1S16A

Crystal structure of e. coli topoisomerase iv pare 43kda subunit complexed with adpnp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
380
Chain Sequence
TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Topoisomerase IV subunit B
total genus 114
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s16A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s16A01
2BT0A 4LFBE 5CTUA 4MYUA 2C2AA 1AMWA 3CRLA 1S16A 4LF9I 3C11A 4DV4E 3HHUA 4O0BA 1Z0EA 2YEHA 1H7SA 1H73A 3O0IA 2O1WA 2HFUA 3B24A 4L8ZA 2BM1A 1D6TA 3T1KA 2IORA 3QT5A 1I58A 4LWIA 2VW5A 2IWSA 2WW4A 3J80Q 3GONA 1I5DA 4DXLA 5IDJA 5CTXA 2UXDI 2E0AA 4FCPA 5BR8E 1BGQA 3LPSA 1FI4A 4GEEA 2YEDA 1N36E 4E01A 3RLRA 4JI8E 3ZZUA 5LL6R 2YE8A 3A0XA 4Z7CA 2CGFA 2XDXA 4R3AA 2BZ5A 1ZM9A 3A0RA 2HG1A 2YGFA 4DR7E 2YEFA 4P7AA 2YEAA 1UYFA 2XABA 2H55A 1TILA 4X62I 4P52A 2QF6A 2YE5A 4XIQA 4FWGA 1UYKA 2WI5A 4I5SA 4HYPA 1QYEA 1UY6A 3JAMQ 1US7A 3EKOA 3MNRP 2Q8FA 2WI3A 1FJGE 4KQVA 5CPHA 4UROA 4KHPE 4CE1A 1EI1A 4U7OA 1YS3A 4Z7YA 2WI6A 4UTGA 1KIJA 2YE7A 3QT6A 1BYQA 3G7EA 3GIFA 4B6CA 4CWOA 3PYGA 5CF0A 4JI2E 2O1VA 4DV3I 2JJCA 2IWUA 1B63A 1Z5BA 2VCJA 4CWQA 3R4NA 2E5LE 3FT5A 3JZ3A 2UU9I 4H81A 5F3KA 4AWOA 4B3RE 4B7PA 1XMOE 4JI3I 2ZDXA 4O05A 4FN5A 4USMA 2WI1A 1UY8A 3R4MA 1H7UA 4YY3I 2ZBKB 4GFNA 2F4VI 2UUAI 3H80A 1N34E 2XEXA 1K47A 4LF5I 4DV7E 4LFCE 3A0TA 3EHHA 5C93A 4H7QA 4BAEA 4EMDA 4AQYI 2V2ZA 2CCTA 1N0UA 4FWHA 1MG7A 4DPTA 4DPWA 3J81Q 4DU7A 1A6FA 1HNZI 3PYEA 1YT0A 2YI7A 1I94I 3T1HI 3CGYA 3T0HA 4DR4E 2UXCI 3D4JA 4MYTA 2UXBE 1N33I 1KTVA 2FWZA 4DV5I 4M1KA 4HXZA 5A2QC 2X36A 4LPBA 4JI5I 4DR3E 3WU3A 3WHAA 5FNCA 4XIRA 1ZM4A 3B8HA 4DR1E 3OWBA 2K5BA 5FNFA 4LWFA 3T2SA 3OTOI 4LFAI 1XNRE 4GKKI 2QG2A 3ZXQA 1L0OA 5J6AA 3JAMC 2ZM6E 4DV6E 2ZKJA 3HZ5A 3Q5JA 4X66I 2UUCE 4NXNI 2CCSA 4B3MI 4WUCA 2AJ4A 4URLA 4ZVIA 1ZWHA 1Z59A 1IBME 4NXMI 1Y8NA 3CRKA 1ZXMA 5M4KA 1NZ0A 4R3MA 2HKJA 1ZXNA 3INWA 2CCUA 4JI6I 1HNWI 4BQGA 2QFOA 1RREA 2H8MA 3GIEA 4LP0A 4EMVA 3QT8A 3OPDA 3G75A 3WQ9A 4NH9A 2UXDE 1YESA 3EKRA 3R4PA 1FWKA 2LJPA 2HCHA 3D0BA 1XMOI 1FKAE 4JI1E 3HEKA 5IWAE 4B3TE 2BU6A 4V26A 1AJ6A 1KZNA 2F4VE 1UY9A 1PVGA 4FW9A 4UT4A 3J81C 3T1YI 4X65I 4HACB 2YE9A 2YKIA 1DARA 4XTJA 4DR7I 2YKBA 5M4MA 4AQYE 4DV1I 4R1FA 4LF6I 1I5BA 1Z0BA 2XDSA 2DEJA 2YEBA 4CE3A 3FV5A 4YHHI 1OSFA 3CWVA 4ED4A 5LMNE 4K0KI 1S14A 1H72C 5GMDA 1BKNA 4DR5I 5D6PA 1I94E 4JI4I 4OX9I 3EHFA 3OWDA 1FJGI 3TTZA 4WUDA 4EGIA 4LF9E 4LF7E 4YKZA 1RR9A 2BYIA 4DUZI 4E00A 2FWYA 3T0ZA 2HHHE 4I3HA 1YT2A 4FWDA 2EXLA 2YK2A 4DUYE 1UEKA 4JG4A 3OMUA 2HFSA 4PU9A 3H4LA 1IBKI 1QZRA 4CWNA 3PEJA 1UYGA 5FLXQ 2WI2A 3TZ4A 3LTOA 3OTOE 4LFAE 1XNRI 4GKKE 2XHXA 1XNQE 4L93A 2PNRA 4NXNE 4DV0E 3HYYA 4FMTA 3TZ0A 4EM7A 2VF3A 4CWRA 4X64E 3DGEA 4URNA 3PYFA 1N34I 2BYHA 4XC0A 4DR6I 3B27A 1TIDA 4RPFA 4JASA 4MPCA 4DV2I 3RKZA 2XCMA 3VHDA 4YKTA 4HACA 2YI6A 4B3SE 5LMUE 2XX5A 1GJVA 2CG9A 4GT8A 4YKUA 3B25A 5M4HA 2VCIA 4HY6A 4CWFA 2ZITA 2YE3A 3PEHA 4LWGA 1OJ4A 1GKZA 1Y4SA 4JQLA 4XKKA 2BV3A 2YEEA 5BOCA 4DV4I 4DV5E 4Q20A 3HULA 1XMQE 4FPPA 1B62A 2XHRA 4GKJI 4NH8A 4ASGA 2R3VA 4JAUA 4YKXA 4MOTA 1YSZA 2DEIA 4DV3E 4CWPA 4LF8E 4BIUA 4DR2E 4URMA 2WEPA 1A4HA 1N36I 3K1JA 1ZM3A 2XX2A 4V25A 1ZM2A 5L3JA 4YHHE 2UUAE 4USKA 2HK3A 4LFCI 1IBMI 4NXME 1MU5A 5IT9Q 3A0YA 4JI4E 4OX9E 2YKJA 4BIZA 4EFUA 1UYDA 1UYCA 4EEHA 4EGKA 2WI4A 3LNUA 4DPYA 3RLQA 3O2FA 1ELOA 1J5EI 3U2KA 4PL9A 2ESAA 2UXBI 1YERA 4KTNA 4AS9A 1N33E 2YK9A 1VISA 3RLPA 1KKHA 4XCLA 1YT1A 2Q8IA 4JI0I 4GCZA 2XX4A 4HY1A 2Q8GA 2YKCA 4DR3I 3R91A 4BQJA 2YEGA 1U2RA 3Q5KA 4X64I 3FT8A 4B3RI 2A2CA 3K97A 5M4PA 1YC1A 3B28A 2J7KA 4O04A 4LF6E 3T10A 4QPKA 5FWKA 4LF5E 1N32I 4W7TA 1Z5CA 4JYAI 4KFGA 1I59A 3F0NA 4MP2A 1UY7A 1MX0A 4KSGA 5F5RA 3TZ2A 2BTZA 2BU7A 1R62A 4QPJA 1XMQI 3QTFA 3VADA 2WI7A 4E02A 3HZ1A 4DPUA 4YKRA 1HR0E 2VQFE 3VHAA 3QT7A 4HZ5A 3J7AM 2HKEA 3D2RA 4LFBI 3K99A 4KP4A 4EFTA 5FLXC 1NHIA 2UUBE 4AWQA 3A0WA 3NMQA 4JI1I 5BODA 1NHJA 3BMYA 3C0EA 4JV5I 4DV0I 5M4NA 2VWCA 2WEQA 2YI5A 3HYZA 1Z0CA 3T1YE 4DUHA 2A2DA 1ID0A 1H74A 5BR8I 2UU9E 3D36A 1KVKA 2YGAA 4YKWA 3WU4A 3R4OA 1TC0A 2CZ9A 4JI8I 2CH4A 3WU6A 5GGZA 4K0KE 4DR5E 1EA6A 3M6AA 3ZZ0A 1TBWA 1J5EE 2YE2A 2GS8A 2GQPA 4FCRA 4JAVA 4ASBA 1FWLA 4DV7I 2V8PA 1XHKA 3QDDA 3U2DA 2VQEE 1YC3A 4X62E 2FXSA 4DUYI 2E1RA 2YE6A 1JM6A 2YEJA 4HXWA 4L90A 4L94A 4KSHA 4XE2A 4YKQA 1HNZE 4WUBA 3INXA 1S4EA 4HYMA 4JI7E 4K4OA 1Y8PA 4KHPI 4MBCA 3EHGA 1UYLA 4XDMA 2Q8HA 4PRXA 2GFDA 3IEDA 5CTWA 3PYDA 5IWAI 4B3TI 3TUHA 2X7IA 2BM0A 1HNXI 2IWXA 2AKPA 4XCJA 2Q2EB 4CWSA 2JKIA 1Y4UA 4DR1I 3SL2A 2XHTA 2BRCA 4FCQA 3V2UC 4DU8A 4BXIA 4GGLA 3O6OA 1AH8A 2XD6A 4YKYA 1N0VC 3B26A 4LWHA 4XIPA 4B3ME 2XJJA 2XK2A 2QG0A 3GIGA 4X9LA 1TC6A 3K17A 1UYEA 4XKAA 3V5RA 1Y8OA 4O07A 2XJXA 4LF7I 3ZZTA 2VQFI 1THNA 4DUZE 3KE6A 1Z0TA 2YEIA 3B82A 2HHHI 1IBLE 2BU8A 3Q5LA 5FNDA 1YSRA 4GKJE 5J71A 3CGZA 4JI6E 1HNWE 4GQTA 1ZW9A 2XJGA 2V2QA 4XITA 4LF4I 5CTYA 3T1HE 1UYHA 3G7BA 1WUUA 3Q1QA 2YECA 4EGHA 3TZ5A 1YC4A 1XNQI 2O1UA 4ASFA 1PKPA 3BM9A 3WU5A 2IOQA 4JI5E 1UYIA 4DPXA 3K60A 1U0ZA 4O09A 1BXDA 3ZXOA 5M4EA 3GIGB 4XKOA 3VHCA 2BSMA 2YI0A 2YJXA 4PRVA 2E5LI 4XD8A 4DV2E 5D7DA 1AH6A 2NPFA 4MB9A 3J7AG 2FYPA 4JI3E 2YE4A 2ZM6I 4DV6I 4B3SI 4MPNA 3R92A 5LMUI 4DV1E 2XDUA 4ASAA 5D7CA 4YY3E 2ZDYA 2UWDA 1B3QA 3OW6A 5LMNI 1HR0I 2XDKA 2HK2A 1TH8A 1Z0VA 2YGEA 4H85A 4HZ0A 4JI7I 3A0ZA 4U7NA 5IDMA 4NH7A 4JI0E 5D7RA 4MP7A 2UUBI 3ZM7A 1AM1A 1U2OA 2BU5A 4AWPA 1NHHA 5D6QA 1GKXA 2YKEA 1UYMA 5GMEA 1IBKE 4JV5E 1HNXE 4LF8I 2EFGA 3ZKBA 4DR4I 4DR2I 2UXCE 2XDLA 3K98A 4CWTA 2IOPA 1I5AA 4U93A 2BREA 4DZYA 2R42A 3EHJA 1YETA 2WERA 4JI2I 1FNMA 1Z0WA 1N32E 4L91A 1Z5AA 4JYAE 5IT9C 3ZKDA 5A2QQ 4X65E 4DR6E 3U67A 2OI2A 3J80C 2BU2A 4CE2A 5IN9A 1IBLI 4X66E 2VQEI 2UUCI 1QY8A 4P8OA 3B78A 4LWEA 1I5CA 4ZKIA 2YJWA 4MPEA 1PIEA 1Z0GA 4LF4E 2V2VA 2V34A
chains in the Genus database with same CATH superfamily
2BT0A 4LFBE 5CTUA 4MYUA 2C2AA 1AMWA 3CRLA 1S16A 4LF9I 3C11A 3P76A 1RHYA 4QNKA 4DV4E 3HHUA 4O0BA 1Z0EA 2YEHA 1H7SA 1H73A 3O0IA 2O1WA 2HFUA 3B24A 4L8ZA 2BM1A 1D6TA 3T1KA 2IORA 3QT5A 1I58A 2GQ0A 4LWIA 2VW5A 2IWSA 2WW4A 3J80Q 3GONA 3S5TA 1I5DA 4DXLA 5IDJA 5CTXA 2UXDI 2E0AA 1OYSA 4FCPA 5BR8E 1BGQA 3CYGA 3LPSA 1FI4A 2C38A 4GEEA 2YEDA 1N36E 4E01A 3RLRA 4JI8E 4BQGA 1USUA 3ZZUA 5LL6R 2YE8A 3A0XA 4Z7CA 2CGFA 2XDXA 4R3AA 2BZ5A 1ZM9A 5JEAC 3A0RA 2HG1A 2YGFA 4DR7E 2YEFA 4P7AA 2BA1D 2YEAA 1UYFA 2XABA 2H55A 1TILA 4X62I 4OO1A 4P52A 2QF6A 2YE5A 4XIQA 1HK7A 3PS2A 4FWGA 1UYKA 2WI5A 3PS3A 4I5SA 4HYPA 1QYEA 1UY6A 5JENA 3JAMQ 1US7A 3EKOA 3MNRP 2Q8FA 2WI3A 1FJGE 1E3PA 4KQVA 5CPHA 4UROA 4KHPE 4CE1A 1EI1A 4U7OA 1YS3A 4Z7YA 2WI6A 4UTGA 1KIJA 2YE7A 3QT6A 3KRNA 4FW3A 1BYQA 3G7EA 3GIFA 4B6CA 4CWOA 3PYGA 5CF0A 4JI2E 2O1VA 5DROA 4DV3I 2JJCA 2IWUA 1Z5BA 1B63A 2VCJA 4CWQA 3R4NA 2E5LE 3FT5A 3JZ3A 3M85G 2UU9I 4H81A 5F3KA 4AWOA 4B3RE 4B7PA 1XMOE 4JI3I 2ZDXA 4O05A 3GLLA 2JEBA 4FN5A 4USMA 2WI1A 1UY8A 3R4MA 1UDOA 1H7UA 4YY3I 2CVEA 2ZBKB 4GFNA 2F4VI 2UUAI 3U1YA 1N34E 2XEXA 4GQUA 1K47A 3H80A 4LF5I 4DV7E 4LFCE 1E3HA 3A0TA 4U3DA 3EHHA 4H7QA 5C93A 4BAEA 4EMDA 1IXMA 4AQYI 2V2ZA 2CCTA 1N0UA 4FWHA 1MG7A 4DPTA 4DPWA 3J81Q 4DU7A 1A6FA 1HNZI 4MU4A 3PYEA 1YT0A 2YI7A 1I94I 3T1HI 3CGYA 5DRQA 3T0HA 4DR4E 2UXCI 1Y60A 3D4JA 4MYTA 2UXBE 1N33I 1KTVA 2FWZA 4DV5I 4M1KA 2BA1G 4HXZA 5A2QC 2X36A 3H1CA 4LPBA 4JI5I 4DR3E 5EKWA 3WU3A 3WHAA 5FNCA 4XIRA 1ZM4A 3B8HA 4DR1E 3OWBA 2JE6A 2K5BA 2Z5EA 5FNFA 4LWFA 3T2SA 3OTOI 4LPFA 3Q6MA 4LFAI 1XNRE 4GKKI 2QG2A 3ZXQA 1L0OA 5J6AA 3JAMC 2ZM6E 4DV6E 2BR2A 2ZKJA 3HZ5A 3Q5JA 4X66I 2UUCE 4NBQA 4NXNI 2CCSA 4B3MI 3B4TA 4WUCA 4LCGA 2AJ4A 4AIDA 4URLA 4ZVIA 1ZWHA 1Z59A 1IBME 4NXMI 1Y8NA 3CRKA 1ZXMA 4MU3A 5M4KA 1NZ0A 1YHCA 4R3MA 2C38B 4IFDD 2HKJA 5C0XA 1ZXNA 3INWA 3M85D 2CCUA 2Z5CA 4JI6I 2IERA 3U1KA 1HNWI 2PNZA 2QFOA 3GMEA 1RREA 2H8MA 3GIEA 4LP0A 3CDJA 4EMVA 3QT8A 3OPDA 3G75A 3WQ9A 4NH9A 2PO0B 2PO2B 2J65A 2UXDE 2Z5BA 1YESA 3EKRA 3R4PA 1FWKA 2LJPA 2HCHA 3UHMA 3D0BA 1XMOI 3P3EA 5DNLA 1FKAE 4JI1E 3HEKA 5IWAE 4B3TE 2BU6A 4V26A 3L7ZA 1AJ6A 1KZNA 2F4VE 1UY9A 1PVGA 4FW9A 4UT4A 3J81C 3T1YI 4X65I 4HACB 2YE9A 2YKIA 1DARA 4XTJA 5ELWA 4DR7I 2YKBA 5M4MA 2C37B 4AQYE 4DV1I 4R1FA 2NN6D 4LF6I 1I5BA 1Z0BA 2XDSA 2DEJA 2YEBA 4CE3A 3FV5A 4YHHI 1OSFA 1Y5YA 3CWVA 4ED4A 5LMNE 4K0KI 1S14A 1H72C 5GMDA 1BKNA 5JEAB 4DR5I 5D6PA 1OYPA 1I94E 4JI4I 4OX9I 3EHFA 3OWDA 1FJGI 5K36F 3TTZA 4WUDA 2F1DA 2IESA 4LF9E 4LF7E 5K36B 1RR9A 4YKZA 2BYIA 4DUZI 4E00A 2FWYA 3T0ZA 2HHHE 4I3HA 1YT2A 4FWDA 2EXLA 2YK2A 4DUYE 1UEKA 4JG4A 3OMUA 2HFSA 2PO2A 4PU9A 3H4LA 1IBKI 1QZRA 4IZJD 4CWNA 5K36D 3PEJA 2Z5BB 1UYGA 5FLXQ 5JEAD 3P3GA 2WI2A 3TZ4A 3LTOA 3OTOE 4LFAE 1XNRI 4GKKE 2XHXA 1XNQE 1USVA 4L93A 3K85A 2PNRA 4NXNE 4DV0E 4E72A 3HYYA 4FMTA 3TZ0A 4EM7A 2VF3A 4J3DA 4X64E 5C0XB 3DGEA 3PYFA 4CWRA 4URNA 1N34I 2BYHA 4XC0A 4DR6I 4OO1C 3B27A 3Q6NA 4RPFA 1TIDA 4JASA 4MPCA 4DV2I 4IFDE 2XCMA 3RKZA 3VHDA 4YKTA 4FW5A 4HACA 2YI6A 4B3SE 4BA1B 5LMUE 2XX5A 1GJVA 2CG9A 4GT8A 4YKUA 3B25A 5M4HA 1Y6ZA 2VCIA 4HY6A 2ZITA 2YE3A 4CWFA 3PEHA 4LWGA 1OJ4A 1GKZA 1Y4SA 2C1IA 4JQLA 2BV3A 2YEEA 4XKKA 4DV4I 5BOCA 4DV5E 4Q20A 3HULA 1XMQE 4FPPA 1B62A 2XHRA 4GKJI 4NH8A 4ASGA 2PO0A 4OO1D 2R3VA 4JAUA 4YKXA 4MOTA 1YSZA 4IFDB 2DEIA 4DV3E 4CWPA 3PS1A 4LF8E 1R6LA 4BIUA 1OYRA 2Z5CB 4DR2E 4URMA 2WEPA 1A4HA 3HKMA 1N36I 3K1JA 1ZM3A 2JT2A 2XX2A 4V25A 1ZM2A 5L3JA 2PNLA 4YHHE 2UUAE 4OO1B 2NN6C 4USKA 2HK3A 4LFCI 5C0XC 1IBMI 4NXME 1MU5A 5IT9Q 3A0YA 4JI4E 4OX9E 2YKJA 4BIZA 4EFUA 1UYDA 1UYCA 4EEHA 4EGKA 2WI4A 2JEBB 3LNUA 4DPYA 3RLQA 3O2FA 1ELOA 1J5EI 5C0XF 3U2KA 4PL9A 2ESAA 2UXBI 1YERA 4KTNA 4AS9A 1N33E 4MDTA 1VISA 3HJCA 1KKHA 5JEAE 2YK9A 4XCLA 3RLPA 5K36C 1YT1A 2Q8IA 4FW6A 4JI0I 2FTKA 2XX4A 4GCZA 4HY1A 2Q8GA 2YKCA 4DR3I 5C0XD 3R91A 1VI7A 4BQJA 2YEGA 1U2RA 3Q5KA 4X64I 4AIMA 1YH8A 3FT8A 4B3RI 2A2CA 3K97A 5M4PA 1YC1A 3B28A 2J7KA 4O04A 4LF6E 3T10A 3NZKA 4QPKA 5FWKA 1R6MA 4LF5E 1N32I 4W7TA 1Z5CA 4JYAI 4KFGA 2HHIA 1I59A 4EGIA 3F0NA 4MP2A 1UY7A 1MX0A 4KSGA 5F5RA 3TZ2A 3PRYA 2BTZA 2BU7A 1R62A 4QPJA 2GO4A 1XMQI 3QTFA 3VADA 2WI7A 2NN6A 4E02A 3HZ1A 4DPUA 4YKRA 1HR0E 2VQFE 3VHAA 3QT7A 4HZ5A 3J7AM 2HKEA 3D2RA 4LFBI 3K99A 4KP4A 4EFTA 5FLXC 1NHIA 2UUBE 5K36E 4AWQA 3A0WA 4IFDA 3NMQA 4JI1I 5BODA 1NHJA 4IS9A 3BMYA 3C0EA 3M7NG 4JV5I 4DV0I 3P06A 4QNJA 2VWCA 2WEQA 4N3OA 2YI5A 3HYZA 5M4NA 1Z0CA 4OKGA 3T1YE 4DUHA 3LMMA 5K36A 2A2DA 1ID0A 1H74A 5BR8I 2UU9E 4FW7A 4LCHA 3D36A 1KVKA 4MU1A 2YGAA 4YKWA 5EL9A 3WU4A 1TC0A 3R4OA 2CZ9A 4JI8I 2O1TA 3WU6A 2CH4A 4BA1A 5GGZA 2GO3A 2C39B 4K0KE 2AE8A 4DR5E 1EA6A 3M6AA 3ZZ0A 4LOMA 1J5EE 1TBWA 2GS8A 2GQPA 2YE2A 4FCRA 4JAVA 1FWLA 4ASBA 4DV7I 2V8PA 1XHKA 3QDDA 3U2DA 2VQEE 1YC3A 4X62E 2FXSA 4DUYI 2E1RA 2YE6A 1JM6A 1UDSA 2YEJA 4HXWA 4L90A 4L94A 4KSHA 4XE2A 4OO1F 4YKQA 1HNZE 1XXEA 4WUBA 3INXA 1S4EA 4HYMA 4JI7E 2C1GA 4K4OA 4LCFA 1Y8PA 1UDQA 4KHPI 4MBCA 3EHGA 1UYLA 4XDMA 2Q8HA 4PRXA 2GFDA 5JEAF 3IEDA 5CTWA 3PYDA 2WP8B 5IWAI 4B3TI 3TUHA 2X7IA 2BM0A 5DNXA 1HNXI 2IWXA 3M7ND 2AKPA 4IZKB 4BA2A 4XCJA 2Q2EB 4CWSA 4IZJA 2JKIA 1Y4UA 4DR1I 3SL2A 2XHTA 2BRCA 4FCQA 2BA0G 2JEAB 3V2UC 4DU8A 4BXIA 5JEAA 4GGLA 3O6OA 1AH8A 2XD6A 4YKYA 1N0VC 3B26A 4LWHA 4XIPA 4B3ME 2CGEA 2XJJA 2XK2A 2QG0A 3GIGA 4X9LA 1TC6A 3K17A 2C37A 1UYEA 3V5RA 4FW4A 4XKAA 1Y8OA 4O07A 2JEAA 4ISAA 4LF7I 2XJXA 3ZZTA 2VQFI 1THNA 4DUZE 3KE6A 1Z0TA 2YEIA 3B82A 2HHHI 2WNRA 5DRRA 1IBLE 2BU8A 3Q5LA 5FNDA 2PO1A 1YSRA 4GKJE 5J71A 3CGZA 4JI6E 1HNWE 4GQTA 1ZW9A 2XJGA 2V2QA 4XITA 4LF4I 3GCMA 5CTYA 3T1HE 1UYHA 3G7BA 1WUUA 5C0XE 3Q1QA 2YECA 4EGHA 3TZ5A 2PO1B 1YC4A 1XNQI 2O1UA 4ASFA 1PKPA 3BM9A 3WU5A 2IOQA 4JI5E 2PNZB 4DPXA 1UYIA 3K60A 1U0ZA 4O09A 1BXDA 3ZXOA 2WNRB 3GIGB 5M4EA 4XKOA 3VHCA 2BSMA 2YI0A 2YJXA 4PRVA 2E5LI 4XD8A 2O3ZA 4DV2E 5D7DA 1AH6A 4MQYA 2NPFA 4MB9A 3J7AG 1UDNA 4IFDF 2FYPA 4JI3E 2YE4A 2ZM6I 4DV6I 4B3SI 4MPNA 3R92A 5LMUI 4DV1E 2XDUA 4ASAA 5D7CA 4YY3E 2ZDYA 2UWDA 1P42A 1B3QA 3OW6A 2BR2B 2PNMA 3L7ZB 5LMNI 1HR0I 2XDKA 2HK2A 1TH8A 1Z0VA 2YGEA 4U3BA 4H85A 4JI7I 4HZ0A 3A0ZA 4U7NA 5DRPA 5IDMA 1F51A 4NH7A 2JE6B 4JI0E 5D7RA 4MP7A 4IZKA 2BA0D 2UUBI 4BA2B 4AM3A 3ZM7A 4OZEA 1AM1A 1U2OA 2BU5A 4AWPA 3CDIA 1NHHA 5D6QA 3DD6A 1GKXA 2YKEA 1UYMA 5GMEA 1IBKE 4JV5E 1HNXE 4LF8I 2EFGA 3ZKBA 4DR4I 4DR2I 4OO1E 2UXCE 2XDLA 3K98A 4CWTA 2IOPA 1I5AA 4U93A 4IFDC 2BREA 4DZYA 2R42A 3EHJA 2NN6F 3P3CA 1YETA 2NN6B 2WERA 4JI2I 2VESA 1FNMA 1Z0WA 1N32E 4L91A 1Z5AA 4JYAE 5IT9C 3ZKDA 5A2QQ 4X65E 4DR6E 3U67A 2OI2A 3J80C 2BU2A 4CE2A 2C39A 5IN9A 1IBLI 4X66E 2VQEI 4MU0A 2UUCI 1QY8A 3B78A 4LWEA 4P8OA 1I5CA 4IZJB 4ZKIA 2YJWA 4MPEA 1PIEA 1Z0GA 2NN6E 4LF4E 2V2VA 2V34A 2WP8A
chains in the Genus database with same CATH topology
2BT0A 4LFBE 5CTUA 4MYUA 2C2AA 1AMWA 3CRLA 1S16A 4LF9I 3C11A 4DV4E 3HHUA 4O0BA 1Z0EA 2YEHA 1H7SA 1H73A 3O0IA 2O1WA 2HFUA 3B24A 4L8ZA 2BM1A 1D6TA 3T1KA 2IORA 3QT5A 1I58A 2GQ0A 4LWIA 2VW5A 2IWSA 2WW4A 3J80Q 3GONA 1I5DA 4DXLA 5IDJA 5CTXA 2UXDI 2E0AA 4FCPA 5BR8E 1BGQA 3LPSA 1FI4A 4GEEA 2YEDA 1N36E 4E01A 3RLRA 4JI8E 1USUA 3ZZUA 5LL6R 2YE8A 3A0XA 4Z7CA 2CGFA 2XDXA 4R3AA 2BZ5A 1ZM9A 3A0RA 2HG1A 2YGFA 4DR7E 2YEFA 4P7AA 2YEAA 1UYFA 2XABA 2H55A 1TILA 4X62I 4P52A 2QF6A 2YE5A 4XIQA 1HK7A 4FWGA 1UYKA 2WI5A 4I5SA 4HYPA 1QYEA 1UY6A 3JAMQ 1US7A 3EKOA 3MNRP 2Q8FA 2WI3A 1FJGE 4KQVA 5CPHA 4UROA 4KHPE 4CE1A 1EI1A 4U7OA 1YS3A 4Z7YA 2WI6A 4UTGA 1KIJA 2YE7A 3QT6A 1BYQA 3G7EA 3GIFA 4B6CA 4CWOA 3PYGA 5CF0A 4JI2E 2O1VA 4DV3I 2JJCA 2IWUA 1Z5BA 1B63A 2VCJA 4CWQA 3R4NA 2E5LE 3FT5A 3JZ3A 2UU9I 4H81A 5F3KA 4AWOA 4B3RE 4B7PA 1XMOE 4JI3I 2ZDXA 4O05A 4FN5A 4USMA 2WI1A 1UY8A 3R4MA 1H7UA 4YY3I 2ZBKB 4GFNA 2F4VI 2UUAI 3H80A 1N34E 2XEXA 1K47A 4LF5I 4DV7E 4LFCE 3A0TA 3EHHA 5C93A 4H7QA 4BAEA 4EMDA 4AQYI 2V2ZA 2CCTA 1N0UA 4FWHA 1MG7A 4DPTA 4DPWA 3J81Q 4DU7A 1A6FA 1HNZI 3PYEA 1YT0A 2YI7A 1I94I 3T1HI 3CGYA 3T0HA 4DR4E 2UXCI 3D4JA 4MYTA 2UXBE 1N33I 1KTVA 2FWZA 4DV5I 4M1KA 4HXZA 5A2QC 2X36A 4LPBA 4JI5I 4DR3E 3WU3A 3WHAA 5FNCA 4XIRA 1ZM4A 3B8HA 4DR1E 3OWBA 2K5BA 2Z5EA 5FNFA 4LWFA 3T2SA 3OTOI 4LFAI 3Q6MA 1XNRE 4GKKI 2QG2A 3ZXQA 1L0OA 5J6AA 3JAMC 2ZM6E 4DV6E 2ZKJA 3HZ5A 3Q5JA 4X66I 2UUCE 4NXNI 2CCSA 4B3MI 4WUCA 2AJ4A 4URLA 4ZVIA 1ZWHA 1Z59A 1IBME 4NXMI 1Y8NA 3CRKA 1ZXMA 5M4KA 1NZ0A 4R3MA 2HKJA 1ZXNA 3INWA 2CCUA 2Z5CA 4JI6I 1HNWI 4BQGA 2QFOA 1RREA 2H8MA 3GIEA 4LP0A 4EMVA 3QT8A 3OPDA 3G75A 3WQ9A 4NH9A 2UXDE 2Z5BA 1YESA 3EKRA 3R4PA 1FWKA 2LJPA 2HCHA 3D0BA 1XMOI 1FKAE 4JI1E 3HEKA 5IWAE 4B3TE 2BU6A 4V26A 1AJ6A 1KZNA 2F4VE 1UY9A 1PVGA 4FW9A 4UT4A 3J81C 3T1YI 4X65I 4HACB 2YE9A 2YKIA 1DARA 4XTJA 4DR7I 2YKBA 5M4MA 4AQYE 4DV1I 4R1FA 4LF6I 1I5BA 1Z0BA 2XDSA 2DEJA 2YEBA 4CE3A 3FV5A 4YHHI 1OSFA 3CWVA 4ED4A 5LMNE 4K0KI 1S14A 1H72C 5GMDA 1BKNA 4DR5I 5D6PA 1I94E 4JI4I 4OX9I 3EHFA 3OWDA 1FJGI 3TTZA 4WUDA 4EGIA 4LF9E 4LF7E 4YKZA 1RR9A 2BYIA 4DUZI 4E00A 2FWYA 3T0ZA 2HHHE 4I3HA 1YT2A 4FWDA 2EXLA 2YK2A 4DUYE 1UEKA 4JG4A 3OMUA 2HFSA 4PU9A 3H4LA 1IBKI 1QZRA 4IZJD 4CWNA 3PEJA 2Z5BB 1UYGA 5FLXQ 2WI2A 3TZ4A 3LTOA 3OTOE 4LFAE 1XNRI 4GKKE 2XHXA 1XNQE 1USVA 4L93A 3K85A 2PNRA 4NXNE 4DV0E 3HYYA 4FMTA 3TZ0A 4EM7A 2VF3A 4CWRA 4X64E 3DGEA 4URNA 3PYFA 1N34I 2BYHA 4XC0A 4DR6I 3B27A 3Q6NA 4RPFA 1TIDA 4JASA 4MPCA 4DV2I 3RKZA 2XCMA 3VHDA 4YKTA 4HACA 2YI6A 4B3SE 5LMUE 2XX5A 1GJVA 2CG9A 4GT8A 4YKUA 3B25A 5M4HA 1Y6ZA 2VCIA 4HY6A 2ZITA 2YE3A 4CWFA 3PEHA 4LWGA 1OJ4A 1GKZA 1Y4SA 4JQLA 4XKKA 2BV3A 2YEEA 5BOCA 4DV4I 4DV5E 4Q20A 3HULA 1XMQE 4FPPA 1B62A 2XHRA 4GKJI 4NH8A 4ASGA 2R3VA 4JAUA 4YKXA 4MOTA 1YSZA 2DEIA 4DV3E 4CWPA 4LF8E 4BIUA 4DR2E 2Z5CB 4URMA 2WEPA 1A4HA 1N36I 3K1JA 1ZM3A 2XX2A 4V25A 1ZM2A 5L3JA 2PNLA 4YHHE 2UUAE 4USKA 2HK3A 4LFCI 1IBMI 4NXME 1MU5A 5IT9Q 3A0YA 4JI4E 4OX9E 2YKJA 4BIZA 4EFUA 1UYDA 1UYCA 4EEHA 4EGKA 2WI4A 3LNUA 4DPYA 3RLQA 3O2FA 1ELOA 1J5EI 3U2KA 4PL9A 2ESAA 2UXBI 1YERA 4KTNA 4AS9A 1N33E 2YK9A 1VISA 3HJCA 1KKHA 4XCLA 3RLPA 1YT1A 2Q8IA 4JI0I 4GCZA 2XX4A 4HY1A 2Q8GA 2YKCA 4DR3I 3R91A 4BQJA 2YEGA 1U2RA 3Q5KA 4X64I 3FT8A 4B3RI 2A2CA 3K97A 5M4PA 1YC1A 3B28A 2J7KA 4O04A 4LF6E 3T10A 4QPKA 5FWKA 4LF5E 1N32I 4W7TA 1Z5CA 4JYAI 4KFGA 1I59A 3F0NA 4MP2A 1UY7A 1MX0A 4KSGA 5F5RA 3TZ2A 3PRYA 2BTZA 2BU7A 1R62A 4QPJA 1XMQI 3QTFA 3VADA 2WI7A 4E02A 3HZ1A 4DPUA 4YKRA 1HR0E 2VQFE 3VHAA 3QT7A 4HZ5A 3J7AM 2HKEA 3D2RA 4LFBI 3K99A 4KP4A 4EFTA 5FLXC 1NHIA 2UUBE 4AWQA 3A0WA 3NMQA 4JI1I 5BODA 1NHJA 3BMYA 3C0EA 4JV5I 4DV0I 3P06A 5M4NA 2VWCA 2WEQA 4N3OA 2YI5A 3HYZA 1Z0CA 3T1YE 4DUHA 2A2DA 1ID0A 1H74A 5BR8I 2UU9E 3D36A 1KVKA 2YGAA 4YKWA 3WU4A 3R4OA 1TC0A 2CZ9A 4JI8I 2O1TA 3WU6A 2CH4A 5GGZA 4K0KE 4DR5E 1EA6A 3M6AA 3ZZ0A 1TBWA 1J5EE 2YE2A 2GS8A 2GQPA 4FCRA 4JAVA 4ASBA 1FWLA 4DV7I 2V8PA 1XHKA 3QDDA 3U2DA 2VQEE 1YC3A 4X62E 2FXSA 4DUYI 2E1RA 2YE6A 1JM6A 2YEJA 4HXWA 4L90A 4L94A 4KSHA 4XE2A 4YKQA 1HNZE 4WUBA 3INXA 1S4EA 4HYMA 4JI7E 4K4OA 1Y8PA 4KHPI 4MBCA 3EHGA 1UYLA 4XDMA 2Q8HA 4PRXA 2GFDA 3IEDA 5CTWA 3PYDA 5IWAI 4B3TI 3TUHA 2X7IA 2BM0A 1HNXI 2IWXA 2AKPA 4IZKB 4XCJA 2Q2EB 4CWSA 4IZJA 2JKIA 1Y4UA 4DR1I 3SL2A 2XHTA 2BRCA 4FCQA 3V2UC 4DU8A 4BXIA 4GGLA 3O6OA 1AH8A 2XD6A 4YKYA 1N0VC 3B26A 4LWHA 4XIPA 4B3ME 2CGEA 2XJJA 2XK2A 2QG0A 3GIGA 4X9LA 1TC6A 3K17A 1UYEA 4XKAA 3V5RA 1Y8OA 4O07A 2XJXA 4LF7I 3ZZTA 2VQFI 1THNA 4DUZE 3KE6A 1Z0TA 2YEIA 3B82A 2HHHI 1IBLE 2BU8A 3Q5LA 5FNDA 1YSRA 4GKJE 5J71A 3CGZA 4JI6E 1HNWE 4GQTA 1ZW9A 2XJGA 2V2QA 4XITA 4LF4I 5CTYA 3T1HE 1UYHA 3G7BA 1WUUA 3Q1QA 2YECA 4EGHA 3TZ5A 1YC4A 1XNQI 2O1UA 4ASFA 1PKPA 3BM9A 3WU5A 2IOQA 4JI5E 1UYIA 4DPXA 3K60A 1U0ZA 4O09A 1BXDA 3ZXOA 5M4EA 3GIGB 4XKOA 3VHCA 2BSMA 2YI0A 2YJXA 2E5LI 4PRVA 4XD8A 4DV2E 5D7DA 1AH6A 2NPFA 4MB9A 3J7AG 2FYPA 4JI3E 2YE4A 2ZM6I 4DV6I 4B3SI 4MPNA 3R92A 5LMUI 4DV1E 2XDUA 4ASAA 5D7CA 4YY3E 2ZDYA 2UWDA 1B3QA 3OW6A 2PNMA 5LMNI 1HR0I 2XDKA 2HK2A 1TH8A 1Z0VA 2YGEA 4H85A 4HZ0A 4JI7I 3A0ZA 4U7NA 5IDMA 4NH7A 4JI0E 5D7RA 4MP7A 4IZKA 2UUBI 3ZM7A 1AM1A 1U2OA 2BU5A 4AWPA 1NHHA 5D6QA 1GKXA 2YKEA 1UYMA 5GMEA 1IBKE 4JV5E 1HNXE 4LF8I 2EFGA 3ZKBA 4DR4I 4DR2I 2UXCE 2XDLA 3K98A 4CWTA 2IOPA 1I5AA 4U93A 2BREA 4DZYA 2R42A 3EHJA 1YETA 2WERA 4JI2I 1FNMA 1Z0WA 1N32E 4L91A 1Z5AA 4JYAE 5IT9C 3ZKDA 5A2QQ 4X65E 4DR6E 3U67A 2OI2A 3J80C 2BU2A 4CE2A 5IN9A 1IBLI 4X66E 2VQEI 2UUCI 1QY8A 4P8OA 3B78A 4LWEA 1I5CA 4IZJB 4ZKIA 2YJWA 4MPEA 1PIEA 1Z0GA 4LF4E 2V2VA 2V34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BT0 A;  4LFB E;  5CTU A;  4MYU A;  2C2A A;  1AMW A;  3CRL A;  1S16 A;  4LF9 I;  3C11 A;  4DV4 E;  3HHU A;  4O0B A;  1Z0E A;  2YEH A;  1H7S A;  1H73 A;  3O0I A;  2O1W A;  2HFU A;  3B24 A;  4L8Z A;  2BM1 A;  1D6T A;  3T1K A;  2IOR A;  3QT5 A;  1I58 A;  4LWI A;  2VW5 A;  2IWS A;  2WW4 A;  3J80 Q;  3GON A;  1I5D A;  4DXL A;  5IDJ A;  5CTX A;  2UXD I;  2E0A A;  4FCP A;  5BR8 E;  1BGQ A;  3LPS A;  1FI4 A;  4GEE A;  2YED A;  1N36 E;  4E01 A;  3RLR A;  4JI8 E;  3ZZU A;  5LL6 R;  2YE8 A;  3A0X A;  4Z7C A;  2CGF A;  2XDX A;  4R3A A;  2BZ5 A;  1ZM9 A;  3A0R A;  2HG1 A;  2YGF A;  4DR7 E;  2YEF A;  4P7A A;  2YEA A;  1UYF A;  2XAB A;  2H55 A;  1TIL A;  4X62 I;  4P52 A;  2QF6 A;  2YE5 A;  4XIQ A;  4FWG A;  1UYK A;  2WI5 A;  4I5S A;  4HYP A;  1QYE A;  1UY6 A;  3JAM Q;  1US7 A;  3EKO A;  3MNR P;  2Q8F A;  2WI3 A;  1FJG E;  4KQV A;  5CPH A;  4URO A;  4KHP E;  4CE1 A;  1EI1 A;  4U7O A;  1YS3 A;  4Z7Y A;  2WI6 A;  4UTG A;  1KIJ A;  2YE7 A;  3QT6 A;  1BYQ A;  3G7E A;  3GIF A;  4B6C A;  4CWO A;  3PYG A;  5CF0 A;  4JI2 E;  2O1V A;  4DV3 I;  2JJC A;  2IWU A;  1B63 A;  1Z5B A;  2VCJ A;  4CWQ A;  3R4N A;  2E5L E;  3FT5 A;  3JZ3 A;  2UU9 I;  4H81 A;  5F3K A;  4AWO A;  4B3R E;  4B7P A;  1XMO E;  4JI3 I;  2ZDX A;  4O05 A;  4FN5 A;  4USM A;  2WI1 A;  1UY8 A;  3R4M A;  1H7U A;  4YY3 I;  2ZBK B;  4GFN A;  2F4V I;  2UUA I;  3H80 A;  1N34 E;  2XEX A;  1K47 A;  4LF5 I;  4DV7 E;  4LFC E;  3A0T A;  3EHH A;  5C93 A;  4H7Q A;  4BAE A;  4EMD A;  4AQY I;  2V2Z A;  2CCT A;  1N0U A;  4FWH A;  1MG7 A;  4DPT A;  4DPW A;  3J81 Q;  4DU7 A;  1A6F A;  1HNZ I;  3PYE A;  1YT0 A;  2YI7 A;  1I94 I;  3T1H I;  3CGY A;  3T0H A;  4DR4 E;  2UXC I;  3D4J A;  4MYT A;  2UXB E;  1N33 I;  1KTV A;  2FWZ A;  4DV5 I;  4M1K A;  4HXZ A;  5A2Q C;  2X36 A;  4LPB A;  4JI5 I;  4DR3 E;  3WU3 A;  3WHA A;  5FNC A;  4XIR A;  1ZM4 A;  3B8H A;  4DR1 E;  3OWB A;  2K5B A;  5FNF A;  4LWF A;  3T2S A;  3OTO I;  4LFA I;  1XNR E;  4GKK I;  2QG2 A;  3ZXQ A;  1L0O A;  5J6A A;  3JAM C;  2ZM6 E;  4DV6 E;  2ZKJ A;  3HZ5 A;  3Q5J A;  4X66 I;  2UUC E;  4NXN I;  2CCS A;  4B3M I;  4WUC A;  2AJ4 A;  4URL A;  4ZVI A;  1ZWH A;  1Z59 A;  1IBM E;  4NXM I;  1Y8N A;  3CRK A;  1ZXM A;  5M4K A;  1NZ0 A;  4R3M A;  2HKJ A;  1ZXN A;  3INW A;  2CCU A;  4JI6 I;  1HNW I;  4BQG A;  2QFO A;  1RRE A;  2H8M A;  3GIE A;  4LP0 A;  4EMV A;  3QT8 A;  3OPD A;  3G75 A;  3WQ9 A;  4NH9 A;  2UXD E;  1YES A;  3EKR A;  3R4P A;  1FWK A;  2LJP A;  2HCH A;  3D0B A;  1XMO I;  1FKA E;  4JI1 E;  3HEK A;  5IWA E;  4B3T E;  2BU6 A;  4V26 A;  1AJ6 A;  1KZN A;  2F4V E;  1UY9 A;  1PVG A;  4FW9 A;  4UT4 A;  3J81 C;  3T1Y I;  4X65 I;  4HAC B;  2YE9 A;  2YKI A;  1DAR A;  4XTJ A;  4DR7 I;  2YKB A;  5M4M A;  4AQY E;  4DV1 I;  4R1F A;  4LF6 I;  1I5B A;  1Z0B A;  2XDS A;  2DEJ A;  2YEB A;  4CE3 A;  3FV5 A;  4YHH I;  1OSF A;  3CWV A;  4ED4 A;  5LMN E;  4K0K I;  1S14 A;  1H72 C;  5GMD A;  1BKN A;  4DR5 I;  5D6P A;  1I94 E;  4JI4 I;  4OX9 I;  3EHF A;  3OWD A;  1FJG I;  3TTZ A;  4WUD A;  4EGI A;  4LF9 E;  4LF7 E;  4YKZ A;  1RR9 A;  2BYI A;  4DUZ I;  4E00 A;  2FWY A;  3T0Z A;  2HHH E;  4I3H A;  1YT2 A;  4FWD A;  2EXL A;  2YK2 A;  4DUY E;  1UEK A;  4JG4 A;  3OMU A;  2HFS A;  4PU9 A;  3H4L A;  1IBK I;  1QZR A;  4CWN A;  3PEJ A;  1UYG A;  5FLX Q;  2WI2 A;  3TZ4 A;  3LTO A;  3OTO E;  4LFA E;  1XNR I;  4GKK E;  2XHX A;  1XNQ E;  4L93 A;  2PNR A;  4NXN E;  4DV0 E;  3HYY A;  4FMT A;  3TZ0 A;  4EM7 A;  2VF3 A;  4CWR A;  4X64 E;  3DGE A;  4URN A;  3PYF A;  1N34 I;  2BYH A;  4XC0 A;  4DR6 I;  3B27 A;  1TID A;  4RPF A;  4JAS A;  4MPC A;  4DV2 I;  3RKZ A;  2XCM A;  3VHD A;  4YKT A;  4HAC A;  2YI6 A;  4B3S E;  5LMU E;  2XX5 A;  1GJV A;  2CG9 A;  4GT8 A;  4YKU A;  3B25 A;  5M4H A;  2VCI A;  4HY6 A;  4CWF A;  2ZIT A;  2YE3 A;  3PEH A;  4LWG A;  1OJ4 A;  1GKZ A;  1Y4S A;  4JQL A;  4XKK A;  2BV3 A;  2YEE A;  5BOC A;  4DV4 I;  4DV5 E;  4Q20 A;  3HUL A;  1XMQ E;  4FPP A;  1B62 A;  2XHR A;  4GKJ I;  4NH8 A;  4ASG A;  2R3V A;  4JAU A;  4YKX A;  4MOT A;  1YSZ A;  2DEI A;  4DV3 E;  4CWP A;  4LF8 E;  4BIU A;  4DR2 E;  4URM A;  2WEP A;  1A4H A;  1N36 I;  3K1J A;  1ZM3 A;  2XX2 A;  4V25 A;  1ZM2 A;  5L3J A;  4YHH E;  2UUA E;  4USK A;  2HK3 A;  4LFC I;  1IBM I;  4NXM E;  1MU5 A;  5IT9 Q;  3A0Y A;  4JI4 E;  4OX9 E;  2YKJ A;  4BIZ A;  4EFU A;  1UYD A;  1UYC A;  4EEH A;  4EGK A;  2WI4 A;  3LNU A;  4DPY A;  3RLQ A;  3O2F A;  1ELO A;  1J5E I;  3U2K A;  4PL9 A;  2ESA A;  2UXB I;  1YER A;  4KTN A;  4AS9 A;  1N33 E;  2YK9 A;  1VIS A;  3RLP A;  1KKH A;  4XCL A;  1YT1 A;  2Q8I A;  4JI0 I;  4GCZ A;  2XX4 A;  4HY1 A;  2Q8G A;  2YKC A;  4DR3 I;  3R91 A;  4BQJ A;  2YEG A;  1U2R A;  3Q5K A;  4X64 I;  3FT8 A;  4B3R I;  2A2C A;  3K97 A;  5M4P A;  1YC1 A;  3B28 A;  2J7K A;  4O04 A;  4LF6 E;  3T10 A;  4QPK A;  5FWK A;  4LF5 E;  1N32 I;  4W7T A;  1Z5C A;  4JYA I;  4KFG A;  1I59 A;  3F0N A;  4MP2 A;  1UY7 A;  1MX0 A;  4KSG A;  5F5R A;  3TZ2 A;  2BTZ A;  2BU7 A;  1R62 A;  4QPJ A;  1XMQ I;  3QTF A;  3VAD A;  2WI7 A;  4E02 A;  3HZ1 A;  4DPU A;  4YKR A;  1HR0 E;  2VQF E;  3VHA A;  3QT7 A;  4HZ5 A;  3J7A M;  2HKE A;  3D2R A;  4LFB I;  3K99 A;  4KP4 A;  4EFT A;  5FLX C;  1NHI A;  2UUB E;  4AWQ A;  3A0W A;  3NMQ A;  4JI1 I;  5BOD A;  1NHJ A;  3BMY A;  3C0E A;  4JV5 I;  4DV0 I;  5M4N A;  2VWC A;  2WEQ A;  2YI5 A;  3HYZ A;  1Z0C A;  3T1Y E;  4DUH A;  2A2D A;  1ID0 A;  1H74 A;  5BR8 I;  2UU9 E;  3D36 A;  1KVK A;  2YGA A;  4YKW A;  3WU4 A;  3R4O A;  1TC0 A;  2CZ9 A;  4JI8 I;  2CH4 A;  3WU6 A;  5GGZ A;  4K0K E;  4DR5 E;  1EA6 A;  3M6A A;  3ZZ0 A;  1TBW A;  1J5E E;  2YE2 A;  2GS8 A;  2GQP A;  4FCR A;  4JAV A;  4ASB A;  1FWL A;  4DV7 I;  2V8P A;  1XHK A;  3QDD A;  3U2D A;  2VQE E;  1YC3 A;  4X62 E;  2FXS A;  4DUY I;  2E1R A;  2YE6 A;  1JM6 A;  2YEJ A;  4HXW A;  4L90 A;  4L94 A;  4KSH A;  4XE2 A;  4YKQ A;  1HNZ E;  4WUB A;  3INX A;  1S4E A;  4HYM A;  4JI7 E;  4K4O A;  1Y8P A;  4KHP I;  4MBC A;  3EHG A;  1UYL A;  4XDM A;  2Q8H A;  4PRX A;  2GFD A;  3IED A;  5CTW A;  3PYD A;  5IWA I;  4B3T I;  3TUH A;  2X7I A;  2BM0 A;  1HNX I;  2IWX A;  2AKP A;  4XCJ A;  2Q2E B;  4CWS A;  2JKI A;  1Y4U A;  4DR1 I;  3SL2 A;  2XHT A;  2BRC A;  4FCQ A;  3V2U C;  4DU8 A;  4BXI A;  4GGL A;  3O6O A;  1AH8 A;  2XD6 A;  4YKY A;  1N0V C;  3B26 A;  4LWH A;  4XIP A;  4B3M E;  2XJJ A;  2XK2 A;  2QG0 A;  3GIG A;  4X9L A;  1TC6 A;  3K17 A;  1UYE A;  4XKA A;  3V5R A;  1Y8O A;  4O07 A;  2XJX A;  4LF7 I;  3ZZT A;  2VQF I;  1THN A;  4DUZ E;  3KE6 A;  1Z0T A;  2YEI A;  3B82 A;  2HHH I;  1IBL E;  2BU8 A;  3Q5L A;  5FND A;  1YSR A;  4GKJ E;  5J71 A;  3CGZ A;  4JI6 E;  1HNW E;  4GQT A;  1ZW9 A;  2XJG A;  2V2Q A;  4XIT A;  4LF4 I;  5CTY A;  3T1H E;  1UYH A;  3G7B A;  1WUU A;  3Q1Q A;  2YEC A;  4EGH A;  3TZ5 A;  1YC4 A;  1XNQ I;  2O1U A;  4ASF A;  1PKP A;  3BM9 A;  3WU5 A;  2IOQ A;  4JI5 E;  1UYI A;  4DPX A;  3K60 A;  1U0Z A;  4O09 A;  1BXD A;  3ZXO A;  5M4E A;  3GIG B;  4XKO A;  3VHC A;  2BSM A;  2YI0 A;  2YJX A;  4PRV A;  2E5L I;  4XD8 A;  4DV2 E;  5D7D A;  1AH6 A;  2NPF A;  4MB9 A;  3J7A G;  2FYP A;  4JI3 E;  2YE4 A;  2ZM6 I;  4DV6 I;  4B3S I;  4MPN A;  3R92 A;  5LMU I;  4DV1 E;  2XDU A;  4ASA A;  5D7C A;  4YY3 E;  2ZDY A;  2UWD A;  1B3Q A;  3OW6 A;  5LMN I;  1HR0 I;  2XDK A;  2HK2 A;  1TH8 A;  1Z0V A;  2YGE A;  4H85 A;  4HZ0 A;  4JI7 I;  3A0Z A;  4U7N A;  5IDM A;  4NH7 A;  4JI0 E;  5D7R A;  4MP7 A;  2UUB I;  3ZM7 A;  1AM1 A;  1U2O A;  2BU5 A;  4AWP A;  1NHH A;  5D6Q A;  1GKX A;  2YKE A;  1UYM A;  5GME A;  1IBK E;  4JV5 E;  1HNX E;  4LF8 I;  2EFG A;  3ZKB A;  4DR4 I;  4DR2 I;  2UXC E;  2XDL A;  3K98 A;  4CWT A;  2IOP A;  1I5A A;  4U93 A;  2BRE A;  4DZY A;  2R42 A;  3EHJ A;  1YET A;  2WER A;  4JI2 I;  1FNM A;  1Z0W A;  1N32 E;  4L91 A;  1Z5A A;  4JYA E;  5IT9 C;  3ZKD A;  5A2Q Q;  4X65 E;  4DR6 E;  3U67 A;  2OI2 A;  3J80 C;  2BU2 A;  4CE2 A;  5IN9 A;  1IBL I;  4X66 E;  2VQE I;  2UUC I;  1QY8 A;  4P8O A;  3B78 A;  4LWE A;  1I5C A;  4ZKI A;  2YJW A;  4MPE A;  1PIE A;  1Z0G A;  4LF4 E;  2V2V A;  2V34 A; 
#chains in the Genus database with same CATH topology
 2BT0 A;  4LFB E;  5CTU A;  4MYU A;  2C2A A;  1AMW A;  3CRL A;  1S16 A;  4LF9 I;  3C11 A;  3P76 A;  1RHY A;  4QNK A;  4DV4 E;  3HHU A;  4O0B A;  1Z0E A;  2YEH A;  1H7S A;  1H73 A;  3O0I A;  2O1W A;  2HFU A;  3B24 A;  4L8Z A;  2BM1 A;  1D6T A;  3T1K A;  2IOR A;  3QT5 A;  1I58 A;  2GQ0 A;  4LWI A;  2VW5 A;  2IWS A;  2WW4 A;  3J80 Q;  3GON A;  3S5T A;  1I5D A;  4DXL A;  5IDJ A;  5CTX A;  2UXD I;  2E0A A;  1OYS A;  4FCP A;  5BR8 E;  1BGQ A;  3CYG A;  3LPS A;  1FI4 A;  2C38 A;  4GEE A;  2YED A;  1N36 E;  4E01 A;  3RLR A;  4JI8 E;  4BQG A;  1USU A;  3ZZU A;  5LL6 R;  2YE8 A;  3A0X A;  4Z7C A;  2CGF A;  2XDX A;  4R3A A;  2BZ5 A;  1ZM9 A;  5JEA C;  3A0R A;  2HG1 A;  2YGF A;  4DR7 E;  2YEF A;  4P7A A;  2BA1 D;  2YEA A;  1UYF A;  2XAB A;  2H55 A;  1TIL A;  4X62 I;  4OO1 A;  4P52 A;  2QF6 A;  2YE5 A;  4XIQ A;  1HK7 A;  3PS2 A;  4FWG A;  1UYK A;  2WI5 A;  3PS3 A;  4I5S A;  4HYP A;  1QYE A;  1UY6 A;  5JEN A;  3JAM Q;  1US7 A;  3EKO A;  3MNR P;  2Q8F A;  2WI3 A;  1FJG E;  1E3P A;  4KQV A;  5CPH A;  4URO A;  4KHP E;  4CE1 A;  1EI1 A;  4U7O A;  1YS3 A;  4Z7Y A;  2WI6 A;  4UTG A;  1KIJ A;  2YE7 A;  3QT6 A;  3KRN A;  4FW3 A;  1BYQ A;  3G7E A;  3GIF A;  4B6C A;  4CWO A;  3PYG A;  5CF0 A;  4JI2 E;  2O1V A;  5DRO A;  4DV3 I;  2JJC A;  2IWU A;  1Z5B A;  1B63 A;  2VCJ A;  4CWQ A;  3R4N A;  2E5L E;  3FT5 A;  3JZ3 A;  3M85 G;  2UU9 I;  4H81 A;  5F3K A;  4AWO A;  4B3R E;  4B7P A;  1XMO E;  4JI3 I;  2ZDX A;  4O05 A;  3GLL A;  2JEB A;  4FN5 A;  4USM A;  2WI1 A;  1UY8 A;  3R4M A;  1UDO A;  1H7U A;  4YY3 I;  2CVE A;  2ZBK B;  4GFN A;  2F4V I;  2UUA I;  3U1Y A;  1N34 E;  2XEX A;  4GQU A;  1K47 A;  3H80 A;  4LF5 I;  4DV7 E;  4LFC E;  1E3H A;  3A0T A;  4U3D A;  3EHH A;  4H7Q A;  5C93 A;  4BAE A;  4EMD A;  1IXM A;  4AQY I;  2V2Z A;  2CCT A;  1N0U A;  4FWH A;  1MG7 A;  4DPT A;  4DPW A;  3J81 Q;  4DU7 A;  1A6F A;  1HNZ I;  4MU4 A;  3PYE A;  1YT0 A;  2YI7 A;  1I94 I;  3T1H I;  3CGY A;  5DRQ A;  3T0H A;  4DR4 E;  2UXC I;  1Y60 A;  3D4J A;  4MYT A;  2UXB E;  1N33 I;  1KTV A;  2FWZ A;  4DV5 I;  4M1K A;  2BA1 G;  4HXZ A;  5A2Q C;  2X36 A;  3H1C A;  4LPB A;  4JI5 I;  4DR3 E;  5EKW A;  3WU3 A;  3WHA A;  5FNC A;  4XIR A;  1ZM4 A;  3B8H A;  4DR1 E;  3OWB A;  2JE6 A;  2K5B A;  2Z5E A;  5FNF A;  4LWF A;  3T2S A;  3OTO I;  4LPF A;  3Q6M A;  4LFA I;  1XNR E;  4GKK I;  2QG2 A;  3ZXQ A;  1L0O A;  5J6A A;  3JAM C;  2ZM6 E;  4DV6 E;  2BR2 A;  2ZKJ A;  3HZ5 A;  3Q5J A;  4X66 I;  2UUC E;  4NBQ A;  4NXN I;  2CCS A;  4B3M I;  3B4T A;  4WUC A;  4LCG A;  2AJ4 A;  4AID A;  4URL A;  4ZVI A;  1ZWH A;  1Z59 A;  1IBM E;  4NXM I;  1Y8N A;  3CRK A;  1ZXM A;  4MU3 A;  5M4K A;  1NZ0 A;  1YHC A;  4R3M A;  2C38 B;  4IFD D;  2HKJ A;  5C0X A;  1ZXN A;  3INW A;  3M85 D;  2CCU A;  2Z5C A;  4JI6 I;  2IER A;  3U1K A;  1HNW I;  2PNZ A;  2QFO A;  3GME A;  1RRE A;  2H8M A;  3GIE A;  4LP0 A;  3CDJ A;  4EMV A;  3QT8 A;  3OPD A;  3G75 A;  3WQ9 A;  4NH9 A;  2PO0 B;  2PO2 B;  2J65 A;  2UXD E;  2Z5B A;  1YES A;  3EKR A;  3R4P A;  1FWK A;  2LJP A;  2HCH A;  3UHM A;  3D0B A;  1XMO I;  3P3E A;  5DNL A;  1FKA E;  4JI1 E;  3HEK A;  5IWA E;  4B3T E;  2BU6 A;  4V26 A;  3L7Z A;  1AJ6 A;  1KZN A;  2F4V E;  1UY9 A;  1PVG A;  4FW9 A;  4UT4 A;  3J81 C;  3T1Y I;  4X65 I;  4HAC B;  2YE9 A;  2YKI A;  1DAR A;  4XTJ A;  5ELW A;  4DR7 I;  2YKB A;  5M4M A;  2C37 B;  4AQY E;  4DV1 I;  4R1F A;  2NN6 D;  4LF6 I;  1I5B A;  1Z0B A;  2XDS A;  2DEJ A;  2YEB A;  4CE3 A;  3FV5 A;  4YHH I;  1OSF A;  1Y5Y A;  3CWV A;  4ED4 A;  5LMN E;  4K0K I;  1S14 A;  1H72 C;  5GMD A;  1BKN A;  5JEA B;  4DR5 I;  5D6P A;  1OYP A;  1I94 E;  4JI4 I;  4OX9 I;  3EHF A;  3OWD A;  1FJG I;  5K36 F;  3TTZ A;  4WUD A;  2F1D A;  2IES A;  4LF9 E;  4LF7 E;  5K36 B;  1RR9 A;  4YKZ A;  2BYI A;  4DUZ I;  4E00 A;  2FWY A;  3T0Z A;  2HHH E;  4I3H A;  1YT2 A;  4FWD A;  2EXL A;  2YK2 A;  4DUY E;  1UEK A;  4JG4 A;  3OMU A;  2HFS A;  2PO2 A;  4PU9 A;  3H4L A;  1IBK I;  1QZR A;  4IZJ D;  4CWN A;  5K36 D;  3PEJ A;  2Z5B B;  1UYG A;  5FLX Q;  5JEA D;  3P3G A;  2WI2 A;  3TZ4 A;  3LTO A;  3OTO E;  4LFA E;  1XNR I;  4GKK E;  2XHX A;  1XNQ E;  1USV A;  4L93 A;  3K85 A;  2PNR A;  4NXN E;  4DV0 E;  4E72 A;  3HYY A;  4FMT A;  3TZ0 A;  4EM7 A;  2VF3 A;  4J3D A;  4X64 E;  5C0X B;  3DGE A;  3PYF A;  4CWR A;  4URN A;  1N34 I;  2BYH A;  4XC0 A;  4DR6 I;  4OO1 C;  3B27 A;  3Q6N A;  4RPF A;  1TID A;  4JAS A;  4MPC A;  4DV2 I;  4IFD E;  2XCM A;  3RKZ A;  3VHD A;  4YKT A;  4FW5 A;  4HAC A;  2YI6 A;  4B3S E;  4BA1 B;  5LMU E;  2XX5 A;  1GJV A;  2CG9 A;  4GT8 A;  4YKU A;  3B25 A;  5M4H A;  1Y6Z A;  2VCI A;  4HY6 A;  2ZIT A;  2YE3 A;  4CWF A;  3PEH A;  4LWG A;  1OJ4 A;  1GKZ A;  1Y4S A;  2C1I A;  4JQL A;  2BV3 A;  2YEE A;  4XKK A;  4DV4 I;  5BOC A;  4DV5 E;  4Q20 A;  3HUL A;  1XMQ E;  4FPP A;  1B62 A;  2XHR A;  4GKJ I;  4NH8 A;  4ASG A;  2PO0 A;  4OO1 D;  2R3V A;  4JAU A;  4YKX A;  4MOT A;  1YSZ A;  4IFD B;  2DEI A;  4DV3 E;  4CWP A;  3PS1 A;  4LF8 E;  1R6L A;  4BIU A;  1OYR A;  2Z5C B;  4DR2 E;  4URM A;  2WEP A;  1A4H A;  3HKM A;  1N36 I;  3K1J A;  1ZM3 A;  2JT2 A;  2XX2 A;  4V25 A;  1ZM2 A;  5L3J A;  2PNL A;  4YHH E;  2UUA E;  4OO1 B;  2NN6 C;  4USK A;  2HK3 A;  4LFC I;  5C0X C;  1IBM I;  4NXM E;  1MU5 A;  5IT9 Q;  3A0Y A;  4JI4 E;  4OX9 E;  2YKJ A;  4BIZ A;  4EFU A;  1UYD A;  1UYC A;  4EEH A;  4EGK A;  2WI4 A;  2JEB B;  3LNU A;  4DPY A;  3RLQ A;  3O2F A;  1ELO A;  1J5E I;  5C0X F;  3U2K A;  4PL9 A;  2ESA A;  2UXB I;  1YER A;  4KTN A;  4AS9 A;  1N33 E;  4MDT A;  1VIS A;  3HJC A;  1KKH A;  5JEA E;  2YK9 A;  4XCL A;  3RLP A;  5K36 C;  1YT1 A;  2Q8I A;  4FW6 A;  4JI0 I;  2FTK A;  2XX4 A;  4GCZ A;  4HY1 A;  2Q8G A;  2YKC A;  4DR3 I;  5C0X D;  3R91 A;  1VI7 A;  4BQJ A;  2YEG A;  1U2R A;  3Q5K A;  4X64 I;  4AIM A;  1YH8 A;  3FT8 A;  4B3R I;  2A2C A;  3K97 A;  5M4P A;  1YC1 A;  3B28 A;  2J7K A;  4O04 A;  4LF6 E;  3T10 A;  3NZK A;  4QPK A;  5FWK A;  1R6M A;  4LF5 E;  1N32 I;  4W7T A;  1Z5C A;  4JYA I;  4KFG A;  2HHI A;  1I59 A;  4EGI A;  3F0N A;  4MP2 A;  1UY7 A;  1MX0 A;  4KSG A;  5F5R A;  3TZ2 A;  3PRY A;  2BTZ A;  2BU7 A;  1R62 A;  4QPJ A;  2GO4 A;  1XMQ I;  3QTF A;  3VAD A;  2WI7 A;  2NN6 A;  4E02 A;  3HZ1 A;  4DPU A;  4YKR A;  1HR0 E;  2VQF E;  3VHA A;  3QT7 A;  4HZ5 A;  3J7A M;  2HKE A;  3D2R A;  4LFB I;  3K99 A;  4KP4 A;  4EFT A;  5FLX C;  1NHI A;  2UUB E;  5K36 E;  4AWQ A;  3A0W A;  4IFD A;  3NMQ A;  4JI1 I;  5BOD A;  1NHJ A;  4IS9 A;  3BMY A;  3C0E A;  3M7N G;  4JV5 I;  4DV0 I;  3P06 A;  4QNJ A;  2VWC A;  2WEQ A;  4N3O A;  2YI5 A;  3HYZ A;  5M4N A;  1Z0C A;  4OKG A;  3T1Y E;  4DUH A;  3LMM A;  5K36 A;  2A2D A;  1ID0 A;  1H74 A;  5BR8 I;  2UU9 E;  4FW7 A;  4LCH A;  3D36 A;  1KVK A;  4MU1 A;  2YGA A;  4YKW A;  5EL9 A;  3WU4 A;  1TC0 A;  3R4O A;  2CZ9 A;  4JI8 I;  2O1T A;  3WU6 A;  2CH4 A;  4BA1 A;  5GGZ A;  2GO3 A;  2C39 B;  4K0K E;  2AE8 A;  4DR5 E;  1EA6 A;  3M6A A;  3ZZ0 A;  4LOM A;  1J5E E;  1TBW A;  2GS8 A;  2GQP A;  2YE2 A;  4FCR A;  4JAV A;  1FWL A;  4ASB A;  4DV7 I;  2V8P A;  1XHK A;  3QDD A;  3U2D A;  2VQE E;  1YC3 A;  4X62 E;  2FXS A;  4DUY I;  2E1R A;  2YE6 A;  1JM6 A;  1UDS A;  2YEJ A;  4HXW A;  4L90 A;  4L94 A;  4KSH A;  4XE2 A;  4OO1 F;  4YKQ A;  1HNZ E;  1XXE A;  4WUB A;  3INX A;  1S4E A;  4HYM A;  4JI7 E;  2C1G A;  4K4O A;  4LCF A;  1Y8P A;  1UDQ A;  4KHP I;  4MBC A;  3EHG A;  1UYL A;  4XDM A;  2Q8H A;  4PRX A;  2GFD A;  5JEA F;  3IED A;  5CTW A;  3PYD A;  2WP8 B;  5IWA I;  4B3T I;  3TUH A;  2X7I A;  2BM0 A;  5DNX A;  1HNX I;  2IWX A;  3M7N D;  2AKP A;  4IZK B;  4BA2 A;  4XCJ A;  2Q2E B;  4CWS A;  4IZJ A;  2JKI A;  1Y4U A;  4DR1 I;  3SL2 A;  2XHT A;  2BRC A;  4FCQ A;  2BA0 G;  2JEA B;  3V2U C;  4DU8 A;  4BXI A;  5JEA A;  4GGL A;  3O6O A;  1AH8 A;  2XD6 A;  4YKY A;  1N0V C;  3B26 A;  4LWH A;  4XIP A;  4B3M E;  2CGE A;  2XJJ A;  2XK2 A;  2QG0 A;  3GIG A;  4X9L A;  1TC6 A;  3K17 A;  2C37 A;  1UYE A;  3V5R A;  4FW4 A;  4XKA A;  1Y8O A;  4O07 A;  2JEA A;  4ISA A;  4LF7 I;  2XJX A;  3ZZT A;  2VQF I;  1THN A;  4DUZ E;  3KE6 A;  1Z0T A;  2YEI A;  3B82 A;  2HHH I;  2WNR A;  5DRR A;  1IBL E;  2BU8 A;  3Q5L A;  5FND A;  2PO1 A;  1YSR A;  4GKJ E;  5J71 A;  3CGZ A;  4JI6 E;  1HNW E;  4GQT A;  1ZW9 A;  2XJG A;  2V2Q A;  4XIT A;  4LF4 I;  3GCM A;  5CTY A;  3T1H E;  1UYH A;  3G7B A;  1WUU A;  5C0X E;  3Q1Q A;  2YEC A;  4EGH A;  3TZ5 A;  2PO1 B;  1YC4 A;  1XNQ I;  2O1U A;  4ASF A;  1PKP A;  3BM9 A;  3WU5 A;  2IOQ A;  4JI5 E;  2PNZ B;  4DPX A;  1UYI A;  3K60 A;  1U0Z A;  4O09 A;  1BXD A;  3ZXO A;  2WNR B;  3GIG B;  5M4E A;  4XKO A;  3VHC A;  2BSM A;  2YI0 A;  2YJX A;  4PRV A;  2E5L I;  4XD8 A;  2O3Z A;  4DV2 E;  5D7D A;  1AH6 A;  4MQY A;  2NPF A;  4MB9 A;  3J7A G;  1UDN A;  4IFD F;  2FYP A;  4JI3 E;  2YE4 A;  2ZM6 I;  4DV6 I;  4B3S I;  4MPN A;  3R92 A;  5LMU I;  4DV1 E;  2XDU A;  4ASA A;  5D7C A;  4YY3 E;  2ZDY A;  2UWD A;  1P42 A;  1B3Q A;  3OW6 A;  2BR2 B;  2PNM A;  3L7Z B;  5LMN I;  1HR0 I;  2XDK A;  2HK2 A;  1TH8 A;  1Z0V A;  2YGE A;  4U3B A;  4H85 A;  4JI7 I;  4HZ0 A;  3A0Z A;  4U7N A;  5DRP A;  5IDM A;  1F51 A;  4NH7 A;  2JE6 B;  4JI0 E;  5D7R A;  4MP7 A;  4IZK A;  2BA0 D;  2UUB I;  4BA2 B;  4AM3 A;  3ZM7 A;  4OZE A;  1AM1 A;  1U2O A;  2BU5 A;  4AWP A;  3CDI A;  1NHH A;  5D6Q A;  3DD6 A;  1GKX A;  2YKE A;  1UYM A;  5GME A;  1IBK E;  4JV5 E;  1HNX E;  4LF8 I;  2EFG A;  3ZKB A;  4DR4 I;  4DR2 I;  4OO1 E;  2UXC E;  2XDL A;  3K98 A;  4CWT A;  2IOP A;  1I5A A;  4U93 A;  4IFD C;  2BRE A;  4DZY A;  2R42 A;  3EHJ A;  2NN6 F;  3P3C A;  1YET A;  2NN6 B;  2WER A;  4JI2 I;  2VES A;  1FNM A;  1Z0W A;  1N32 E;  4L91 A;  1Z5A A;  4JYA E;  5IT9 C;  3ZKD A;  5A2Q Q;  4X65 E;  4DR6 E;  3U67 A;  2OI2 A;  3J80 C;  2BU2 A;  4CE2 A;  2C39 A;  5IN9 A;  1IBL I;  4X66 E;  2VQE I;  4MU0 A;  2UUC I;  1QY8 A;  3B78 A;  4LWE A;  4P8O A;  1I5C A;  4IZJ B;  4ZKI A;  2YJW A;  4MPE A;  1PIE A;  1Z0G A;  2NN6 E;  4LF4 E;  2V2V A;  2V34 A;  2WP8 A; 
#chains in the Genus database with same CATH homology
 2BT0 A;  4LFB E;  5CTU A;  4MYU A;  2C2A A;  1AMW A;  3CRL A;  1S16 A;  4LF9 I;  3C11 A;  4DV4 E;  3HHU A;  4O0B A;  1Z0E A;  2YEH A;  1H7S A;  1H73 A;  3O0I A;  2O1W A;  2HFU A;  3B24 A;  4L8Z A;  2BM1 A;  1D6T A;  3T1K A;  2IOR A;  3QT5 A;  1I58 A;  2GQ0 A;  4LWI A;  2VW5 A;  2IWS A;  2WW4 A;  3J80 Q;  3GON A;  1I5D A;  4DXL A;  5IDJ A;  5CTX A;  2UXD I;  2E0A A;  4FCP A;  5BR8 E;  1BGQ A;  3LPS A;  1FI4 A;  4GEE A;  2YED A;  1N36 E;  4E01 A;  3RLR A;  4JI8 E;  1USU A;  3ZZU A;  5LL6 R;  2YE8 A;  3A0X A;  4Z7C A;  2CGF A;  2XDX A;  4R3A A;  2BZ5 A;  1ZM9 A;  3A0R A;  2HG1 A;  2YGF A;  4DR7 E;  2YEF A;  4P7A A;  2YEA A;  1UYF A;  2XAB A;  2H55 A;  1TIL A;  4X62 I;  4P52 A;  2QF6 A;  2YE5 A;  4XIQ A;  1HK7 A;  4FWG A;  1UYK A;  2WI5 A;  4I5S A;  4HYP A;  1QYE A;  1UY6 A;  3JAM Q;  1US7 A;  3EKO A;  3MNR P;  2Q8F A;  2WI3 A;  1FJG E;  4KQV A;  5CPH A;  4URO A;  4KHP E;  4CE1 A;  1EI1 A;  4U7O A;  1YS3 A;  4Z7Y A;  2WI6 A;  4UTG A;  1KIJ A;  2YE7 A;  3QT6 A;  1BYQ A;  3G7E A;  3GIF A;  4B6C A;  4CWO A;  3PYG A;  5CF0 A;  4JI2 E;  2O1V A;  4DV3 I;  2JJC A;  2IWU A;  1Z5B A;  1B63 A;  2VCJ A;  4CWQ A;  3R4N A;  2E5L E;  3FT5 A;  3JZ3 A;  2UU9 I;  4H81 A;  5F3K A;  4AWO A;  4B3R E;  4B7P A;  1XMO E;  4JI3 I;  2ZDX A;  4O05 A;  4FN5 A;  4USM A;  2WI1 A;  1UY8 A;  3R4M A;  1H7U A;  4YY3 I;  2ZBK B;  4GFN A;  2F4V I;  2UUA I;  3H80 A;  1N34 E;  2XEX A;  1K47 A;  4LF5 I;  4DV7 E;  4LFC E;  3A0T A;  3EHH A;  5C93 A;  4H7Q A;  4BAE A;  4EMD A;  4AQY I;  2V2Z A;  2CCT A;  1N0U A;  4FWH A;  1MG7 A;  4DPT A;  4DPW A;  3J81 Q;  4DU7 A;  1A6F A;  1HNZ I;  3PYE A;  1YT0 A;  2YI7 A;  1I94 I;  3T1H I;  3CGY A;  3T0H A;  4DR4 E;  2UXC I;  3D4J A;  4MYT A;  2UXB E;  1N33 I;  1KTV A;  2FWZ A;  4DV5 I;  4M1K A;  4HXZ A;  5A2Q C;  2X36 A;  4LPB A;  4JI5 I;  4DR3 E;  3WU3 A;  3WHA A;  5FNC A;  4XIR A;  1ZM4 A;  3B8H A;  4DR1 E;  3OWB A;  2K5B A;  2Z5E A;  5FNF A;  4LWF A;  3T2S A;  3OTO I;  4LFA I;  3Q6M A;  1XNR E;  4GKK I;  2QG2 A;  3ZXQ A;  1L0O A;  5J6A A;  3JAM C;  2ZM6 E;  4DV6 E;  2ZKJ A;  3HZ5 A;  3Q5J A;  4X66 I;  2UUC E;  4NXN I;  2CCS A;  4B3M I;  4WUC A;  2AJ4 A;  4URL A;  4ZVI A;  1ZWH A;  1Z59 A;  1IBM E;  4NXM I;  1Y8N A;  3CRK A;  1ZXM A;  5M4K A;  1NZ0 A;  4R3M A;  2HKJ A;  1ZXN A;  3INW A;  2CCU A;  2Z5C A;  4JI6 I;  1HNW I;  4BQG A;  2QFO A;  1RRE A;  2H8M A;  3GIE A;  4LP0 A;  4EMV A;  3QT8 A;  3OPD A;  3G75 A;  3WQ9 A;  4NH9 A;  2UXD E;  2Z5B A;  1YES A;  3EKR A;  3R4P A;  1FWK A;  2LJP A;  2HCH A;  3D0B A;  1XMO I;  1FKA E;  4JI1 E;  3HEK A;  5IWA E;  4B3T E;  2BU6 A;  4V26 A;  1AJ6 A;  1KZN A;  2F4V E;  1UY9 A;  1PVG A;  4FW9 A;  4UT4 A;  3J81 C;  3T1Y I;  4X65 I;  4HAC B;  2YE9 A;  2YKI A;  1DAR A;  4XTJ A;  4DR7 I;  2YKB A;  5M4M A;  4AQY E;  4DV1 I;  4R1F A;  4LF6 I;  1I5B A;  1Z0B A;  2XDS A;  2DEJ A;  2YEB A;  4CE3 A;  3FV5 A;  4YHH I;  1OSF A;  3CWV A;  4ED4 A;  5LMN E;  4K0K I;  1S14 A;  1H72 C;  5GMD A;  1BKN A;  4DR5 I;  5D6P A;  1I94 E;  4JI4 I;  4OX9 I;  3EHF A;  3OWD A;  1FJG I;  3TTZ A;  4WUD A;  4EGI A;  4LF9 E;  4LF7 E;  4YKZ A;  1RR9 A;  2BYI A;  4DUZ I;  4E00 A;  2FWY A;  3T0Z A;  2HHH E;  4I3H A;  1YT2 A;  4FWD A;  2EXL A;  2YK2 A;  4DUY E;  1UEK A;  4JG4 A;  3OMU A;  2HFS A;  4PU9 A;  3H4L A;  1IBK I;  1QZR A;  4IZJ D;  4CWN A;  3PEJ A;  2Z5B B;  1UYG A;  5FLX Q;  2WI2 A;  3TZ4 A;  3LTO A;  3OTO E;  4LFA E;  1XNR I;  4GKK E;  2XHX A;  1XNQ E;  1USV A;  4L93 A;  3K85 A;  2PNR A;  4NXN E;  4DV0 E;  3HYY A;  4FMT A;  3TZ0 A;  4EM7 A;  2VF3 A;  4CWR A;  4X64 E;  3DGE A;  4URN A;  3PYF A;  1N34 I;  2BYH A;  4XC0 A;  4DR6 I;  3B27 A;  3Q6N A;  4RPF A;  1TID A;  4JAS A;  4MPC A;  4DV2 I;  3RKZ A;  2XCM A;  3VHD A;  4YKT A;  4HAC A;  2YI6 A;  4B3S E;  5LMU E;  2XX5 A;  1GJV A;  2CG9 A;  4GT8 A;  4YKU A;  3B25 A;  5M4H A;  1Y6Z A;  2VCI A;  4HY6 A;  2ZIT A;  2YE3 A;  4CWF A;  3PEH A;  4LWG A;  1OJ4 A;  1GKZ A;  1Y4S A;  4JQL A;  4XKK A;  2BV3 A;  2YEE A;  5BOC A;  4DV4 I;  4DV5 E;  4Q20 A;  3HUL A;  1XMQ E;  4FPP A;  1B62 A;  2XHR A;  4GKJ I;  4NH8 A;  4ASG A;  2R3V A;  4JAU A;  4YKX A;  4MOT A;  1YSZ A;  2DEI A;  4DV3 E;  4CWP A;  4LF8 E;  4BIU A;  4DR2 E;  2Z5C B;  4URM A;  2WEP A;  1A4H A;  1N36 I;  3K1J A;  1ZM3 A;  2XX2 A;  4V25 A;  1ZM2 A;  5L3J A;  2PNL A;  4YHH E;  2UUA E;  4USK A;  2HK3 A;  4LFC I;  1IBM I;  4NXM E;  1MU5 A;  5IT9 Q;  3A0Y A;  4JI4 E;  4OX9 E;  2YKJ A;  4BIZ A;  4EFU A;  1UYD A;  1UYC A;  4EEH A;  4EGK A;  2WI4 A;  3LNU A;  4DPY A;  3RLQ A;  3O2F A;  1ELO A;  1J5E I;  3U2K A;  4PL9 A;  2ESA A;  2UXB I;  1YER A;  4KTN A;  4AS9 A;  1N33 E;  2YK9 A;  1VIS A;  3HJC A;  1KKH A;  4XCL A;  3RLP A;  1YT1 A;  2Q8I A;  4JI0 I;  4GCZ A;  2XX4 A;  4HY1 A;  2Q8G A;  2YKC A;  4DR3 I;  3R91 A;  4BQJ A;  2YEG A;  1U2R A;  3Q5K A;  4X64 I;  3FT8 A;  4B3R I;  2A2C A;  3K97 A;  5M4P A;  1YC1 A;  3B28 A;  2J7K A;  4O04 A;  4LF6 E;  3T10 A;  4QPK A;  5FWK A;  4LF5 E;  1N32 I;  4W7T A;  1Z5C A;  4JYA I;  4KFG A;  1I59 A;  3F0N A;  4MP2 A;  1UY7 A;  1MX0 A;  4KSG A;  5F5R A;  3TZ2 A;  3PRY A;  2BTZ A;  2BU7 A;  1R62 A;  4QPJ A;  1XMQ I;  3QTF A;  3VAD A;  2WI7 A;  4E02 A;  3HZ1 A;  4DPU A;  4YKR A;  1HR0 E;  2VQF E;  3VHA A;  3QT7 A;  4HZ5 A;  3J7A M;  2HKE A;  3D2R A;  4LFB I;  3K99 A;  4KP4 A;  4EFT A;  5FLX C;  1NHI A;  2UUB E;  4AWQ A;  3A0W A;  3NMQ A;  4JI1 I;  5BOD A;  1NHJ A;  3BMY A;  3C0E A;  4JV5 I;  4DV0 I;  3P06 A;  5M4N A;  2VWC A;  2WEQ A;  4N3O A;  2YI5 A;  3HYZ A;  1Z0C A;  3T1Y E;  4DUH A;  2A2D A;  1ID0 A;  1H74 A;  5BR8 I;  2UU9 E;  3D36 A;  1KVK A;  2YGA A;  4YKW A;  3WU4 A;  3R4O A;  1TC0 A;  2CZ9 A;  4JI8 I;  2O1T A;  3WU6 A;  2CH4 A;  5GGZ A;  4K0K E;  4DR5 E;  1EA6 A;  3M6A A;  3ZZ0 A;  1TBW A;  1J5E E;  2YE2 A;  2GS8 A;  2GQP A;  4FCR A;  4JAV A;  4ASB A;  1FWL A;  4DV7 I;  2V8P A;  1XHK A;  3QDD A;  3U2D A;  2VQE E;  1YC3 A;  4X62 E;  2FXS A;  4DUY I;  2E1R A;  2YE6 A;  1JM6 A;  2YEJ A;  4HXW A;  4L90 A;  4L94 A;  4KSH A;  4XE2 A;  4YKQ A;  1HNZ E;  4WUB A;  3INX A;  1S4E A;  4HYM A;  4JI7 E;  4K4O A;  1Y8P A;  4KHP I;  4MBC A;  3EHG A;  1UYL A;  4XDM A;  2Q8H A;  4PRX A;  2GFD A;  3IED A;  5CTW A;  3PYD A;  5IWA I;  4B3T I;  3TUH A;  2X7I A;  2BM0 A;  1HNX I;  2IWX A;  2AKP A;  4IZK B;  4XCJ A;  2Q2E B;  4CWS A;  4IZJ A;  2JKI A;  1Y4U A;  4DR1 I;  3SL2 A;  2XHT A;  2BRC A;  4FCQ A;  3V2U C;  4DU8 A;  4BXI A;  4GGL A;  3O6O A;  1AH8 A;  2XD6 A;  4YKY A;  1N0V C;  3B26 A;  4LWH A;  4XIP A;  4B3M E;  2CGE A;  2XJJ A;  2XK2 A;  2QG0 A;  3GIG A;  4X9L A;  1TC6 A;  3K17 A;  1UYE A;  4XKA A;  3V5R A;  1Y8O A;  4O07 A;  2XJX A;  4LF7 I;  3ZZT A;  2VQF I;  1THN A;  4DUZ E;  3KE6 A;  1Z0T A;  2YEI A;  3B82 A;  2HHH I;  1IBL E;  2BU8 A;  3Q5L A;  5FND A;  1YSR A;  4GKJ E;  5J71 A;  3CGZ A;  4JI6 E;  1HNW E;  4GQT A;  1ZW9 A;  2XJG A;  2V2Q A;  4XIT A;  4LF4 I;  5CTY A;  3T1H E;  1UYH A;  3G7B A;  1WUU A;  3Q1Q A;  2YEC A;  4EGH A;  3TZ5 A;  1YC4 A;  1XNQ I;  2O1U A;  4ASF A;  1PKP A;  3BM9 A;  3WU5 A;  2IOQ A;  4JI5 E;  1UYI A;  4DPX A;  3K60 A;  1U0Z A;  4O09 A;  1BXD A;  3ZXO A;  5M4E A;  3GIG B;  4XKO A;  3VHC A;  2BSM A;  2YI0 A;  2YJX A;  2E5L I;  4PRV A;  4XD8 A;  4DV2 E;  5D7D A;  1AH6 A;  2NPF A;  4MB9 A;  3J7A G;  2FYP A;  4JI3 E;  2YE4 A;  2ZM6 I;  4DV6 I;  4B3S I;  4MPN A;  3R92 A;  5LMU I;  4DV1 E;  2XDU A;  4ASA A;  5D7C A;  4YY3 E;  2ZDY A;  2UWD A;  1B3Q A;  3OW6 A;  2PNM A;  5LMN I;  1HR0 I;  2XDK A;  2HK2 A;  1TH8 A;  1Z0V A;  2YGE A;  4H85 A;  4HZ0 A;  4JI7 I;  3A0Z A;  4U7N A;  5IDM A;  4NH7 A;  4JI0 E;  5D7R A;  4MP7 A;  4IZK A;  2UUB I;  3ZM7 A;  1AM1 A;  1U2O A;  2BU5 A;  4AWP A;  1NHH A;  5D6Q A;  1GKX A;  2YKE A;  1UYM A;  5GME A;  1IBK E;  4JV5 E;  1HNX E;  4LF8 I;  2EFG A;  3ZKB A;  4DR4 I;  4DR2 I;  2UXC E;  2XDL A;  3K98 A;  4CWT A;  2IOP A;  1I5A A;  4U93 A;  2BRE A;  4DZY A;  2R42 A;  3EHJ A;  1YET A;  2WER A;  4JI2 I;  1FNM A;  1Z0W A;  1N32 E;  4L91 A;  1Z5A A;  4JYA E;  5IT9 C;  3ZKD A;  5A2Q Q;  4X65 E;  4DR6 E;  3U67 A;  2OI2 A;  3J80 C;  2BU2 A;  4CE2 A;  5IN9 A;  1IBL I;  4X66 E;  2VQE I;  2UUC I;  1QY8 A;  4P8O A;  3B78 A;  4LWE A;  1I5C A;  4IZJ B;  4ZKI A;  2YJW A;  4MPE A;  1PIE A;  1Z0G A;  4LF4 E;  2V2V A;  2V34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...