1S0WC

1b lactamse/ b lactamase inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
b'AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSSTGAYRGSAHLWFTDGVLQGKRQWDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase TEM
publication title The modular architecture of protein-protein binding interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 1s0wC02
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 1s0wC01
4DM5A 3N4IB 2G2UB 2PXGA 3E2LC 1S0WC 5D0QE 3C7VB 1XXMC 2KM7A 5D0OE 3C4OB 2KXXA 3C7UB 3GMUB 3C4PB 5AYWE 3E2KC 5EKQE 2G2WB 2YH9A 3D4EA 2B5RC 1JTGB
chains in the Genus database with same CATH superfamily
4DM5A 3N4IB 2G2UB 2PXGA 3E2LC 1S0WC 5D0QE 3C7VB 1XXMC 3NWFA 2KM7A 3NWDA 5D0OE 3NWAA 3C4OB 2KXXA 4HSIA 3C7UB 3GMUB 3C4PB 5AYWE 3E2KC 5EKQE 2G2WB 2YH9A 3NW8A 4L1RA 3FVCA 3D4EA 2B5RC 2GUMA 1JTGB
chains in the Genus database with same CATH topology
4DM5A 3N4IB 2G2UB 2PXGA 3E2LC 1S0WC 5D0QE 3C7VB 1XXMC 3NWFA 2KM7A 3NWDA 5D0OE 3NWAA 3C4OB 2KXXA 4HSIA 3C7UB 3GMUB 3C4PB 5AYWE 3E2KC 5EKQE 2G2WB 2YH9A 3NW8A 4L1RA 3FVCA 3D4EA 2B5RC 2GUMA 1JTGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DM5 A;  3N4I B;  2G2U B;  2PXG A;  3E2L C;  1S0W C;  5D0Q E;  3C7V B;  1XXM C;  2KM7 A;  5D0O E;  3C4O B;  2KXX A;  3C7U B;  3GMU B;  3C4P B;  5AYW E;  3E2K C;  5EKQ E;  2G2W B;  2YH9 A;  3D4E A;  2B5R C;  1JTG B; 
#chains in the Genus database with same CATH topology
 4DM5 A;  3N4I B;  2G2U B;  2PXG A;  3E2L C;  1S0W C;  5D0Q E;  3C7V B;  1XXM C;  3NWF A;  2KM7 A;  3NWD A;  5D0O E;  3NWA A;  3C4O B;  2KXX A;  4HSI A;  3C7U B;  3GMU B;  3C4P B;  5AYW E;  3E2K C;  5EKQ E;  2G2W B;  2YH9 A;  3NW8 A;  4L1R A;  3FVC A;  3D4E A;  2B5R C;  2GUM A;  1JTG B; 
#chains in the Genus database with same CATH homology
 4DM5 A;  3N4I B;  2G2U B;  2PXG A;  3E2L C;  1S0W C;  5D0Q E;  3C7V B;  1XXM C;  3NWF A;  2KM7 A;  3NWD A;  5D0O E;  3NWA A;  3C4O B;  2KXX A;  4HSI A;  3C7U B;  3GMU B;  3C4P B;  5AYW E;  3E2K C;  5EKQ E;  2G2W B;  2YH9 A;  3NW8 A;  4L1R A;  3FVC A;  3D4E A;  2B5R C;  2GUM A;  1JTG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...