4QQNA 4Q12A 1WL8A 1GSHA 3E7FA 4LJYA 4DE5A 1Q1ZA 2JGRA 4JIMA 4JI4B 3GF4A 4QV2A 1V1RA 3CT4A 3EMKA 1C9DB 4Q01A 1H0SA 4MRRA 2XZDA 4U7HA 1NG1A 3BMCB 3P9RA 5DU2A 1ISRA 4A03A 3AHDA 3EGDB 4C0QC 4NXMB 2O8DA 1XLUA 1NXSA 1K7CA 4C7OA 2F90A 3RIHA 4NH0A 4D6YA 1Z2CA 1J8VA 3D6UA 3RV4A 1YCGA 2W7TA 1FUEA 2Z56A 3EK2A 2ZANA 1ACLA 4YI3A 1JBQA 3KU1A 4PEVA 2JD1A 4WW0A 4HNSA 3FHTA 3R9XA 4AJJA 1QGYA 2F59A 4L08A 2XGMA 4D6XA 3BXOA 3OM8A 4BYGA 2EYUA 3RSHA 3R7LA 3R40A 4CXMA 3UBTA 3GUHA 3BMQA 1UFOA 2PEZA 4BZZA 3NMUF 3I92A 1A82A 4MJLA 2HV8A 4LK2A 2NUPB 4DV2B 2P0EA 1I80A 5DM60 5SV2A 4IQ8A 3USZA 1SWWA 4CEHB 3RSGA 1RYEA 4MWGA 2X2EA 3FFAA 4MV1A 3T38A 3L8HA 2C84A 2Z2YA 1U6IA 3BN3A 4IJMA 4IXWA 3LVRE 2IJGX 5F77A 3GVPA 4NF2A 2B4KA 1A76A 1I3OA 3RVJA 4CPDA 2QZPA 3ZHTA 4LYEA 4KFRA 2BR5A 4KR3A 1TUGA 4ZOLB 1W93A 3CZMA 2FMTA 4QYMA 5I4CA 1VB5A 4GX0A 2V7EA 3LUPA 3QKSA 4FXOA 1L8AA 2Q2QA 3LHIA 5HFJA 1G19A 2K87A 3GL9A 2QT9A 2ZTGA 3IDFA 2C83A 3IUMA 2HFJA 4H7PA 3WRXC 3MJVA 4RM0A 1Z0IA 3PFKA 5LU8A 3A9UA 4J3NA 1XMQB 1N77A 2WFZA 1H42A 1WJGA 3WKCA 5HQTA 4CM6A 1ZKMA 1PGQA 3R20A 4XYMA 4B2IA 5JASA 3HCCA 1NL3A 4LKOA 3S29A 1NQVA 5DKFA 1JT2A 4F1JA 4EYSA 4R7GA 2BMDA 3LU1A 1PN3A 3HNRA 3K9GA 4UFNA 2QLFA 4TXLA 4U63A 4MGEA 1C3LA 3OE5A 1ZITA 5HA5A 1UDWA 1UBMS 1UZUA 3BH7A 4UATA 3ELDA 4L28A 3QPWA 4XM1A 1WHTB 4H7DA 1N3LA 2ILTA 2PLRA 1W581 2B8WA 1QH1A 2R96A 4MINA 4NNOA 1QO9A 2P4HX 2QORA 1YQQA 1V8OA 2G6BA 3HKBA 5J5AA 2BTEA 3R3JA 5K99A 3GEEA 4H7HA 4M1OA 5GWXA 4GWLA 5HJ2A 4ZI7F 5L8VA 3MTEA 3S28A 3EQ9A 2H5EA 4M9CA 2GPNA 1B0UA 2JIOA 3GGJA 1JZSA 4AX4A 1GV1A 1NJGA 1NC1A 1Z2AA 3QXJA 2HI0A 1S8FA 4BRZA 2VP4A 3V7UA 1XZ8A 1M6VA 1QAQA 4ILKA 4E11A 1NBEA 2VSYA 4PXYA 1CS0A 3HUEA 2JJ1A 5LMUB 2AEJA 4LX8A 2ADFA 3HCBA 1K6IA 4O2AB 3RC9A 2FGJA 4KN5A 3TNLA 1L7PA 3TQHA 5ALXA 2ZRNA 4IVRA 1FB5A 2BGMA 1L5NA 4BTLA 5BV7A 2ZGVA 1TA0A 3EIXA 3FHLA 3LZDA 5AT1A 2PGDA 1AGPA 1ULAA 3G82C 4PTLA 1KC1A 4ZCPA 3CLTD 1S5PA 3QWAA 1GCIA 4MYDA 4W7HA 2GREA 3Q8KA 1IVYA 2A4KA 3NOXA 1TRHA 3W8EA 3R6JA 2P9CA 2QRZA 4HFJA 1TVKB 1AU9A 2A0YA 2IHUA 2O5VA 3VOSA 1QXSA 4FWIB 2UXDB 1C50A 2PUJA 1ADFA 2FOIA 4AU1A 1I6MA 2QYHA 1GZ4A 5J2UB 3WV4A 1SQ6A 3UGJA 4HL6A 2GXAA 4ED9A 5ES3A 4WL0A 1RADA 1ZRHA 1G4UR 2VJPA 2JFWA 4WNAA 4ZEXA 3OLYA 1TEZA 1OJ7A 4RZSA 6PFKA 1L7OA 2PS0A 4IH9A 1QQ6A 3JZMA 3NAGA 3EPPA 1WPQA 3DPUA 3IKVA 4MDYA 5C34B 1A8SA 3LRPA 3WSWA 5B5SA 3Q41A 4W8HA 4WBSA 4KJZA 1MBZA 4PRKA 4Z7OB 4QOFA 1CYDA 3WNZA 1M9NA 2OG2A 4V0MA 1K6EA 4D5GA 1MRSA 2LTAA 1I3LA 5A9SB 2I6FA 3R7BA 1ZG3A 3JU3A 2H9AA 1GQYA 2EQ5A 2WWGA 3MTDA 1C7IA 2XAUA 4KPUA 1QGOA 2QJTA 1B8PA 5DNDA 4GXNA 4A6XA 4REOA 3SLRA