1S0UA

Eif2gamma apo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
404
structure length
391
Chain Sequence
b'SQAEVNIGMVGHVDHGKTSLTKALTGVWTDRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPINIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
molecule tags Translation
source organism Methanocaldococcus jannaschii
publication title X-ray Structure of Translation Initiation Factor eIF2gamma: IMPLICATIONS FOR tRNA AND eIF2alpha BINDING.
pubmed doi rcsb
total genus 96
structure length 391
sequence length 404
ec nomenclature
pdb deposition date 2004-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s0uA01
3MHPA 3EASA 3U3MA 4ZIRA 1R0XA 1VHLA 1ZVQA 3OZWA 2FU5C 2Z5FA 4FMCF 1UEJA 3K09A 5DGXA 2MMGA 4KLNA 1Q86D 2ZRBA 2ZS9A 4PO8A 1OB5A 2QNRA 2AXPA 5FOSA 5JWHA 2PZFA 4PC7A 5CIQA 3TR5A 2YJTD 1XMVA 1Z8FA 2NO7A 2MSCB 2I1VB 3OF5A 2EFEB 2IYTA 4I1SA 1R0YA 1U99A 3K09C 3T61A 2GESA 1ZM4A 3UMSA 4BWYA 2GXUA 1NBMA 1XTRA 3LXXA 1E2KA 1W5TA 3Q5DA 1Z0KA 1LV7A 1XCMA 4W9MC 3ND9A 2VSFA 1FW6A 3PJRA 4HSEA 1KRHA 3N2EA 2ZYTX 2YC2C 4QM7A 5J40A 2YOFA 3ZC3A 3K0SA 2J5XA 3NG1A 5KSYA 1A8PA 1RFLA 4DLWA 1MRSA 1ZJ6A 4MYTA 2VL7A 3NHAA 3CIOA 1JECA 4OQLA 1MRNA 2QTVB 2OXRA 3S1AA 1N2CE 2I1QA 2FDCA 4AK9A 1ZNYA 2EU8A 2ORVA 1YZTA 2QG6A 2ZI6A 1S96A 3RS2A 4B3FX 3LBIA 2XTMA 2RKOA 1R7RA 3TAUA 3TE6A 1AA9A 1NKSA 1DTSA 3AP1A 3BXZA 3KQHA 1XE1A 1M90D 4P33A 3DHWC 5DN6D 3CPWB 4CF7A 1YZNA 1E2FA 1UF9A 3IQXA 3LWNA 3LO8A 5AR1A 3PENA 1YJWB 2B8TA 3BRWD 3HYTA 4TSFD 3VKGA 1LY1A 1B23P 1WP9A 3IILA 4JLNA 2P5TB 3D6TB 4V0OA 5M04A 4AIIA 3B1VA 5HCNA 4JKYA 1HURA 2V7QD 2ZRDA 1RE0A 5IRCD 1XMJA 4R98A 5EP4A 1T91A 2Q9AA 5EP2A 2O8FB 4M1MA 4R71A 4CVNA 2BN4A 2D62A 2GDJA 3WP1B 3NDBB 4GL2A 4Q18A 4G5SA 3UMRA 4NL4H 4G5GA 2D2FA 2QENA 3KB1A 1K6MA 4KODA 5FA6A 1YZGA 4JLDA 4EQ6A 1VQ5B 2RGEA 2HCJB 4HAXA 4EKDA 5F9HA 2GF0A 3MJRA 4IOLA 2AD1A 2V1UA 1NJID 1QHYA 2HF9A 4HDQB 4M22A 3UWOA 4C0LA 2ZS7A 2YOGA 5CLQA 4AG6A 2X2EA 5FTLA 2QA5A 3Q7QA 2OM2A 2R6AA 2VPPA 1IN7A 4LY6A 3SN6A 1XPOA 2ZITA 3QF4B 3OJWA 4NMMA 4NYJQ 4MA4A 2UKDA 1X1RA 2A7QA 3I3SR 1NG1A 2IYRA 3FVQA 3K0AB 3MJHA 5H1YA 2YKGA 1WCV1 3ASYA 5DHAA 1PVOA 5EMNA 1OGJA 1OXVA 2CBZA 4RCZA 4JJKA 5GJBA 4BFVA 4PANA 4CEIB 1XPUA 1KDRA 3P20A 2ZJ5A 1OT3A 2GWHA 3A1WA 5BYKA 4PC6A 2IYUA 2OUKA 2R6HA 3KJIA 3M4YA 4FCTA 4YXWD 2GA8A 2JATA 1VQMB 1KSFX 1HQYE 1L4UA 2KSQA 4LSGA 3KB2A 3FOZA 5GADl 4NYMQ 4M1SA 4OQFA 3QKSA 2CL6X 4D4MA 2V55B 3SE0A 4B2LA 2OHFA 4DUGA 1S72B 4DDUA 3WBKA 4J0QA 1NMYA 4TMWA 2FZLA 2HMAA 3BK7A 5JMTA 1E9SA 3CRW1 2VH5R 2ZSFA 3EG5A 2BM1A 1S9HA 2OE2A 3W6OA 4ITRC 4IOJA 3VR6A 2UVQA 2R8RA 2J45A 3SJAA 2AK3A 2O0KA 3PUYA 1X86B 3EWSA 1XD9A 3AF3A 4DQKA 4I4LA 4AKEA 1U8AA 2C9OA 4OK6A 2P67A 3BFVA 3Q5EA 3CM0A 5GJCA 3GJ5A 4MYUA 5TB5A 3SNHA 1KO8A 1YR8A 5FBQB 1MH1A 2PLFA 5FOXA 4BFXA 3MMPA 3L0OA 4DWJA 2EFHB 4KFRA 3WP0A 5KTYA 4AKHA 3MSXA 3PV0A 3THYA 1TU4A 1W2GA 1CIPA 4ZGNB 2A3RA 1S0UA 1AGRA 1OHHA 1US8A 3EPKA 1SXJB 2QGZA 2FA9A 1MO4A 3ZZUA 4LJ9A 4DLVA 1NRJB 3I5YA 2OESA 3JQRA 2REBA 3ZVLA 2VBCA 2H17A 2NZ8A 1TAGA 4A6XA 5JHHB 2WKQA 2XNDA 4MKHA 3T12A 3ADBA 2P5SA 1E1QA 1X8JA 1Z08A 3FMIA 4B3DA 2ZJBA 3GFPA 4CEJA 1YZQA 4B34A 5AJZA 4IDOA 5J4VA 4Q9HA 3FHTA 3I92A 1ZNXA 3ZZ0A 2RC5A 2BDTA 3K70C 3VO2A 1DPFA 2ZJAA 1S9DA 1Z6AA 4UJ5A 5FOWA 1EFHA 1R5NA 1OIXA 2DFNA 2F3RA 4V02A 4M1WA 2NPIA 4DT1B 721PA 4QHYA 1NL3A 1N0WA 1DEKA 5DHFA 1JXMA 4ZCLA 1W4CA 1CR1A 2QTFA 2BJVA 1Z29A 1XPRA 2VNHA 4RD4A 1QHGA 3I32A 2R44A 2CCKA 1EX6A 4DQLA 2GJ8A 1KIMA 2X8AA 4LHZA 2O5VA 3W8RA 1YJ5A 2ANCA 2R9VA 4M1TA 1E2QA 2OFWA 4JSYA 4PXAA 3VX4A 1N0VC 1U81A 5EP3A 4EPVA 2AL7A 2H8KA 4JYCA 1QVGB 1T8UA 3FHCB 3NBFA 1Z63A 2P2LA 1K8AD 1E9CA 1E0KA 2GVZC 2GXSA 4KFTA 3A6PC 2R6DA 1UBCA 4LJ6A 3CRVA 3GJ3A 4Q9IA 821PA 1CS4C 5FL7D 1R0ZA 4LJAA 3K9HA 2C99A 2QEQA 2V6IA 3MD0A 3KXIA 2YNMA 3B82A 2VNJA 4O2RA 3RRYA 3WYGA 3RHFA 1W4RA 3WMGA 3QFRA 2C5LA 1L4YA 1OFHA 4LBYA 2VO1A 4XVQA 4TYQA 2QMEA 4MDFA 4KCGA 3GLIE 1TUEA 5FI0B 1XJQA 4OJQA 2QZ4A 3CUEF 3MWKA 2WJVA 5IK2D 1TADA 1KDOA 3JZAA 1Q3HA 2C95A 4ACAA 1C4OA 5HTKA 4L9SA 1NLYA 1H8HD 2OTJB 3OEHA 1E63A 1D9XA 4KHZA 4MKIA 1UDXA 5K8LA 1W46A 4HB2A 1JEEA 1Z47A 1VCNA 1DAMA 3UG6A 4PAQA 4AWXA 1B2RA 1II0A 2DR3A 3BFXA 1W5SA 3NC1C 1TEVA 4Q4AB 4M9QA 1DG1G 1OFIA 3HWSA 2I4IA 3U2QA 3DM9B 1UM8A 3ASZA 3NIBA 3WNCA 3QXSA 3RSOA 4C30A 4A2QA 2WMOB 1UADA 2ZRFA 2IBMA 4A36A 1Q7YD 3BB4A 4P4SB 2WJIA 2JLUA 3PIRA 4GZLA 3L2OB 4P3YA 1N5JA 1QZXA 1IY2A 4YQFA 3SQWA 4XJXA 3ZVNA 3EZ9A 1Z06A 3BE4A 3E5HA 3Q9LA 4W7SA 3DPUA 4A8JB 4BUJA 4IFEA 3O8CA 1EWQA 5CK5A 4DDTA 1JALA 3DO6A 2J7PA 4GSYA 4ESHA 2OK8A 1Q0UA 3SBEA 3AVVA 2PBRA 3OESA 4EJSA 2ZVPX 5CM9C 4GNKA 1P4SA 5FTNA 1A4RA 3QNUA 2IYSA 3ZIAD 3TVTA 2QAGB 2WSSD 2IW3A 2EFDB 3K9LA 4ARZB 1TPZA 4KAXA 2D4HA 4E03A 5AWFC 1SXJD 2ZUCA 4YALA 4EJSC 1HV8A 3I73A 5GJWC 1GZSA 3HDTA 3QBTA 4QBFA 1RRCA 1RKBA 2YWGA 2DPXA 2I3BA 3FWYA 4KXFB 3LVBA 3AH8A 4MRNA 4OK3A 1HT2E 1COWD 1G20E 2BIFA 3QFTA 2F1HA 3AUXA 3E1SA 3U44A 3CWZA 2B92A 3R8CA 4QFMA 4B71A 4LI0A 4RFSA 5GV7A 2D7DA 2KI5A 4QL3A 4I99A 1G3RA 1S2MA 4TLAA 2JASA 1QDEA 4JT2A 4XWAA 4RD3A 2N46A 3ADDA 1E4YA 1W1WA 1WB9A 2FPMA 2EFCB 1NSTA 1W2HA 5TDHA 3T06B 1RW4A 1L8QA 4M9XA 1XEWY 4B3BA 2Z43A 3NBZC 4IXNA 5EE5B 4NH0A 1AGPA 1G16A 4TWZA 4RZ3A 3UIEA 4HE6A 2GVDC 3D8BA 2H57A 1LVGA 3WYFA 5HXBA 2G0TA 4E07A 1KO5A 1OV4A 1U9IC 3SHWA 3QG5A 1KJWA 2IEZA 3GJ0A 2PT7A 4OYHA 3I8SA 4KFSA 3X1WA 4RY2A 2PX3A 1YHQB 1ZUHA 1VG1A 4DKXA 4WVFA 3LXRA 1KMHB 5AJXA 1MV5A 4UAJA 5EQTA 2DB3A 3VMFA 5J5CA 1QHHB 1Z0IA 2JIZA 4CEIA 4CZ2A 1Z07A 1JJ2B 5JSZB 3PUZA 4D2IA 1Q82D 1E2IA 1ZM3A 4WZAE 5L8VA 4X8LA 2GILA 1XJCA 1W36C 3GLIA 2BMFA 4XTCS 2A5FA 2N1BA 5HE8A 3BFKA 5EXSA 3QEJA 3VHLB 1KI2A 2G88A 5JRJA 4ZDWA 2BHRA 3U3RA 3TH5A 2ZVQX 4DLTA 4L4UA 3CRRA 2BKEA 4WIAA 3CW2A 1SVWA 3W8NA 1X8KA 3LVRE 1QUFA 3J81k 4QGAA 5B64A 4Q1CA 2BKUA 1FPMA 3I1FA 5JEDA 2A5DA 1OW3B 1T0HB 2JAQA 1CR2A 2CNDA 1OXXK 3ZLJA 3FKSD 1AQUA 2IL1A 3LO5A 2R65A 3HJNA 1SKYB 2OV2A 3H84A 2FPKA 4XD7D 2QBYB 2NMVA 4RD1A 2ATXA 3T5GA 1T5LA 1TF5A 3H2YA 1OKKA 3KJEA 1KGDA 2VQSA 2WWFA 2V1XA 3H0KA 3H1TA 2DBYA 5CYOA 1XD8A 2BWJA 1V43A 1YR9A 4HAWA 3GLGA 5D3MA 2FSGA 4YMSA 2QQEA 5C4GB 1T4GA 1NBME 3L8ZA 1SZPA 3C8UA 1J7KA 1XZQA 4B48A 3B1YA 2VTKA 2D2EA 4HLCA 1YZUA 2YINC 4OHZA 2ZJZA 3A4LA 4B4DA 3GLHA 1EGAA 4ZDIA 4C2UA 4NP6A 1D2EA 1EFUA 2ERXA 4I1UA 4ON9A 3X1DA 3BC1A 4DIDA 3B1WA 2CDNA 2QDXA 3BIFA 1Q22A 2ZJYA 1OH7A 4HI0E 3RNLA 3F8TA 5IHPA 1BMFD 1NLZA 1WRBA 1GO2A 2BVNA 4DXAA 1U8YA 3EA5A 1P3JA 1E9DA 4DZZA 4TLDA 5KDOA 2CVHA 4C0SA 1I4TD 3IBYA 3KX2A 3V76A 3KDSE 4ZCIA 2DERA 3C14C 3L8YA 4TZ6A 2NO6A 4HYYA 2UZ3A 3CRQA 2PJRA 1VQ8B 4Z1MA 3EIEA 1UEIA 3B2EA 2F6RA 3SS8A 3I5XA 4MQBA 3DKPA 5KO2A 4Q03A 2IUSA 1RRGA 3GJ4A 1OH5A 1FFHA 1JR3E 2CRVA 3WNBA 2JA1A 1LF0A 2F1RA 1PV4A 1U8ZA 2KBFA 3ZYCA 3KUDA 2MSDB 3R9WA 1DO0A 3GEIA 3IKJA 2WHXA 3I55B 1MO3A 3AVYA 2FFHA 2CHQA 4AD8A 2RMKA 1NLFA 4KSBA 4Q4HA 2ZROA 4AYWA 3LQQA 3GLFB 3KKQA 1T3SA 2F43B 4JLVA 4BASA 4U5XA 5KU1A 2ZM5A 2ORIA 4NCIA 1E64A 3CO5A 1DAEA 3GLHE 5FH9A 1Y3AA 2CNWA 3AVOA 2BPOA 3U3JA 3A8TA 4TL8A 1E96A 1XWIA 3K9GA 4FWIB 5DYGA 1C1YA 5KNDA 4JL5A 4MRSA 2OAQ1 2Q9BA 4Q19A 1DDGA 2QI9C 1U90A 1KC8D 4YLGA 2VYQA 2YV5A 4UNRA 1GM5A 3N2IA 4FINA 2GETA 4HEJA 4Q9LA 1OH6A 2ZETA 4IFBA 3LLMA 5HKKA 1HE8B 1IN6A 1XCPA 4MH0R 2QQ0A 2X77A 3EZ6A 1T0JB 2VNIA 1K8RA 4EPWA 1KI6A 1WA5A 1SVSA 1DVRA 5L3QB 3OAAA 1CNEA 1FTSA 1AKYA 3IPXA 4Q01A 2H5EA 4PZLA 4AC9A 3A58B 2FSHA 2J0QA 2IHBA 4LV5B 2RHDA 2CLDX 1GAJA 5CDFE 3B7GA 1GUAA 5HCIA 3THWA 3OE7D 2VLIA 3ZZTA 4RZUA 3TQCA 4R9UC 3QKRA 3IBGA 1GR1A 1ZNZA 1AK2A 1G3UA 1W0KD 4HUQA 1OF1A 1KHTA 1P73A 2BBTA 2EYUA 3CX6A 4V0LA 4H9GA 2OBMA 2QMHA 5H59A 4NBSA 2W6JD 4ZIRB 4CDGA 4XVUA 3CPEA 1XMSA 3H4MA 1J9ZA 2ZYVX 5E3HA 3MCAA 1XXHA 3F5FA 2O8BB 1R8QA 4YDSA 1ZC4A 4PO1A 4E22A 2IYZA 4CIDA 1HA3A 2KB0A 2N42A 3CX8A 2HLDD 3CCUB 3GQBA 2F7SA 2GCOA 4GDFA 1S1MA 3FE2A 1VQ7B 5L3SB 3L0PA 1FNNA 2AKYA 4U02A 4K46A 1UKEA 2WAYA 3T1QA 2XXAA 2ASEA 5JEEA 3QENA 4F38A 1J8YF 3E70C 4LJ4A 3Q72A 3TUZC 4FMDB 4UXJA 4DB2A 1DADA 2CNWD 1I7PA 2CHGA 3LV8A 2Q3MA 4NCKA 1ZAKA 2ZRLA 4Q7MB 1CJUC 2QRNA 4TYNA 1OXTA 2HXYA 3ONWA 3E1YE 3UG7A 4UJ3A 5AUQA 1G9XA 1G4AE 2OXCA 1G64A 1Y63A 2JDIA 3IIKA 4M9SA 4FCVA 3VR1A 1Z0FA 2GJ9A 4ZKDA 1EFTA 2BEJA 3GMTA 4PTLA 4BEBA 2PH1A 4F4IA 3CZPA 2FG5A 4JLOA 1ESMA 2RC6A 1Q57A 2J59A 1XDBA 3CC7B 2ZIAA 4LHXA 3AVUA 1TX4B 3T35A 3LFUA 2JCSA 1XTJA 2R62A 4LUCA 1EP3B 2VA8A 2JJ2A 4Q1DA 2ZRPA 3UMFA 1G7SA 1E6CA 1G18A 1QF9A 2GBLA 3UATA 1YZKA 1G291 3KZ1E 4DJTA 2WBLC 4WA7A 4BLTA 2X1VA 4AYXA 1QG0A 4PHGA 4IOKA 1GDDA 1IHUA 1VYVA 2PLRA 4MKFA 5HKKD 4RD0A 3A37A 3AGPA 3UANA 2IF2A 2KJQA 1SKYE 3PITA 2J46A 4Q00A 1VG8A 1G41A 2J87A 2NG1A 1TQ4A 3PEVA 4FW9A 1D5CA 2XGJA 2REXB 5IK2A 5H70A 5CIWA 3C5CA 4BLPA 2ZYUX 4TLCA 5H8WA 4QJ4A 4JZKA 2AR7A 1VKJA 3KQLA 4A15A 4B43A 2FMXA 3B60A 4B3XA 1T3HA 5FPHA 3OHMA 3OIVA 3GLGE 4F7WA 4PQFA 5G3YA 5DH9A 2QRZA 2RGCA 5J4YA 1E1QD 4C0KA 4NKRA 3PUWA 5AN9A 3TNFA 1XJ0A 1N0UA 2H92A 2DYKA 2IXGA 3K1JA 3TW8B 1NJFA 3VO1A 2QTZA 1A2BA 1QG4A 2IUTA 2JLQA 2LKCA 2REOA 3LLUA 5G41A 3O8DA 1MOZA 1O87A 3X1YA 3N5CA 1E2DA 4MRRA 3W2IA 2CHVA 1YRBA 1IB0A 3WRXC 1P2UA 2OZEA 1VQPB 1LTQA 5J4KA 3KKPA 6Q21A 1VQKB 3OW2B 2HYIC 2XNSA 2FGJA 2HLDA 3GP8A 1T3LA 1KI4A 1UAAA 2JLVA 1DG3A 3O47A 5LD2B 1G8GA 2ZRMA 3AF4A 3RRMA 2FOLA 1KSGA 2WICA 2ZYWX 1VQ9B 1NY5A 4G5OA 1KI3A 4GI7A 4Q02A 1N5KA 2OFXA 1NN1A 3R9IA 2ORWA 3AUYA 1VHTA 4U7DA 4MGZR 1EP2B 4IXMA 2Z4RA 2OEPA 1VQOB 2ZI5A 4F92B 2V9PA 5JI3E 1FP6A 2O8EA 4IDPA 4Q1BA 4X8OA 4EPRA 2RCNA 3W6NA 2ZU6A 2OO7A 4A92A 4DC9A 4F91B 4XVRA 1YHNA 3L82B 4ZDJA 1VG9B 1EG7A 3GLHB 3RC3A 4C9BA 3K70D 1W0JD 3U5ZB 1KAGA 3RAPR 1BS1A 2BCJQ 4GOKA 4URXR 1NMZA 5AJVB 2OCBA 1M34E 2BBOA 2FF7A 2ZSEA 4BFYA 1XF9A 2LWIA 2BMDA 3GJ6A 1GL7A 2ODWA 4V0NA 4KSCA 3FMOB 2OLJA 1UMKA 4DLXA 4LJ7A 5EUMA 1H8ED 2QY9A 3B1XA 3RDPA 3THYB 3KTAB 5EXTA 4US0R 4LYHA 2ANBA 1US8B 1T5IA 3M1IA 1EFRA 1QRAA 1QH0A 1E0JA 4B6EA 3KQNA 5FPKA 4XIGS 4JLAA 4ASUD 4TN1A 4BFTA 1W36D 1SQ5A 3NXSA 3ZQ6A 2SHKA 4LYAA 1ZMXA 3FKQA 1DAIA 3B9PA 1KK3A 3QFSA 5LB2A 3VKHA 1H65A 3X2SA 1GSIA 5FBRB 1YITB 2J7KA 3SFVA 2IF0A 1IN8A 4DSTA 3CMEB 1VYTA 1Z0DA 2XTNA 1UBFA 3EC2A 4D0GA 2Q21A 4DCTA 2NTYC 1GNRA 1TUIA 1YE8A 1J8MF 5J4LA 1GILA 2JLRA 1E2EA 4US2R 3ZBUA 1CEEA 3B6EA 4TL6A 1VIYA 2CLCX 4YHBA 3G0HA 1AS3A 1ZCBA 3THOA 1V5WA 4BRUA 1TVCA 3LX8A 3MWJA 2CXXA 4DT1A 1E0AA 2OBLA 1FRNA 2ZSAA 3K0FA 3WMFA 4UNNA 1P2TA 1KI1A 5KSOA 3IUYA 4AF7A 2CJWA 2G1JA 4P4TA 2XB2A 1N6OA 2OCPA 4WZ6A 1Q1EA 3U4QB 2FN4A 4EPTA 1F48A 4LGMA 3ECCA 1ZP6A 4EFMA 4O0MA 4L16A 2BMJA 1FL9A 5FI1B 4ZGQB 4XSHA 4Y7CA 1G6OA 1SVOA 5A5GA 2W2VA 3TGPA 4QJ5A 1R5OA 2FE4A 4IRUB 3EAQA 1EWYA 5L3QA 3TR0A 2EW1A 3QKUA 2IWHA 2C9YA 4C4PA 1CULC 2ZE5A 1FDRA 4D4LA 1E99A 1SXJA 3HYRA 2XEXA 1P9RA 4PQRA 1T9HA 4BGDA 1M8PA 4YAWA 1WDTA 4DDWA 1VDZA 2OSBA 2O8DA 4TTQA 3W5IA 2QM8A 4Y9RA 2UZIR 1P6XA 2GZHA 2BJWA 3MGCA 2E87A 4I1OA 3NEJA 1H8EA 4KYUA 4MUBA 1KQSB 2GJSA 5DN6A 5P21A 3B85A 4CRWB 3AKYA 5KPJA 4HDOB 1JNYA 1IN5A 1G7RA 2FFAA 5BYJA 3RRNA 2QPOA 4MYCA 5JECA 2VP2A 1SM4A 3W5HA 4D26A 2PEZA 2J3EA 4L5BA 2V54A 4WQMA 3ZBTA 1UBGA 2ODEA 3G71B 1CNFA 2EYQA 1XD2B 2RAPA 2ODNA 3AVPA 4NYMR 1G3IA 4IOMA 1I4DD 3AP3A 4FIDA 3OE7A 4UXHA 5GVRA 3MRSA 4GBMA 2GCOB 3L43A 4CGZA 1J70A 1NSFA 2QA4B 1AZTA 3AP2A 3GEHA 1KI7A 1DAHA 1KMQA 1P72A 2A5JA 3W2EA 2FPLA 2B5OA 2XX3A 5FL7A 4PZYA 5KPDA 3KUCA 2E9SA 4OI4A 5CYPA 5GJVC 3VTKA 3N70A 4HAVA 4RSGA 3U60B 4S2EA 2XTZA 5LBIA 3REFA 2XB4A 4DBLC 1Q12A 2QE7D 3WY9A 2G83A 2HF8A 3NH9A 4LWZA 3R8FA 4NYJR 1Q1ZA 4QC2A 5LD2C 1QBKC 4NU0A 1W4AA 4P4SA 5G53C 2J9RA 4UNPA 1WE2A 3SU8A 4K81B 1E9BA 2CL7X 4RD2A 1FUKA 2WOJA 3CR7A 4DSNA 5EE1A 3IEVA 1TTTA 2GF9A 5DI3B 4B35A 5JS7A 1SXJE 1ZBDA 2LCFA 1IN4A 2QPAA 4ABYA 1AN0A 1E94E 4FCWA 1Q44A 4IVPA 1ZD1A 5FOUA 2YYZA 1OGIA 4Q4JA 2QAGA 1XU4A 3OAAD 1JI0A 4ARZA 1Q1BA 2XZPA 4AURA 4HDCA 3CWQA 1IAQA 4HB3A 3TJZA 2W83A 1EX7A 2KBEA 2QMOA 4HLUA 3IO5A 5FPTA 4DCUA 5ELXA 1XZPA 2GXAA 1GRNA 1FX0A 1ZD8A 2RH5A 4V0ME 4G1VA 2PIAA 3HU3A 1NMXA 2OK7A 1GVNB 1E9EA 4JLBA 4G3XA 2A78A 2ZAMA 4MGIR 1NIPA 5FUVA 1L2TA 2OBNA 1JR3A 1SHKA 1AS0A 3A1SA 3VHXA 4DSUA 3P27A 3B8HA 3U44B 1BYUA 1JQLB 4LC0A 2HUPA 1KK1A 4FMDF 2GPJA 5HE9A 4FK8A 4HZUB 5BN4A 1WBBA 4PR0A 3QG1A 4PQYA 1E98A 2W0MA 2XOKD 4TQ9A 3UPUA 2GJKA 3K53A 4BPRA 4UKDA 1E2JA 1SVKA 3CNLA 2AFIE 3FYHA 4X8HA 4C0AC 4EFNA 2O8CB 3CB4A 4JYBA 4PC2A 2V7QA 4D0NA 4YAFA 4GOJA 2OFOA 3GJ7A 3HU2A 3B13B 3CD6B 2PX0A 1QUEA 1GAWA 3TKLA 4TYWA 5FUYA 3OEHD 2WTUA 3CXCB 3QPWA 4E5UA 4TTPA 3LDAA 2YOHA 1A7JA 3W5UA 2R6CA 4FWTA 4TQAA 4M53A 2ZAOA 3K8YA 4ZO4A 3BGWA 1OXSC 2VF7A 3VR2A 3U3OA 4BFZA 3QUSA 2WVJA 3RVBA 3LW8A 1F3OA 1SGWA 2ZJ8A 5AJWA 3O8RA 2G6BA 3QPVA 4TZ0A 1EFCA 5TY0A 2WOOA 2CVFA 3AKDA 3DM5A 3GLIB 4DLSA 1E3MA 2WKPA 1AS2A 2G3YA 4MGYR 4NDZA 3BB1A 1M1YE 1SULA 3FGNA 4GPTA 1PJRA 4WXRA 3LAWA 5JCZA 1N5LA 1JR6A 4QGHA 1P2VA 2WJHA 4LYJA 5AK0A 1VPLA 5TARA 2P6UA 3FPKA 3DOEA 3SC3A 2D74A 1I2DA 2IX3A 3L0SA 4G5RA 3AKCA 3CPJB 4YMUA 3NDPA 3PEUA 2Q0HA 1MT0A 3MLEA 5JI2E 4XSGA 4JLPA 2BGJA 4C0BA 4D80A 3E20A 4B47A 4LHYA 4MYHA 3THXB 4IEEA 1TF2A 1UDWA 3KKOA 4PHTA 5KUTA 1L7VC 4LV6A 1W0JA 5H5JA 3CCQB 5EZ6B 3WBJA 1AJEA 4XD7A 4DLRA 3HU1A 1U98A 2QBYA 3U6KA 3SDZA 1BKDR 3FKSA 2BC9A 4KFUA 3CCLB 2OT3B 1KI9A 1E2PA 5KSPA 1LB1B 2QORA 4HLUC 3TQFA 2WJJA 3W5JA 3CX7A 4DCSA 3FTQA 2IYXA 3RWOA 5FBWB 4MGKR 5E7JA 3RSLA 1F2TB 5EZ5A 3EPLA 1ZRHA 4LBVA 2CCJA 2DHRA 2PEYA 2VP6A 4URYR 5JJIA 1M7HA 5E7MA 4EQ6B 3EW9A 2VP5A 2AD5A 1JAIA 1N5IA 2EFGA 1HQCA 1IOZA 4IDHA 4A4DA 1CLUA 3QXJA 1CKEA 3VX3A 4GMDA 1GITA 4PZZA 4F4CA 4NCJA 3A1TA 4PPNA 4LHWA 2FEMA 1GL9B 5FTJA 1N6LA 5BQ5A 2D7CA 5TMPA 2J0UB 1W49A 3H86A 3IQWA 1KZ7B 2TMKA 1ZCAA 4IHQA 4NHOA 4JIMA 2QU8A 2BCGY 1ANKA 1II8B 1JPJA 3CCSB 3LBNA 4CT4B 1D8TA 1JR3D 2C2HA 3JQQA 4PC1A 1E9FA 3BH0A 1DBSA 1KTVA 1EWRA 1ZUNB 1XXHE 2VP0A 1E2GA 2GZDA 1XMIA 2NO9A 3F0TA 3I8XA 4HATA 3R7WA 5EUQB 1QVRA 3CNNA 3NKVA 1Q3TA 5KDLA 4ACBA 4C7OB 2P65A 2WWGA 2A30A 4JLMA 1R8SA 3IDQA 4A2PA 3VU9B 5BXQC 1NF3A 4WW0A 4OI1A 1IQPA 3PG5A 4TMXA 4U9UA 1OXUA 3AVQA 4B76A 3UXMA 4B2IA 1VYUA 5EE9A 3EIHA 2CMKA 5KOYA 4QOSA 4BQSA 4LYFA 4PSAA 4RZXA 3P4YA 1QG2A 4Z54A 3BORA 2ZUDA 1VCIA 1LS1A 4Q66C 5SZHB 1DAGA 3U4QA 1WMSA 4B3GA 4C0JA 4JBYA 2DFKB 5DNYB 1GAQA 1G4UR 1Q21A 4A0FA 2H16A 4PSVA 1CRQA 2ZRJA 5DYIA 1KD1D 2V8OA 3VNUA 3FFAA 5JWOA 2QE7A 2X19A 4PFSA 1NN5A 3CCJB 2IYWA 5KSWB 4OK5A 4D25A 3LA6A 2RHMA 1RRFA 4HUTA 1YKSA 1KY2A 2A9KA 2HT6A 3QOFA 3TLXA 5BN3A 3EPHA 3V9PA 1FOEB 3U7GA 4B2PA 1FQJA 3FFBA 1OE0A 4LOAA 1NDHA 1LS6A 1A82A 1JA0A 4JL8A 2GK6A 2WZQA 4NCNA 3Q8XB 5BN5A 5JFGA 1CF4A 1F60A 2NO0A 3IGFA 1W4BA 1E1RA 4E09A 4RKFA 1ZUIA 2GNOA 3K0AA 1TQDA 2IS2A 3REGA 1YZLA 3FMFA 3TVDA 2A5YB 3VFDA 1GKYA 2AK2A 1ZYUA 1FNBA 2ERYA 1PUJA 2OG2A 3AV0B 3EWAA 3QI2A 1JB1A 1GFIA 5C2JB 3LVQE 3CF0A 3CR8A 2YWHA 3OFND 3PEWA 1N6RA 2WWXA 3RABA 1ETUA 2W0SA 4V03A 5E7IA 4DEYA 2EQBA 1D6JA 5JJLA 3EZFA 4N0DA 3P1JA 2JJ8A 3GLFA 1XP8A 1IJFA 4W5WA 4YMVA 1F2UB 3LW7A 1VMAA 4Q4LA 4V0MA 3ZD7A 2W6JA 2V3CC 5H68A 2XSZA 3MFYA 2GKSA 1NY6A 4ERNA 1VG0B 4OJKA 2JIZD 3CBQA 1HE1C 4OQXA 1M6NA 2ZPTX 4IDQA 4OL0A 3FDIA 2ZANA 2VF8A 5HR5A 3K70B 4Q5IA 1P62B 5AUNB 4TMZA 1CJMA 4BFUA 4DRZA 1R4AA 5G3ZA 5JHGB 3PQCA 3ZS9A 4QBHA 2DFLA 1A1VA 3LH5A 1RZ3A 4JSTA 4XWOA 1KSJA 1D1NA 4DCVA 1JXOA 1XTIA 2IA5A 5LB4A 1M7BA 5KSZA 3GEEA 1OPXA 1A2KC 5BW8A 1KI6B 1R2QA 1R6BX 1AIPA 1N6KA 2ATVA 2GXQA 3NTUA 3W9YA 3DDCA 2IUUA 1YIJB 3EXAA 2C04A 3BS4A 3SJZA 1G8HA 3CLVA 3FHOA 2VNKA 4DCNA 2RGAA 3HPQA 2AWOA 1W87A 4M8NE 1SVIA 1W47A 1QX4A 1YU9A 5DISB 2WMNB 4G1BA 1Z6GA 1MO6A 2BBSA 2BEKA 4YMWA 3P26A 1GKIA 1KY3A 2MMCA 3QKRB 2VP9A 2ZRKA 4TYPA 4IW3B 1HUQA 3TW4A 2DEUA 2ZRCA 3WXMA 2OCYC 2JJ1A 2QSZA 3O8BA 4RVCA 2QM7A 3EARA 2CCGA 2ZEJA 4GZMA 3ZIAA 1GNQA 3IHWA 2DWQA 2GAAA 2W58A 1NVVR 4YDHB 5GV8A 1N8RD 1QVFB 1RJ9A 4YC7A 2O8CA 4RKEA 3CH5A 3WRYC 1P9WA 3W34A 1FUUA 4N1AA 3ICEA 1XEXA 1YR7A 2C78A 3T1TA 1VCOA 1XX6A 2ZE7A 2WIAA 1OKKD 3OFNA 2FV8A 1ZIPA 2QEXB 4KU4A 4EFLA 3ZVRA 1BO6A 2C96A 1Z6XA 3EC1A 1NIJA 1NVXQ 1KI8A 3I72A 4Z1MD 3IO3A 1RYHA 2B21A 3D3QA 3TIFA 4MUAA 5FOVA 3U7EB 4FI3C 3TUJC 4B74A 2WKRA 5E95A 4DUGD 4GOXA 2DWPA 3WHKA 2EWVA 4II7A 4PHHA 4ASUA 3CMAB 3CC2B 2JEOA 5B58C 3VR4A 1OB2A 2XSZD 1E2LA 4TT3D 2OTLB 2FNAA 2X2FA 3CCEB 4B75A 1UKZA 2O0HA 3KFVA 2CK3A 4MITA 4NPHA 4C0QC 1II9A 1IXSB 4JT4A 4PAOA 3GPLA 1CR0A 1DS6A 2ZI9A 3CRMA 1E0SA 2BV3A 1GWNA 2OCAA 2PZGA 2RGBA 4A82A 2J0SA 4OHYA 1W48A 4Y0AA 3VQTA 3RYTC 1BQEA 3CCVB 3NBXX 2IEYA 3QXHA 1GKUB 3WHLA 1BJKA 1XCGB 1JA1A 1OIVA 4DLZA 1W7AA 1JJVA 4QG7A 3EZ7A 4QXAA 4XTRA 2OLKA 2ZUBA 1FTNA 4EDHA 1HH4A 4D4KA 2A5GA 3R9XA 2QAGC 4D4JA 2WPDA 1S4QA 1TEXA 4ZV4A 1XBTA 2ZREA 3UKDA 3GCGA 5GVSA 4ESVA 4LJ8A 4AKIA 3K0CA 4LJYA 2HCBA 2CK3D 2Q3HA 1NVVQ 2IC5A 5K8TA 1SVLA 2PJZA 2VSOA 2E1RA 1YR6A 4P31A 4QGGA 5FOTA 1O3YA 5FBVB 4PPQA 2IYVA 4ZI2A 2JJ1D 2YC4C 5CK4A 3ADCA 2HEIA 4LX0A 2JLSA 3TSWA 2BM0A 3QPUA 4Q4AA 5JZVA 2BMEA 1QHIA 2VHJA 1OFUX 3Q3JB 2R6GA 3SR0A 1QHXA 3W90A 4EUNA 4QHTA 2XZLA 4URVR 4XH9B 1U0JA 3SHFA 5CITA 4Z51A 3ZS8A 4DHEA 4YXWA 2GJAA 4QBGB 2QL6A 1CRPA 2FSFA 1P9NA 1UJ2A 4PSKA 1DAFA 1P61B 3AF0A 1RRPA 4URZR 3SOPA 3TRFA 4BZXA 5JBQA 2J1LA 5B30A 2LKDA 3R7WB 4Q9KA 1OYYA 3RRZA 1KJYA 2PZEA 2XZOA 3FPAA 4QRHA 3RS4A 4PX9A 4MKGA 4JVNA 3MWYW 4M9ZA 4N3NA 3QVVA 5ANRB 2JLWA 2W2TA 4HZIA 1LFDB 3MWLA 3X1XA 4JVSB 4TTRA 1B0UA 1K5DA 2QMUA 1XEWX 3RWMB 2JJ2D 1I2MA 1UBEA 2GCPA 4KLZA 4TQUS 1X8LA 1PUIA 2B6HA 1CBUA 1N6PA 2NIPA 3EA0A 3HR7A 3LRPA 3T5DA 3S1AB 4L9WA 1DAKA 5FR1A 2FJUA 3WYAA 3EIQA 1CU1A 2GEVA 3G5UA 1DOAA 1MABA 3U3KA 4DIEA 1N6IA 1F5NA 3C7KA 4URWR 2FFQA 5FUXA 2CEAA 3JVVA 4A2WA 1IY0A 1CXZA 3QSYA 3B5JA 4H1UA 4RFSB 3RS0A 1Z0AA 2VHCA 4JVLA 4PPGA 3BH7A 2P0EA 4TLBA 1YJ9B 2D3WA 5JRZA 1EESA 1QGYA 1DE0A 3DMDA 1G5RA 1VTKA 1J99A 4HB4A 5KDDA 2O8EB 2O0JA 521PA 4A1FA 4LK2A 4MDEA 1OHHD 3EZ2A 2EVWX 4OHWA 4QM6A 1DELA 4IDNA 4UNQA 1VQLB 1PLKA 4Q7JB 3IIJA 3SYKA 3MUFA 3T15A 2FSIA 1HT1E 1OLOA 2PL3A 2IYQA 3I62A 1Z6TA 2W6IA 3G6EB 3DEFA 4MRVA 4B73A 3GLGB 3I4LA 3VAAA 1P75A 3KKNA 3PVSA 1Z22A 2PMDA 5F98A 1GIAA 2FEOA 2HJGA 3K0CC 3W6PA 3VR3A 1J90A 3MG9A 5JJKA 5EE0A 1KYIA 2AFHE 3FB4A 3TSOA 1Z83A 3C15C 1W34A 4OI0A 1QHHA 4RCYA 2ZSDA 3QEOA 1U94A 4JLKA 4Q1FA 5D3QA 1BX1A 1SHZA 3WNDA 1Z5ZA 2G77B 3ZD6A 1OYWA 4BLOA 1D9ZA 5SZIA 1I4LD 3ZDQA 1J2JA 3BERA 1XTKA 3KKMA 4M2LA 4JBXA 5AJYA 1VIAA 4JBWA 1KSHA 1NNEA 4URUR 1MO5A 1ZM2A 3U7FB 1PLJA 1NP6A 2QSYA 5TR9A 2XNCA 2RGXA 4HE5A 2F1IA 3CONA 1FNMA 3EPJA 1VCMA 3KFXA 4BZPA 2V6JA 2QAJA 1F2UA 1E1RD 121PA 1X1SA 1ZINA 4DLUA 5CJPA 4IVRA 4WOPA 3EX7C 1XD2A 4P6VF 5AUPB 3V4RA 1ZU4A 4NTZA 4BPBA 1CQXA 3NHBA 1H8HA 4HLDA 3U61B 1AMOA 4XWKA 2RB4A 3JVUA 4AG5A 4PC3A 2WM9B 3K0FB 2YWFA 3A4NA 4B6FA 5KHOC 1YRAA 1S1CA 2QP4A 2WV9A 2CJWB 1Q81D 2VHUA 1Z0JA 1QVAA 1NN0A 3QKSB 2O8FA 3G82C 3KJHA 5TVKA 1VQ4B 4KBFA 4A0RA 3QE0A 4LZZA 3BH6A 4OHVA 2ODBA 4LDJA 4QNRA 5J47A 5D3MB 2R6FA 3D31A 2JDID 5EXPA 1IBRA 3M0EA 2HV8A 5HPYB 3LD9A 4QGFA 4TMKA 4JVMA 4ZI3A 5BWMA 1FP7A 1G21E 4ZDKA 5C18A 2GEUA 3OIWA 1IJEA 4PGOA 4WXPA 4PO9A 2YVUA 2AX4A 2O8DB 2C03A 1HTWA 2ZI7A 3W3AA 2FZ4A 4AKGA 1JJ7A 1Z28A 2VYFA 2W2XA 2XNDD 4I1VA 5F9FA 5DIFA 2QUZA 4GFDA 3GFOA 1IXZA 1KKMA 1M7GA 1XTSA 2NZJA 2Q3FA 2BOVA 1G7CA 2F3TA 4FMCB 5EJEA 4B3CA 4U00A 4JLJA 4TMVA 3JQPA 3GFTA 3JZMA 4C43A 3L0IB 1ZIOA 5FBLB 1E32A 3OZVA 4UNSA 1CR4A 1RJ9B 4IVQA 4NCHA 2Y8EA 3UK6A 5K8IA 2WWWA 2F55A 4C0HA 4HUQB 1F20A 4IKEA 2IT1A 5C1BA 2DCUA 2QTLA 1KNXA 5EXXA 5LDDC 1XEXB 2K5UA 1R5BA 2IYYA 2VEDA 4Q47A 1GJRA 4LPKA 2BGIA 3AF2A 4CEJB 1X3SA 2V4ZA 1X6VA 1GG2A 1G8FA 2G1KA 2GRJA 3LNCA 3PUVA 3QY0A 3CCRB 1NKTA 4F93B 3NH6A 1E79D 4BLRA 3C4JA 3TMKA 5HZHA 2GQFA 4HAUA 3SYNA 4GMXA 4CEHA 1E4VA 2XAUA 1CP2A 3SJBA 2VZLA 1NVUQ 4DVGA 2J41A 1G17A 2YZ2A 1G8YA 3IPYA 3QKTA 5L3SA 3QIAA 4DB4A 4JL6A 2CE2X 3A4MA 1JPNA 1HYQA 3NEYA 4GT1A 4OQMA 4KO8A 2XXAB 1A5TA 5DI3A 3VR5A 4LC1A 1W44A 4ILEA 3KL4A 4UXIA 2CL0X 1QHNA 2ZSBA 4TL9A 4RD6A 3TUIC 2ZE8A 1BMFA 3AVWA 2QTHA 2NO1A 5CDFA 1FMLA 1G8PA 4Q4JB 5CJ2A 3FJOA 4Q21A 3RS5A 4EPXA 4RFVA 3SJCA 5B57C 4D82A 5AUOB 4TT3A 5C46F 1CJTC 1E79A 3DZDA 4ZCMA 4QHSA 2IYLD 4OKSA 2QP3A 5FPSA 1RYFA 1FX0B 1ZU5A 2JGNA 3K9NA 2VHTA 1DDIA 2F9LA 3THWB 2FH5B 2IS6A 3TBKA 3PUXA 4LV8B 2QROA 1GOTA 1VQ6B 1S3GA 1VECA 2IXFA 2ZRHA 3AEZA 3PCRB 4YAOA 1D2MA 1PLLA 2ZI4A 2H1LA 4AF6A 2WJYA 4Q1EA 1XEFA 1GRQA 2ZQ5A 1YQTA 2IWRA 1KO7A 3SFZA 5DSZA 2WWHA 3QE2A 3F3YA 4A0GA 2VRWA 2GK7A 1LNZA 3OIUA 3THXA 1XXHB 4R7ZA 3T1OA 1ZM7A 3C16C 3RANA 4G0NA 3ZQJA 4F4JA 2MSEB 3U6BA 1RIFA 2XITA 2Q6TA 4BLQA 3TK1A 5CB8A 3W2FA 1E9RA 1S8FA 4L15A 2ZR7A 1RPZA 2VHQA 4BECA 5EE3A 5LPNA 4Q48A 2P3SA 5IT5A 1TU3A 1ZW6A 1F2TA 2R2AA 2AN9A 1KZGB 2ZRGA 4BLSA 4W5JA 4WBSA 1NI3A 1KO4A 4JS0A 2G9NA 3AVXA 5K8UA 4A8JC 1EFRD 3BOSA 1OFTA 2HYDA 3CH4B 2F9MA 2WAXA 3K0EA 1GTVA 3BBPA 5A0FA 3PR1A 4B33A 5J4HA 1SKQA 1U9IA 2HXSA 2J0UA 1PZNA 5E4FA 3A36A 1XFAA 2OAP1 1GNPA 5TV2A 1E62A 1II8A 3DVLA 4A8JA 3KJGA 2Z83A 4LJ5A 2F1JA 2OILA 4KV9A 2WWIA 1IXRC 4M1KA 2ZXUA 4EJSB 2XNJA 3W5VA 2YWEA 2CE7A 1NN3A 1OJLA 3TSZA 1ELOA 5B2ZA 4EH1A 2PCLA 1KAOA 1MABB 2ZU0C 4A9AA 4C7OA 4UQOA 2ECKA 3CPHA 4M21A 4CT5A 1K5GA 2QT0A 5F3WB 4M1YA 1TL7C 1P5ZB 3VU9A 3ES9A 2O52A 2IS1A 4TMTA 4HLQB 1DO2A 4OBEA 2WPDD 1ZC3A 2Z4SA 1E2MA 2QT1A 1KJZA 3ZGXA 4LBWA 3NVAA 5CB6A 3CCMB 1WF3A 4BE7B 2ONKA 1KDPA 4FMBB 2GHIA 2DY1A 2RGGA 3OJXA 5FTKA 5FFMA 5UKDA 4Q7KA 1GRRA 1TNDA 4CYMA 3A1VA 3OZUA 2GZAA 1P60A 4PAMA 621PA 4P0TA 1SXJC 5SZKB 1EP1B 1KDTA 3B78A 3QFCA 3AVTA 2DETA 5DO9A 3KQKA 2KWIA 3VNVA 5JWRA 8OHMA 3P4XA 2HJVA 3KXKA 3PFIA 4NE2A 4EIWA 3VKWA 1KK0A 2D06A 1R0WA 2ZE6A 3IEUA 2C9CA 5SZJA 5EP1A 2B8WA 4DSOA 2J0VA 4OI2A 1H85A 2KE5A 2ZS8A 1R10A 2ZRIA 4LPSA 5DI9A 1QFZA 4PPFA 4Y9UA 3PXGA 4KBGA 1NJGA 4LRWA 3AQ4A 1U0LA 4POAA 3LY5A 4YONB 3G4SB 4G01B 4JMPA 3ZJYA 3IHLA 4DDVA 3T1VA 2X3UA 1W2BB 3FMPB 1OH8A 3LBHA 2AWNA 1BIFA 4LHVA 3SI7A 1KMHA 3SYLA 3UWKA 2QPTA 1ESNA 2GAOA 1Z3IX 2ZRNA 2BF4A 3ADKA 1T8TA 1M2OB 2JLXA 1NVWQ 4EPYA 3OEED 5CLLA 4G5QA 4Y0VA 1QFJA 3ZVMA 1GL6A 3I61A 3ICQB 4BRWA 1GVHA 1D2NA 4A6PA 4DEXA 3W3ZB 5FPYA 1GP2A 1KNQA 4K8OA 1FMJA 1N6HA 1UPTA 1G7TA 2BMWA 2PT5A 1KKLA 2P6RA 1XB2A 1COWA 1AZSC 1P2SA 5JCPA 1ONBA 5G40A 3SEAA 5A4JA 4AI6A 1JQJC 4RZ2A 1ZD9A 5KYKA 2BBWA 3V4FA 2WIBA 3QJYA 4O3MA 3HP1A 2GEDA 1N25A 1G6HA 3AGQA 4M4SA 1F6BA 1G1MA 4FN5A 3C5HA 3NBYC 3BJIC 5FTMA 421PA 2HT1A 1KO1A 1Z2CA 2VP4A 3WMEA 4NONA 5TXGA 2IK8A 4WAUA 1Q20A 221PA 3NC0C 4R2IA 2GTPA 2AHOA 1QFYA 2ZR0A 4IJMA 3AKEA 4K1XA 1YVDA 4D6PA 2GBLC 3CNOA 4O2LA 3QF7A 4KVAA 1UFQA 1KK2A 3D7MA 3HPRA 1HEIA 1IONA 4KYIB 3KTAA 3CF6R 4Q1AA 5F2EA 1HY3A 4F7DA 1MR3F 2NQ2C 3E2IA 1FRQA 2P6NA 3X1ZA 3B9QA 1H42A 3GD7A 4C2TA 1LW7A 4US1R 3TAHA 1RVDA 5JSZA 1TF7A 3RS7A 2QGNA 3QF4A 1CJVC 4QNMA 3ETLA 3M6AA 2WSMA 4KI0A 1LF5A 3DZ8A 1AM4D 4OQNA 4HB0A 4W5HA 4N0EA 2L0XA 2A2ZA 2JLZA 1U2RA 4I81A 1MKYA 4TLEA 1OIWA 1FQKA 2Z0MA 2JLYA 1CJKC 2BSAA 4OHXA 4QKQA 4JJZA 1VQNB 1Z2AA 1S3SA 1EK0A 3T34A 3W2HA 2C8VA 4D81A 2DFTA 4M1OA 3ND8A 4R2HA 1FNCA 4JKIA 4CEHB 1Q1QA 2NPFA 2GCNA 1AKEA 4L8GA 4C3ZA 5FR2A 2RGDA 3LQRA 2WWYA 4B32A 3W2GA 1G5TA 1JBKA 4BFWA 2ZJ2A 4G1UC 4RJLA 4AYTA 5IF9A 4BFSA 4Q4HB 2H7VA 1G3MA 3SZRA 2F43A 2VIIA 5KNBA 1BOFA 3CC4B 1M1KD 2NGRA 2FGKA 1AQYA 1KOFA 2EWWA 1G3QA 4CW7A 2EIXA 2DWOA 4H1VA 3HR8A 2ZRAA 1CTQA 2WJGA 4NYIR 4ZKEA 1QGZA 2B7CA 3SBDA 5C4MA 4P32A 2WSSA 5KNCA 3CZQA 3DL0A 1IY1A 1ZM9A 4IEIA 2VSXA 1BH2A 2ZI3A 1M74A 3OEEA 1G5PA 1ODFA 3R20A 2CLSA 4S35A 1C9KA 4DLYA 4KVGA 1QGAA 3MAAC 1NG9A 2W6ID 1TQ6A 1OSNA 5FUWA 4P4UA 1W0KA 1U0HC 2ZJOA 3B1ZA 3BD9A 5JLJA 2PMKA 1UKVY 1JB9A 3GJXC 5L3RA 5DLQC 1P7CA 3ZH9B 3NWJA 4NYIQ 1UKYA 2FFBA 4KJZA 4YMTA 4TYYA 5L3VA 1FNDA 4A0HA 2IHYA 3BAFA 4LBZA 1WQ1R 2ZR9A 2ZTSA 4N3GA 1RC8A 3PEYA 1SVMA 4HAZA 4O25A 4BZQA 5HZKA 2C98A 3CKLA 2XJ9A 5CM8B 4Q9JA 4QJ3A 2PCJA 3QBVA 4FD2A 5DE3A 4MRPA 2QN6A 2RGNA 3RLFA 4QBIA 3U7HB 2J7PD 3IIMA 1YJNB 4Z8XA 2C77A 3QXCA 1QHSA 3Q7PA 3BB3A 4LCBA 1XNJA 1WBDA 5THXA 3Q85A 3RS3A 4YAUA 2RGNC 4FXPA 4Z8YA 1BYIA 1WXQA 2NOAA 2O8BA 1JEDA 4WZBE 1K9MD 1Z6YA 1E2HA 2AKAB 2G0NA 4EAQA 2ONJA 3C41J 2Z6VA 3CRZA 1N6NA 2XJ4A 3GJ8A 4D0LB 1W36B 1N3BA 2W00A 1IM2A 4ZPXA 3V00A 3I56B 4NZYA 3AM1A 4AY2A 3DOFA 1G19A 1TMKA 3OIYA 4BEJA 3QQ5A 2H18A 2QP9X 3KXLA 3DMNA 3LX5A 2B7BA 3DKVA 1T6NA 3SQXA 3AB3A 4X8MA 2XOKA 5FL3A 3RC8A 2IXEA 1XTQA 4M0LA 1TQ2A 2Q9CA 3QVUA 2FX3A 1EXMA 4TSFA 1TLLA 3CF2A 1XRJA 2HDNB 4GRAA 4TL7A 3KQUA 4V0KA 1ZNWA 4GP7A 1E2NA 4XOIA 2YHSA 3QXXA 5JS8A 3P32A 1DARA 1K73D 3GLFE 2FWRA 4B44A 1FZQA 5IDVA 1E69A 3AF1A 2AXNA 1JAHA 3OZXA 4HAYA 1NBMD 3A1UA 4KITB 4PHFA 3BWDD 2IS4A 1YI2B 1W35A 4HZUA 1BX0A 4GP6A 1E9AA 4Q7LA
chains in the Genus database with same CATH superfamily
2X0NA 1SUWA 3BK2A 3EASA 4GE0A 4ZIRA 3H5RA 2FU5C 4QPDA 2QTWB 3DA8A 3DP9A 2QVYX 3QH4A 5DBHX 4H31A 2ZRBA 2ZS9A 3ABSB 3Q6IA 4UTOA 3SSMA 4KDCA 2MIIA 3AL3A 4QVGA 1YO6A 1QFMA 2AN3A 3ZHBA 4GLFA 3LDHA 1ZN7A 2BDEA 4JJ8A 3CZAA 3GQBB 4I1SA 3DVSX 1NP7A 4YBRA 4DM4A 1U99A 4OMDA 1NATA 4P84A 1VE6A 2QMZA 2GESA 4KG7A 1ML3A 4MVJE 3ZV4A 1Z75A 2JCGA 1VLYA 3OT5A 2OFFA 1NBMA 1HT0A 4S1PA 5K3FA 3HUEA 4TTTS 1W5TA 2XB8A 2PD4A 2G5TA 2XQVA 1LV7A 1XCMA 5AVUA 3I9KA 1Z3CA 1ZH8A 4W9MC 1Z2PX 1D0SA 5CA0B 2WD7A 1PK9A 2GNPA 1A27A 3WBFA 3HBNA 2XCLA 2ZYTX 3G9UA 4QM7A 4C08A 1H6CA 3TNJA 5JBIA 3PC8A 3A3BA 1K8YB 5E8RA 1BKSB 3VC7A 5IWCA 3V1KA 1FQWA 1N7GA 1A04A 4UCXA 4DLWA 3ZY5A 3KAPA 4IPTA 1V5IA 3GWZA 4YAJA 5EQJB 3CIOA 5HBGA 1GGFA 2JRLA 4M0DA 4ZQCB 1UJBA 3VOSA 4FM9A 5KNBD 3S1AA 1N2CE 3WGHA 5GTDA 4CIVA 2PD3A 2OBRA 1LBEA 1S96A 13PKA 3LKDA 1OBOA 2JS7A 3C3DA 3TAUA 2DTEA 1AA9A 3LYHA 1V25A 1DTSA 3BXZA 4B2YA 2IZ0A 1Z36A 1XE1A 2CB9A 1NUTA 1M90D 2PZLA 2XA1A 4NWIA 3TE7A 4UD2A 5LVAA 1BKYA 1BEZA 3LUFA 3F6EX 1CUSA 5D1NA 1ZVJA 5DLDA 5DN6D 1AXEA 1LLDA 1NSYA 1UF9A 3WBBA 3LWNA 3GR6A 3NTOA 3GCZA 1N05A 3PENA 1CVRA 1IHPA 2B8TA 2PVPA 5AR1A 5JPDA 3AERA 5KMGB 4W8GA 1IEVA 3T1HB 3VKGA 5IJZA 3GRCA 3QYFA 4PONA 3IILA 5CEFA 4XM3A 1IWOA 3WK8A 4V0OA 4AIIA 3QEBZ 2YXBA 3T9BA 5JATA 5KNDD 4Q4CA 5CX1A 3VZBA 1G38A 1LSJA 1S02A 2RGYA 2W6OA 1XMJA 3OKCA 3ND5A 1MO2A 4J4TA 5J63A 5BV7A 1ZY2A 2YJ3A 1H2HA 3DCNA 3OG9A 3HDVA 4MUEA 3AFGA 2P77A 3OUUA 3USES 3HKCA 5EKDA 4H0FA 1JKIA 4P6YA 3I9V1 2HNKA 3WP1B 3NDBB 4GL2A 3FDZB 3SAJA 1NQTA 3L5OA 4WBNF 3CZMA 5JCJA 2H4ZA 4YQEA 1K6MA 1YZGA 2JHFA 2FUNB 4RGQA 1BE6A 1EVEA 1RM4A 2GF0A 4IOLA 2AD1A 5BSRA 3LY7A 2Q5FA 2AG5A 5KNLA 4HDQB 3QVTA 1NBWB 1W30A 2HF9A 3LYAA 4HWGA 1KQPA 4P7KA 5K4HA 1PQ4A 2X2EA 1UZLA 2OGSA 3DYBA 1D04A 1TTPB 2SNIE 5M29A 1XKXA 5C52B 4MDYA 3WMRA 1F17A 1NJ1A 2R6AA 4PYLA 2X5NA 1IN7A 4LY6A 1NNEA 2Y2VA 4FZ3A 3L0CA 2LD4A 5J58A 1HNWB 4K5QA 4JJEA 1S2DA 3FGPA 1UH5A 4AQDA 1T5OA 4H7PA 4BNVA 2UZ4A 1T26A 3FPCA 1P80A 4NMMA 5L7WA 1Q95A 3LUBA 4MA4A 3THSA 2X7HA 4P81A 2A7QA 3I3SR 4W9NA 3K0AB 1PJ7A 2VPXA 5H1YA 3V5NA 2K87A 1ITZA 1WCV1 1PKXA 2VJBA 1U2DA 3ASYA 3P9NA 4I9UA 5HJ2A 3SVLA 1CY7A 1OXVA 1REQB 1QS0B 2L17A 3LUPA 4PANA 4D3SA 1XPUA 4MROA 4EFKA 5GJBA 1NMEA 6REQA 1G20B 2GPWA 5DXFA 3P20A 1QKKA 5CP8A 2ZJ5A 3AF5A 4RPDA 1OT3A 3MIZA 3O84A 1SZCA 4AZ3A 3M4YA 1TK2A 3KJIA 4PZAA 1P45A 4YXWD 1WLYA 3GH1A 1Y8RB 2GA8A 2XUKA 4GXNA 2C3MA 3KPVA 4MCIA 2KSQA 2GPYA 3ILHA 4DRXB 2GBFA 4I50A 3KB2A 3PHIA 2YN4A 4MCHA 4MQMA 10MHA 1YWGO 3ONEA 4KMRA 4NYMQ 1P8AA 2A3NA 5HKBA 3SE0A 2OHFA 3Q6MA 4L85A 3ABRB 1XTUA 4PNPA 2VS1A 1F4PA 3ZV5A 3WBKA 3KE9A 4MWZA 2O50A 1YH3A 3H11A 3KR2A 1PG5A 4YCBA 3B1JA 2EXXA 3KSDO 1E9SA 3W6ZA 2Q7OE 5DM70 3D6MA 2BM1A 1FFAA 2DHEA 3GRZA 1WXGA 3E6AA 3H2IA 3ZZNA 3R3VA 2NAFA 3AUFA 1HLFA 1XLWA 3U7RA 3C7AA 1BWPA 2R47A 4H35A 5H4GA 3JSAA 2E4YA 4YLYA 1UPUA 2W71A 2JARA 1HE3A 2F1LA 1GG9A 1I4WA 3NHPA 5ECGC 5AW3A 4IQ8A 3I28A 2P67A 2XVZA 3SX0A 3TQIA 4MYUA 2HMTA 2CDAA 3DD1A 4IMPA 1U7UA 3CVVA 5DASA 3T7EA 5FBQB 4BX2A 4BFXA 3NOQA 3O75A 5FOXA 3MMPA 1DO8A 3WYCA 4DWJA 1YT5A 2AOWA 2EFHB 1R8XA 2Q5JA 2V8BA 2VRCA 3BL8A 1JHPA 1UBKS 3MUNA 1DRKA 5KTYA 4DM7A 4QEDA 3SLDA 2HWUA 3PV0A 3DBOB 5CNKA 3N1UA 1W2GA 2WTXA 4KJXA 3MMZA 1AGRA 3EZGA 4IBOA 1SXJB 4ETNA 1R16A 5AK5A 3WG9A 1WSAA 2FA9A 4I55F 1JDTA 5CCEA 4RJ2A 5J1SB 4LJ9A 2NSHA 4DLVA 2YY7A 4IDGA 3IVXA 4BX0A 8ADHA 1QP4A 2PX4A 3JQRA 4B6QA 2GWRA 4KQGA 3ZDDA 3ZVLA 3NUZA 4JJ6A 4KWTA 1U9YA 2IGTA 1GR0A 2B99A 3G68A 1WTHD 5IAOA 2VJJA 2XNDA 2WKQA 2RHTA 5LQUA 4OH1A 4B31A 5JFTA 4X7PA 1RAGA 1DUSA 2P5SA 5EZQA 2YL2A 4DBVO 4IL5A 4DIKA 2WFLA 1E43A 1FYXA 4U7HA 5AJZA 1EAMA 2JPDA 3ROTA 3TNDA 4Q9HA 2ZBDA 1SA0B 3I92A 3I9V6 4G0QA 2GD0A 4EJ2A 3ZZ0A 3WB0A 3GDFA 5E2BA 5FQNA 1B0AA 1DPFA 2IEGA 1QAQA 5IJWA 3ZK7A 1OIXA 2NLOA 3ROKA 4V02A 1LDNA 1JF8A 5EJMA 4L3OA 1JPVA 1CNMA 1QR6A 2NPIA 3A2NA 4MV6A 3TL2A 5HS6A 1PK7A 5JQGB 3D6FA 3DMPA 3D7KA 3NMUF 2NU6B 4BQRA 5DHFA 4UVGA 3UENA 1EXVA 4HNRA 4ZCLA 4ZGGA 3RC2A 1DJQA 5JYCA 2BJVA 2BUAA 4LOKA 1C3VA 5DWDA 3COWA 5DX8A 3VI4B 4O2AF 4M9UA 1QQTA 3BH4A 2VUHB 2IXTA 5K3BA 5TT1A 3UAOA 5ALVA 2G67A 5HIJA 1R4NB 1MA3A 3KQTA 4QUDA 3U9TA 4FIZA 1ZJ5A 3RARA 3RIYA 3T9EA 1YJ5A 2ANCA 2BKLA 3W8RA 1N2BA 1SRRA 2I2AA 3HCNA 1Q3KA 1ZN2A 4OHMA 4W7IA 3VX4A 3OLXA 3DGEC 3LPCA 4KO4S 2MYNA 1U81A 5HYVA 4MXDA 1TVEA 1IG3A 3RVJA 4EPVA 4DR4B 4WWHA 4JYCA 3PL1A 3NBFA 1T1EA 3CVJA 1GV0A 2P2LA 3Q41A 3IJRA 1K8AD 4Q3OA 3A9VA 3QYAA 1XDDA 2I55A 2R6DA 4XWTA 4MWEA 3LSYA 4CFYA 4QO7A 4P2NA 1CS4C 1EHYA 2I9PA 3IMKA 1R0ZA 3K9HA 3TD2A 2C99A 2WUFA 4Z4HA 1Y4UA 2I6FA 4L5JA 1T3GA 3JX9A 3ZGNA 2YNMA 3B82A 2VNJA 2VYCA 1EM6A 4J0GA 2DPMA 4WGGA 1U2ZA 3RRYA 5HS4A 4Q37A 3CISA 4KQ6A 5J3OA 1G98A 3EJ6A 3UMBA 4LBYA 4NOJA 4X6UA 4Q7QA 1QTQA 1VHDA 1U0GA 1ZEJA 1ZCJA 5DM4A 3CN9A 1E1CA 3PCTA 3R9XB 4DDKA 3JQCA 5IK2D 1ZONA 1U4SA 5D5QA 1KDOA 1QANA 3JZAA 2ID7A 3D0KA 4EZBA 1HQDA 1J06A 1WP4A 3CCBA 4QYSA 5ALHA 2PUEA 4OU5A 1H8HD 1P3DA 1JR4A 3E8SA 2OBSA 1PR4A 5GONA 2XMGA 4RDJA 2XECA 1HE4A 1YULA 3L4SO 5A3RA 1C2YA 1W46A 1JEEA 4DRYA 3EXG2 3DVQX 1PK8A 4LG1A 4G67A 2EJUA 1RLMA 4DA0A 1H5UA 1BW9B 1TEVA 3NC1C 3ZU3A 3NAGA 3HSSA 3V34A 4YROA 4JOSA 4RQTA 1DG1G 3OOWA 4UAGA 1K6EA 1RVV1 4KQIA 1ZS9A 2V7TA 1VA5A 4BNYA 5K7SA 5JSFA 3AF6A 3HVKA 2WMOB 4I5EA 4KGZA 4B83A 4EA9A 1Q7YD 2VDUE 2IPAB 3IUEA 1TDJA 3EGCA 4P93A 5E9QA 3L2OB 4P3YA 1N5JA 1TO6A 1USVA 2NZVG 3P2KA 4YQFA 5JXJA 3SQWA 4D92A 2HUNA 4A8JB 5JNTA 4OUKX 2Z8XA 4EY6A 3O8CA 5IYWA 1JALA 2Q62A 3AW9A 5DN9A 2ZYRA 2QVGA 4GSYA 4EJSA 2PBRA 3OESA 1ZGZA 1FX1A 1A71A 1VSQA 3PKZA 3USCS 1A4RA 4M7PA 3TVTA 3U7QB 2WSSD 2J32A 2QK4A 4EDFA 3K9LA 4RM2A 4IS3A 1GPJA 4I4NA 1TPZA 1NAIA 4KAXA 2X0DA 2WY2D 4F12A 1UK7A 3HUDA 3WKAA 1DKMA 1M3SA 2JNWA 3RSSA 1E7SA 4E03A 1L7PA 4YALA 5MFPA 4DEVA 5GJWC 3HDTA 3OLZA 4FFWA 1OZAA 4JI4B 2YWGA 1AHHA 1VI6A 3LUGA 3LVBA 3R3YA 4MRNA 4EY5A 1A4UA 4OK3A 3EG9A 2K2WA 4CCSA 2JHPA 5AKZA 3PP8A 4FYPA 3ILVA 4K8RB 5AOAA 3WDMA 2BIFA 5JDCA 3QFTA 2XMZA 3OFKA 3F96A 3OI7A 4MP3A 2AZ4A 5CAEA 3DE1X 3CWZA 4H6PA 3OM9A 4J0IA 1RWKA 4RFSA 1PD1A 1U6JA 3FH0A 3PPYA 4EHIA 2VBGA 4AQYB 3T7CA 3U4CA 4IUDS 1IDN1 2JASA 2QTGA 5BQOA 2FPGA 3NYIA 3WQBA 4RWZA 2NUPB 2J85A 5K4GA 3H1GA 4WBNB 3G1TA 1RWVA 2EFCB 1W2HA 1ZK4A 3H4IA 4I9NA 4PSCA 1RW4A 5EHQA 5F33A 5TDHA 3T06B 5JV5A 4C29A 1X1DA 4LZWA 2ZUFA 3MCTA 5EE5B 3HSKA 3TOZA 3SKVA 3UT5B 3UIEA 4XPIB 4HE6A 3G0IA 3OX2A 2GVDC 2JKYA 3D8BA 3FPFA 4JLWA 4LWPA 1RPTA 3KEWA 1UANA 3SC4A 2G0TA 3BRQA 5AW4A 3BY2A 3IXMA 6ADHA 2J6HA 2WJZB 3QKIA 1JFVA 3TAXA 4I66A 5NULA 2YV4A 4EX7A 3GG2A 5MN5A 3HVJA 4TUYB 1Q2UA 3D4NA 2PX3A 1MXFA 3HBJA 1ZLYA 2G5PA 3Q6NA 3JTMA 4I7EA 1QWOA 4KQJA 2NUTA 2IHTA 1VG1A 2VJIA 3S1LA 5I4KA 1JDUA 2YQZA 1NR7A 5JBNA 2XUOA 4UAJA 1TD9A 3LUHA 1TOAA 1T2UA 1Y5RA 3VMFA 3SP1A 2DB3A 2JIZA 4CZ2A 1PWXA 4FOLA 4PX2A 5JSZB 3SC2B 5LYJF 2VLBA 3T3PB 3P9QA 3IPLA 4C7BA 1Q82D 2QRVA 1E2IA 1S7GA 5DW3A 4R16A 2ACKA 1SR8A 2GILA 1YI0A 1XJCA 1L8LA 4L6AA 4XTCS 3JQDA 4HDRA 2X4GA 3TDKA 3PHLA 3M6VA 1C3JA 1U3DA 2ZYHA 3D3KA 4MYSA 5C1PA 1XA4A 3QEJA 4OJTA 1B4DA 4ZDWA 3O31A 1GGKA 4PZEA 3O83A 5BSXA 3RUEA 5AVQA 2FP4A 1C3OB 3IQZA 4L4UA 4JY7A 4EI9A 4X60A 4WIAA 4CIYA 2XLBA 4OHRA 4GF5A 3I5UA 3KWMA 5B64A 4Q1CA 1FPMA 1RYNA 3KJXA 3ZU6A 5IU6A 4WKPA 3DE3X 4BO0A 1AQUA 3T53B 1EJ0A 3LO5A 3VA7A 3DCJA 1A9OA 4K3UA 3SSNA 1NQ5A 4XD7D 4J0HA 4WOCA 1PFQA 2GCGA 1SOUA 2ATXA 5DM2A 2XCTB 1RAEA 1DQSA 1T5LA 1Y33E 4ND6A 3FCEA 4ZVOA 4RH3A 1OKKA 1SBTA 4GPZA 1KGDA 3JWIA 1VIDA 2V1XA 4ZV7A 1PR0A 3QIVA 1D2RA 1XD8A 4LGYA 4KPFC 2BI4A 1MHTA 1PL6A 3GLGA 1VKNA 2FSGA 4HTFA 2A9FA 2CSUA 2QQEA 4YMSA 3AEUA 5LOVA 5SV2A 5FIUA 1C7QA 3HCCA 3MTJA 1U3VA 4WCDA 3VBCA 4GRIA 3MYRA 4HLCA 2YINC 5EJ2A 3COPA 3GLHA 5HF5A 3VYUB 4G0UA 2GO1A 4KKTA 4TWBA 4AP6A 1D2EA 2ERXA 4KE9A 1BCRB 1JEJA 2OV6A 3CXUA 5I9NA 1ISFA 3B1WA 2CDNA 3BIFA 3S2YA 3ODPA 3CP8A 2D1TA 2II6A 1CUGA 4HI0E 4IINA 1OH7A 3D3JA 3F8TA 4RLZA 3ANYB 4UVEA 1M2WA 4H7HA 5BR7A 2BVNA 1FUEA 2ZSUA 5TSDA 1BHQ1 1E9DA 2B35A 4FYWA 4TT8A 2AOTA 3WLHA 3KX2A 3V76A 3A27A 3EVTA 3UBMA 3C14C 1SPXA 2PWAA 1J2YA 1ZJ4A 4HYYA 2UZ3A 2WFZA 1U9ZA 2PJRA 5FORA 3WFZA 1LI7A 4GO1A 1ODSA 5C8ZA 3G8AA 3B2EA 2ZWAA 1RWNA 2QXYA 3AI7A 4MQBA 3TG2A 4FNOA 1JSLA 2IUSA 2O1XA 1JR3E 3G02A 5IBPA 3DKRA 4GE3A 3HNRA 2H06A 1LF0A 4G2NA 1RPNA 2F1RA 2YVQA 4KO3S 4QTTB 2R00A 3TM5A 4CCYB 5MN4A 1X38A 3D26A 3VZQA 3UAZA 3SR4A 2B6NA 1XQ9A 3I55B 2GYUA 3AVYA 2FFHA 1Y1SA 2CHQA 1NNUA 1P1HA 1WZEA 1NLFA 2QX8A 3QLUA 4KSBA 1RAAA 3E22A 4E12A 4AYWA 2QRMA 4JYMA 1T3SA 4Q39A 1UCFA 2Q6IA 4BASA 4NZPA 2ZM5A 2ORIA 4NCIA 4R84A 5TEWA 3QX9A 3T8YA 1M2VA 3UJ8A 5JJ5A 1O4VA 4Z0NA 3GNSA 3GLHE 2C97A 1AU9A 1DDOA 2CNWA 3AVOA 5EINA 4K26A 3R8XA 3D8SA 3V42A 3A6LA 2Z1DA 3A26A 1VZ2A 5DLPA 1E96A 1XWIA 3K9GA 3Q11A 5AKEA 3GMSA 5B6JA 1C0LA 4ZT4A 2GN2A 2JBHA 3OPYI 4KH0A 3SZUA 2ZUEA 1U90A 4YLGA 4OHFA 4E6EA 1ORTA 5BNZA 3NANA 1XCBA 2XMBA 1YDEA 4HEJA 4LDNA 3RTCA 3SJPA 4IFBA 3LLMA 4YIKA 1JG3A 2FMIA 2MT9A 3TZLA 2FI1A 3VC3A 1HE8B 3E0QA 2JA2A 1EFPA 1UOPA 2Q2QA 2QQ0A 2X77A 3EZ6A 3RVPA 3HJFA 3IJPA 4PBSA 3C4VA 3GIWA 2XPCA 1A5ZA 4OVKA 1WA5A 1UK8A 2VAMA 3KT0A 5L3QB 3N7TA 2Z2ZA 1CUCA 3K1AA 2QRPA 3FUUA 2FSHA 5AVSA 2B5VA 4G9EA 2XY4A 2WA1A 1MJFA 4LV5B 3N76A 4NJEA 3VMMA 1Y5NA 2F59A 2RHDA 2J0EA 5CDFE 5B58T 3B7GA 5CXQA 1GUAA 5HCIA 5I4BA 3OE7D 4MIYA 4RZUA 4MMZB 2HLNA 3QKRA 3JQ8B 3IBGA 1T3TA 4MIEA 1ZNZA 2POCA 4J94A 2ESRA 1RWOA 1OF1A 5B4UA 3COJA 1KHTA 3ZCUA 4RZIA 4TKVB 4DA6A 2DWUA 5E6TA 2I7DA 1PDWA 5H59A 5E6RB 3WSTA 4XM2A 1KMCA 2QUJA 1MN6A 1CYEA 1M73E 1X39A 4ZXPA 1XXHA 3F5FA 5BW6B 4ZGBA 4RENA 4YDSA 1ECCA 3V3TA 4C20A 3GIRA 1Y3FE 3K32A 3VJLA 1NI5A 2CHUA 1X74A 1HA3A 3CX8A 3NNDA 1DC4A 2F7SA 1CDDA 1MAUA 4UCQA 3RJ9A 4FNAA 1CFJA 1S1MA 2XUPA 3OU2A 3L0PA 2BMVA 1QZUA 1SCQA 2AKYA 2FOXA 2E49A 4K46A 1KOLA 2Q2WA 5FAKA 4ZOAA 1HR0B 2NZXA 2YUTA 2ASEA 3W3AH 2YWRA 4DF3A 3PGMA 4UOEA 4ZYTA 3PQDA 4I46A 3TUZC 4F6RA 4NZMA 2CNWD 4LECA 4FZRA 3MJEA 2CHGA 3GVXA 3T7AA 2WILA 4NCKA 4Q7MB 2NYAA 2QRNA 3HCEA 1OXTA 2HXYA 1ACJA 3DXFA 4ER5A 5KTNA 1GFWA 1AQLA 3UG7A 3G7NA 1G9XA 1CRZA 2QAIA 3EOAI 4G07A 4M9SA 3IIKA 4RGYA 1IB6A 7AT1A 4QPJC 5TS2A 3EFBA 1T0IA 3RU9A 1EFTA 2BEJA 3GMTA 3R5XA 3SBXA 3FNHA 4N6GA 2C58A 5KQMA 1YJBA 3UB4A 1AKQA 4B4UA 1QE5A 5CFNA 5EHXA 1DQYA 3N2GB 3AIKA 4JLOA 1XLTC 3RVQA 1HRKA 2AVNA 1EDZA 1C30A 1Q57A 1QRSA 3NIGB 4PYIA 2ZIAA 3MJDA 1TX4B 2GASA 4CKEA 3J7AC 2ZTGA 3L6RA 4WZAA 2JCSA 2F62A 3UV7A 2HK6A 3GUZA 2YQ4A 5HF6A 3CLTC 2DOKA 1Q0ZA 1P18A 3DH0A 4WEOA 4M0UA 1ABBA 2BGWA 2JJ2A 4UOQA 5K3OA 3PI6A 2ACWA 3FJ1A 4DV6B 1G18A 1YZKA 2VDQB 1OA1A 2FMFA 3KZ1E 2YMMA 4PM4A 2VDLB 4N6NA 4DJTA 4CR8A 1Q0HA 2WBLC 3K73O 1WW3A 1QR2A 2GAIA 5EVJA 1QG0A 5CB4F 5AW2A 1TO1E 4IOKA 3UTCA 4CQNA 1J56A 1IHUA 1VYVA 1U7WA 3KR0A 2PLRA 5J2UA 4LF9B 3ILSA 4RD0A 3A37A 4KZPA 4TVOA 5CU7A 2IF2A 2W37A 5F77A 5E8JA 4CLHA 3IUJA 1BRTA 1SKYE 3RASA 1HRDA 3BGOS 1SBHA 3PCXA 4N82A 3T0GA 2J87A 3F74A 3KV1A 3N8KA 3PQFA 4Y6OA 5CLIA 2XGJA 2REXB 5IK2A 2QVCA 4WUTA 3C5CA 1LI4A 4XYBA 5H8WA 4PGGA 3G7SA 1CUJA 1V1JA 4JZKA 4TXLA 2RI0A 4Z9BA 4A15A 1WUHS 1Y7PA 2WIDA 1WXDA 3VDQA 3FN4A 4OHPA 4RANA 5JQGF 3UWMA 5G1OA 5G3YA 2WYVA 1NUAA 2Y3IA 3LPAA 5EIFA 1EFAA 3CKKA 5J4YA 1XJ0A 4TRJA 4MQLA 1N0UA 2H92A 2IXGA 3K1JA 3B7WA 3PC3A 4AN4A 4O0LA 3DQPA 2EBHX 3VO1A 3NHWA 3D59A 4AMVA 3PR2B 1A2BA 1QG4A 3JD3A 2JLQA 3LLUA 4L28A 5G41A 3T56B 1MOZA 2QIPA 5KYYB 1E2DA 4MRRA 1L4FA 1YRBA 1NPTO 2GRUA 4RS3A 2ZPAA 1YC2A 2E2WA 1G55A 3MBOA 4OV6B 4FFLA 6NULA 1U28A 1I10A 1T3LA 1CETA 2JLVA 1DG3A 2XD4A 3AF4A 3F4LA 1JBEA 1M6HA 3FIJA 3NDRA 4PG7A 3ROPA 3RRMA 2PIDA 5JE8A 1KSGA 3HFGA 3LI2A 3V33A 1OILA 2OFXA 3VJMA 1JWLA 4G65A 3Q3EA 1T2DA 2ATIA 2OHHA 4DJAA 4IXMA 1JHMA 3S5JA 4CV2A 2OEPA 4M36A 1VQOB 2WK1A 2ZI5A 2V9PA 3OMWA 2I65A 4JP3A 4TV9B 5HILA 3W05A 1FP6A 3FHLA 4GECA 4PQEA 2QU7A 3LQ4A 3O2NA 5BWBA 3PR3A 2HA6A 2VXYA 2XE4A 2HCFA 4EPRA 3QLEA 1UM9A 3VO9A 4Y2RA 3B70A 5TVGA 2R48A 5H3HA 4CE6A 3TWOA 2EKPA 2J48A 2JFYA 1KAGA 3R3XA 1O0CA 3RAPR 5GM2A 1BFKA 3G0DA 3SG0A 5FWXB 4BFYA 1F6DA 2FF7A 1XF9A 4XQEA 1WW8A 3U1VA 1NJSA 4X85A 2ZT8A 2H9AA 5CB0A 1CF9A 1C14A 2ODWA 2Y6UA 3QV2A 4V0NA 5DGHA 1I6KA 1GYQA 3D5TA 4PRKA 4V3BA 1H8ED 4FSHA 1D1PA 1BGWA 3NYWA 5DTJA 2FOIA 1B93A 3JRWA 3VPHA 1DBPA 1U0RA 5DX0A 1VLMA 4LAFA 2AH5A 5EXTA 2Q4BA 4US0R 3WK4A 1SQ6A 2ANBA 1QBGA 2HTEA 4B6EA 3THRA 2J31A 3OPOA 4XIGS 4U0JA 4JLAA 4UATA 4TN1A 1T5DX 2GO7A 2Q5IA 2C9BA 5EWLA 4BFTA 3FKQA 1QRTA 2QXUA 4Z7JA 1EVYA 2UVPA 4JZYA 5CVJA 2ISSD 1MAWA 3PXXA 5BW4A 5K01A 1Q0SA 5DGIA 5FBRB 4E3WA 4A7PA 2VTDA 1NVTA 2CNNA 4FBMA 2IF0A 1NVBA 4MW1A 4DSTA 3G17A 6CHYA 2VAPA 4JC5A 2Q21A 1GNRA 1YE8A 2OCXA 3DLTA 3LK6A 4CLXA 2CEKA 1COZA 1KEPA 1UPAA 3MGBA 1XK7A 4F3RA 4LA4A 1BE8A 3QJGA 4HNAA 3B6EA 4ONEA 2WA2A 4TL6A 2IV3A 4L0QA 4MA5A 1E2UA 5BQ3A 4EUKA 3THOA 3KKKA 1TVCA 1P4GA 1V8FA 3LX8A 3OC0A 4LF4B 1Z17A 1E3QA 2OC4A 1E0AA 1WKCA 3QK7A 1FRNA 1DIOB 3QGMA 3ZKWA 1A50B 1FQOA 3OQMA 5LWHA 1T10A 1B6TA 1N6OA 2GKGA 2FJ0A 3I9JA 1Q1EA 5D5PA 1PG2A 3U4QB 3IE1A 5IVIA 4CHTA 4B7ZA 3OLWA 5I7SA 1I3CA 3ECCA 5TMBA 2O8NA 5BSFA 4IKOA 1XAGA 4L16A 1TJ4A 1FL9A 1QAOA 2ECQA 5HZGA 5FI1B 5AH0A 1UD3A 3Q0IA 4KFCA 4ZGQB 4XSHA 2HQOA 2KYRA 2A1UB 4JUDX 1WCYA 2Q5LA 2XMDA 1EWYA 3EAQA 3TR0A 5L6LB 2IWHA 2WUWE 2GDZA 1X94A 2C9YA 4IV5A 5JO9A 2GHQA 3IOYA 2R86A 4F2GA 1FDRA 3HYRA 2WWRA 3DMYA 4XM1A 1I9CA 1RYMA 1M8PA 4M54A 2OSBA 2XH8A 3EQ9A 1J2RA 3W5IA 1KEVA 4B33A 1LX7A 5E4TA 4BQFA 4ESOA 2V3WA 2ZBPA 1DC6A 1E3WA 1TMOA 1V7ZA 4KXMA 4INAA 5LQCA 2E87A 3GY0A 1H8EA 2G70A 2JI6A 2W8BB 3R5JA 5P21A 3UMJA 3AKYA 3DYVA 3MAJA 5BY2A 2W93A 2XA9A 3RRNA 4WKGA 1PWYE 3GIDA 4AMUA 4MYCA 4YRIA 2LPMA 2VP2A 3ROEA 4XL9A 3TQRA 4CIAA 4MR7A 4RTRA 4XOPA 1UBGA 4NABA 4NYMR 4LF7B 1I4DD 3RB8A 1IU9A 3D7LA 2IIBA 3WAGA 5DRTA 2VK8A 1QQ7A 3IEXA 1MB3A 1Y34E 4N7RA 3NPMA 2FPRA 2GCOB 1YHZA 1J49A 1J70A 1YKGA 2QA4B 1SC3A 1X7WA 4K3VA 3ZZ1A 1KMQA 5JNVA 2XX3A 1SHTX 1U7ZA 1QVVA 4GEKA 4QIHA 2RGWA 4FFPA 5BSKA 4RTMA 1PKVA 3DD5A 3FTEA 2Q1TA 4MCAA 5T6MA 2GLTA 4NVRA 4HAVA 1D09A 4RSGA 4OUDB 3DLAA 3U60B 2EBUA 3CIFA 1PFGA 3GJYA 1GTJ1 1JDZA 3DCYA 3NJ8A 4S2EA 2A4MA 5LBIA 2BONA 1GQFA 3EXEA 1QU3A 4DBLC 3EEBA 4HJXA 4LWZA 3TLGA 2NTEA 1NW6A 4XLCA 2O2SA 4XWWA 1MGOA 4NYJR 4XUDA 3WK7A 5LD2C 3L1VA 5G53C 3KAJA 2J9RA 3GCDA 4RFLA 3H87A 1RE1A 1MW8X 3SU8A 3C3PA 2AV6A 5KJCA 3CUKA 5HK9A 1FUKA 4FZ5A 1TTTA 1DEOA 1QV6A 1V35A 4L3WA 4JUAA 5DI3B 4IWXA 1SXJE 3RU3A 3EGXA 3L06A 1E7YA 1ZBDA 2OR3A 3GEMA 5AP9A 1W5EA 4ABYA 5CG1A 4YRKA 3G2OA 5BWNA 3EF1A 1IIBA 3ZXYA 1E94E 1QF7A 1OXMA 1WBJB 4DYVA 2OTCA 1ZD1A 1NNLA 1L5ZA 1OGIA 4HQ0A 1DKOA 3NGXA 3F8WA 3ORSA 3GPIA 4LN1A 4R8RA 5LZ9A 2D5IA 3QX3A 4ARZA 4FILA 4E94A 5H9VA 3ZI7A 3M81A 4QQKA 4YQYA 2AYZA 3CWQA 4DQVA 5B3KA 2OVFA 3QWFA 4U7FA 3EC7A 2GEKA 3H97A 3JQBA 3LRTA 5JOQA 3T7JA 3SXJA 2RH5A 4W5TA 4BFLA 3HU3A 1QOZA 3H6GA 3EG9B 4G3XA 4MGIR 2FZWA 4MCJA 1JG4A 2M9MA 1IY9A 4IQGA 4BP3A 1AS0A 2JIPA 4JA2A 3VHXA 1KOGA 3P27A 3LLCA 3QI7A 2UYQA 2Z8YM 1BYUA 3AHIA 4LC0A 2HUPA 1M5TA 2VBIA 4FONA 1VM6A 3MWFA 4MJ7A 4AW9A 5T7BA 5E7QA 1CK4A 4PR0A 2EGUA 2R2GA 1DRVA 3TLMA 4HN2A 1E98A 1FLDA 2PTGA 1RZUA 5B7QA 4ZWNA 4BPRA 2SKCA 3H9GA 2I91A 1SVKA 2PHZA 1G2PA 3CB4A 3HDGA 2PFGA 2F2TA 3EISA 2V7QA 4POOA 3QVGB 4OF4A 2H9IA 4KAJA 2WJWA 4D6XA 5A5VA 5F5NA 3C8ZA 4TKLA 2YCLA 3NO4A 4D45A 3N7AA 5ECWA 3EQZA 2EJCA 4YV7A 4RTJA 3OEHD 2MR6A 4ZOQI 2WTUA 4OX9Y 3RFTA 4E5UA 4B3IA 4IYRA 3JW8A 2GREA 3LDAA 3SCZA 2WD7B 4ZOCA 4HOYA 3O3NB 4TQAA 4BNDA 4M53A 2BFDA 3O1LA 2ZAOA 3K8YA 3H5LA 3RIXA 3H2GA 1DUIA 3UGQA 3VR2A 1MJGM 4L4ZA 2HSGA 5DNVA 4AJ2A 1WAMA 3IP9A 1Y82A 5FWDA 4BP9A 3T7KA 2R68A 2WJ3A 5CHEA 2W2PA 3NWBA 3GUCA 5AJWA 3WGTA 2G6BA 4R1LA 3TRJA 5IC4A 3KZCA 2IY7A 4HPXB 3B3AA 1AS2A 2PLNA 4KNVA 3OO0A 3PJFA 1M1YE 3HY3A 3ND7A 4FUTA 4HQNA 4QGHA 5F7XA 3G2KA 1VPLA 3UICA 2P6UA 3LFTA 3T52A 5FBHA 1JIXA 5AVKA 2WQ6A 3C6XA 3KPUA 3QE9Y 2QRUA 3AKCA 4J8PA 4YMUA 1RM3A 3BE6A 4ZVPA 3HO6A 2Q0HA 3PSHA 4OOVA 3AETA 4XSGA 5AVYA 2P8JA 3E20A 3ENVA 4MYHA 4CQMB 3THXB 3KKOA 2NTVA 3CLUC 5C1IA 1L7VC 4LV6A 4ME6A 3AEKB 2CFRA 3H9QA 4CODB 5H5JA 5AMXA 4F2PA 3BD7A 4DLRA 4BMNA 2PQ2A 1OU4A 1V1MA 3U6KA 3SDZA 1CY1A 1KR2A 2TMYA 2H2IA 3D8NA 3CCLB 4FYXA 4U7PB 1X7GA 4B9EA 2QORA 1OLXB 1A5BB 2I6XA 2WJJA 2X9VA 4FFDA 3CX7A 1RD4A 3RWOA 1QCYA 1XQVA 3ME5A 4MGEA 5CJJA 5FBWB 1F2TB 1Z4IA