1S0UA

Eif2gamma apo
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
404
structure length
391
Chain Sequence
SQAEVNIGMVGHVDHGKTSLTKALTGVWTDRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPINIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure of Translation Initiation Factor eIF2gamma: IMPLICATIONS FOR tRNA AND eIF2alpha BINDING.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 96
structure length 391
sequence length 404
ec nomenclature
pdb deposition date 2004-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1s0uA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s0uA01
3OIWA 3UMRA 3WP0A 4C7OB 2QGNA 4Z1MD 2IS2A 3UPUA 1TQ2A 3O8BA 1KDRA 4BFXA 4TSFD 5GV8A 3W5VA 1FP6A 2F43B 4NCHA 4V03A 4M1MA 1QVGB 1GVNB 2FPLA 4M22A 3AF0A 2ZSBA 4P32A 1YKSA 2ZANA 4YHBA 1UKZA 3TQFA 4D0GA 4B3GA 5F9FA 1G8YA 3OZWA 2QEQA 2IUUA 2PJRA 4X8LA 3K09C 2PL3A 1RFLA 3QKUA 3TR5A 1KY3A 3EWAA 4PPQA 1VCMA 4DBLC 2UKDA 1OFUX 4KU4A 2ODWA 4AKIA 2WMNB 2OK8A 4QOSA 1ELOA 4H9GA 2HF9A 3OEHA 5FOXA 1Z3IX 3FPKA 5ANRB 3BFKA 2RH5A 3TMKA 2E1RA 4P4SB 1A5TA 2Z6VA 3FKSD 2IXGA 4KI0A 3U3JA 4C0AC 1W0KA 2RB4A 4IRUB 121PA 1GP2A 3T34A 3PEYA 2QP3A 1DAFA 1W34A 3I32A 1KMQA 4WVFA 3O8CA 2JLWA 3C41J 2DR3A 2MSEB 2KSQA 1OYYA 1L4YA 5KUTA 5KOYA 3TUZC 3B8HA 1QVAA 1KSJA 3VU9B 1G21E 1MABA 2QPAA 4QJ5A 3VR6A 3UATA 3DOEA 5FR2A 1VCOA 1J90A 3LXXA 4PTLA 4L9SA 2VP4A 3CXCB 2R6HA 4Z8XA 1W46A 3K70B 2QA4B 2V55B 2FPKA 1RIFA 1G18A 2IEYA 1NKSA 1JPNA 1X3SA 2OAQ1 2ZJBA 1VKJA 1LTQA 2XXAB 4IHQA 3N70A 3GFPA 1Z8FA 2X8AA 3AP3A 4GT1A 3TNFA 2EWWA 1EFCA 2PZEA 3BK7A 4MITA 2XJ4A 3SBDA 4JBWA 2YWEA 2AKAB 5CM9C 1EP3B 2GBLA 4FIDA 3JZAA 2GAAA 3KFVA 1RE0A 3SFVA 1GL6A 1SQ5A 4FMDF 4S35A 1Z2AA 5DE3A 3FOZA 2XITA 2W00A 3VR2A 1Q1BA 4XSHA 2F3TA 4EJSA 1KJZA 3B7GA 5IF9A 4S2EA 4JLDA 2D3WA 1FQJA 3I61A 3KJHA 1KQSB 1SULA 2RGBA 3C8UA 1I7PA 2REXB 2P5SA 1LNZA 3QXXA 1KO4A 1ZUHA 1G1MA 5CJPA 2ATVA 2B6HA 5DI3A 1LS6A 1WP9A 1EP2B 3SHWA 4Q1DA 1YHQB 2NQ2C 3A37A 4I4LA 1KI8A 2GWHA 3GLFA 2ZRLA 3ZJYA 2G1JA 3CPWB 3A8TA 3NWJA 4PPNA 2AX4A 2JASA 2ZRIA 4IDNA 4PHFA 5EMNA 3LO5A 1A8PA 4B6EA 2BCJQ 5IHPA 1E2NA 3KUDA 2NPIA 4XWAA 1GNRA 2C2HA 4R2HA 1OXSC 2NO1A 3B2EA 4N0EA 5FOSA 2WWGA 3FDIA 2CBZA 3UXMA 3VNUA 1E9CA 1PVOA 3QXSA 2IF0A 1D2EA 2BMJA 2QZ4A 5EE5B 4FMDB 1EWQA 2WTUA 3NTUA 3VKWA 3BBPA 4AKEA 3AKEA 5EP3A 3K70C 2EIXA 1MO6A 1E2GA 4PO1A 4JBXA 5DIFA 3FTQA 4JIMA 1L7VC 1K6MA 4MDFA 1MO4A 2QM7A 4BE7B 2ZU6A 4G01B 3KJIA 2JATA 1RJ9A 2AFHE 1CBUA 5JWRA 521PA 2C8VA 2XTMA 3T1QA 4RZUA 2JLZA 2FFHA 1SZPA 3LW8A 1FP7A 4MRVA 4C7OA 1WXQA 3W5UA 1O3YA 4BFSA 2H57A 1G291 1P6XA 4HUTA 5EUMA 5GJCA 1QHSA 3SNHA 1TU4A 2B92A 4B48A 1R4AA 2QQEA 1G3RA 5TR9A 4EUNA 1EFRA 1YZKA 1CU1A 3CRW1 1GUAA 1ZM7A 4N3GA 2CNDA 4UJ3A 4YDHB 4M1OA 5FBLB 4NYJR 1HY3A 4OHYA 4QHSA 4D4KA 2QU8A 1GRNA 1Z0KA 1KRHA 2BF4A 1ZP6A 1NN1A 4K8OA 2RHMA 1NLYA 4MGYR 4BFVA 2J59A 2ZS8A 1VCNA 1WMSA 1E9FA 1QZXA 1XMSA 4GP6A 1N5KA 1TMKA 1W2BB 1ZC4A 1J7KA 3P1JA 1Z83A 1AS0A 4C0HA 4LYFA 4PAMA 1E2QA 2YOGA 3U44A 3T35A 1R7RA 3A58B 1EP1B 3EZ9A 1KK3A 3IGFA 4R9UC 4KFSA 4JL6A 5CM8B 4B34A 5DI3B 5G53C 3CCVB 1GAQA 4JLKA 3PUZA 3AVUA 5E3HA 2DB3A 1N6LA 2JJ2A 1ZC3A 4U9UA 4B3XA 2B7CA 2LKCA 4MYHA 5AJVB 4HB3A 1WBDA 3CCSB 2FMXA 4HI0E 5SZHB 4FD2A 1E9SA 3LH5A 4K81B 1G17A 1H8EA 2GETA 2YVUA 3LY5A 4IDOA 1COWA 3T1OA 2XB2A 2B8WA 1CRQA 2W6JA 3NHBA 2ONJA 2OTLB 4FI3C 4ZDJA 1K73D 1T91A 4YXWA 4QBHA 1NJID 3ASZA 4KVAA 3IIMA 3AVQA 3EA5A 4IEEA 3L0OA 4HE6A 4BGDA 5A0FA 1QG0A 4BLPA 4AKGA 1E64A 3VR5A 1CJKC 4US1R 2IEZA 3DL0A 2X2EA 3M1IA 5E7IA 2OESA 3HR8A 4QC2A 5FBWB 4ACBA 3WBJA 1K5DA 2ZUCA 4K46A 2XSZD 4HAXA 2HT6A 3W2EA 2AR7A 2VO1A 2WSSA 2VPPA 3CCJB 4UNRA 4IFEA 5JEDA 2ZROA 2RAPA 3BXZA 1N5IA 4OJKA 1US8B 3AVYA 5L3SA 5E95A 1MKYA 1P75A 3T15A 4DVGA 3ZLJA 1U8ZA 4G1VA 2ZVPX 3LX8A 1IY0A 2OLKA 4NCIA 1GFIA 1W87A 1XEWX 2KWIA 4JJZA 4X8MA 1E1RD 4OHZA 1RKBA 2FGKA 1XTQA 2ZR9A 4C9BA 3EPLA 4NYJQ 2AK2A 1XX6A 1VQ7B 3W6OA 4P6VF 2CNWD 4I1OA 2ZE5A 3W2HA 4HUQB 2VP9A 3BGWA 3LBNA 4DB2A 2EQBA 1Q3TA 1U0HC 4ZKDA 5FBVB 1WCV1 4PHTA 3VNVA 4WA7A 1GRRA 2W83A 5K8IA 1JNYA 4FXPA 2VRWA 2CMKA 4XH9B 2O52A 2J5XA 2NZJA 4LBYA 1D2NA 4Q9LA 2DBYA 2WSMA 2BEJA 2VQSA 3TW4A 3A1TA 4PXAA 1VQLB 1OIVA 1JAIA 1OJLA 3F0TA 5AUOB 4HAWA 3ZBTA 4DCUA 3RWMB 3KTAB 1GKIA 1GSIA 2JDIA 3SR0A 4IXMA 4WZ6A 4XVQA 2R6CA 2GAOA 4MRNA 4TL9A 4IKEA 4IDPA 1C4OA 4JVLA 1YR6A 2ZETA 3MWKA 3SYLA 2VP6A 2ZYWX 1FL9A 1Z06A 2Q3MA 2RGXA 2RC6A 5CJ2A 5J4VA 5FOWA 1SHKA 1W36B 3MCAA 5J4LA 3GLHB 2A5FA 1TF5A 2OCPA 1NVWQ 1Z0IA 4ZKEA 3MJHA 3SBEA 4EKDA 3CW2A 1NSFA 2F1JA 1S3SA 2QAGC 2HF8A 3LW7A 3GFTA 4RD2A 1G3MA 4HLQB 4ILEA 2J7KA 1XJCA 3FHTA 2GKSA 3KKNA 4H1UA 2BV3A 4PQYA 5H70A 1FNCA 2VHTA 4Q7MB 4CRWB 4DLSA 4ZGQB 4QGHA 3B1VA 3WMFA 2DFKB 5GADl 5DN6D 1SXJD 2P3SA 1MRNA 4A4DA 2CLCX 2DFLA 4A1FA 3LBIA 4TT3A 1PUIA 1M90D 2DWOA 3HPQA 3EPJA 5JRZA 1NDHA 5JSZA 2WJHA 1G5RA 1W4BA 1LS1A 1CF4A 3LXRA 2FSHA 4Q1CA 1K8AD 1E94E 1II8A 1R8QA 1PZNA 1U9IA 1VG1A 3H84A 4KLZA 3SZRA 1OPXA 2H17A 4QHTA 5BN4A 3OF5A 1N2CE 2PZGA 3LVRE 2QT1A 1ZRHA 1VQMB 2C9CA 2IWRA 4R71A 1VHLA 2H5EA 2R9VA 3A4LA 4XIGS 3VTKA 1JR6A 4NZYA 3W2IA 2QT0A 1TEXA 3GJ5A 2ONKA 2G0NA 2ZIAA 1VQOB 4DXAA 3SJAA 3AV0B 3CNLA 4P3YA 1JJ2B 1E1QD 1GAJA 4EJSB 2ZE6A 1DAIA 2O0KA 1BKDR 1U98A 4L15A 4NYMR 4JSTA 4Q18A 1XZPA 2WOJA 4Q48A 4DCVA 3I3SR 4KJZA 1G7RA 3ZIAA 4AIIA 3I5XA 1OT3A 3CCRB 4F7DA 3QUSA 5KDDA 2JIZD 4G1UC 4Y0AA 3CUEF 1Q22A 1X8KA 1XXHB 3P32A 4ACAA 1QHNA 2H8KA 4ZIRA 2V7QD 2BDTA 5HE9A 4GL2A 2O8BA 1JAHA 1NMZA 5H1YA 1E9EA 4YMUA 1G7SA 5JLJA 4UAJA 1G64A 1KI1A 2DHRA 4CZ2A 2JAQA 2WKQA 1Z6TA 2XOKA 4YAUA 1M34E 2D62A 1YHNA 3OE7A 5CLLA 5GJVC 1R5BA 1P62B 4B44A 1E0KA 3A36A 2RGAA 3A1WA 4NYIR 1EFTA 1SKYB 4GOKA 3Q3JB 5LB2A 4LK2A 3LQRA 1MV5A 3RNLA 1AQYA 1OW3B 4URUR 4NE2A 3TJZA 2DEUA 1S72B 3DZ8A 4QJ4A 3K0FB 5M04A 1A2KC 4AI6A 2QRNA 4A15A 3CPHA 3G6EB 2WIAA 5CIWA 2NO0A 1FNNA 2GZDA 1IXRC 5FPHA 3ZD6A 3W5HA 3D3QA 1PJRA 1TADA 3EASA 3NBYC 1NIJA 2BKEA 3WMGA 3VX4A 1QHHA 4LGMA 5IRCD 3CC2B 3UMFA 3KXKA 4G1BA 2ZE8A 3K0AB 4JLPA 2WIBA 3W8RA 1AIPA 1G4UR 3CRQA 5JSZB 2YJTD 1NBMD 1G5PA 1XTSA 2HLDA 3GLIA 2WWXA 3B78A 2GPJA 3AEZA 4DIDA 2JA1A 1ZW6A 3DZDA 4EFMA 2VZLA 3RRYA 1IBRA 4L8GA 3QOFA 2W2XA 2ZRJA 4RFSA 4DDWA 5JMTA 2ECKA 1RRPA 1ZAKA 3E70C 2F3RA 4ZGNB 2YYZA 4TMXA 3TIFA 3D6TB 3N2IA 3SOPA 1OF1A 4GFDA 1UBCA 4ZCLA 4TWZA 5C2JB 1BX0A 1VQNB 4Q01A 3AP1A 4UKDA 2CK3A 3LQQA 3SN6A 2HXYA 2VA8A 3P26A 3KTAA 1QH0A 4CYMA 2Z43A 3G82C 4IOJA 4RFSB 5KHOC 2ZRMA 1LF0A 2GCPA 3QSYA 1KNQA 2GXQA 4Q00A 2J0SA 2IX3A 2WKPA 1L2TA 1YZUA 1NRJB 1RRGA 5FTJA 5CDFA 1ZU4A 1CJMA 3RYTC 3SYNA 2DPXA 2ZAMA 1BX1A 4I99A 3VMFA 1EG7A 2A78A 3ZVLA 1EGAA 3K9LA 3W2FA 2ATXA 2IYYA 3TRFA 2FNAA 1E62A 3CZQA 4ZV4A 4Q4LA 2F1IA 2MSCB 1DG1G 5DISB 4EQ6B 3G4SB 2OCYC 4ARZA 1FX0A 1TUIA 1N6IA 1QDEA 3CRMA 2C5LA 3FMPB 3OEED 3PUYA 3OZVA 1R10A 1SKYE 4TLEA 2OG2A 1CQXA 4M9SA 2WAYA 3QKSA 1Q7YD 1OGIA 3KKOA 2C9OA 3E2IA 4E07A 3ADKA 3RS3A 2QUZA 3E20A 1KZGB 2R8RA 3GLGE 3NBFA 5J4KA 2Q9BA 4TMZA 1X8JA 1XEXA 2HXSA 3QXHA 1ESMA 4TLCA 5HE8A 1BJKA 4Q4AA 5AUQA 4BPRA 4II7A 3WNBA 3PCRB 4OQXA 1DADA 5DSZA 3CZPA 3KFXA 2EW1A 3QE0A 1BH2A 2QG6A 2W0MA 4GP7A 4TLDA 3RAPR 4GMXA 1S9DA 3OEEA 3AH8A 1P9NA 4M4SA 4ZCMA 4BLOA 2H92A 2CLSA 2OILA 2W2VA 1N6OA 1JBKA 3DEFA 4QNMA 4XWKA 3EA0A 3U61B 5AUPB 1OYWA 3GMTA 3ZQ6A 1RC8A 3MGCA 3E5HA 3UMSA 1QG4A 1DOAA 3H86A 5HPYB 4AF6A 3HPRA 5SZIA 1U9IC 3AF2A 1W0JD 3I8SA 1SHZA 4Z8YA 3JVUA 2VF7A 4JBYA 4DHEA 3U7GA 5ELXA 1E2DA 4P0TA 5KDLA 4URVR 2NPFA 1T5LA 4ESVA 4Q21A 1IN7A 3I92A 1E2EA 4B73A 2A9KA 2QBYA 1RPZA 1OSNA 4C4PA 4EFLA 3THYA 4AF7A 1GR1A 1Q86D 1OXXK 1Z5ZA 1G3IA 4LY6A 1Z08A 2A30A 5JHHB 2ZR0A 3ZBUA 4HDCA 4WXRA 3W5IA 1BO6A 2NO7A 2PLRA 2QORA 2QY9A 3U60B 2JLRA 4P4TA 2RC5A 4NH0A 1HEIA 2EFDB 1VQ4B 3TAUA 1T0HB 4XSGA 1HT1E 3OJXA 1KSFX 5L3RA 4FN5A 2OBLA 1XRJA 2CVHA 2QSYA 4DRZA 3K0AA 3QF4B 4MH0R 3TBKA 4Q4HB 2WJGA 2ZJZA 1KNXA 3P4XA 4KBFA 4A0HA 1G41A 3W34A 1Q1ZA 2XNDD 3R9XA 5CK4A 3GQBA 4DLVA 4Q1EA 1HE1C 3HU1A 2QL6A 1G19A 3T12A 2C96A 3CB4A 2J9RA 3C5CA 4US0R 1EFHA 4OI2A 5FUXA 1SM4A 2YZ2A 5FTKA 5K8LA 4KFUA 1HYQA 5SZJA 4KHZA 5GJWC 5BYKA 4YC7A 1WRBA 3GJ4A 4HSEA 4V0MA 1VECA 1KK0A 3TW8B 1GJRA 3CPEA 4NYIQ 3R9IA 1TQDA 1DELA 4EPYA 3CH4B 1KO7A 3OE7D 4A9AA 2NOAA 1YZGA 3NKVA 1T8TA 1VQ6B 3DOFA 4I81A 4AG6A 1E0SA 4HB0A 2R44A 4G5GA 1U8AA 1P73A 1CJUC 1XEFA 2XNJA 1NBME 3IILA 1B23P 1PV4A 3KDSE 3PUWA 1U2RA 4DLRA 1GWNA 1OFIA 3ONWA 1BYIA 5JJIA 2F1RA 4PC3A 1JI0A 3Q7QA 1DAKA 2HCBA 4URZR 4Q9KA 3OIVA 3CM0A 2ZI4A 1W7AA 2ZRAA 4QJ3A 1W2HA 4C30A 1XE1A 2IC5A 3DPUA 3EARA 2D74A 4TYPA 1ZUNB 1NVVR 2O8CA 1T9HA 3U3MA 3EIHA 2E87A 3OW2B 3AF1A 5DLQC 2VIIA 2RGDA 4B75A 4U5XA 1UAAA 4TLBA 5KO2A 1ESNA 4EJSC 2AL7A 1A1VA 3SYKA 2ZSEA 1KI9A 2NO9A 1F60A 2DWPA 1NG9A 2GZHA 1LY1A 2ZRDA 4JL8A 2GCNA 4TQUS 4C0QC 1AQUA 1GAWA 1TF7A 1XD9A 2ZRGA 4URXR 2JEOA 4OL0A 3KL4A 1NBMA 2Z0MA 3NDBB 2GZAA 3P20A 2OK7A 3GJ3A 1FOEB 3ICEA 2O8CB 1N6KA 2FA9A 3NEJA 2OSBA 3THXA 2N46A 3IIJA 1JR3A 2AK3A 4XD7A 3GJ7A 4JYCA 1HH4A 1Q82D 4YMWA 2QN6A 3QFCA 1I4DD 1OH7A 4DDTA 3QNUA 2QE7D 4R7ZA 4EPTA 4B6FA 2IXFA 1H8HD 1ZVQA 1SKQA 1VMAA 3R9WA 1G8PA 1XJ0A 2GEDA 3QVUA 3TUIC 1VQKB 1E96A 4LYHA 1DVRA 3FMIA 1XXHA 2PIAA 2GNOA 4U00A 3A1UA 1E6CA 1ZNWA 4Q9IA 5KNBA 5J40A 1D5CA 4OYHA 4P4SA 5FBRB 2QQ0A 2YWGA 2LWIA 3BOSA 3R8FA 3P4YA 1QRAA 3FFBA 1EWRA 1NL3A 1QHYA 1RVDA 4TL8A 1T3SA 1VG0B 1ZINA 3RABA 3C15C 2YWHA 3D7MA 4QL3A 3THWB 1XMVA 1Q21A 2CVFA 4WZAE 1WDTA 1L4UA 2PCLA 4A0GA 4BWYA 2WVJA 4GI7A 4W9MC 2IYZA 2OHFA 1YJNB 4HDOB 1E2KA 2SHKA 5EP1A 2WWYA 5IDVA 3KJEA 1NF3A 2C78A 1AK2A 1EX7A 1KI3A 2J45A 4LJ4A 5EUQB 4URYR 1ZD1A 3WMEA 3U5ZB 3L43A 4CGZA 2HJGA 3BORA 1M1YE 1ZD9A 4JLMA 3PEWA 3V9PA 5FTMA 2QPOA 2IYLD 1JQLB 2YC2C 2FDCA 1Z6GA 4KBGA 2ZEJA 4GBMA 1IN4A 4Q4JB 3X2SA 1W36C 1PLKA 4B74A 3OAAA 1UBFA 3R7WA 4M9XA 2ANBA 4B71A 2FSIA 2VF8A 2W6ID 2ZR7A 2GXUA 5GV7A 4B47A 1KDTA 1RJ9B 2QGZA 2ZE7A 3CR8A 2F9LA 4EPRA 2A2ZA 1S2MA 5DYGA 4AYWA 3RS2A 3F3YA 2IS4A 2RCNA 5H8WA 1P9WA 2WHXA 3OZXA 2JIZA 1XCGB 2BPOA 2BN4A 3U7FB 1P2SA 1OFHA 3B82A 4O0MA 3X1ZA 2V6IA 3W3AA 3RRMA 4B32A 4D0NA 1CR4A 3CWZA 2XGJA 1KJWA 2ZI9A 3U7HB 3BC1A 3ZD7A 3JZMA 2O0JA 2J1LA 1OH8A 1QFZA 2X19A 4HLUC 2JLVA 4BFZA 1A2BA 1FTSA 3CRVA 1ZCAA 2FJUA 4FCVA 1JXMA 3W8NA 1EK0A 3ADDA 2OTJB 4MGIR 4JLVA 2XXAA 3AVOA 4LDJA 1EESA 3TSZA 4QGFA 5EE0A 1T6NA 1IB0A 5L3VA 3TAHA 2VNIA 4PHGA 2QTVB 1U94A 1SXJC 3G0HA 5AR1A 1NY5A 2DFNA 3PXGA 4KSCA 2BVNA 3EZ2A 1YR8A 2CL6X 1GKYA 2BC9A 2R6FA 4LJYA 5EZ5A 4NP6A 1UDWA 2ZJ8A 4M1SA 4JT4A 3JQQA 1E4VA 3U7EB 1TTTA 4QBGB 1H8HA 2WWFA 4TT3D 1X8LA 2WZQA 1FMJA 1SXJA 3ZVMA 3THXB 2G0TA 2TMKA 4RZXA 2PZFA 3R8CA 3ZS8A 3FFAA 4GRAA 4DCSA 3DVLA 1II9A 4WIAA 1G4AE 2OT3B 3T5DA 1OGJA 3ZDQA 1Q44A 1Z6XA 4L5BA 3ZVNA 1XDBA 1GIAA 2YHSA 1VQPB 5K8TA 1VTKA 3KKQA 4KAXA 1UMKA 2VEDA 2W0SA 4G3XA 1IJEA 1SXJB 4MKFA 4UJ5A 4UXHA 5FL7D 3AM1A 2Q3HA 3VR4A 2PH1A 2ZU0C 2AFIE 3REFA 3AVVA 4NHOA 2YWFA 1TAGA 1T4GA 1V43A 1J70A 1VIAA 3DHWC 2IBMA 4CVNA 3W3ZB 4DCTA 2HCJB 1UDXA 1VDZA 2HV8A 4TYQA 2NTYC 1FQKA 4YAOA 2MMCA 2XX3A 3Q5EA 3DMNA 2ZXUA 3R20A 1XD8A 3TVTA 1CJVC 1QBKC 4LHWA 3U3KA 1SVSA 1ZM3A 2ZS9A 5FL3A 1XNJA 4BLRA 2WWHA 1EFRD 3HR7A 1MO5A 1H42A 3AVTA 1IN8A 2QE7A 4F4JA 1CKEA 2J0VA 4YONB 5E7JA 4PSAA 5J47A 4RCZA 1I4TD 2YV5A 3M4YA 2WSSD 2W6IA 4A92A 4NCNA 4U7DA 2XSZA 4PZLA 4BEBA 2ODEA 4YAWA 4IOMA 3CRRA 5EP4A 1E9DA 2GJ9A 4E22A 4DB4A 5KDOA 1IXZA 1II0A 2IYRA 2IS1A 4EPWA 2FF7A 2FG5A 1E9BA 3CH5A 2H16A 1QFYA 5GVRA 1NP6A 2QAJA 3QPUA 4O2RA 1EX6A 4BZQA 4HUQA 3RC8A 3TE6A 3ZGXA 4XJXA 1YIJB 1COWD 1KAGA 1MR3F 4UNPA 1YRBA 1G20E 1KDPA 2FSGA 3I72A 2C9YA 3K8YA 3SS8A 4GMDA 5JBQA 5KYKA 4D2IA 2XNDA 2JJ2D 1I4LD 3K0CC 4FMCB 3SQWA 4HLDA 2J0UA 2GQFA 4F4IA 2B5OA 5H59A 2QROA 4Y0VA 3QKSB 3C14C 2IA5A 2ZM5A 2JLQA 1P72A 2WMOB 2V6JA 4MUAA 1U99A 5FPSA 2IWHA 4ARZB 2JGNA 1GZSA 4KSBA 4QHYA 1Q1EA 2ZRHA 4FWIB 3KB1A 4D4MA 3K53A 1AMOA 3LV8A 3C4JA 1RYFA 5KSPA 3K0CA 3VKGA 1VQ8B 2IF2A 1Q12A 1YZQA 4MRPA 1OV4A 1KZ7B 2FSFA 5FOVA 5BN5A 1J2JA 4GSYA 5F9HA 3BERA 3NC1C 4TYYA 3B1XA 4OK6A 1FRNA 1UBGA 4KO8A 4MKHA 2QP4A 4YXWD 3ADBA 3PENA 1S3GA 2W6JD 3SDZA 1ZD8A 3CX8A 2ZYTX 2BMEA 1XFAA 1Z29A 2EFCB 5TV2A 3IQXA 2B8TA 3B13B 3CNOA 4IXNA 5B30A 3IIKA 4JLBA 4N3NA 5G41A 3SQXA 2XZPA 4LYJA 3X1YA 1W35A 2OFOA 4DLWA 2C03A 4G5QA 4HZIA 3L2OB 5BW8A 3GLGB 1R0YA 3FJOA 3EW9A 3V76A 5KTYA 1ZJ6A 1KO5A 3KB2A 5BN3A 4B76A 3FMOB 3Q85A 1W44A 4LJAA 3RS4A 1TX4B 8OHMA 1VQ5B 1II8B 2IYWA 4E5UA 3EZ6A 4NL4H 4AY2A 4CW7A 3EZFA 2REBA 4QKQA 2D2EA 4TL7A 4V0OA 4F38A 4HAYA 3I4LA 2WWIA 1ZUIA 4PZZA 4C0BA 1Z07A 4CIDA 1KMHB 2P6UA 1KHTA 3RDPA 3BAFA 4C0LA 3IKJA 4E03A 3CF2A 2AKYA 1X6VA 4W5JA 1XCPA 1XWIA 1DAGA 1M7HA 2H18A 4D4LA 1QUFA 4B35A 4ASUD 4DQLA 4IVQA 2D7DA 1QGZA 1RW4A 2VNJA 1N8RD 4LYAA 1HUQA 3FKQA 2MSDB 4IFBA 621PA 1DG3A 4W5WA 3K70D 2N1BA 1W0JA 4KV9A 3L0SA 3L8ZA 4Q7JB 4PAOA 4RD4A 2PLFA 2IXEA 3GLHA 5BQ5A 4YLGA 2EWVA 1MOZA 4NPHA 1YR9A 2IW3A 2ZYVX 3BRWD 4Q1AA 1IN5A 3TK1A 1KI6B 4DEXA 1GKUB 3FMFA 3M6AA 4WOPA 2FWRA 4A82A 2VP5A 2OUKA 3B1ZA 2DETA 4NYMQ 1SVLA 4E09A 2VHUA 2CL7X 1ZYUA 5FUYA 4RD0A 4Q7LA 4JLAA 1J8MF 4FK8A 2QRZA 5HR5A 3BFXA 3E1SA 1NJGA 3E1YE 1G9XA 2OEPA 2RGEA 3B85A 1AJEA 5JZVA 2CK3D 3WYGA 1P2TA 3KQUA 5FBQB 3BB4A 1YJWB 4KYUA 3KKPA 4W7SA 4TQAA 1TNDA 1E0JA 1E2HA 1QVRA 2IK8A 5FUVA 2K5UA 3BFVA 2RGCA 3JQPA 3X1XA 4A6XA 4Q9HA 3D8BA 1AKEA 1SVMA 1UKYA 3IEUA 2PX0A 2OCAA 2OBMA 1QF9A 1IAQA 1TQ6A 4Q4AB 2G9NA 3O47A 1NVVQ 3NBXX 1QVFB 4PANA 1DEKA 1QHHB 3H0KA 1R5NA 2DERA 4W5HA 2HT1A 1XEWY 2O8DA 3BIFA 3LAWA 5EXPA 1TLLA 3QF7A 1U0JA 2QSZA 5SZKB 4MDEA 1Z0AA 3A1VA 4MGZR 3DKPA 3L0IB 3QIAA 2DCUA 4Y9RA 2X3UA 3PG5A 1W4AA 4OQNA 3ND8A 1BQEA 3NVAA 3LNCA 3THOA 3W90A 2PX3A 1FW6A 5FOTA 2BCGY 3GP8A 1GNQA 1XXHE 5EZ6B 4BECA 2R6GA 1NLFA 2ZQ5A 4RZ3A 3GJXC 1N0WA 2RGNA 2ZI5A 3THWA 1YRAA 3I55B 2CLDX 2R65A 1XTRA 4CEHA 4Q1BA 4HEJA 4BASA 4XTCS 4LBVA 1XD2B 5BWMA 1YI2B 2FGJA 3OFNA 1DTSA 2ZRKA 1QG2A 2WJYA 1QGAA 1CR1A 3OEHD 3VR1A 2I4IA 5KSZA 2QTFA 2ZJOA 3GLGA 3QBTA 2CHQA 3DMDA 1F48A 3ADCA 2H7VA 1PLLA 1GRQA 1ONBA 4MUBA 3PUVA 3SI7A 5AJZA 4CT4B 1OKKD 1E0AA 3KQKA 3GJ8A 5CYOA 2PEYA 2CJWA 3QE2A 3QF4A 3KQNA 2KBFA 1EFUA 1NKTA 1Z0JA 4A2WA 4LX0A 3ICQB 1AN0A 4KFRA 2VSFA 3CBQA 4Q02A 2GJSA 2H1LA 4JMPA 1Q81D 2B21A 1ANKA 5FFMA 2PJZA 1Z0DA 4PC6A 3QXCA 3QJYA 1N5LA 1GOTA 1UF9A 2G83A 2ZUBA 4Z1MA 1JJVA 1M74A 1T8UA 3EC1A 1NN3A 5FOUA 2FX3A 1N6RA 4NONA 4I1VA 2AHOA 3L8YA 1UPTA 5DH9A 3HU2A 3FKSA 4Q7KA 5B64A 5JECA 2VYFA 1DAHA 3K0FA 3EC2A 1LW7A 2FU5C 2PT5A 1NSTA 4KXFB 3WXMA 4RKFA 4MRSA 3CLVA 1OH5A 1AKYA 1E4YA 2V9PA 1PUJA 3CD6B 3CCMB 1D9XA 3IPYA 2WAXA 4X8HA 5DN6A 4CF7A 5B58C 2ZJAA 3N5CA 5JJLA 4KODA 3FHOA 2ZREA 3V00A 5JWOA 1OHHA 1W47A 2EFHB 3CCUB 5KNDA 3RSOA 2FZLA 4DSTA 1MH1A 3LD9A 2ZAOA 4V0NA 1W4RA 4KVGA 4QBIA 4TSFA 3QG1A 1KO1A 1QGYA 2BM1A 4HLCA 5TDHA 4A2PA 4BZPA 4OI0A 2QTHA 4LJ6A 5C1BA 4CEHB 5CB6A 2HLDD 2I1QA 2O8FA 3WBKA 2OBNA 2WPDD 3OAAD 5AJXA 2NG1A 3NIBA 1U0LA 4BLSA 1QHXA 2HMAA 2FZ4A 4NTZA 5AK0A 1QUEA 4B2IA 1VYTA 1IN6A 1ZNXA 3K9GA 5JI3E 3QKTA 1OIXA 3DKVA 3WHKA 4IOLA 4JJKA 5UKDA 5L8VA 3X1WA 2JJ8A 1AM4D 2CEAA 4ZIRB 2QAGA 3ZZUA 1JQJC 3SJCA 3I62A 3LX5A 1BOFA 4M1YA 4N0DA 3ZQJA 3NG1A 1XTIA 4PZYA 2N42A 4JS0A 1Y3AA 4PO8A 4OK5A 2O0HA 2RKOA 1ZM2A 4ITRC 3RRZA 4DT1B 2P6NA 3QY0A 2JCSA 1X1SA 2XOKD 4NKRA 2G3YA 4RD6A 2GBLC 2J7PA 1UJ2A 3IQWA 2QA5A 4KLNA 3AB3A 2ZRPA 3FGNA 4XTRA 1AGPA 1E99A 4OKSA 2V7QA 1P2UA 2OE2A 3SJBA 3W2GA 1KK2A 2QM8A 3QKRA 4YDSA 4Z54A 2NO6A 3MMPA 1SVWA 4FW9A 4JVMA 4BUJA 1IM2A 5TVKA 4BLTA 1JA1A 2J3EA 3B1WA 2EYUA 3VQTA 3ZIAD 4YMSA 3HP1A 2DFTA 2BGJA 4GZMA 4ZDWA 5H5JA 4GDFA 1D9ZA 2QPTA 1F2TA 1E1QA 4EH1A 1YZLA 4QGGA 1W48A 3Q72A 3DM5A 4AK9A 2CL0X 1E2MA 4RVCA 3MG9A 1M1KD 2GK7A 3C7KA 3EX7C 3LLMA 2ZYUX 4PPGA 4BFTA 4BRWA 1RRFA 3NDPA 4EDHA 1YZNA 1DE0A 4LJ8A 4TTPA 4EAQA 4D25A 1T3LA 1LVGA 1R5OA 2AWNA 4O2LA 3PEVA 5KPDA 2BBWA 1VG9B 1I2MA 5D3QA 1W2GA 1U90A 2RGNC 4TMTA 1XD2A 3AVXA 4Q4HA 1WE2A 1G7TA 2GHIA 3IHLA 1KDOA 5CLQA 2CNWA 1N0VC 2FFBA 1H8ED 1RYHA 721PA 4GOXA 1KSGA 4F91B 1BIFA 4LCBA 4DLYA 4JT2A 3CCLB 5A4JA 1GTVA 5JHGB 1R0ZA 2GJ8A 2X2FA 3I56B 3BD9A 4IW3B 1HQCA 1AGRA 1XJQA 3VX3A 3K1JA 2Q21A 3UWKA 1R0WA 5AN9A 1OB5A 1XTKA 3Q8XB 3T06B 4IVRA 1IXSB 1F20A 4CEJA 3B60A 3VR3A 1E3MA 3KXLA 3T61A 4BFWA 4C0KA 4R98A 5EE1A 3OESA 1W5TA 4WQMA 5CIQA 3BB3A 4PSKA 5FUWA 2ZS7A 4MQBA 5CITA 1J8YF 3W6NA 2BMWA 5JWHA 2WBLC 5EXSA 3IBYA 3G5UA 5TARA 2YOFA 1W36D 2CCJA 2C99A 3ZH9B 1M7BA 1N25A 2O8BB 2C04A 4XVRA 3LVQE 4C2TA 2Q6TA 3MAAC 2CJWB 2HDNB 5FPYA 4XD7D 4MYUA 1P61B 1G7CA 2I1VB 2WKRA 1JR3D 1NMYA 3EAQA 5EQTA 4NMMA 1FDRA 5KSOA 5FTNA 1UEIA 4WBSA 2V8OA 4FMCF 1DARA 4B3FX 2GA8A 3MFYA 4JVSB 5JFGA 4OQLA 2JJ1A 4XVUA 4C0SA 2BOVA 2A5DA 3RRNA 2YOHA 4PX9A 3RSLA 4PHHA 4LRWA 1F2TB 4IJMA 1MRSA 5EXTA 4I1SA 1PLJA 4KYIB 1JA0A 5HTKA 3B1YA 2PEZA 2ERXA 3VU9A 4Q03A 4RFVA 1M6NA 1E2FA 3BH7A 3GEEA 3NBZC 2WJJA 1CS4C 2HYIC 4JL5A 1CLUA 2ODNA 3KKMA 4TMKA 2GVDC 1JPJA 3N2EA 4QBFA 4B4DA 1X86B 4BZXA 1E1RA 3CPJB 3U6BA 3JQRA 5LBIA 4DLXA 4TZ6A 1K5GA 3FWYA 4PQRA 4RSGA 3TQCA 1A82A 3T5GA 5AWFC 4IDHA 5LB4A 3GLIB 1IJFA 3UANA 3H4MA 4BFYA 4CT5A 3UKDA 1B2RA 4OI4A 3TKLA 3GLHE 4O25A 4U02A 5DGXA 1Q57A 3ECCA 3GFOA 4A0RA 2FEMA 4AYTA 4Y9UA 2IL1A 4UQOA 4F93B 1R0XA 2XNSA 4RCYA 1ODFA 4R2IA 2CE2X 4BLQA 2NGRA 1X1RA 5CYPA 1W5SA 5FPTA 1XCMA 2V1XA 4Q66C 2V4ZA 4JLJA 5KSYA 1A7JA 4TMWA 1CRPA 4RKEA 1WB9A 3HYRA 1J99A 1KOFA 1Q3HA 4DIEA 4LWZA 4KITB 2ZI3A 1VYUA 1SVKA 3SC3A 4RD3A 4YAFA 3CKLA 4M1TA 2GXSA 2BWJA 2VNHA 1KI6A 2OAP1 3AGQA 1F2UB 4PSVA 5DO9A 1H85A 2JLSA 3CONA 2QMOA 1TVCA 4G0NA 3BS4A 4O3MA 4DSUA 2WICA 4PAQA 3WHLA 1GITA 1KD1D 3A1SA 3AUXA 1UBEA 3FPAA 4RY2A 4CDGA 4XWOA 3LA6A 4G5SA 2AD1A 4I1UA 2R6AA 3L82B 2F43A 3T1TA 2JLYA 3RLFA 3PQCA 4MKIA 4AG5A 4DKXA 3QFTA 2ZI6A 1FNDA 1U81A 1LF5A 4PC1A 2IUSA 5G40A 4DLUA 1KTVA 2F55A 3SJZA 1W4CA 2J0UB 1WBBA 2CCKA 3TGPA 4F92B 1WQ1R 3BJIC 3OHMA 4V0LA 4WXPA 3AP2A 2ZUDA 4NBSA 4MKGA 3QKRB 3RVBA 3QEJA 1E2IA 4TLAA 1P7CA 5HXBA 2C95A 4F4CA 2QNRA 4QFMA 4A8JB 2DWQA 1TL7C 1P5ZB 3AGPA 2Z5FA 2F1HA 2P5TB 1G16A 2AN9A 3SHFA 4D0LB 3IEVA 4DLTA 3LO8A 1E79D 5KSWB 2C98A 2D06A 4P31A 4K1XA 3ZYCA 1YJ5A 3GLIE 1HA3A 2FN4A 2IYQA 2ZJYA 2GXAA 4UXIA 3FYHA 1TUEA 4A2QA 2VP2A 4C3ZA 1S8FA 3EPKA 1R6BX 3TLXA 1Y63A 1ZU5A 1ZIPA 1KK1A 3TSOA 3BWDD 2ZJ2A 2OFWA 4JLNA 1CNFA 1P9RA 3QEOA 5LD2B 1FNMA 5LPNA 2A3RA 1OE0A 5FTLA 3U2QA 2J46A 1HURA 2VH5R 3AKDA 3C16C 1IQPA 4L4UA 4LSGA 2BKUA 2HYDA 5J5CA 1CIPA 2GCOA 2YC4C 3J81k 4M0LA 1MT0A 1YU9A 4DUGA 3CO5A 3THYB 2YNMA 3MWYW 2IYTA 4JKYA 3U3RA 4AWXA 1ZM9A 1G3QA 2BJWA 4DWJA 3PIRA 4M8NE 1XMIA 1BMFD 4WZBE 5AUNB 4IOKA 1YE8A 2Z4SA 1NVUQ 1XF9A 2P0EA 4LJ9A 4BFUA 3B9PA 2KE5A 5C4GB 3W6PA 5LDDC 1XPUA 4EPVA 1NN5A 3KUCA 2EFEB 2GCOB 4V0KA 2KI5A 5DI9A 5C4MA 1JECA 4DSOA 4L9WA 2XTZA 1TF2A 3VO2A 2G6BA 4UNNA 3SFZA 4CEJB 2F6RA 4XOIA 3U3OA 5KU1A 2ZRBA 4FMBB 1C1YA 5E7MA 1UEJA 3I73A 3AUYA 3IPXA 4ZI3A 2QDXA 2UVQA 3U44B 4TMVA 1M2OB 2GDJA 4PPFA 4DDUA 4A36A 3IO3A 1ZMXA 2QAGB 3EZ7A 1YR7A 4ZPXA 2PT7A 4M1KA 1CR2A 2Q9CA 1CULC 5KPJA 421PA 1IY1A 1O87A 1Z22A 1KI4A 2BBOA 1NLZA 3UK6A 3PUXA 3PVSA 3U6KA 2KJQA 4OHXA 2IHYA 3K0EA 3PV0A 2Q3FA 2Q9AA 2QP9X 3KZ1E 1VPLA 4CEIA 4HZUB 4Q1FA 2QTZA 1HV8A 1M8PA 3QPVA 4A6PA 4JYBA 4B33A 3NH6A 4JZKA 2IHBA 5FR1A 1NIPA 4FINA 5TY0A 5D3MA 3RS7A 3QVVA 2J87A 2JLUA 3EXAA 4HZUA 1E2LA 2AD5A 1JB9A 1RZ3A 1Q20A 2OLJA 3AF4A 3CF6R 4YQFA 2OO7A 1D6JA 1IONA 4C0JA 2PMDA 1K9MD 4D82A 2NZ8A 2PBRA 3PITA 5FI1B 1OH6A 3LRPA 4LZZA 5D3MB 5C46F 3GEHA 5EP2A 1FTNA 1D8TA 3CC7B 4H1VA 3IDQA 4LUCA 4PC7A 4FCTA 1OKKA 4OQFA 1DO0A 3LBHA 4IEIA 1ETUA 2FFQA 4ON9A 1VG8A 1VCIA 2WOOA 2WM9B 3Q7PA 3K0SA 1F6BA 2L0XA 3W9YA 3WP1B 2BBTA 2I3BA 3BE4A 4D6PA 4AYXA 1W0KD 1S1MA 3LDAA 2QMUA 4RD1A 2XB4A 3OFND 2O8EB 1NN0A 3ZZTA 1G8GA 3QQ5A 5JEEA 1Z63A 1KGDA 1DBSA 1T0JB 2FFAA 3FB4A 3IBGA 3IHWA 1QFJA 3CR7A 4ZI2A 2VLIA 1T3HA 3RS5A 1R8SA 3GCGA 3QXJA 5F2EA 3SU8A 4Q19A 1FFHA 4ZDKA 3HJNA 2VL7A 1XTJA 2VHJA 4D26A 3O8DA 1OFTA 3U4QA 1P3JA 1N6PA 4LHVA 4A8JA 2F9MA 2BGIA 5L3QB 2IYUA 2UZIR 2NIPA 4BRUA 1N5JA 4LBZA 2P67A 4LPKA 3GPLA 3P27A 1KC8D 2EVWX 2V1UA 4D81A 2ZRCA 3CX7A 2ANCA 3QI2A 4HB2A 4A0FA 2R2AA 4X8OA 4C43A 4RJLA 1CJTC 5JRJA 1SVOA 3S1AA 2VSOA 3SE0A 5J4HA 2A5YB 2HUPA 3CX6A 2FEOA 3TH5A 4NCJA 4LJ5A 3ND9A 4M9QA 4AURA 5FH9A 1MO3A 2YINC 3LVBA 1JB1A 2VBCA 4PFSA 3ZVRA 1TPZA 1VIYA 3MHPA 1NMXA 2HEIA 3C5HA 2HJVA 1GM5A 5IK2A 4HAVA 5CB8A 2CE7A 1FUKA 1SXJE 4AKHA 4TN1A 1KJYA 1TQ4A 2ODBA 3EIQA 4OJQA 5JCZA 4PQFA 1G6HA 1AZTA 4PGOA 1VQ9B 3BH6A 5TXGA 1L8QA 3HYTA 3B5JA 4DUGD 2OCBA 5THXA 3WNCA 2OV2A 4AD8A 2J41A 4Q4JA 3A4NA 3I1FA 1WA5A 1Z6YA 4M53A 3WRXC 1S96A 3UG7A 2GEUA 2RHDA 3B6EA 4A8JC 1I2DA 5G3YA 4QM6A 5TB5A 2WJVA 3ES9A 3GLFE 4JKIA 4ERNA 3RHFA 4B3BA 1Q0UA 4Z51A 1Z6AA 1F5NA 3HWSA 1XP8A 1F3OA 4LC1A 4D80A 1N6NA 4US2R 3G71B 5IT5A 1G3UA 1E79A 3LFUA 1DDGA 3IUYA 1VYVA 4HB4A 1YITB 1OXTA 4WW0A 1HE8B 5A5GA 1BMFA 4LHYA 2O8EA 2O8FB 2JDID 3CWQA 4V02A 4Q47A 1JR3E 2IS6A 3MLEA 3TSWA 5HZKA 2CDNA 2VNKA 2Z4RA 5EJEA 2DYKA 4IVPA 5JS7A 2QTLA 2CHGA 3FHCB 4ASUA 1AZSC 3KX2A 2BSAA 2IYVA 2FV8A 2MMGA 3VFDA 1FMLA 3FE2A 1IHUA 4F7WA 2XZLA 1KY2A 1DS6A 4URWR 3PFIA 4LHXA 4P33A 4TYWA 1YQTA 2GK6A 1KI2A 3RC3A 1NY6A 1KYIA 5DYIA 2P65A 3EIEA 1XPRA 4RZ2A 1E32A 4HAUA 1P60A 5GVSA 1AA9A 4TTRA 3LLUA 1NG1A 2JJ1D 5E4FA 1S9HA 3S1AB 1ZIOA 2Y8EA 3MWLA 3OJWA 4DT1A 1FPMA 3GJ6A 4OK3A 1M7GA 5FA6A 3F5FA 2ZITA 3M0EA 2D7CA 5EE3A 2ZRFA 5DHFA 3EPHA 4POAA 4GNKA 1ZM4A 4EIWA 4QG7A 6Q21A 4JLOA 4D4JA 3VO1A 3QBVA 2QENA 3QENA 5H68A 3ZZ0A 4GZLA 1GG2A 4TQ9A 2VHCA 4YALA 3GJ0A 3KJGA 1S4QA 1G8FA 4OI1A 2EU8A 1G5TA 4MGKR 4TL6A 2EFGA 2QMHA 2OXCA 1W49A 3CNNA 1QX4A 5AJWA 2RMKA 1JEEA 2DY1A 2AXPA 1JALA 2IUTA 4OQMA 2OFXA 1ZBDA 1KMHA 2QI9C 2XJ9A 4LHZA 3CF0A 2G88A 4MRRA 4Q9JA 3CIOA 1GDDA 4MYTA 4BEJA 4UXJA 2NMVA 2ASEA 4HDQB 3X1DA 3QFRA 3CC4B 3V4RA 3H1TA 3RS0A 3WYFA 5HCIA 3NC0C 2WV9A 5HKKD 4KFTA 2O8DB 2ORIA 4AC9A 1IY2A 2GRJA 2VTKA 4Y7CA 4LPSA 3K9NA 3DM9B 3VHLB 4B2LA 2XNCA 4TZ0A 1W1WA 3RWOA 4YMVA 4N1AA 2QBYB 2BJVA 2BMDA 3MRSA 2GJAA 1B0UA 2D4HA 1US8A 2WJIA 4DDVA 2WWWA 3O8RA 4BPBA 3AF3A 2X77A 2ORWA 4JSYA 1OLOA 3GD7A 2CHVA 2VSXA 5DNYB 4OHVA 3ZC3A 1S0UA 3H2YA 3Q9LA 3VKHA 3WY9A 2VYQA 3OIYA 2FE4A 1OB2A 1FZQA 2REOA 5P21A 2FH5B 2X1VA 5G3ZA 1DO2A 3MSXA 3CRZA 3MWJA 1Z2CA 4FWTA 1N6HA 1KO8A 3PEUA 4ZO4A 1OXVA 2J0QA 3CCEB 2OM2A 3CMEB 2A5GA 1BS1A 1DAEA 2ZSFA 3UWOA 2CXXA 4ESHA 1NJFA 2V54A 3BH0A 5JCPA 4DQKA 2UZ3A 4JVNA 4EFNA 1JEDA 2ZI7A 5EE9A 4HAZA 2ERYA 2Z83A 1P4SA 3ETLA 3AVWA 3IO5A 3OZUA 1CR0A 4QGAA 1XEXB 1KIMA 3MUFA 1HTWA 4B3DA 2VHQA 1HT2E 821PA 5K8UA 3KQHA 221PA 2LKDA 3B9QA 1FRQA 3W5JA 2XZOA 4YMTA 1SGWA 1XZQA 4LI0A 4LV5B 1UKEA 4NDZA 3KQLA 2GEVA 4G5OA 5C18A 3NXSA 1JJ7A 5J4YA 5HZHA 4TYNA 4B43A 4DEYA 4WAUA 2R6DA 1CEEA 2BM0A 1QHIA 1NI3A 4HYYA 3MD0A 5FL7A 2F7SA 5F3WB 3CMAB 3R7WB 1D2MA 1DDIA 4BQSA 1RRCA 3WYAA 3JVVA 4HATA 1XMJA 2W58A 3I8XA 5B2ZA 1Z0FA 1NNEA 2CRVA 3AQ4A 4P4UA 3TUJC 5FPKA 4MYCA 4DSNA 3A4MA 3VAAA 1E98A 3DDCA 4MA4A 3TR0A 5HKKA 1XPOA 1G6OA 3NEYA 1E2JA 2G77B 1LB1B 2CCGA 1C9KA 1N3BA 2D2FA 2ZSAA 3WNDA 3DO6A 2IYXA 3FVQA 1TEVA 3HU3A 4DC9A 1CNEA 3EG5A 4Q5IA 4DJTA 2GVZC 2C77A 4NU0A 4EPXA 1F2UA 4M21A 4LBWA 2XAUA 5AJYA 4OBEA 3RANA 1D1NA 4QRHA 5KNCA 2ORVA 3Q5DA 5LD2C 1VHTA 1ZNYA 2KB0A 2GJKA 1UADA 3D31A 1Q1QA 2B7BA 4IDQA 1AS2A 4KCGA 4TTQA 3OIUA 2FOLA 3PJRA 5BYJA 5L3QA 1EXMA 4HE5A 3I5YA 4DCNA 2V3CC 1A4RA 4CEIB 1UM8A 3U4QB 1XBTA 1UFQA 1E9RA 1GL7A 1LV7A 4HLUA 4B2PA 1UKVY 1N0UA 1KKMA 3AKCA 4NCKA 3PR1A 2VP0A 4PC2A 1U8YA 4FCWA 1JXOA 1KKLA 2P2LA 1YZTA 2R62A 1ZNZA 3ASYA 2W2TA 1E2PA 3LWNA 3NHAA 5FI0B 5TMPA 4V0ME 2ZJ5A 2EYQA 1LFDB 4GPTA 1E69A 1E63A 2J7PD 1CTQA 1YVDA 2ZRNA 3F8TA 1FX0B 3NH9A 1WF3A 2AXNA 5EXXA 4PR0A 2GF9A 5DHAA 4LOAA 5GJBA 2IT1A 1IOZA 1XB2A 2GESA 5B57C 1CP2A 2OZEA 2ZVQX 4QXAA 5JI2E 4GOJA 3EWSA 2O5VA 4OHWA 1OXUA 2GF0A 2PMKA 1KSHA 2BEKA 1FNBA 4B3CA 1R2QA 2A5JA 1KI7A 4L16A 2KBEA 4LV8B 5L3SB 2P6RA 1BYUA 1DPFA 3BB1A 5BXQC 5JJKA 4G5RA 2BMFA 3HDTA 1XU4A 3QG5A 4UNQA 2QEXB 5HCNA 1KAOA 1YJ9B 2BBSA 4DLZA 1S1CA 1GVHA 1HQYE 2AWOA 3GEIA 4LC0A 3GLFB 3UG6A 1EWYA 1AS3A 3T1VA 5F98A 2YKGA 4ZCIA 1CXZA 3AVPA 1GNPA 2JLXA 1MABB 2A7QA 4M1WA 2RGGA 5CK5A 1P2VA 2G1KA 2ZSDA 3KXIA 3QPWA 3TVDA 1Z47A 1T5IA 1QHGA 4ZDIA 1NVXQ 4QNRA 4DZZA 2GTPA 3ZS9A 5CDFE 4J0QA 3K09A 2E9SA 5JS8A 4M9ZA 4ABYA 2XEXA 1G8HA 1ZCBA 2Q0HA 1OIWA 2LCFA 1OHHD 1SVIA 4UNSA 1H65A 1V5WA 3SEAA 4M2LA 3UIEA 4C2UA 1J9ZA 1TU3A 2IYSA 3REGA 3V4FA 3VHXA 2GILA 1GILA 3L0PA 2OXRA 2BIFA 3MJRA 2FPMA 2XTNA 1DAMA 3WRYC 2ZTSA 1GO2A 4PO9A 3A6PC 5IK2D 3K9HA 2BHRA 1E9AA 1FUUA 3CCQB 4EQ6A 2PCJA 2ZPTX 3QFSA 1GL9B 2QMEA 1Z28A 4LV6A 4QM7A 1K8RA 4LJ7A 3AKYA 2WPDA
chains in the Genus database with same CATH superfamily
2VDPB 4HS9A 3OIWA 4MNTA 1XAJA 1XZIA 3WP0A 2O4UX 3PQ2A 1OROA 1ORWA 3PFFA 4MJ3A 2IS2A 1Q91A 1G20B 1NMEA 2R85A 3O8BA 5CR9A 3C6MA 4HVCA 1RFGE 1HDGO 2GD1O 4TKUA 1YBAA 2QAIA 1FP6A 2JVKA 3IAM6 4O63O 1PR5A 1Y7LA 4V03A 1GPLA 3D3NA 3ZWDA 4OOVA 4M1MA 5FO0A 1V8ZA 2XLBA 3KBBA 3PHGA 5IM4F 1JH9A 1E5DA 1X7YA 1I2ZA 4C29A 4D02A 4EX7A 2MDTA 1R64A 1JDJA 1JWLA 4X8IA 2RBGA 3A2LA 5U4QA 1YKSA 2ZANA 1UKZA 4PX5A 4DLVA 3BTOA 3AEKA 3H5NA 2QEQA 4KN8A 2IUUA 4LZAA 2YXBA 2I3GA 4X8LA 5FYQA 1V25A 2PL3A 1M1YA 3CF4G 2RJOA 4WK6A 5D8DA 4C4XA 4CQLA 2OCLA 3FYUA 4PPQA 1GUYA 4DA8A 2RGYA 5HIJA 4KGVA 3NV9A 4UTOA 2ODWA 4ZANA 4BJ1A 4Z9FA 1ZUD1 2GRAA 3O8QB 4QOSA 1JHPA 3QWBA 5DCUA 3WIOA 2O6HA 4L51A 3Q8LA 1LK0A 4WZKA 2H9IA 4FBGA 2RI6A 3CNBA 4CI0B 2HC9A 4ZJYA 1O0BA 4D8YA 3PCXA 4G67A 4YJ3F 2XUDA 4KI0A 3U3JA 4NE9A 4C0AC 2QX8A 1JMKC 3LPCA 3AM5A 1SU7A 5AM3A 4IRUB 1Y0RA 3R6GA 3C3MA 3AQIA 2BY4A 1I33A 2Y0CA 3NJ4A 2O2HA 4MKXA 3RK0A 2RE8A 3V6MA 3JQAD 4WVFA 5CLJA 3O8CA 4ARIA 5CDUA 3C41J 2KSQA 2PXCA 3DD5A 3RUHA 1TMYA 1HEUA 1MQAA 1AKUA 2FPGB 2QJOA 3PP8A 4LTMA 5KOJA 4XCXA 5KOYA 2VDOB 1G21E 4DYHA 1K5PA 2YS7A 1FVOA 1TKRA 4BV8A 1V48A 2QPAA 1I5RA 3SCZA 5FR2A 2E18A 3BH4A 1VCOA 1N92A 4IMRA 4L9SA 2VP4A 1QTRA 3HO8A 2VHXA 2CYBA 4KI7A 1UKBA 4O1HA 3AZQA 3CXCB 1TRHA 1ULTA 4BNLA 4HH0A 3BK2A 3GGOA 1NP7A 3L02A 3GP5A 4ZTUB 1ADJA 2WABA 1RIFA 5G0SA 4UTNA 2ZUFA 3I04A 4CLEA 1DKNA 3I30X 1NKSA 3JAKB 3BSYA 1X3SA 2OAQ1 4WLEA 3RK4A 1REQA 2A1UB 4IHQA 3M9LA 5DOVA 2WIGA 2X8AA 4ZZ1A 4GT1A 2PZEA 3BK7A 4NS4A 3V1TC 2C9DA 2OD9A 3MTJA 4G1EB 2I5PO 2YWEA 4XFJA 5CM9C 2WYWA 2ZJ0A 4OX9B 2Z2XA 4H4CA 5F12A 1L1RA 1RE0A 3VNQA 3FJYA 2NYAA 4FMDF 4OLHA 3QVXA 4B4VA 3FOZA 3QBDA 1BWPA 5I6DA 4DLNA 1T5OA 3VR2A 1G59A 5LZ4A 1T6YA 1BOOA 3ZD9A 5D86A 5HXAA 1QKIA 3KAJA 3E7FA 1MO2A 2GF2A 1M0SA 3B7GA 4JLDA 4P58A 1H69A 3PNVA 4UEOA 3ESCA 3HN7A 1M73E 2ZFUA 4GQBA 3TLAA 1RRMA 4H17A 2REXB 4JP8A 2Y1WA 2P5SA 1WHSA 1HYEA 1ZMRA 3KSUA 4MDHA 1ODKA 2P9ZA 4OXYA 4BL5A 1KO4A 3GFSA 3V7UA 1ZUHA 5CJPA 2IV7A 3R4VA 5FWNA 3SHWA 4YRCA 1KETA 2GWHA 4P3OA 4LY0A 2ZRLA 4PCAA 3L4BC 5DHTA 5EIWA 4YRZA 4N47A 1M34B 1ICEA 1WCWA 2G5PA 1EWKA 1VE3A 4RMIA 5LA6B 1ID1A 5TJ9A 2JASA 3TO5A 4E5SA 2RD2A 5EMNA 3NDIA 2JI9A 2PD3A 2DF8A 2IDZA 1A8PA 1I8TA 3LO5A 4J0IA 5DP1A 1JQ3A 1TA9A 3HG7A 1V2GA 1J2YA 1G66A 1MLDA 1W0CA 2J3IA 3KUDA 4LE2A 4EG7A 4RY8A 2RK4A 4R2HA 4EMUA 1OXSC 4HDSB 4RULA 1D04A 3N9IA 2WWGA 4H4DA 4OXQA 2CBZA 1KXZA 3P2OA 4UU8A 2MCFA 4BTVA 1Y5RA 3B3FA 1PT5A 2G7ZA 3OLZA 3QXSA 3CTAA 3KE9A 4X71A 2IF0A 3ZHCA 1XSEA 3FVVA 1ZI9A 2WTUA 2G08A 3CHYA 4MJ7A 3WR5A 2HI0A 1I2AA 1GUFA 2PKQO 2QX7A 3AKEA 5B4UA 5EQFA 3KIPA 2B8NA 4TT8A 4DSZA 2FRVA 2AUTA 3ZOZA 1ODCA 3FTQA 4RPCA 5DIFA 5D84A 3H4TA 2CL5A 2EEZA 3LECA 1V9SA 3KJIA 1B00A 1LSUA 2JATA 2P9GA 3C7CB 3KAKA 4X92A 1YB2A 2QPLA 5ALHA 3I2IA 3I6BA 3T1QA 2JLZA 1QR6A 4ZT6A 3DE7X 5MN6A 5JASA 4FFBA 3W5UA 2FUCA 4BFSA 4IHJA 2ZL7A 2QR2A 5HDQA 1ENOA 4QYMA 1NWHA 5CH5A 1W59A 2K7FA 1UP6A 3UNXA 4MR8B 1R4AA 4JP2A 1M10A 3FYSA 2QQEA 3G2IA 2O1EA 3QE3A 3C74A 4KWEA 3GGDA 2O2ZA 5EWJB 1KRWA 5TR9A 4S24A 4TZKA 1YBHA 4EUNA 1CU1A 3WMRA 1GUAA 3G0BA 1RS0A 3AMVA 1CNMA 3AM3A 3PKZA 4E51A 4LECA 3D0QA 4NYJR 1RWPA 4QRIA 4OHYA 2QU8A 1NXSA 1EEXB 3I34X 4M37A 1Y4SA 1NN1A 1PT8A 4A5OA 2JFVA 3ELUA 4KAFA 4CM5A 3ADPA 6NULA 4MGYR 4BFVA 2KS6A 4WINA 1EUDA 2H00A 4ZD6A 3O2SB 1O9BA 2YFQA 1CS0B 1GUBA 4IFIA 1M76A 1ZC4A 4KAAA 4MVJH 1M0WA 1FDVA 1Z83A 1N4AA 3SEFA 1E2QA 2H5LA 2X9LA 3GEMA 2I67A 1N1DA 3FWNA 4JL6A 3SWWA 3LRTA 4JLKA 1GN8A 4IS2A 5K03A 3H11B 1PCXA 4QO8A 2X5OA 2ECFA 4JGBA 1LK7A 1S7GA 1I5EA 2OYRA 4HGQA 4TLMB 4YHHB 3L7YA 4KIGA 5FNVB 2OV3A 2YIDA 2FMXA 1C41A 4UZSA 2JGKA 4H1WA 1P2FA 4EECA 1CT9A 4K81B 1V96A 2YVUA 2XADA 4WKBA 3RVNA 5C9ZA 3LZDA 3T38A 5L4LA 1XRQA 4YXWA 1T91A 3OE4A 4CIYA 4KVAA 1N5DA 5EIEA 3R24A 1N8TA 3AVQA 4QREA 1U2SA 3GN2A 5KWJA 1RHJA 3L0OA 3GRUA 4O4IB 1LWOA 1SUCA 3B6IA 4XYEA 5G1NA 5JFTA 1T35A 1L7MA 3M1LA 5LYYA 3ZGLA 4US1R 1MTZA 3M1IA 3NM6B 2WP8J 3O26A 2FTKE 2OESA 3Q12A 4QC2A 3ESAA 3GGSA 1WP6A 1NHGA 3WBJA 1N8SA 1REQB 2A1UA 3H9GA 3JRXA 4HAXA 3W2EA 2WSSA 2VPPA 3CCJB 4IFEA 3S0JA 2GFHA 1N5IA 1WS6A 4LXIA 5HBRA 1JSZA 5K0FA 4Z7NB 3IURA 5E95A 3PGVA 2Q0SA 2WVAA 3AR5A 1U8ZA 2HTEA 2Q3CA 2XMSA 2L2QA 1IY0A 3HV2A 4LW8A 3B3AA 1PGQA 2KWIA 4HWPA 1N0HA 3MCUA 4JJZA 3DDYA 1M0EA 3W5AA 4LY3A 3OPOA 3JY6A 2C4UA 1RKBA 4TWJA 4TUYF 4WK2B 4C9BA 3QKIA 4TKVA 2R4TA 1C30A 2DRIA 3WLJA 1U4SA 4E12A 3GG9A 3I6MA 4HL6A 4LSWA 5C1DA 3EXHB 3W2HA 3NEPX 4HUQB 2VP9A 5IYWA 5B1DA 5C51B 4I4TA 3BY2A 4K8RB 4TXJA 3LBNA 4AT1A 2EQBA 3PNLA 3TTWA 3VU0A 4CM1A 2O2EA 5T8KC 1KE1A 2WJ4A 1WCV1 5FBVB 3VNVA 1FVHA 4GPBA 1KYTA 1OC4A 2NTVA 3DR3A 5K8IA 3K9BA 3VI3B 4U7JA 1QLWA 4DNTB 4TV8B 1H3FA 4B4WA 4QTUB 1YFZA 1ZJ4A 3I04M 4KH1A 3PDIA 4LBYA 1JJFA 1UDAA 3LGSA 2AZXA 3BUSA 1YLOA 3TW4A 1T5DX 3NPMA 3A1TA 1T25A 3QMPA 4CM3A 1U1GA 1ZMBA 2PIDA 4CV3A 3OQ6A 5AUOB 3QSGA 3ZBTA 1JU3A 3LK7A 4JB2A 3X1MA 1Q0ZA 2ASVA 2JDIA 1MVOA 3PQ6A 4J03A 4MYDA 1ZJZA 3J7TA 4HFNA 4QQFA 4XVQA 3SR0A 3BMXA 4TN5A 4MWOA 3SM9A 1KOGA 4DFDA 1J42A 5ADVA 1EVIA 2A0WA 2BSXA 2EG9A 4CQMD 1MIHA 2P4EA 5BURA 2R7KA 4C03A 4IDPA 3O31A 1KDVA 4JVLA 3X1WA 1D0IA 2ZETA 2RAVA 2VHYA 3SYLA 3TZEA 1Z06A 2HK6A 2RGXA 3X0DA 1JG2A 5FOWA 1SHKA 4UBNA 4UC0A 4HGOA 4CMBA 3GLHB 2QMQA 1ZK2A 4RPIA 1M5TA 1IAVA 4NDAA 5FCDA 5HF9A 1IZ9A 4EKDA 3CW2A 1NSFA 2F1JA 2ID8A 2QAGC 4PCLA 1RXSA 2FRDC 5K0CA 1G3MA 2P3MA 1DBIA 2WF6A 2FLKA 4II3A 1PFQA 4MI3A 4RKRA 1I6MA 2BV3A 3M4NA 4PQYA 2RKWA 5EZYF 3FNHA 2C2XA 1Q17A 4D46A 5CFOA 5JH7F 1JIVA 2FMFA 4FLMA 3B1VA 3WMFA 2DFKB 5GADl 4BBAA 4BWFB 3HCFA 4JUIA 5FYDA 5AK3A 1O03A 1FFWA 5DN6D 4HNQA 4LZWA 1K3FA 5HFAA 5IJXA 5HQ3A 3J7AC 5IYPA 2CLLB 1Y7TA 2CLCX 3HFSA 2DFLA 5C31A 5JCJA 3LBIA 1VL8A 1B6TA 1ZX1A 2OP0A 2XWBF 1MW9X 1L9KA 3H04A 2A9OA 3BREA 3HH8A 3JASB 5KYWA 3EPJA 4J8PA 1NDHA 1ZKMA 4JR2A 1O96B 3C7TA 5DM60 5HJ5A 2V9ZA 2Z9DA 3LCVB 4Y9DA 5CVEA 3V1MA 2XYPA 3BMNB 3EXEB 4Q1CA 3K1AA 1SBQA 5EJ9A 2Z8YM 4BB6A 4KLZA 5ERYA 1OZHA 3LUKA 5IFKA 3JPYA 1YJ8A 1OFVA 4N9QA 5J2TF 5AIAA 2C2WA 2C9CA 3PXXA 2HRDA 1SIWA 3WS7A 4XA8A 2JFNA 3DFMA 3A4LA 1ZH0A 3HZZA 3R7SA 1JR6A 3DTVB 1XKTA 1LA2A 4PVDA 3SPXA 3TINA 3DQPA 5AIBA 3GJ5A 5LQAA 1P7ZA 2ZIAA 1NAIA 3ADBA 5BW6B 1JFSA 4Z4IA 3BICA 4RSMA 3GEGA 1V7ZA 1E1QD 1ODSA 2VRCA 3L1HA 1R0LA 4M3NA 5HCUA 4QFDA 3T9DA 1U98A 5FORA 4NYMR 1H9BA 3IXMA 1XZPA 1O1YA 2WOJA 5I47A 4BUZA 3FPBA 1POWA 1G7RA 1O94D 3I3SR 3G8YA 3FSJX 2CJYA 3AJ8A 3OKPA 1GPYA 4KVZA 1OT3A 3FVRA 1MQSA 4I5IA 2O3JA 3K73O 3MT0A 3QUSA 4JDPA 4GMFA 4JUDX 4NX2A 4DARA 5MHTA 1X87A 1AUXA 1CDEA 5JQGA 1Q22A 4RS4A 3R3XA 2ZBVA 2EG5A 4BMCA 5CCEA 2X15A 4UVGA 1EAMA 3ND6A 4R40A 5HE9A 1JDUA 3RSZA 2NN3C 3HBLA 1UM9B 5EI5A 1GNLA 3V6LA 1T2DA 1M2OA 1DO8A 3T7JA 4YAUA 1M34E 1N9ZA 1XALA 2X40A 4B7AA 4E14A 3HCOA 4QGSA 5GJVC 1E0KA 3A36A 4QXRA 5BRNA 5LLTA 2RGAA 3A1WA 1EFTA 3A9UA 3RLIA 3DDNA 3Q3JB 4R16A 2XQIA 4LK2A 4NEGA 2PBFA 4XN3A 1MV5A 3RNLA 4DQXA 2PDAA 1ECPA 3D6UA 2I1WA 4QJ4A 1WOYA 3V48A 4IQ0A 4DPMA 2QRNA 4MRAA 3MGBA 3ZI4A 1HT3A 1BAPA 2WIAA 5CIWA 3AXTA 2RJNA 1VE6A 2AFIB 3I1YA 2NSDA 4F8EA 2M9MA 4G26A 2WT4A 3ZD6A 3LQ4A 1GLGA 2XGGA 1PJRA 3D3QA 5F7OA 5F7XA 2B4YA 3EASA 3OMXA 3G6KA 2BKEA 3IVGA 2ECOA 2N1MA 3WMGA 1QHHA 4ZT3A 5IRCD 3CC2B 2B2XA 2ZYHA 4PFJA 1W9XA 3DLAA 3K0AB 2A9JA 2C1XA 2OWEA 1AIPA 1G4UR 3CRQA 1O96A 1W6UA 1M8GA 1V35A 4KQ9A 5IVIA 3ETGA 5JSZB 3MJSA 2HLDA 3DMYA 3WRYA 4CKCB 1G2IA 3OWXA 3UWPA 5A8AA 1L7DA 3ZH2A 1XQBA 2NO5A 3WZMA 3DZDA 3KSDO 3C8MA 4CG0A 4B7XA 3ZYZA 3QOFA 2W2XA 5JMTA 4RFSA 3GNLA 1W76A 3OKFA 4KO1S 1UQTA 1YRYE 1C3OB 2Q7OE 2D8MA 2A9VA 4ZGNB 1NR7A 5FRDA 1V5IA 4RTRA 3QEAZ 5BSYA 4LRQA 2MINB 3D1LA 4GFDA 3RWBA 2HMWA 1UBCA 4ZCLA 4TWZA 5C2JB 1XPOA 1BX0A 1KZYC 3L8MA 3AP1A 3G2OA 4M88A 4Q01A 5H3CA 3FRJA 3SN6A 1JYFA 3OF3A 3IT1A 4R41A 5F2OA 4CYMA 1QH0A 1AGNA 1AO3A 2O3QA 2Z30A 3EXFB 3G82C 1LJ8A 4RFSB 4K9LA 5KHOC 2QN1A 3PD0A 1GFSA 1K28D 3QSYA 2GCPA 2GGSA 2GXQA 3D0KA 1ZXBA 2BEWB 4Q00A 1QK4A 3TAXA 4BQRA 2DOGA 1TJPB 1L2TA 1K06A 2P9FA 5FTJA 4TS9A 5KYXA 1CJMA 1GGFA 3CVOA 1IHMA 2FLWA 1L1FA 3SYNA 5K0JA 5EMJA 2YWCA 3BL6A 3MEQA 4FXUA 2GLXA 4NRDA 1EG7A 3QE9Y 3EIXA 3K9LA 3KVNA 3W2FA 2OCXA 3PEFA 5GOTA 3S1SA 2ATXA 2IYYA 3OFSA 2FNAA 3DT6A 3PL1A 4HNGA 4YAGA 3CZQA 3ZE2B 4CMEC 2F1IA 3CQ9A 2MSCB 5AW3A 5DISB 2EERA 4MWCA 5AXBA 5CPFA 2FW1A 4I2NA 1PWHA 1KFBB 2C5LA 3OZVA 4JI4B 1OWPA 4N41A 5HZAA 1CQXA 2WAYA 2L18A 4TS4A 3Q40A 3GZJA 2FWJA 4DA9A 3CH7A 4G0ZA 4RGYA 2VHWA 5FNVA 4HLNA 2XMCA 4TV9F 1O8BA 1UAGA 1C1HA 2W2KA 4N8EA 2C5SA 4RIFA 4NG4A 5HE8A 5JNUA 1VE5A 4L2IB 4DIUA 4WECA 3RVRA 3VDMA 1N9KA 8ATCA 4IH1A 1Q0PA 4BPRA 1DKQA 1HE5A 3PCRB 2BGUA 2P30A 1N34B 2JIQA 3CZPA 2VG8A 4XKWA 1HSOA 3I1IA 1EVZA 2OHVA 2E89A 2QW1A 4INAA 4TLDA 3WSVA 1CS0A 3OEEA 1Q5PA 1S9DA 1Y1TA 2XI4A 1PDWA 3AH8A 4BNZA 1FXWA 2GX6A 3CB2A 3KOZA 1PJ2A 3QVOA 1ZGGA 2H92A 3WIDA 1NP3A 4M0MA 2W2VA 4QNMA 3DEFA 4WFJA 3U61B 3DTVA 3NP7A 1OYWA 1RC8A 4Y98A 3MGCA 3E5HA 3PHIA 1PQ4A 1QG4A 1X1BA 3DBHB 3KD3A 4AF6A 3KLPX 1YJAA 4MS4B 4B4UA 5B5SA 1W0JD 5F35A 3U7GA 4JBYA 4B85A 1H0RA 3DBRA 4YO8A 4C7BA 4XLFA 4FONA 5KDLA 2NPFA 1T5LA 5K6AA 1JE0A 1YDHA 5HIAA 1Y9DA 5BQ3A 1NRXA 4G2TA 4XLLA 1Q95A 4B6OA 5LQDA 3AR4A 4ZV7A 1UMDA 2Q1YA 2WYRA 3DJFA 2M1XA 2HIMA 3JTMA 2P79A 3HABA 3L7KA 3PFHA 3TQQA 2BFDB 1Q86D 1OXXK 1W88A 1ZISA 1E2UA 3C3KA 2DUJA 5BV2P 5IN4A 1G38A 4DMRA 1RCFA 1J0CA 3ZWYA 4P54A 4KK3A 2QUJA 1NNLA 5BWLA 5F2NA 3U60B 2H2HA 4Z4WA 1K98A 4W9NC 1BCSA 3HB5X 4DV2B 5GONF 4H59A 5DBIA 1J8VA 2QGFA 1HEIA 3V4SA 3QIVA 3FA2A 2BUCA 3TAUA 3G5LA 3OJXA 4IF6A 4FN5A 5AP9A 1WU8A 2OBLA 3RQIA 1XRJA 1YO6A 5BSKA 1A7KA 3HRHA 3INTA 5IM5A 3QF4B 4BLUA 4DLAA 2L82A 4EHFA 4R0MA 4IX9A 1U2DA 2OCGA 4HRYA 4KBFA 4A0HA 2B0CA 2JFBA 2EKQA 4MWBA 5DX8A 1G41A 4YMHA 3W34A 2I4RA 1QDUA 4GAEA 5HZBA 1KS2A 3R9XA 1SCIA 3GQBA 4J90A 4Q1EA 4KKUA 1YACA 1SBCA 2PYZA 5EGNA 3T7RA 4BN5A 4DGSA 1HO3A 4KB5A 3W1EA 1F06A 1G19A 2C96A 4UU1A 1K5HA 5SY4A 4US0R 3DZIA 3LUCA 3L7NA 4PYRA 5AO9A 4HGZA 1GGEA 3U7IA 1ZN2A 4N3CA 5GJWC 3DFIA 2Q5HA 1ACMA 5ESDA 2HPVA 1I4EB 2AF4C 1VECA 4ZP1A 2VS1A 4ZZ3A 1GJRA 4X41A 4MV5A 1TQDA 2UZ4A 2PKCA 4EPYA 1T1GA 1KVTA 4FTWA 1RLOA 5JY1A 2NOAA 1W94A 3C3YA 3DOFA 1HG0A 2QD4A 5A71A 3Q0EA 4FZJA 1Z45A 3H11A 3G9XA 4HRVA 4Q39A 3COYA 3B5IA 2XNJA 3IILA 4WN3A 4D4IA 5YASA 1DJQA 4K2HA 1Z4QA 3IULA 1R5JA 3ZHVA 1L7QA 2F3UA 4IQFA 4J0GA 3ZW9A 1L4HA 3IP3A 1IZ0A 1SCUB 3H18A 1A7AA 2H2AA 3JR7A 3NFYA 4LCJA 4MGHA 4YJHB 5KYUA 1OFIA 3ONWA 1JZSA 1E3TA 3PNYA 5FHQA 4AMBA 3T1HB 2F1RA 1TB4A 1DAKA 3F78A 3O93A 3NDJA 3GI1A 4I2VA 4URZR 2WD9A 3A9TA 2WK1A 1W2HA 4C30A 2IC5A 3A6GA 4HADA 3SX4A 1LNQA 1T36B 2D74A 2G70A 2YMMA 1NVVR 3DE0X 4GRDA 3UFXB 5ALTA 1BEUB 1GEGA 2E87A 1AB5A 3QV2A 4I6GA 5I7HA 3RKRA 1EXVA 2O59A 4MUMA 4B75A 1B3BA 2HMUA 4U5XA 1UAAA 4NNJA 3UOGA 5KO2A 5E38A 1ESNA 2ZYDA 3MJ4A 2ZSEA 1JIXA 2WDPA 3PF8A 4LI3X 4GYJA 1U8FO 1F60A 2DWPA 2YVLA 2GZHA 3E9RA 1LY1A 2ZRDA 3ZHXA 2GCNA 4FFVA 1SC9A 1NULA 1TF7A 4OXNA 2FWAA 2O3SA 5F4BA 3W7BA 4URXR 3F3SA 1J1UA 1NBMA 2H65A 2X4IA 3GLVA 2GSDA 4NU6A 3WZLA 2FA9A 1M2WA 4FS3A 1JQDA 2GPBA 2G82A 2N46A 4RLQA 5EIAA 3IIJA 4GXTA 1DC7A 1NJ1A 3FTEA 4KV7A 1A72A 3TFOA 3M3PA 3ZWMA 4P26A 1GQOA 3QNUA 4PG6A 4B6FA 2IXFA 2D13A 3QGMA 4Y7DA 1TW2A 5IXYA 2Q7DA 3E7XA 3OZAA 2BFBA 2XTJA 4J49A 4Z9YA 5G02A 1TVKB 1VQKB 2CN1A 2QQGA 3G7SA 4PXYA 4LYHA 1DVRA 1DJNA 2C2BA 5A5VA 3WLMA 3DTNA 2PIAA 4FDAA 3OHPA 1I0LA 3IP8A 1YE5A 1ZNWA 1LLCA 1SWWA 5ECWA 3GNTA 1GAXA 4OYHA 1NM5A 4G23A 1UT5A 2DKOA 3T9CA 4R5HA 4DWWA 4DV6B 4YRIA 1F4PA 2Z4TA 4WH0A 3P5BA 3P4YA 1B1CA 1RVDA 2Q5LA 4RWEA 1T3SA 1K6IA 1ZINA 3RABA 3S29A 2XF8A 1RXUA 1Q21A 2CVFA 4WZAE 3QFFA 3WJ7A 1L4UA 1IXYA 3QPDA 1M34A 3TLMA 3ZQKA 1EX1A 4A0GA 1DV2A 4BP1A 4ZDKA 4CKBA 3AUSA 1E2KA 2Q0XA 2W70A 1UJMA 3HVKA 4FHZA 3H8SA 4LJ4A 2YW2A 5LXTA 2AHRA 3WQZA 2HJGA 1J97A 3HXLA 4EO7A 1E7WA 5BUQA 1KVRA 1ZD9A 2C5EA 3RKSA 4IEFB 4QM7A 2X9GA 2HBQA 2QPOA 3GAAA 4ZT4A 3ZTTA 4EGJA 3HKBA 4LMBA 2RONA 3WRXA 1PN3A 1IN4A 3F7TA 3WTCA 3X2SA 4IMIB 1W36C 1JTFA 4B74A 5JDIA 3H8WA 3OAAA 1UBFA 1GTSA 4GYWA 2JNWA 2A9RA 2ANBA 4A6DA 2VPYA 4JQZA 2DJIA 1VA5A 3D6AA 4PRKA 2YWXA 4UTRA 4JI0B 3P2MA 4JJAA 1WKBA 3NCTA 4DJEC 2W6OA 1NWCA 1U3CA 4R1PA 4B47A 1VKRA 4BO3A 2G6TA 5B3KA 2C7RA 2ZE7A 3CR8A 3HCWA 1XO1A 2JEZA 5DYGA 1HZJA 4NOKA 2QR5A 3OZEA 2OYSA 3JQCA 2IS4A 3E9NA 2RCNA 1NVAA 5EJ2A 2JS7A 4HH1A 3ZV4A 2BN4A 1RPJA 4IHJB 1UD6A 1P2SA 3B82A 3KV1A 3H9EO 4QLOA 5EHZA 2V6IA 2D0OB 4FFBB 3RRMA 4D0NA 1Q16A 5DWVA 5I8ZA 2PMWB 1YVRA 1V3QE 3NBUA 1G9TA 3KZKA 1BVRA 1Y0BA 2X19A 4EYOA 2R97A 4A0SA 2F3PA 5HYVA 1I0ZA 3CRVA 1U7HA 2J3HA 4G0XA 4Y6GB 1P29A 4YUWA 2IHVA 3O8LA 5IW8A 4JI2B 2OTJB 4X84A 2IHZA 2B9EA 4LDJA 1VKOA 4L9AA 2QZPA 3IDZA 4DLPA 1IB0A 4HQNA 3TAHA 2JHGA 1TZCA 4PHGA 2QTVB 3AY7A 2ZUWA 5KKAA 3OD1A 1O95C 3RFCA 3PXGA 2P3LA 4KSCA 4I3HA 4WXHA 1Z6PA 3BGSA 1QIEA 1N2SA 4TRNA 3T5TA 1AHNA 2R6FA 1V1RA 4JVOA 2X8JA 5HUJA 3RJTA 5LQJA 4M1SA 1E4VA 1B3RA 1FSPA 3K9FC 2H11A 1H8HA 1FYEA 3KZNA 2O7SA 2DUUA 4TT3D 4Z3DA 4W7HA 4KGXA 4MR9A 4JC0A 1EX9A 1X8LA 2WZQA 3SIPA 4D8TA 1VJGA 2EAUA 2DH5A 2IYEA 3ZWPA 1T8WA 3AWIA 2PGLA 4NFHA 1QRTA 4RZXA 3U0BA 1V26A 2FDRA 2XCUA 4GRAA 1XCBA 1CZOA 3FFTA 3KHSA 4DCSA 4WIAA 4BNNA 4QEZA 2QL9A 1C3LA 4ZQIA 4NEHB 1QYXA 3BWYA 1OGJA 4IBOA 1Q44A 4L5BA 1I32A 4QXQA 1XDBA 5EQDA 3DP7A 4G1MB 1MFZA 5K8TA 4XR6A 3GVJA 1UMKA 3KKQA 3M70A 4P3NA 4YRRA 5FL7D 3TL6A 4GYYA 3CVJA 3DXXA 3AM1A 2WV7A 1IHOA 3BSFA 1OLSB 4I55F 3S2FA 4DV7B 3AJ9A 4G25A 1I6LA 3R7NA 2YIJA 1RAIA 1VIAA 2B8JA 3GRCA 3MBKA 4L4RA 2HCJB 1JFRA 1D6NA 2Y0EA 1PQUA 2I22A 4PBRA 2BFEB 4RIIA 4TYQA 3DLBA 3NPAA 3FX2A 2ZB2A 1AKMA 2BAGA 4JD5A 3L7IA 2BMAA 2C4NA 2UVDA 5L95A 3DW1X 1XD8A 5JPCA 1QBKC 1VB3A 4LHWA 5I7UA 1SVSA 1L5HB 3F8SA 5FL3A 1XNJA 1UZMA 2WWHA 3UXYA 4EF6A 5JDCC 3AVTA 4F2WA 2VNSA 1GPKA 5EL0A 4HP8A 3T7IA 2I34A 1RXVA 4BV2A 5E7JA 4PSAA 3UJ7A 4RCZA 5J47A 5CCXA 1VJDA 3O38A 3LZ6A 4L8JA 1MAWA 5JXWA 4NCNA 3L77A 4X1YA 2LBPA 3EQ6A 3EULA 3GPBA 2ONJA 1ZOSA 2ODEA 4YAWA 3CY6A 3N8IA 3USES 5ALVA 2GJ9A 3CP8A 2YY6A 3VAZA 1IXZA 1UBKS 5HQTA 4Q34A 4NAUA 4R9VA 2FF7A 5CBKA 2ZYGA 3FMGA 3KVOA 1P2DA 2B5VA 1LBEA 5TMEA 4Q12A 4DV1B 4O2RA 1JDVA 4BZQA 2VUIB 1SHUX 3L6CA 4OKIA 3ZVKA 5EKXA 1DBWA 3EWNA 3KL2A 4XW2A 5HG0A 3Q39A 4UNPA 1COWD 1MR3F 1PJAA 4DBZA 2FSGA 3EE6A 3I72A 5ELMA 4ONEA 5CTJA 3VZQA 4CM8A 3FMVA 3IUPA 2ONYA 3FCXA 5ERGB 4ZIRA 5DB4A 2Q0QA 5CDYA 1VLOA 4RA6A 5JBQA 2XMZA 3DKIA 3ICCA 4LIPD 3ZV6A 5KYKA 1XKQA 3EGEA 5AI8A 4I5GA 1C4KA 1P18A 4AWAA 1KFKB 1BTOA 4MYRA 3GT4A 2ZZMA 4IDFA 4OQQA 2H4ZA 1KZ4A 1M1XB 5DNCA 4FDMA 5KZMB 5KS2A 3TW0A 4M7OA 1TLFA 1AKNA 1OOEA 2PSFA 3NDRA 4RJKA 2ZM5A 1OBCA 1GSOA 3WGMA 4EUKA 2V6JA 4YJ3B 1U99A 3MJEA 4KMOA 4G8CA 3HXKA 3QHAA 1KP2A 4QHYA 1SD5A 4P2GA 2VSQA 2V9CA 4LSZA 2PTHA 1JAZA 3LRXA 5CVUA 2DQ4A 5KSPA 3K0CA 2G17A 5HTOA 1VQ8B 4YJHA 3AZOA 4MVJG 1OV4A 1KQNA 1NXWA 2B98A 3SY8A 5BN5A 3DAYA 2W43A 3BERA 5F9HA 4RDLA 2AT1A 3O8OA 2VF4X 1BQ3A 1OU0A 1JDSA 2B3TA 4MKHA 4F6RA 1T1IA 4X93A 5PNTA 1DI0A 3SDZA 3QYFA 1ZD8A 3P19A 2ZYTX 2BMEA 1CUFA 1SOVA 4RESA 4EY3A 3TDNA 2GA9A 2ZJFA 3I3OA 2GZMA 2BH2A 2CXNA 5TV2A 2OHIA 3CNOA 3NT4A 4IXNA 3TIXB 2G5TA 4DJ5X 3VM6A 2V6BA 4YFYA 4ENWA 5L7TA 1TJYA 3W5SA 4WWHA 4DLWA 1BQ4A 1CWUA 3L2OB 1QP8A 4P5EA 5E9QA 3FYTA 3I05A 1P4HA 1T1EA 5KTYA 4EYKA 4YLYA 1KO5A 3H5TA 4ND5A 3FMOB 3NNNA 4CKXA 1PFUA 4C05A 4LJAA 1V5FA 4Y67A 1TX4B 3FZEA 5D01A 4DC0A 3FPHA 3OJLA 2WLSA 4E5UA 4AY2A 2REBA 1ZL2A 5B6IA 3QZUA 1PAUA 2IZZA 4L4YA 4TL7A 2EJUA 1DINA 1DIHA 4HAYA 4PLCA 4DJDC 3QA9A 4R3WA 1ZUIA 2QUIA 4M60A 3MTQA 1LGYA 1Z07A 3FH0A 4CIDA 1H66A 2WHPA 3AI1A 1Z5OA 4NZZA 1GSAA 2OBSA 1GYRA 2AKYA 4HWSA 5JH7B 1X6VA 4ENRA 3RVOA 3FLAA 3U4CA 1DAGA 1M7HA 2P2GA 3U4IA 4DPLA 3H3JA 4DQLA 3FDZA 2JFGA 4S1TA 4Z4RA 2FQWA 4IVQA 2Q46A 3MZ0A 4O2BA 4R1UA 4XQ9A 2JAOA 4LYAA 3MJDA 1NHWA 1UDRA 5IXSA 5JXHA 1RWVA 1QANA 2DTEA 2IU3A 4MPDA 3FKQA 2MSDB 1OAOA 4D0RA 621PA 4U2GA 1RAFA 4X6LA 3BC9A 1GQRA 3F4KA 1FLDA 3TZLA 3WLLA 2X6YA 2Q6OA 2DULA 4PIPA 4OP1A 3LY8A 4BC0A 4B6RA 4GF5A 4RD4A 2PLFA 1SZDA 2IXEA 1Y82A 2PZAA 2EWVA 1MOZA 4XLEA 1M1UA 2G9VA 3GLHA 4NPHA 4YLGA 4JMQA 4C08A 2CFRA 2GVNA 1BS9A 3TK1A 3ZXXA 1L4LA 1GKUB 1IG0A 1HLFA 2F67A 2QIOA 3D6FA 4DEXA 3IPCA 4JCOA 1DAOA 4R2LA 2K4MA 5CH3A 3BAZA 3TECE 3DWEX 2A4KA 1W9HA 1ZHOA 2VHUA 2ZB3A 3ONNA 4G0QA 5K3FA 1B8UA 2IHUA 3CZRA 1QNFA <