1S16A

Crystal structure of e. coli topoisomerase iv pare 43kda subunit complexed with adpnp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
380
Chain Sequence
TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Topoisomerase IV subunit B
publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 114
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s16A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s16A01
2K5BA 5M4MA 1FWLA 4DV3I 4LPBA 1RREA 1FJGI 2YE6A 1PIEA 4K0KI 3T1HI 1FNMA 3WU4A 4XKAA 2FYPA 5D6PA 4E00A 2YEGA 3B78A 3ZKBA 1JM6A 2BU8A 4MBCA 2E0AA 3R4OA 5FLXC 4XDMA 4FWHA 4GGLA 2Q8HA 2VF3A 4DV7I 4UROA 4CE1A 4BXIA 3EHGA 5M4NA 3RLPA 4LF5E 3H4LA 4KHPE 4CWNA 4L94A 4R1FA 4JI7E 1QY8A 4EGHA 2VQEI 1YT0A 4YHHE 4AQYI 2ZDYA 4NXNE 2HFUA 4V26A 5M4PA 5BOCA 2WI5A 4USMA 2YE3A 4BQJA 4JV5I 3OTOE 4HY6A 1HNXE 4JYAE 1Z0GA 1TH8A 2HHHI 4JI0I 2HG1A 3ZXOA 2XJGA 2YE4A 2BZ5A 4ED4A 4DUZI 3A0RA 4HACA 2JJCA 2YE9A 4KFGA 3Q5KA 4FCPA 3IEDA 4K4OA 2V2QA 5F3KA 2CH4A 2O1VA 2YE8A 3WHAA 4KSHA 4JI1E 4LF8I 2XHRA 4CE2A 4JI6I 4LF9I 2J7KA 4XKOA 3MNRP 4YKWA 4URNA 1Y8OA 3TZ5A 1A4HA 2XX2A 2YI6A 1IBLI 2R3VA 1NHJA 1Y8NA 1YESA 2XHTA 2YEBA 1K47A 4ASAA 4CWQA 1IBME 2XDUA 4YY3E 3J81Q 1U2OA 4DPUA 3G7BA 1N36I 4QPKA 4EFTA 4JI8E 5D6QA 1UYGA 2BYIA 2E1RA 4B3TE 4DR7E 2EFGA 4DU8A 1IBKE 3VADA 4BIUA 4DUYE 4DZYA 1GKXA 4FCRA 2VQFE 1BKNA 4XIPA 4DR6E 1UYKA 4DPYA 3B25A 2UUBE 4CWTA 2WW4A 3QT5A 1KIJA 1U2RA 4LP0A 3LNUA 3QDDA 2YKJA 1AMWA 2UUAI 4HYMA 3T2SA 4H81A 1XNRE 1OSFA 4LWGA 5LMUE 4X66E 2CZ9A 3EHFA 2YE2A 4B6CA 4GKJE 4EGKA 2YEIA 4B3RE 1Z0VA 4P8OA 4X64E 3OPDA 1N32I 1BGQA 2BRCA 4MPNA 3WU3A 1I58A 1I94E 1XMOI 5L3JA 4FWGA 3A0XA 3T10A 1PVGA 2F4VE 4DV1I 4WUDA 2IWSA 4JI4E 1UYCA 4GKKI 4XIRA 1H72C 3R4MA 2YJXA 4EFUA 2XDSA 2A2DA 4UTGA 1FWKA 5FNFA 5J71A 4DR4I 4DV6E 3LTOA 4DR1E 2Q8IA 3WU6A 4Z7CA 4X65I 1N33E 1YC1A 1Z5AA 1S14A 3O0IA 2XK2A 5CTUA 4KP4A 4LFCI 3T1YI 2YI5A 4JI3I 3JAMQ 1HNZE 3GIGB 4DV4I 4URLA 3B27A 2UU9E 1VISA 3LPSA 3CRLA 1KZNA 2AKPA 2YKBA 4DR3I 5IWAI 4E02A 3EKRA 3TZ2A 2X36A 4EGIA 2XJJA 4U7OA 2WI1A 5IT9C 2YGFA 1YSZA 5CF0A 3CRKA 4DV0E 2ESAA 1I5CA 2E5LI 2BM1A 4DV2I 4XC0A 4B3SE 3Q1QA 4DR5E 2ZM6I 2HK2A 3FT8A 4LFAE 4ASGA 1HR0E 1XMQI 4X62I 1D6TA 2UXBI 5FLXQ 4JI2E 2V2VA 1N34I 3ZZTA 3D0BA 4LF4E 4DV5E 1TILA 2Q8GA 3T1KA 2BSMA 1YERA 2CCTA 1AJ6A 1MU5A 1TIDA 5LL6R 4XCLA 3HYZA 5CPHA 4FN5A 3K97A 1OJ4A 1AM1A 3OWBA 1UY9A 1ZM9A 1B3QA 4XD8A 4YKRA 3TTZA 3VHCA 4PRVA 2A2CA 1I59A 4GFNA 4AS9A 1KKHA 4JI5E 2YEAA 4O07A 3D36A 5A2QC 3B8HA 3EHHA 4O04A 1AH6A 5M4EA 4B3ME 1UYIA 3A0YA 3HZ5A 4P52A 3CGYA 4DR2E 1UYDA 2IWUA 4LF5I 4KHPI 2GS8A 4JI7I 5F5RA 4XKKA 1ZM2A 2QFOA 1ID0A 5CTWA 4KSGA 1MX0A 3VHDA 3EKOA 2VCJA 5GMEA 3ZZ0A 4KTNA 4YHHI 2BU5A 3D4JA 2FWZA 4NXNI 4DPTA 2UXCE 3O2FA 3T0HA 4ASFA 2XX4A 4MYUA 3OTOI 4CWRA 4E01A 1HNXI 4OX9E 4JYAI 4LFBE 1I5BA 5IDMA 5LMNE 5GMDA 1EI1A 1Z5BA 3J80C 3R4NA 1H73A 1TBWA 4EMDA 2YEDA 3BM9A 4XE2A 3NMQA 4XCJA 1H7SA 1Y4UA 4LF7E 1Z5CA 3TZ0A 4JI1I 3HULA 5IN9A 2LJPA 3KE6A 3GIEA 4DXLA 2UUCE 4NH7A 4YKYA 2IWXA 2IOQA 3M6AA 1YS3A 3U2DA 3PYDA 1BYQA 2YKCA 3HEKA 2YKEA 3JZ3A 4KQVA 4L8ZA 4PL9A 4BIZA 4CWPA 4PRXA 1ZXMA 3J81C 1HNWE 4LWHA 2YEHA 1KVKA 1Y4SA 1IBMI 3B24A 4YY3I 2Q8FA 1I5DA 5M4KA 3HZ1A 5FNDA 5M4HA 5BR8E 1Y8PA 1H7UA 2O1UA 4JI8I 3A0ZA 4NH9A 4LF6E 4YKQA 2EXLA 5GGZA 1Z0BA 4B3TI 4DR7I 1IBKI 5CTXA 1H74A 4DUYI 4MOTA 2HKEA 1UYEA 1S4EA 2VQFI 4NXME 3BMYA 3G75A 4U7NA 4WUBA 4DR6I 2BU7A 4L90A 1J5EE 4EMVA 2UUBI 4CE3A 3B28A 4EM7A 2HFSA 4USKA 2UXDE 2YE7A 3INWA 2AJ4A 1THNA 2DEJA 3F0NA 2XCMA 2BTZA 4RPFA 4MP2A 3A0TA 2QG0A 3QT8A 4YKXA 1XNRI 3J7AM 2OI2A 1B63A 4X66I 5LMUI 1ZM4A 4CWSA 4GKJI 4JASA 2VCIA 4ZKIA 2QF6A 3RLQA 2XDLA 1ZWHA 2YEEA 4FMTA 4B3RI 1UYMA 4X64I 4MPCA 2FWYA 1XNQE 2XDKA 2Q2EB 1WUUA 3FV5A 4JG4A 1KTVA 3GIFA 2DEIA 1AH8A 1I94I 3C0EA 4HZ0A 3RLRA 4HZ5A 4DV3E 2WI3A 1NHHA 1FJGE 1NHIA 2F4VI 2BREA 4K0KE 2X7IA 4JI4I 2YEFA 3T1HE 3DGEA 4R3AA 2CCUA 3TUHA 4JAVA 3T0ZA 2CGFA 4DV6I 4O05A 3U67A 4DR1I 1L0OA 2YGEA 1UEKA 1N33I 1ELOA 4O09A 5IT9Q 3U2KA 1EA6A 2YKIA 4HYPA 2HKJA 3D2RA 1MG7A 3TZ4A 2YI0A 4DV7E 2ZKJA 5BODA 2H8MA 4MPEA 4FCQA 1YETA 3HHUA 2WI2A 2VWCA 4Z7YA 2GFDA 2YI7A 2JKIA 1HNZI 2YK2A 2H55A 2V2ZA 4GEEA 2VQEE 1NZ0A 2FXSA 2UU9I 4AQYE 1GKZA 3CWVA 1QYEA 1Z0WA 3ZKDA 3GIGA 4JV5E 4JQLA 4XTJA 1FKAE 2YECA 2BU2A 4HACB 2HHHE 4JI0E 4MP7A 1UY6A 2BU6A 4XIQA 4DV0I 1PKPA 3WQ9A 4X9LA 4DUZE 4H7QA 4B3SI 2YJWA 4DR5I 4YKUA 4LFAI 4GQTA 1HR0I 5CTYA 1FI4A 4AWOA 4JI2I 3R4PA 3PYFA 3RKZA 5J6AA 3PEJA 5A2QQ 1TC0A 3K99A 4LF4I 4LF8E 4JI6E 4LF9E 4DV5I 4L93A 5FWKA 2BV3A 3HYYA 4BQGA 4GCZA 1IBLE 5D7CA 2ZITA 1S16A 3QT6A 1XHKA 1I5AA 4GT8A 1Z0TA 2YK9A 3V5RA 4L91A 4LWFA 4O0BA 3OW6A 1Z59A 1YT1A 1N36E 1U0ZA 2IORA 2XHXA 4EEHA 4I5SA 1RR9A 2HK3A 3SL2A 3R92A 3C11A 1UYHA 2XX5A 4JI5I 3K98A 4V25A 4YKZA 3PYEA 4ZVIA 2V34A 3J80Q 3B26A 4B3MI 2VW5A 4YKTA 2NPFA 4DR2I 4CWOA 1YC3A 5D7DA 1ZXNA 1ZM3A 3QTFA 1US7A 2GQPA 3V2UC 4MB9A 4WUCA 2XJXA 2WI7A 1BXDA 1Z0CA 5IDJA 3K1JA 2UXCI 2WI4A 2IOPA 4FWDA 4OX9I 4LFBI 2UUAE 5LMNI 2BT0A 2WEQA 3PEHA 2XEXA 2YEJA 2C2AA 1YC4A 4W7TA 3B82A 1GJVA 3EHJA 3INXA 3CGZA 3FT5A 4LWIA 3K17A 4DPXA 4DPWA 1N32E 1UYFA 2ZDXA 4U93A 1Z0EA 4LF7I 2BM0A 1YSRA 3J7AG 4DU7A 1XMOE 4AWPA 2XDXA 2UUCI 3K60A 4ASBA 2XD6A 1UY8A 1B62A 4M1KA 3ZZUA 4DV1E 2UWDA 5C93A 2O1WA 4AWQA 4GKKE 1HNWI 1UY7A 1UYLA 4BAEA 4DR4E 2WI6A 4PU9A 4QPJA 2WERA 5BR8I 4X65E 2CCSA 4LF6I 4I3HA 4P7AA 4B7PA 1TC6A 4UT4A 4LFCE 4LWEA 3T1YE 4H85A 1R62A 3A0WA 4CWFA 4NXMI 2CG9A 2YGAA 4JI3E 4HXZA 1J5EI 2R42A 4MYTA 4DV4E 3Q5JA 3ZXQA 3PYGA 3OMUA 4JAUA 4HY1A 4HXWA 2V8PA 3R91A 3QT7A 3GONA 2UXDI 3WU5A 2PNRA 1A6FA 4DR3E 4URMA 2XABA 5IWAE 4NH8A 4Q20A 3ZM7A 4DUHA 3Q5LA 1YT2A 4FW9A 2E5LE 1QZRA 4DV2E 2WEPA 3G7EA 2BYHA 3O6OA 2ZM6E 2YE5A 5FNCA 1N0UA 1ZW9A 3H80A 3VHAA 1XMQE 2QG2A 4X62E 1N0VC 4XITA 2UXBE 3JAMC 1DARA 2ZBKB 1N34E 1XNQI 2HCHA 5D7RA 3OWDA 4FPPA 4R3MA
chains in the Genus database with same CATH superfamily
2JT2A 2K5BA 5M4MA 1FWLA 2Z5CA 4DV3I 4OZEA 4LPBA 1RREA 1FJGI 2YE6A 1PIEA 1UDSA 4K0KI 3T1HI 1FNMA 2BA0G 2JEBB 3WU4A 4XKAA 4GQUA 4IS9A 2FYPA 4MU1A 4AM3A 5D6PA 4E00A 2YEGA 3B78A 3ZKBA 1JM6A 2BU8A 4MBCA 2E0AA 3R4OA 3P06A 2WNRB 5FLXC 4XDMA 3NZKA 2NN6C 4FWHA 4GGLA 2VF3A 4DV7I 4UROA 2Q8HA 4BXIA 4CE1A 3EHGA 5M4NA 3RLPA 4LF5E 3H4LA 4KHPE 4CWNA 4L94A 4R1FA 4JI7E 1QY8A 2PO2B 5JEAD 4EGHA 2VQEI 1YT0A 4YHHE 4AQYI 2ZDYA 4LCGA 2J65A 2HFUA 4NXNE 4V26A 3CDIA 2WI5A 4USMA 2YE3A 5BOCA 4IZKA 3OTOE 4JV5I 4BQJA 4HY6A 1HNXE 4JYAE 2C39B 1Z0GA 1IXMA 1TH8A 3PS3A 2HHHI 4JI0I 2HG1A 3HKMA 4IFDB 3ZXOA 2XJGA 1USUA 5K36B 2YE4A 2BZ5A 4ED4A 4DUZI 3A0RA 3P76A 4HACA 2JJCA 2YE9A 4KFGA 3Q5KA 3CDJA 4FCPA 3IEDA 4K4OA 2V2QA 5F3KA 2CH4A 2PNZA 2O1VA 2YE8A 2PO0A 3WHAA 4KSHA 4JI1E 4LF8I 2XHRA 4CE2A 4JI6I 4LF9I 2J7KA 4XKOA 3MNRP 4YKWA 4URNA 1Y8OA 3TZ5A 1A4HA 2XX2A 5DRRA 2YI6A 1IBLI 2R3VA 1NHJA 5C0XB 1Y8NA 1YESA 2XHTA 2YEBA 1K47A 4ASAA 4CWQA 1IBME 2XDUA 4YY3E 4U3BA 3J81Q 1U2OA 4DPUA 3RLRA 3G7BA 1N36I 1Y6ZA 4QPKA 5JEAA 4JI8E 4EFTA 5D6QA 1UYGA 2BYIA 2E1RA 4B3TE 4DR7E 2EFGA 4DU8A 1IBKE 3VADA 4BIUA 2C37B 4DUYE 4DZYA 1GKXA 4FCRA 2Z5BA 1BKNA 2VQFE 4XIPA 4DR6E 1UYKA 4DPYA 3B25A 3KRNA 2UUBE 4CWTA 2WW4A 3QT5A 4OO1D 2GO3A 1KIJA 1U2RA 4LP0A 1F51A 3LNUA 3QDDA 2YKJA 1AMWA 2UUAI 4HYMA 3T2SA 2IERA 4H81A 1XNRE 1OSFA 4LWGA 5LMUE 4X66E 2CZ9A 3EHFA 4LCHA 2YE2A 4B6CA 4GKJE 4EGKA 2YEIA 3L7ZB 4B3RE 1Z0VA 4P8OA 4X64E 3OPDA 1N32I 2NN6B 1BGQA 2BRCA 4MPNA 3WU3A 1I58A 1I94E 1XMOI 5L3JA 4FWGA 3A0XA 3T10A 1PVGA 3PS2A 2IESA 2F4VE 4DV1I 4WUDA 1YHCA 2IWSA 4JI4E 2O3ZA 2PNMA 1UYCA 4GKKI 3LMMA 4LOMA 1H72C 3CYGA 2YJXA 3R4MA 2XDSA 2A2DA 3P3CA 1FWKA 4UTGA 5FNFA 5J71A 4DR4I 4DV6E 3LTOA 4DR1E 2Q8IA 3WU6A 4Z7CA 4X65I 1N33E 1YC1A 1Z5AA 2JEAA 1S14A 4NBQA 2XK2A 3O0IA 5CTUA 2BR2B 2Z5CB 3Q6NA 4KP4A 4LFCI 4FW4A 3T1YI 2YI5A 2VESA 4JI3I 3JAMQ 1HNZE 3P3GA 3GIGB 4DV4I 4IFDF 4URLA 3B27A 2UU9E 1VISA 5K36F 3LPSA 3CRLA 1KZNA 3M85D 2AKPA 2YKBA 4DR3I 5IWAI 2JE6A 4E02A 3EKRA 3TZ2A 2X36A 4EGIA 2XJJA 4U7OA 2WP8A 2WI1A 5IT9C 2YGFA 1YSZA 5CF0A 3CRKA 4DV0E 2ESAA 1I5CA 2E5LI 2BM1A 4DV2I 4XC0A 1E3PA 4B3SE 3Q1QA 4DR5E 2ZM6I 2HK2A 3FT8A 4LFAE 4ASGA 1HR0E 1XMQI 5C0XF 4X62I 4IZJD 1D6TA 2UXBI 5FLXQ 4JI2E 2V2VA 1N34I 3ZZTA 3D0BA 4LF4E 4IZKB 1HK7A 4DV5E 1TILA 2Q8GA 4IFDE 3T1KA 2BSMA 4IZJB 2C38B 1YERA 2CCTA 5K36E 1AJ6A 2BA1G 1MU5A 4IFDD 1TIDA 5LL6R 4XCLA 3HYZA 5CPHA 5K36D 4FN5A 3K97A 1OJ4A 1AM1A 3OWBA 1UY9A 1ZM9A 1B3QA 4XD8A 4YKRA 3TTZA 3VHCA 4PRVA 2CGEA 2A2CA 1I59A 4GFNA 4AS9A 1KKHA 2JEBA 4JI5E 2YEAA 4O07A 3D36A 5A2QC 3B8HA 3EHHA 4O04A 5C0XE 4MU4A 4B3ME 1AH6A 5M4EA 1UYIA 3A0YA 3HZ5A 4P52A 3CGYA 4DR2E 1UYDA 2IWUA 2WNRA 5C0XD 4LF5I 1Y60A 4KHPI 2GS8A 4JI7I 5F5RA 4XKKA 5FNDA 1ZM2A 2QFOA 1ID0A 5CTWA 4KSGA 1MX0A 3VHDA 3EKOA 2VCJA 5GMEA 1USVA 1UDNA 3ZZ0A 4YHHI 4KTNA 2BU5A 3D4JA 2FWZA 4NXNI 4DPTA 2UXCE 4BA1A 3O2FA 3T0HA 4ASFA 2XX4A 4MYUA 3OTOI 4CWRA 4E01A 1HNXI 4OX9E 4JYAI 4LFBE 1I5BA 5IDMA 5LMNE 5GMDA 2NN6F 5M4HA 1EI1A 1VI7A 2BA0D 1Z5BA 3PRYA 4MU3A 2C39A 3J80C 1H73A 1TBWA 4EMDA 2YEDA 3R4NA 3BM9A 4XE2A 3NMQA 4XCJA 1H7SA 1Y4UA 4LF7E 1Z5CA 2GQ0A 3TZ0A 4JI1I 3HULA 5IN9A 2LJPA 3KE6A 3GIEA 4DXLA 2UUCE 4NH7A 4YKYA 2IWXA 2IOQA 3M6AA 1YS3A 3U2DA 3PYDA 1BYQA 2YKCA 3HEKA 2YKEA 3JZ3A 4KQVA 4L8ZA 4MU0A 4PL9A 4BIZA 4PRXA 1ZXMA 3J81C 4CWPA 1HNWE 3B4TA 4LWHA 2YEHA 1KVKA 1Y4SA 1IBMI 3B24A 4YY3I 2Q8FA 2NN6E 1I5DA 5M4KA 4U3DA 3HZ1A 2PO1A 5BR8E 1Y8PA 2C1IA 1H7UA 2O1UA 2F1DA 2NN6D 4LPFA 4JI8I 3A0ZA 4NH9A 4LF6E 4YKQA 2EXLA 5GGZA 1Z0BA 4B3TI 4DR7I 1IBKI 5CTXA 1H74A 4DUYI 4MOTA 2HKEA 5ELWA 1UYEA 1S4EA 2VQFI 4NXME 3BMYA 3G75A 4U7NA 4WUBA 4DR6I 2BU7A 4L90A 1J5EE 4EMVA 2UUBI 4CE3A 2C37A 3M85G 3K85A 3B28A 4EM7A 2HFSA 4QNKA 4USKA 2UXDE 3U1YA 2YE7A 3INWA 2AJ4A 4OKGA 1THNA 4MQYA 1OYSA 2DEJA 5JEAC 1OYRA 3F0NA 4FW5A 2XCMA 2BTZA 4RPFA 2JEAB 4MP2A 4EFUA 3A0TA 2QG0A 3QT8A 4YKXA 1XNRI 3J7AM 2OI2A 1B63A 4X66I 5LMUI 1ZM4A 4CWSA 4GKJI 4JASA 2VCIA 4ZKIA 2QF6A 3H1CA 4OO1A 2XDLA 4J3DA 1ZWHA 3RLQA 2YEEA 4FMTA 4B3RI 4FW7A 1UYMA 4X64I 4MPCA 2FWYA 1XNQE 2XDKA 2Q2EB 1WUUA 3FV5A 4QNJA 4JG4A 1KTVA 1UDOA 2DEIA 3L7ZA 1I94I 1AH8A 3C0EA 3GIFA 3M7ND 4DV3E 2WI3A 2WP8B 4MDTA 4HZ5A 4HZ0A 1OYPA 1NHHA 1FJGE 1NHIA 1UDQA 2F4VI 4K0KE 2BREA 2X7IA 4JI4I 4BA2A 2YEFA 1P42A 3T1HE 3DGEA 4R3AA 2CCUA 3TUHA 4JAVA 3T0ZA 2CGFA 4DV6I 4O05A 3U67A 4DR1I 3DD6A 1L0OA 3UHMA 1UEKA 1N33I 1ELOA 4AIDA 5IT9Q 2YGEA 4O09A 1EA6A 3U2KA 2YKIA 4HYPA 2HKJA 3D2RA 1MG7A 3TZ4A 2YI0A 4DV7E 2ZKJA 5BODA 2GO4A 2H8MA 3HJCA 5JEAF 4FCQA 1YETA 4MPEA 3HHUA 2WI2A 2VWCA 4Z7YA 2GFDA 2YI7A 2JKIA 1HNZI 2BR2A 2YK2A 2H55A 2V2ZA 5EKWA 4GEEA 2VQEE 1NZ0A 2FXSA 2UU9I 4AQYE 2AE8A 1GKZA 3CWVA 1QYEA 1Z0WA 3ZKDA 3GIGA 4JV5E 4JQLA 4XTJA 1FKAE 4OO1C 2YECA 2BU2A 4HACB 2HHHE 4JI0E 4MP7A 1UY6A 2BU6A 5JENA 3Q6MA 4XIQA 4DV0I 1PKPA 3WQ9A 4X9LA 3PS1A 4DUZE 2PNZB 4H7QA 4B3SI 2PO0B 2YJWA 4DR5I 4YKUA 4LFAI 4GQTA 1HR0I 5CTYA 1FI4A 1Y5YA 2HHIA 4AWOA 4JI2I 3R4PA 3PYFA 5JEAE 3RKZA 5J6AA 3PEJA 5A2QQ 1TC0A 3K99A 4LF4I 4BA1B 4LF8E 4JI6E 4LF9E 4DV5I 4L93A 5FWKA 2BV3A 3HYYA 4BQGA 4GCZA 1RHYA 1IBLE 5D7CA 2ZITA 1S16A 3QT6A 4ISAA 1XHKA 1I5AA 3S5TA 5DNLA 4GT8A 1Z0TA 2YK9A 2PO2A 5JEAB 3V5RA 4IZJA 2C38A 4L91A 4LWFA 5M4PA 4O0BA 3OW6A 1Z59A 1YT1A 1N36E 1U0ZA 2IORA 2XHXA 4EEHA 5EL9A 1RR9A 4I5SA 2HK3A 3SL2A 2Z5BB 3C11A 3R92A 2Z5EA 1UYHA 2XX5A 4JI5I 3K98A 4V25A 4YKZA 3PYEA 4ZVIA 2V34A 3J80Q 4IFDA 3B26A 3U1KA 4B3MI 2VW5A 2NPFA 4YKTA 5K36A 4DR2I 4CWOA 1YC3A 4OO1F 5D7DA 1ZXNA 1ZM3A 3QTFA 1US7A 2CVEA 2GQPA 3V2UC 4MB9A 4WUCA 2XJXA 2WI7A 1BXDA 1Z0CA 2PO1B 5IDJA 3K1JA 2UXCI 2BA1D 2IOPA 2WI4A 4FWDA 4OX9I 4LFBI 2UUAE 5LMNI 2BT0A 2WEQA 3PEHA 2XEXA 5C0XA 2YEJA 2C2AA 1YC4A 4W7TA 3B82A 1GJVA 3EHJA 3INXA 3CGZA 3FT5A 4LCFA 5DRPA 4LWIA 3K17A 4DPXA 4DPWA 1N32E 1UYFA 2ZDXA 1E3HA 3GLLA 4U93A 1Z0EA 2PNLA 2BM0A 4LF7I 3M7NG 1R6LA 1YSRA 4OO1E 3J7AG 4DU7A 1XMOE 4AWPA 2XDXA 2UUCI 3K60A 4ASBA 2XD6A 1UY8A 1B62A 4M1KA 3ZZUA 4DV1E 5DROA 2O1TA 2UWDA 5C93A 2O1WA 4AWQA 4GKKE 1HNWI 1UY7A 1UYLA 4BAEA 4IFDC 4XIRA 4DR4E 2WI6A 4OO1B 5DNXA 4PU9A 5K36C 4QPJA 2FTKA 5BR8I 4X65E 2WERA 2CCSA 4LF6I 4I3HA 4FW6A 4P7AA 4B7PA 1TC6A 4UT4A 4LFCE 4LWEA 3T1YE 4H85A 1R62A 3A0WA 4CWFA 4E72A 4N3OA 4NXMI 2CG9A 2YGAA 4FW3A 5DRQA 4JI3E 4HXZA 4BA2B 1J5EI 2R42A 4MYTA 4DV4E 3Q5JA 3ZXQA 3PYGA 3OMUA 2JE6B 4JAUA 4HY1A 4HXWA 5C0XC 2V8PA 3R91A 3QT7A 3P3EA 2NN6A 3GONA 2UXDI 3WU5A 2PNRA 1A6FA 4DR3E 4URMA 2XABA 5IWAE 4NH8A 4Q20A 3ZM7A 4DUHA 3Q5LA 4AIMA 1XXEA 1YT2A 4FW9A 3GCMA 2E5LE 1QZRA 1R6MA 4DV2E 2C1GA 2WEPA 3G7EA 2BYHA 3O6OA 2ZM6E 2YE5A 5FNCA 1N0UA 3GMEA 1ZW9A 3H80A 3VHAA 1XMQE 2QG2A 4X62E 1N0VC 1YH8A 4XITA 2UXBE 3JAMC 1DARA 2ZBKB 1N34E 1XNQI 2HCHA 5D7RA 3OWDA 4FPPA 4R3MA
chains in the Genus database with same CATH topology
2K5BA 5M4MA 1FWLA 2Z5CA 4DV3I 4LPBA 1RREA 1FJGI 2YE6A 1PIEA 4K0KI 3T1HI 1FNMA 3WU4A 4XKAA 2FYPA 5D6PA 4E00A 2YEGA 3B78A 3ZKBA 1JM6A 2BU8A 4MBCA 2E0AA 3R4OA 3P06A 5FLXC 4XDMA 4FWHA 4GGLA 2Q8HA 2VF3A 4DV7I 4UROA 4CE1A 4BXIA 3EHGA 5M4NA 3RLPA 4LF5E 3H4LA 4KHPE 4CWNA 4L94A 4R1FA 4JI7E 1QY8A 4EGHA 2VQEI 1YT0A 4YHHE 4AQYI 2ZDYA 4NXNE 2HFUA 4V26A 5M4PA 5BOCA 2WI5A 4USMA 2YE3A 4BQJA 4IZKA 3OTOE 4JV5I 4HY6A 1HNXE 4JYAE 1Z0GA 1TH8A 2HHHI 4JI0I 2HG1A 3ZXOA 2XJGA 1USUA 2YE4A 2BZ5A 4ED4A 4DUZI 3A0RA 4HACA 2JJCA 2YE9A 4KFGA 3Q5KA 4FCPA 3IEDA 4K4OA 2V2QA 5F3KA 2CH4A 2O1VA 2YE8A 3WHAA 4KSHA 4JI1E 4LF8I 2XHRA 4CE2A 4JI6I 4LF9I 2J7KA 4XKOA 3MNRP 4YKWA 4URNA 1Y8OA 3TZ5A 1A4HA 2XX2A 2YI6A 1IBLI 2R3VA 1NHJA 1Y8NA 1YESA 2XHTA 2YEBA 1K47A 4ASAA 4CWQA 1IBME 2XDUA 4YY3E 3J81Q 1U2OA 4DPUA 3G7BA 1N36I 1Y6ZA 4QPKA 4EFTA 4JI8E 5D6QA 1UYGA 2BYIA 2E1RA 4B3TE 4DR7E 2EFGA 4DU8A 1IBKE 3VADA 4BIUA 4DUYE 4DZYA 1GKXA 4FCRA 2Z5BA 1BKNA 2VQFE 4XIPA 4DR6E 1UYKA 4DPYA 3B25A 2UUBE 4CWTA 2WW4A 3QT5A 1KIJA 1U2RA 4LP0A 3LNUA 3QDDA 2YKJA 1AMWA 2UUAI 4HYMA 3T2SA 4H81A 1XNRE 1OSFA 4LWGA 5LMUE 4X66E 2CZ9A 3EHFA 2YE2A 4B6CA 4GKJE 4EGKA 2YEIA 4B3RE 1Z0VA 4P8OA 4X64E 3OPDA 1N32I 1BGQA 2BRCA 4MPNA 3WU3A 1I58A 1I94E 1XMOI 5L3JA 4FWGA 3A0XA 3T10A 1PVGA 2F4VE 4DV1I 4WUDA 2IWSA 4JI4E 2PNMA 1UYCA 4GKKI 4XIRA 1H72C 3R4MA 2YJXA 4EFUA 2XDSA 2A2DA 4UTGA 1FWKA 5FNFA 5J71A 4DR4I 4DV6E 3LTOA 4DR1E 2Q8IA 3WU6A 4Z7CA 4X65I 1N33E 1YC1A 1Z5AA 1S14A 3O0IA 2XK2A 5CTUA 2Z5CB 3Q6NA 4KP4A 4LFCI 3T1YI 2YI5A 4JI3I 3JAMQ 1HNZE 3GIGB 4DV4I 4URLA 3B27A 2UU9E 1VISA 3LPSA 3CRLA 1KZNA 2AKPA 2YKBA 4DR3I 5IWAI 4E02A 3EKRA 3TZ2A 2X36A 4EGIA 2XJJA 4U7OA 2WI1A 5IT9C 2YGFA 1YSZA 5CF0A 3CRKA 4DV0E 2ESAA 1I5CA 2E5LI 2BM1A 4DV2I 4XC0A 4B3SE 3Q1QA 4DR5E 2ZM6I 2HK2A 3FT8A 4LFAE 4ASGA 1HR0E 1XMQI 4X62I 1D6TA 4IZJD 2UXBI 5FLXQ 4JI2E 2V2VA 1N34I 3ZZTA 3D0BA 4LF4E 4IZKB 1HK7A 4DV5E 1TILA 2Q8GA 3T1KA 2BSMA 4IZJB 1YERA 2CCTA 1AJ6A 1MU5A 1TIDA 5LL6R 4XCLA 3HYZA 5CPHA 4FN5A 3K97A 1OJ4A 1AM1A 3OWBA 1UY9A 1ZM9A 1B3QA 4XD8A 4YKRA 3TTZA 3VHCA 4PRVA 2CGEA 2A2CA 1I59A 4GFNA 4AS9A 1KKHA 4JI5E 2YEAA 4O07A 3D36A 5A2QC 3B8HA 3EHHA 4O04A 1AH6A 5M4EA 4B3ME 1UYIA 3A0YA 3HZ5A 4P52A 3CGYA 4DR2E 1UYDA 2IWUA 4LF5I 4KHPI 2GS8A 4JI7I 5F5RA 4XKKA 1ZM2A 2QFOA 1ID0A 5CTWA 4KSGA 1MX0A 3VHDA 3EKOA 2VCJA 1USVA 5GMEA 3ZZ0A 4KTNA 4YHHI 2BU5A 3D4JA 2FWZA 4NXNI 4DPTA 2UXCE 3O2FA 3T0HA 4ASFA 2XX4A 4MYUA 3OTOI 4CWRA 4E01A 1HNXI 4OX9E 4JYAI 4LFBE 1I5BA 5IDMA 5LMNE 5GMDA 1EI1A 1Z5BA 3PRYA 3J80C 3R4NA 1H73A 1TBWA 4EMDA 2YEDA 3BM9A 4XE2A 3NMQA 4XCJA 1H7SA 1Y4UA 4LF7E 1Z5CA 2GQ0A 3TZ0A 4JI1I 3HULA 5IN9A 2LJPA 3KE6A 3GIEA 4DXLA 2UUCE 4NH7A 4YKYA 2IWXA 2IOQA 3M6AA 1YS3A 3U2DA 3PYDA 1BYQA 2YKCA 3HEKA 2YKEA 3JZ3A 4KQVA 4L8ZA 4PL9A 4BIZA 4CWPA 4PRXA 1ZXMA 3J81C 1HNWE 4LWHA 2YEHA 1KVKA 1Y4SA 1IBMI 3B24A 4YY3I 2Q8FA 1I5DA 5M4KA 3HZ1A 5FNDA 5M4HA 5BR8E 1Y8PA 1H7UA 2O1UA 4JI8I 3A0ZA 4NH9A 4LF6E 4YKQA 2EXLA 5GGZA 1Z0BA 4B3TI 4DR7I 1IBKI 5CTXA 1H74A 4DUYI 4MOTA 2HKEA 1UYEA 1S4EA 2VQFI 4NXME 3BMYA 3G75A 4U7NA 4WUBA 4DR6I 2BU7A 4L90A 1J5EE 4EMVA 2UUBI 4CE3A 3K85A 3B28A 4EM7A 2HFSA 4USKA 2UXDE 2YE7A 3INWA 2AJ4A 1THNA 2DEJA 3F0NA 2XCMA 2BTZA 4RPFA 4MP2A 3A0TA 2QG0A 3QT8A 4YKXA 1XNRI 3J7AM 2OI2A 1B63A 4X66I 5LMUI 1ZM4A 4CWSA 4GKJI 4JASA 2VCIA 4ZKIA 2QF6A 3RLQA 2XDLA 1ZWHA 2YEEA 4FMTA 4B3RI 1UYMA 4X64I 4MPCA 2FWYA 1XNQE 2XDKA 2Q2EB 1WUUA 3FV5A 4JG4A 1KTVA 3GIFA 2DEIA 1AH8A 1I94I 3C0EA 4HZ0A 3RLRA 4HZ5A 4DV3E 2WI3A 1NHHA 1FJGE 1NHIA 2F4VI 2BREA 4K0KE 2X7IA 4JI4I 2YEFA 3T1HE 3DGEA 4R3AA 2CCUA 3TUHA 4JAVA 3T0ZA 2CGFA 4DV6I 4O05A 3U67A 4DR1I 1L0OA 2YGEA 1UEKA 1N33I 1ELOA 4O09A 5IT9Q 3U2KA 1EA6A 2YKIA 4HYPA 2HKJA 3D2RA 1MG7A 3TZ4A 2YI0A 4DV7E 2ZKJA 5BODA 2H8MA 3HJCA 4MPEA 4FCQA 1YETA 3HHUA 2WI2A 2VWCA 4Z7YA 2GFDA 2YI7A 2JKIA 1HNZI 2YK2A 2H55A 2V2ZA 4GEEA 2VQEE 1NZ0A 2FXSA 2UU9I 4AQYE 1GKZA 3CWVA 1QYEA 1Z0WA 3ZKDA 3GIGA 4JV5E 4JQLA 4XTJA 1FKAE 2YECA 2BU2A 4HACB 2HHHE 4JI0E 4MP7A 1UY6A 2BU6A 3Q6MA 4XIQA 4DV0I 1PKPA 3WQ9A 4X9LA 4DUZE 4H7QA 4B3SI 2YJWA 4DR5I 4YKUA 4LFAI 4GQTA 1HR0I 5CTYA 1FI4A 4AWOA 4JI2I 3R4PA 3PYFA 3RKZA 5J6AA 3PEJA 5A2QQ 1TC0A 3K99A 4LF4I 4LF8E 4JI6E 4LF9E 4DV5I 4L93A 5FWKA 2BV3A 3HYYA 4BQGA 4GCZA 1IBLE 5D7CA 2ZITA 1S16A 3QT6A 1XHKA 1I5AA 4GT8A 1Z0TA 2YK9A 3V5RA 4IZJA 4L91A 4LWFA 4O0BA 3OW6A 1Z59A 1YT1A 1N36E 1U0ZA 2IORA 2XHXA 4EEHA 4I5SA 1RR9A 2HK3A 3SL2A 2Z5BB 3C11A 3R92A 2Z5EA 1UYHA 2XX5A 4JI5I 3K98A 4V25A 4YKZA 3PYEA 4ZVIA 2V34A 3J80Q 3B26A 4B3MI 2VW5A 4YKTA 2NPFA 4DR2I 4CWOA 1YC3A 5D7DA 1ZXNA 1ZM3A 3QTFA 1US7A 2GQPA 3V2UC 4MB9A 4WUCA 2XJXA 2WI7A 1BXDA 1Z0CA 5IDJA 3K1JA 2UXCI 2WI4A 2IOPA 4FWDA 4OX9I 4LFBI 2UUAE 5LMNI 2BT0A 2WEQA 3PEHA 2XEXA 2YEJA 2C2AA 1YC4A 4W7TA 3B82A 1GJVA 3EHJA 3INXA 3CGZA 3FT5A 4LWIA 3K17A 4DPXA 4DPWA 1N32E 1UYFA 2ZDXA 4U93A 1Z0EA 2PNLA 2BM0A 4LF7I 1YSRA 3J7AG 4DU7A 1XMOE 4AWPA 2XDXA 2UUCI 3K60A 4ASBA 2XD6A 1UY8A 1B62A 4M1KA 3ZZUA 4DV1E 2O1TA 2UWDA 5C93A 2O1WA 4AWQA 4GKKE 1HNWI 1UY7A 1UYLA 4BAEA 4DR4E 2WI6A 4PU9A 4QPJA 2WERA 5BR8I 4X65E 2CCSA 4LF6I 4I3HA 4P7AA 4B7PA 1TC6A 4UT4A 4LFCE 4LWEA 3T1YE 4H85A 1R62A 3A0WA 4CWFA 4N3OA 4NXMI 2CG9A 2YGAA 4JI3E 4HXZA 1J5EI 2R42A 4MYTA 4DV4E 3Q5JA 3ZXQA 3PYGA 3OMUA 4JAUA 4HY1A 4HXWA 2V8PA 3R91A 3QT7A 3GONA 2UXDI 3WU5A 2PNRA 1A6FA 4DR3E 4URMA 2XABA 5IWAE 4NH8A 4Q20A 3ZM7A 4DUHA 3Q5LA 1YT2A 4FW9A 2E5LE 1QZRA 4DV2E 2WEPA 3G7EA 2BYHA 3O6OA 2ZM6E 2YE5A 5FNCA 1N0UA 1ZW9A 3H80A 3VHAA 1XMQE 2QG2A 4X62E 1N0VC 4XITA 2UXBE 3JAMC 1DARA 2ZBKB 1N34E 1XNQI 2HCHA 5D7RA 3OWDA 4FPPA 4R3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5B A;  5M4M A;  1FWL A;  4DV3 I;  4LPB A;  1RRE A;  1FJG I;  2YE6 A;  1PIE A;  4K0K I;  3T1H I;  1FNM A;  3WU4 A;  4XKA A;  2FYP A;  5D6P A;  4E00 A;  2YEG A;  3B78 A;  3ZKB A;  1JM6 A;  2BU8 A;  4MBC A;  2E0A A;  3R4O A;  5FLX C;  4XDM A;  4FWH A;  4GGL A;  2Q8H A;  2VF3 A;  4DV7 I;  4URO A;  4CE1 A;  4BXI A;  3EHG A;  5M4N A;  3RLP A;  4LF5 E;  3H4L A;  4KHP E;  4CWN A;  4L94 A;  4R1F A;  4JI7 E;  1QY8 A;  4EGH A;  2VQE I;  1YT0 A;  4YHH E;  4AQY I;  2ZDY A;  4NXN E;  2HFU A;  4V26 A;  5M4P A;  5BOC A;  2WI5 A;  4USM A;  2YE3 A;  4BQJ A;  4JV5 I;  3OTO E;  4HY6 A;  1HNX E;  4JYA E;  1Z0G A;  1TH8 A;  2HHH I;  4JI0 I;  2HG1 A;  3ZXO A;  2XJG A;  2YE4 A;  2BZ5 A;  4ED4 A;  4DUZ I;  3A0R A;  4HAC A;  2JJC A;  2YE9 A;  4KFG A;  3Q5K A;  4FCP A;  3IED A;  4K4O A;  2V2Q A;  5F3K A;  2CH4 A;  2O1V A;  2YE8 A;  3WHA A;  4KSH A;  4JI1 E;  4LF8 I;  2XHR A;  4CE2 A;  4JI6 I;  4LF9 I;  2J7K A;  4XKO A;  3MNR P;  4YKW A;  4URN A;  1Y8O A;  3TZ5 A;  1A4H A;  2XX2 A;  2YI6 A;  1IBL I;  2R3V A;  1NHJ A;  1Y8N A;  1YES A;  2XHT A;  2YEB A;  1K47 A;  4ASA A;  4CWQ A;  1IBM E;  2XDU A;  4YY3 E;  3J81 Q;  1U2O A;  4DPU A;  3G7B A;  1N36 I;  4QPK A;  4EFT A;  4JI8 E;  5D6Q A;  1UYG A;  2BYI A;  2E1R A;  4B3T E;  4DR7 E;  2EFG A;  4DU8 A;  1IBK E;  3VAD A;  4BIU A;  4DUY E;  4DZY A;  1GKX A;  4FCR A;  2VQF E;  1BKN A;  4XIP A;  4DR6 E;  1UYK A;  4DPY A;  3B25 A;  2UUB E;  4CWT A;  2WW4 A;  3QT5 A;  1KIJ A;  1U2R A;  4LP0 A;  3LNU A;  3QDD A;  2YKJ A;  1AMW A;  2UUA I;  4HYM A;  3T2S A;  4H81 A;  1XNR E;  1OSF A;  4LWG A;  5LMU E;  4X66 E;  2CZ9 A;  3EHF A;  2YE2 A;  4B6C A;  4GKJ E;  4EGK A;  2YEI A;  4B3R E;  1Z0V A;  4P8O A;  4X64 E;  3OPD A;  1N32 I;  1BGQ A;  2BRC A;  4MPN A;  3WU3 A;  1I58 A;  1I94 E;  1XMO I;  5L3J A;  4FWG A;  3A0X A;  3T10 A;  1PVG A;  2F4V E;  4DV1 I;  4WUD A;  2IWS A;  4JI4 E;  1UYC A;  4GKK I;  4XIR A;  1H72 C;  3R4M A;  2YJX A;  4EFU A;  2XDS A;  2A2D A;  4UTG A;  1FWK A;  5FNF A;  5J71 A;  4DR4 I;  4DV6 E;  3LTO A;  4DR1 E;  2Q8I A;  3WU6 A;  4Z7C A;  4X65 I;  1N33 E;  1YC1 A;  1Z5A A;  1S14 A;  3O0I A;  2XK2 A;  5CTU A;  4KP4 A;  4LFC I;  3T1Y I;  2YI5 A;  4JI3 I;  3JAM Q;  1HNZ E;  3GIG B;  4DV4 I;  4URL A;  3B27 A;  2UU9 E;  1VIS A;  3LPS A;  3CRL A;  1KZN A;  2AKP A;  2YKB A;  4DR3 I;  5IWA I;  4E02 A;  3EKR A;  3TZ2 A;  2X36 A;  4EGI A;  2XJJ A;  4U7O A;  2WI1 A;  5IT9 C;  2YGF A;  1YSZ A;  5CF0 A;  3CRK A;  4DV0 E;  2ESA A;  1I5C A;  2E5L I;  2BM1 A;  4DV2 I;  4XC0 A;  4B3S E;  3Q1Q A;  4DR5 E;  2ZM6 I;  2HK2 A;  3FT8 A;  4LFA E;  4ASG A;  1HR0 E;  1XMQ I;  4X62 I;  1D6T A;  2UXB I;  5FLX Q;  4JI2 E;  2V2V A;  1N34 I;  3ZZT A;  3D0B A;  4LF4 E;  4DV5 E;  1TIL A;  2Q8G A;  3T1K A;  2BSM A;  1YER A;  2CCT A;  1AJ6 A;  1MU5 A;  1TID A;  5LL6 R;  4XCL A;  3HYZ A;  5CPH A;  4FN5 A;  3K97 A;  1OJ4 A;  1AM1 A;  3OWB A;  1UY9 A;  1ZM9 A;  1B3Q A;  4XD8 A;  4YKR A;  3TTZ A;  3VHC A;  4PRV A;  2A2C A;  1I59 A;  4GFN A;  4AS9 A;  1KKH A;  4JI5 E;  2YEA A;  4O07 A;  3D36 A;  5A2Q C;  3B8H A;  3EHH A;  4O04 A;  1AH6 A;  5M4E A;  4B3M E;  1UYI A;  3A0Y A;  3HZ5 A;  4P52 A;  3CGY A;  4DR2 E;  1UYD A;  2IWU A;  4LF5 I;  4KHP I;  2GS8 A;  4JI7 I;  5F5R A;  4XKK A;  1ZM2 A;  2QFO A;  1ID0 A;  5CTW A;  4KSG A;  1MX0 A;  3VHD A;  3EKO A;  2VCJ A;  5GME A;  3ZZ0 A;  4KTN A;  4YHH I;  2BU5 A;  3D4J A;  2FWZ A;  4NXN I;  4DPT A;  2UXC E;  3O2F A;  3T0H A;  4ASF A;  2XX4 A;  4MYU A;  3OTO I;  4CWR A;  4E01 A;  1HNX I;  4OX9 E;  4JYA I;  4LFB E;  1I5B A;  5IDM A;  5LMN E;  5GMD A;  1EI1 A;  1Z5B A;  3J80 C;  3R4N A;  1H73 A;  1TBW A;  4EMD A;  2YED A;  3BM9 A;  4XE2 A;  3NMQ A;  4XCJ A;  1H7S A;  1Y4U A;  4LF7 E;  1Z5C A;  3TZ0 A;  4JI1 I;  3HUL A;  5IN9 A;  2LJP A;  3KE6 A;  3GIE A;  4DXL A;  2UUC E;  4NH7 A;  4YKY A;  2IWX A;  2IOQ A;  3M6A A;  1YS3 A;  3U2D A;  3PYD A;  1BYQ A;  2YKC A;  3HEK A;  2YKE A;  3JZ3 A;  4KQV A;  4L8Z A;  4PL9 A;  4BIZ A;  4CWP A;  4PRX A;  1ZXM A;  3J81 C;  1HNW E;  4LWH A;  2YEH A;  1KVK A;  1Y4S A;  1IBM I;  3B24 A;  4YY3 I;  2Q8F A;  1I5D A;  5M4K A;  3HZ1 A;  5FND A;  5M4H A;  5BR8 E;  1Y8P A;  1H7U A;  2O1U A;  4JI8 I;  3A0Z A;  4NH9 A;  4LF6 E;  4YKQ A;  2EXL A;  5GGZ A;  1Z0B A;  4B3T I;  4DR7 I;  1IBK I;  5CTX A;  1H74 A;  4DUY I;  4MOT A;  2HKE A;  1UYE A;  1S4E A;  2VQF I;  4NXM E;  3BMY A;  3G75 A;  4U7N A;  4WUB A;  4DR6 I;  2BU7 A;  4L90 A;  1J5E E;  4EMV A;  2UUB I;  4CE3 A;  3B28 A;  4EM7 A;  2HFS A;  4USK A;  2UXD E;  2YE7 A;  3INW A;  2AJ4 A;  1THN A;  2DEJ A;  3F0N A;  2XCM A;  2BTZ A;  4RPF A;  4MP2 A;  3A0T A;  2QG0 A;  3QT8 A;  4YKX A;  1XNR I;  3J7A M;  2OI2 A;  1B63 A;  4X66 I;  5LMU I;  1ZM4 A;  4CWS A;  4GKJ I;  4JAS A;  2VCI A;  4ZKI A;  2QF6 A;  3RLQ A;  2XDL A;  1ZWH A;  2YEE A;  4FMT A;  4B3R I;  1UYM A;  4X64 I;  4MPC A;  2FWY A;  1XNQ E;  2XDK A;  2Q2E B;  1WUU A;  3FV5 A;  4JG4 A;  1KTV A;  3GIF A;  2DEI A;  1AH8 A;  1I94 I;  3C0E A;  4HZ0 A;  3RLR A;  4HZ5 A;  4DV3 E;  2WI3 A;  1NHH A;  1FJG E;  1NHI A;  2F4V I;  2BRE A;  4K0K E;  2X7I A;  4JI4 I;  2YEF A;  3T1H E;  3DGE A;  4R3A A;  2CCU A;  3TUH A;  4JAV A;  3T0Z A;  2CGF A;  4DV6 I;  4O05 A;  3U67 A;  4DR1 I;  1L0O A;  2YGE A;  1UEK A;  1N33 I;  1ELO A;  4O09 A;  5IT9 Q;  3U2K A;  1EA6 A;  2YKI A;  4HYP A;  2HKJ A;  3D2R A;  1MG7 A;  3TZ4 A;  2YI0 A;  4DV7 E;  2ZKJ A;  5BOD A;  2H8M A;  4MPE A;  4FCQ A;  1YET A;  3HHU A;  2WI2 A;  2VWC A;  4Z7Y A;  2GFD A;  2YI7 A;  2JKI A;  1HNZ I;  2YK2 A;  2H55 A;  2V2Z A;  4GEE A;  2VQE E;  1NZ0 A;  2FXS A;  2UU9 I;  4AQY E;  1GKZ A;  3CWV A;  1QYE A;  1Z0W A;  3ZKD A;  3GIG A;  4JV5 E;  4JQL A;  4XTJ A;  1FKA E;  2YEC A;  2BU2 A;  4HAC B;  2HHH E;  4JI0 E;  4MP7 A;  1UY6 A;  2BU6 A;  4XIQ A;  4DV0 I;  1PKP A;  3WQ9 A;  4X9L A;  4DUZ E;  4H7Q A;  4B3S I;  2YJW A;  4DR5 I;  4YKU A;  4LFA I;  4GQT A;  1HR0 I;  5CTY A;  1FI4 A;  4AWO A;  4JI2 I;  3R4P A;  3PYF A;  3RKZ A;  5J6A A;  3PEJ A;  5A2Q Q;  1TC0 A;  3K99 A;  4LF4 I;  4LF8 E;  4JI6 E;  4LF9 E;  4DV5 I;  4L93 A;  5FWK A;  2BV3 A;  3HYY A;  4BQG A;  4GCZ A;  1IBL E;  5D7C A;  2ZIT A;  1S16 A;  3QT6 A;  1XHK A;  1I5A A;  4GT8 A;  1Z0T A;  2YK9 A;  3V5R A;  4L91 A;  4LWF A;  4O0B A;  3OW6 A;  1Z59 A;  1YT1 A;  1N36 E;  1U0Z A;  2IOR A;  2XHX A;  4EEH A;  4I5S A;  1RR9 A;  2HK3 A;  3SL2 A;  3R92 A;  3C11 A;  1UYH A;  2XX5 A;  4JI5 I;  3K98 A;  4V25 A;  4YKZ A;  3PYE A;  4ZVI A;  2V34 A;  3J80 Q;  3B26 A;  4B3M I;  2VW5 A;  4YKT A;  2NPF A;  4DR2 I;  4CWO A;  1YC3 A;  5D7D A;  1ZXN A;  1ZM3 A;  3QTF A;  1US7 A;  2GQP A;  3V2U C;  4MB9 A;  4WUC A;  2XJX A;  2WI7 A;  1BXD A;  1Z0C A;  5IDJ A;  3K1J A;  2UXC I;  2WI4 A;  2IOP A;  4FWD A;  4OX9 I;  4LFB I;  2UUA E;  5LMN I;  2BT0 A;  2WEQ A;  3PEH A;  2XEX A;  2YEJ A;  2C2A A;  1YC4 A;  4W7T A;  3B82 A;  1GJV A;  3EHJ A;  3INX A;  3CGZ A;  3FT5 A;  4LWI A;  3K17 A;  4DPX A;  4DPW A;  1N32 E;  1UYF A;  2ZDX A;  4U93 A;  1Z0E A;  4LF7 I;  2BM0 A;  1YSR A;  3J7A G;  4DU7 A;  1XMO E;  4AWP A;  2XDX A;  2UUC I;  3K60 A;  4ASB A;  2XD6 A;  1UY8 A;  1B62 A;  4M1K A;  3ZZU A;  4DV1 E;  2UWD A;  5C93 A;  2O1W A;  4AWQ A;  4GKK E;  1HNW I;  1UY7 A;  1UYL A;  4BAE A;  4DR4 E;  2WI6 A;  4PU9 A;  4QPJ A;  2WER A;  5BR8 I;  4X65 E;  2CCS A;  4LF6 I;  4I3H A;  4P7A A;  4B7P A;  1TC6 A;  4UT4 A;  4LFC E;  4LWE A;  3T1Y E;  4H85 A;  1R62 A;  3A0W A;  4CWF A;  4NXM I;  2CG9 A;  2YGA A;  4JI3 E;  4HXZ A;  1J5E I;  2R42 A;  4MYT A;  4DV4 E;  3Q5J A;  3ZXQ A;  3PYG A;  3OMU A;  4JAU A;  4HY1 A;  4HXW A;  2V8P A;  3R91 A;  3QT7 A;  3GON A;  2UXD I;  3WU5 A;  2PNR A;  1A6F A;  4DR3 E;  4URM A;  2XAB A;  5IWA E;  4NH8 A;  4Q20 A;  3ZM7 A;  4DUH A;  3Q5L A;  1YT2 A;  4FW9 A;  2E5L E;  1QZR A;  4DV2 E;  2WEP A;  3G7E A;  2BYH A;  3O6O A;  2ZM6 E;  2YE5 A;  5FNC A;  1N0U A;  1ZW9 A;  3H80 A;  3VHA A;  1XMQ E;  2QG2 A;  4X62 E;  1N0V C;  4XIT A;  2UXB E;  3JAM C;  1DAR A;  2ZBK B;  1N34 E;  1XNQ I;  2HCH A;  5D7R A;  3OWD A;  4FPP A;  4R3M A; 
#chains in the Genus database with same CATH topology
 2JT2 A;  2K5B A;  5M4M A;  1FWL A;  2Z5C A;  4DV3 I;  4OZE A;  4LPB A;  1RRE A;  1FJG I;  2YE6 A;  1PIE A;  1UDS A;  4K0K I;  3T1H I;  1FNM A;  2BA0 G;  2JEB B;  3WU4 A;  4XKA A;  4GQU A;  4IS9 A;  2FYP A;  4MU1 A;  4AM3 A;  5D6P A;  4E00 A;  2YEG A;  3B78 A;  3ZKB A;  1JM6 A;  2BU8 A;  4MBC A;  2E0A A;  3R4O A;  3P06 A;  2WNR B;  5FLX C;  4XDM A;  3NZK A;  2NN6 C;  4FWH A;  4GGL A;  2VF3 A;  4DV7 I;  4URO A;  2Q8H A;  4BXI A;  4CE1 A;  3EHG A;  5M4N A;  3RLP A;  4LF5 E;  3H4L A;  4KHP E;  4CWN A;  4L94 A;  4R1F A;  4JI7 E;  1QY8 A;  2PO2 B;  5JEA D;  4EGH A;  2VQE I;  1YT0 A;  4YHH E;  4AQY I;  2ZDY A;  4LCG A;  2J65 A;  2HFU A;  4NXN E;  4V26 A;  3CDI A;  2WI5 A;  4USM A;  2YE3 A;  5BOC A;  4IZK A;  3OTO E;  4JV5 I;  4BQJ A;  4HY6 A;  1HNX E;  4JYA E;  2C39 B;  1Z0G A;  1IXM A;  1TH8 A;  3PS3 A;  2HHH I;  4JI0 I;  2HG1 A;  3HKM A;  4IFD B;  3ZXO A;  2XJG A;  1USU A;  5K36 B;  2YE4 A;  2BZ5 A;  4ED4 A;  4DUZ I;  3A0R A;  3P76 A;  4HAC A;  2JJC A;  2YE9 A;  4KFG A;  3Q5K A;  3CDJ A;  4FCP A;  3IED A;  4K4O A;  2V2Q A;  5F3K A;  2CH4 A;  2PNZ A;  2O1V A;  2YE8 A;  2PO0 A;  3WHA A;  4KSH A;  4JI1 E;  4LF8 I;  2XHR A;  4CE2 A;  4JI6 I;  4LF9 I;  2J7K A;  4XKO A;  3MNR P;  4YKW A;  4URN A;  1Y8O A;  3TZ5 A;  1A4H A;  2XX2 A;  5DRR A;  2YI6 A;  1IBL I;  2R3V A;  1NHJ A;  5C0X B;  1Y8N A;  1YES A;  2XHT A;  2YEB A;  1K47 A;  4ASA A;  4CWQ A;  1IBM E;  2XDU A;  4YY3 E;  4U3B A;  3J81 Q;  1U2O A;  4DPU A;  3RLR A;  3G7B A;  1N36 I;  1Y6Z A;  4QPK A;  5JEA A;  4JI8 E;  4EFT A;  5D6Q A;  1UYG A;  2BYI A;  2E1R A;  4B3T E;  4DR7 E;  2EFG A;  4DU8 A;  1IBK E;  3VAD A;  4BIU A;  2C37 B;  4DUY E;  4DZY A;  1GKX A;  4FCR A;  2Z5B A;  1BKN A;  2VQF E;  4XIP A;  4DR6 E;  1UYK A;  4DPY A;  3B25 A;  3KRN A;  2UUB E;  4CWT A;  2WW4 A;  3QT5 A;  4OO1 D;  2GO3 A;  1KIJ A;  1U2R A;  4LP0 A;  1F51 A;  3LNU A;  3QDD A;  2YKJ A;  1AMW A;  2UUA I;  4HYM A;  3T2S A;  2IER A;  4H81 A;  1XNR E;  1OSF A;  4LWG A;  5LMU E;  4X66 E;  2CZ9 A;  3EHF A;  4LCH A;  2YE2 A;  4B6C A;  4GKJ E;  4EGK A;  2YEI A;  3L7Z B;  4B3R E;  1Z0V A;  4P8O A;  4X64 E;  3OPD A;  1N32 I;  2NN6 B;  1BGQ A;  2BRC A;  4MPN A;  3WU3 A;  1I58 A;  1I94 E;  1XMO I;  5L3J A;  4FWG A;  3A0X A;  3T10 A;  1PVG A;  3PS2 A;  2IES A;  2F4V E;  4DV1 I;  4WUD A;  1YHC A;  2IWS A;  4JI4 E;  2O3Z A;  2PNM A;  1UYC A;  4GKK I;  3LMM A;  4LOM A;  1H72 C;  3CYG A;  2YJX A;  3R4M A;  2XDS A;  2A2D A;  3P3C A;  1FWK A;  4UTG A;  5FNF A;  5J71 A;  4DR4 I;  4DV6 E;  3LTO A;  4DR1 E;  2Q8I A;  3WU6 A;  4Z7C A;  4X65 I;  1N33 E;  1YC1 A;  1Z5A A;  2JEA A;  1S14 A;  4NBQ A;  2XK2 A;  3O0I A;  5CTU A;  2BR2 B;  2Z5C B;  3Q6N A;  4KP4 A;  4LFC I;  4FW4 A;  3T1Y I;  2YI5 A;  2VES A;  4JI3 I;  3JAM Q;  1HNZ E;  3P3G A;  3GIG B;  4DV4 I;  4IFD F;  4URL A;  3B27 A;  2UU9 E;  1VIS A;  5K36 F;  3LPS A;  3CRL A;  1KZN A;  3M85 D;  2AKP A;  2YKB A;  4DR3 I;  5IWA I;  2JE6 A;  4E02 A;  3EKR A;  3TZ2 A;  2X36 A;  4EGI A;  2XJJ A;  4U7O A;  2WP8 A;  2WI1 A;  5IT9 C;  2YGF A;  1YSZ A;  5CF0 A;  3CRK A;  4DV0 E;  2ESA A;  1I5C A;  2E5L I;  2BM1 A;  4DV2 I;  4XC0 A;  1E3P A;  4B3S E;  3Q1Q A;  4DR5 E;  2ZM6 I;  2HK2 A;  3FT8 A;  4LFA E;  4ASG A;  1HR0 E;  1XMQ I;  5C0X F;  4X62 I;  4IZJ D;  1D6T A;  2UXB I;  5FLX Q;  4JI2 E;  2V2V A;  1N34 I;  3ZZT A;  3D0B A;  4LF4 E;  4IZK B;  1HK7 A;  4DV5 E;  1TIL A;  2Q8G A;  4IFD E;  3T1K A;  2BSM A;  4IZJ B;  2C38 B;  1YER A;  2CCT A;  5K36 E;  1AJ6 A;  2BA1 G;  1MU5 A;  4IFD D;  1TID A;  5LL6 R;  4XCL A;  3HYZ A;  5CPH A;  5K36 D;  4FN5 A;  3K97 A;  1OJ4 A;  1AM1 A;  3OWB A;  1UY9 A;  1ZM9 A;  1B3Q A;  4XD8 A;  4YKR A;  3TTZ A;  3VHC A;  4PRV A;  2CGE A;  2A2C A;  1I59 A;  4GFN A;  4AS9 A;  1KKH A;  2JEB A;  4JI5 E;  2YEA A;  4O07 A;  3D36 A;  5A2Q C;  3B8H A;  3EHH A;  4O04 A;  5C0X E;  4MU4 A;  4B3M E;  1AH6 A;  5M4E A;  1UYI A;  3A0Y A;  3HZ5 A;  4P52 A;  3CGY A;  4DR2 E;  1UYD A;  2IWU A;  2WNR A;  5C0X D;  4LF5 I;  1Y60 A;  4KHP I;  2GS8 A;  4JI7 I;  5F5R A;  4XKK A;  5FND A;  1ZM2 A;  2QFO A;  1ID0 A;  5CTW A;  4KSG A;  1MX0 A;  3VHD A;  3EKO A;  2VCJ A;  5GME A;  1USV A;  1UDN A;  3ZZ0 A;  4YHH I;  4KTN A;  2BU5 A;  3D4J A;  2FWZ A;  4NXN I;  4DPT A;  2UXC E;  4BA1 A;  3O2F A;  3T0H A;  4ASF A;  2XX4 A;  4MYU A;  3OTO I;  4CWR A;  4E01 A;  1HNX I;  4OX9 E;  4JYA I;  4LFB E;  1I5B A;  5IDM A;  5LMN E;  5GMD A;  2NN6 F;  5M4H A;  1EI1 A;  1VI7 A;  2BA0 D;  1Z5B A;  3PRY A;  4MU3 A;  2C39 A;  3J80 C;  1H73 A;  1TBW A;  4EMD A;  2YED A;  3R4N A;  3BM9 A;  4XE2 A;  3NMQ A;  4XCJ A;  1H7S A;  1Y4U A;  4LF7 E;  1Z5C A;  2GQ0 A;  3TZ0 A;  4JI1 I;  3HUL A;  5IN9 A;  2LJP A;  3KE6 A;  3GIE A;  4DXL A;  2UUC E;  4NH7 A;  4YKY A;  2IWX A;  2IOQ A;  3M6A A;  1YS3 A;  3U2D A;  3PYD A;  1BYQ A;  2YKC A;  3HEK A;  2YKE A;  3JZ3 A;  4KQV A;  4L8Z A;  4MU0 A;  4PL9 A;  4BIZ A;  4PRX A;  1ZXM A;  3J81 C;  4CWP A;  1HNW E;  3B4T A;  4LWH A;  2YEH A;  1KVK A;  1Y4S A;  1IBM I;  3B24 A;  4YY3 I;  2Q8F A;  2NN6 E;  1I5D A;  5M4K A;  4U3D A;  3HZ1 A;  2PO1 A;  5BR8 E;  1Y8P A;  2C1I A;  1H7U A;  2O1U A;  2F1D A;  2NN6 D;  4LPF A;  4JI8 I;  3A0Z A;  4NH9 A;  4LF6 E;  4YKQ A;  2EXL A;  5GGZ A;  1Z0B A;  4B3T I;  4DR7 I;  1IBK I;  5CTX A;  1H74 A;  4DUY I;  4MOT A;  2HKE A;  5ELW A;  1UYE A;  1S4E A;  2VQF I;  4NXM E;  3BMY A;  3G75 A;  4U7N A;  4WUB A;  4DR6 I;  2BU7 A;  4L90 A;  1J5E E;  4EMV A;  2UUB I;  4CE3 A;  2C37 A;  3M85 G;  3K85 A;  3B28 A;  4EM7 A;  2HFS A;  4QNK A;  4USK A;  2UXD E;  3U1Y A;  2YE7 A;  3INW A;  2AJ4 A;  4OKG A;  1THN A;  4MQY A;  1OYS A;  2DEJ A;  5JEA C;  1OYR A;  3F0N A;  4FW5 A;  2XCM A;  2BTZ A;  4RPF A;  2JEA B;  4MP2 A;  4EFU A;  3A0T A;  2QG0 A;  3QT8 A;  4YKX A;  1XNR I;  3J7A M;  2OI2 A;  1B63 A;  4X66 I;  5LMU I;  1ZM4 A;  4CWS A;  4GKJ I;  4JAS A;  2VCI A;  4ZKI A;  2QF6 A;  3H1C A;  4OO1 A;  2XDL A;  4J3D A;  1ZWH A;  3RLQ A;  2YEE A;  4FMT A;  4B3R I;  4FW7 A;  1UYM A;  4X64 I;  4MPC A;  2FWY A;  1XNQ E;  2XDK A;  2Q2E B;  1WUU A;  3FV5 A;  4QNJ A;  4JG4 A;  1KTV A;  1UDO A;  2DEI A;  3L7Z A;  1I94 I;  1AH8 A;  3C0E A;  3GIF A;  3M7N D;  4DV3 E;  2WI3 A;  2WP8 B;  4MDT A;  4HZ5 A;  4HZ0 A;  1OYP A;  1NHH A;  1FJG E;  1NHI A;  1UDQ A;  2F4V I;  4K0K E;  2BRE A;  2X7I A;  4JI4 I;  4BA2 A;  2YEF A;  1P42 A;  3T1H E;  3DGE A;  4R3A A;  2CCU A;  3TUH A;  4JAV A;  3T0Z A;  2CGF A;  4DV6 I;  4O05 A;  3U67 A;  4DR1 I;  3DD6 A;  1L0O A;  3UHM A;  1UEK A;  1N33 I;  1ELO A;  4AID A;  5IT9 Q;  2YGE A;  4O09 A;  1EA6 A;  3U2K A;  2YKI A;  4HYP A;  2HKJ A;  3D2R A;  1MG7 A;  3TZ4 A;  2YI0 A;  4DV7 E;  2ZKJ A;  5BOD A;  2GO4 A;  2H8M A;  3HJC A;  5JEA F;  4FCQ A;  1YET A;  4MPE A;  3HHU A;  2WI2 A;  2VWC A;  4Z7Y A;  2GFD A;  2YI7 A;  2JKI A;  1HNZ I;  2BR2 A;  2YK2 A;  2H55 A;  2V2Z A;  5EKW A;  4GEE A;  2VQE E;  1NZ0 A;  2FXS A;  2UU9 I;  4AQY E;  2AE8 A;  1GKZ A;  3CWV A;  1QYE A;  1Z0W A;  3ZKD A;  3GIG A;  4JV5 E;  4JQL A;  4XTJ A;  1FKA E;  4OO1 C;  2YEC A;  2BU2 A;  4HAC B;  2HHH E;  4JI0 E;  4MP7 A;  1UY6 A;  2BU6 A;  5JEN A;  3Q6M A;  4XIQ A;  4DV0 I;  1PKP A;  3WQ9 A;  4X9L A;  3PS1 A;  4DUZ E;  2PNZ B;  4H7Q A;  4B3S I;  2PO0 B;  2YJW A;  4DR5 I;  4YKU A;  4LFA I;  4GQT A;  1HR0 I;  5CTY A;  1FI4 A;  1Y5Y A;  2HHI A;  4AWO A;  4JI2 I;  3R4P A;  3PYF A;  5JEA E;  3RKZ A;  5J6A A;  3PEJ A;  5A2Q Q;  1TC0 A;  3K99 A;  4LF4 I;  4BA1 B;  4LF8 E;  4JI6 E;  4LF9 E;  4DV5 I;  4L93 A;  5FWK A;  2BV3 A;  3HYY A;  4BQG A;  4GCZ A;  1RHY A;  1IBL E;  5D7C A;  2ZIT A;  1S16 A;  3QT6 A;  4ISA A;  1XHK A;  1I5A A;  3S5T A;  5DNL A;  4GT8 A;  1Z0T A;  2YK9 A;  2PO2 A;  5JEA B;  3V5R A;  4IZJ A;  2C38 A;  4L91 A;  4LWF A;  5M4P A;  4O0B A;  3OW6 A;  1Z59 A;  1YT1 A;  1N36 E;  1U0Z A;  2IOR A;  2XHX A;  4EEH A;  5EL9 A;  1RR9 A;  4I5S A;  2HK3 A;  3SL2 A;  2Z5B B;  3C11 A;  3R92 A;  2Z5E A;  1UYH A;  2XX5 A;  4JI5 I;  3K98 A;  4V25 A;  4YKZ A;  3PYE A;  4ZVI A;  2V34 A;  3J80 Q;  4IFD A;  3B26 A;  3U1K A;  4B3M I;  2VW5 A;  2NPF A;  4YKT A;  5K36 A;  4DR2 I;  4CWO A;  1YC3 A;  4OO1 F;  5D7D A;  1ZXN A;  1ZM3 A;  3QTF A;  1US7 A;  2CVE A;  2GQP A;  3V2U C;  4MB9 A;  4WUC A;  2XJX A;  2WI7 A;  1BXD A;  1Z0C A;  2PO1 B;  5IDJ A;  3K1J A;  2UXC I;  2BA1 D;  2IOP A;  2WI4 A;  4FWD A;  4OX9 I;  4LFB I;  2UUA E;  5LMN I;  2BT0 A;  2WEQ A;  3PEH A;  2XEX A;  5C0X A;  2YEJ A;  2C2A A;  1YC4 A;  4W7T A;  3B82 A;  1GJV A;  3EHJ A;  3INX A;  3CGZ A;  3FT5 A;  4LCF A;  5DRP A;  4LWI A;  3K17 A;  4DPX A;  4DPW A;  1N32 E;  1UYF A;  2ZDX A;  1E3H A;  3GLL A;  4U93 A;  1Z0E A;  2PNL A;  2BM0 A;  4LF7 I;  3M7N G;  1R6L A;  1YSR A;  4OO1 E;  3J7A G;  4DU7 A;  1XMO E;  4AWP A;  2XDX A;  2UUC I;  3K60 A;  4ASB A;  2XD6 A;  1UY8 A;  1B62 A;  4M1K A;  3ZZU A;  4DV1 E;  5DRO A;  2O1T A;  2UWD A;  5C93 A;  2O1W A;  4AWQ A;  4GKK E;  1HNW I;  1UY7 A;  1UYL A;  4BAE A;  4IFD C;  4XIR A;  4DR4 E;  2WI6 A;  4OO1 B;  5DNX A;  4PU9 A;  5K36 C;  4QPJ A;  2FTK A;  5BR8 I;  4X65 E;  2WER A;  2CCS A;  4LF6 I;  4I3H A;  4FW6 A;  4P7A A;  4B7P A;  1TC6 A;  4UT4 A;  4LFC E;  4LWE A;  3T1Y E;  4H85 A;  1R62 A;  3A0W A;  4CWF A;  4E72 A;  4N3O A;  4NXM I;  2CG9 A;  2YGA A;  4FW3 A;  5DRQ A;  4JI3 E;  4HXZ A;  4BA2 B;  1J5E I;  2R42 A;  4MYT A;  4DV4 E;  3Q5J A;  3ZXQ A;  3PYG A;  3OMU A;  2JE6 B;  4JAU A;  4HY1 A;  4HXW A;  5C0X C;  2V8P A;  3R91 A;  3QT7 A;  3P3E A;  2NN6 A;  3GON A;  2UXD I;  3WU5 A;  2PNR A;  1A6F A;  4DR3 E;  4URM A;  2XAB A;  5IWA E;  4NH8 A;  4Q20 A;  3ZM7 A;  4DUH A;  3Q5L A;  4AIM A;  1XXE A;  1YT2 A;  4FW9 A;  3GCM A;  2E5L E;  1QZR A;  1R6M A;  4DV2 E;  2C1G A;  2WEP A;  3G7E A;  2BYH A;  3O6O A;  2ZM6 E;  2YE5 A;  5FNC A;  1N0U A;  3GME A;  1ZW9 A;  3H80 A;  3VHA A;  1XMQ E;  2QG2 A;  4X62 E;  1N0V C;  1YH8 A;  4XIT A;  2UXB E;  3JAM C;  1DAR A;  2ZBK B;  1N34 E;  1XNQ I;  2HCH A;  5D7R A;  3OWD A;  4FPP A;  4R3M A; 
#chains in the Genus database with same CATH homology
 2K5B A;  5M4M A;  1FWL A;  2Z5C A;  4DV3 I;  4LPB A;  1RRE A;  1FJG I;  2YE6 A;  1PIE A;  4K0K I;  3T1H I;  1FNM A;  3WU4 A;  4XKA A;  2FYP A;  5D6P A;  4E00 A;  2YEG A;  3B78 A;  3ZKB A;  1JM6 A;  2BU8 A;  4MBC A;  2E0A A;  3R4O A;  3P06 A;  5FLX C;  4XDM A;  4FWH A;  4GGL A;  2Q8H A;  2VF3 A;  4DV7 I;  4URO A;  4CE1 A;  4BXI A;  3EHG A;  5M4N A;  3RLP A;  4LF5 E;  3H4L A;  4KHP E;  4CWN A;  4L94 A;  4R1F A;  4JI7 E;  1QY8 A;  4EGH A;  2VQE I;  1YT0 A;  4YHH E;  4AQY I;  2ZDY A;  4NXN E;  2HFU A;  4V26 A;  5M4P A;  5BOC A;  2WI5 A;  4USM A;  2YE3 A;  4BQJ A;  4IZK A;  3OTO E;  4JV5 I;  4HY6 A;  1HNX E;  4JYA E;  1Z0G A;  1TH8 A;  2HHH I;  4JI0 I;  2HG1 A;  3ZXO A;  2XJG A;  1USU A;  2YE4 A;  2BZ5 A;  4ED4 A;  4DUZ I;  3A0R A;  4HAC A;  2JJC A;  2YE9 A;  4KFG A;  3Q5K A;  4FCP A;  3IED A;  4K4O A;  2V2Q A;  5F3K A;  2CH4 A;  2O1V A;  2YE8 A;  3WHA A;  4KSH A;  4JI1 E;  4LF8 I;  2XHR A;  4CE2 A;  4JI6 I;  4LF9 I;  2J7K A;  4XKO A;  3MNR P;  4YKW A;  4URN A;  1Y8O A;  3TZ5 A;  1A4H A;  2XX2 A;  2YI6 A;  1IBL I;  2R3V A;  1NHJ A;  1Y8N A;  1YES A;  2XHT A;  2YEB A;  1K47 A;  4ASA A;  4CWQ A;  1IBM E;  2XDU A;  4YY3 E;  3J81 Q;  1U2O A;  4DPU A;  3G7B A;  1N36 I;  1Y6Z A;  4QPK A;  4EFT A;  4JI8 E;  5D6Q A;  1UYG A;  2BYI A;  2E1R A;  4B3T E;  4DR7 E;  2EFG A;  4DU8 A;  1IBK E;  3VAD A;  4BIU A;  4DUY E;  4DZY A;  1GKX A;  4FCR A;  2Z5B A;  1BKN A;  2VQF E;  4XIP A;  4DR6 E;  1UYK A;  4DPY A;  3B25 A;  2UUB E;  4CWT A;  2WW4 A;  3QT5 A;  1KIJ A;  1U2R A;  4LP0 A;  3LNU A;  3QDD A;  2YKJ A;  1AMW A;  2UUA I;  4HYM A;  3T2S A;  4H81 A;  1XNR E;  1OSF A;  4LWG A;  5LMU E;  4X66 E;  2CZ9 A;  3EHF A;  2YE2 A;  4B6C A;  4GKJ E;  4EGK A;  2YEI A;  4B3R E;  1Z0V A;  4P8O A;  4X64 E;  3OPD A;  1N32 I;  1BGQ A;  2BRC A;  4MPN A;  3WU3 A;  1I58 A;  1I94 E;  1XMO I;  5L3J A;  4FWG A;  3A0X A;  3T10 A;  1PVG A;  2F4V E;  4DV1 I;  4WUD A;  2IWS A;  4JI4 E;  2PNM A;  1UYC A;  4GKK I;  4XIR A;  1H72 C;  3R4M A;  2YJX A;  4EFU A;  2XDS A;  2A2D A;  4UTG A;  1FWK A;  5FNF A;  5J71 A;  4DR4 I;  4DV6 E;  3LTO A;  4DR1 E;  2Q8I A;  3WU6 A;  4Z7C A;  4X65 I;  1N33 E;  1YC1 A;  1Z5A A;  1S14 A;  3O0I A;  2XK2 A;  5CTU A;  2Z5C B;  3Q6N A;  4KP4 A;  4LFC I;  3T1Y I;  2YI5 A;  4JI3 I;  3JAM Q;  1HNZ E;  3GIG B;  4DV4 I;  4URL A;  3B27 A;  2UU9 E;  1VIS A;  3LPS A;  3CRL A;  1KZN A;  2AKP A;  2YKB A;  4DR3 I;  5IWA I;  4E02 A;  3EKR A;  3TZ2 A;  2X36 A;  4EGI A;  2XJJ A;  4U7O A;  2WI1 A;  5IT9 C;  2YGF A;  1YSZ A;  5CF0 A;  3CRK A;  4DV0 E;  2ESA A;  1I5C A;  2E5L I;  2BM1 A;  4DV2 I;  4XC0 A;  4B3S E;  3Q1Q A;  4DR5 E;  2ZM6 I;  2HK2 A;  3FT8 A;  4LFA E;  4ASG A;  1HR0 E;  1XMQ I;  4X62 I;  1D6T A;  4IZJ D;  2UXB I;  5FLX Q;  4JI2 E;  2V2V A;  1N34 I;  3ZZT A;  3D0B A;  4LF4 E;  4IZK B;  1HK7 A;  4DV5 E;  1TIL A;  2Q8G A;  3T1K A;  2BSM A;  4IZJ B;  1YER A;  2CCT A;  1AJ6 A;  1MU5 A;  1TID A;  5LL6 R;  4XCL A;  3HYZ A;  5CPH A;  4FN5 A;  3K97 A;  1OJ4 A;  1AM1 A;  3OWB A;  1UY9 A;  1ZM9 A;  1B3Q A;  4XD8 A;  4YKR A;  3TTZ A;  3VHC A;  4PRV A;  2CGE A;  2A2C A;  1I59 A;  4GFN A;  4AS9 A;  1KKH A;  4JI5 E;  2YEA A;  4O07 A;  3D36 A;  5A2Q C;  3B8H A;  3EHH A;  4O04 A;  1AH6 A;  5M4E A;  4B3M E;  1UYI A;  3A0Y A;  3HZ5 A;  4P52 A;  3CGY A;  4DR2 E;  1UYD A;  2IWU A;  4LF5 I;  4KHP I;  2GS8 A;  4JI7 I;  5F5R A;  4XKK A;  1ZM2 A;  2QFO A;  1ID0 A;  5CTW A;  4KSG A;  1MX0 A;  3VHD A;  3EKO A;  2VCJ A;  1USV A;  5GME A;  3ZZ0 A;  4KTN A;  4YHH I;  2BU5 A;  3D4J A;  2FWZ A;  4NXN I;  4DPT A;  2UXC E;  3O2F A;  3T0H A;  4ASF A;  2XX4 A;  4MYU A;  3OTO I;  4CWR A;  4E01 A;  1HNX I;  4OX9 E;  4JYA I;  4LFB E;  1I5B A;  5IDM A;  5LMN E;  5GMD A;  1EI1 A;  1Z5B A;  3PRY A;  3J80 C;  3R4N A;  1H73 A;  1TBW A;  4EMD A;  2YED A;  3BM9 A;  4XE2 A;  3NMQ A;  4XCJ A;  1H7S A;  1Y4U A;  4LF7 E;  1Z5C A;  2GQ0 A;  3TZ0 A;  4JI1 I;  3HUL A;  5IN9 A;  2LJP A;  3KE6 A;  3GIE A;  4DXL A;  2UUC E;  4NH7 A;  4YKY A;  2IWX A;  2IOQ A;  3M6A A;  1YS3 A;  3U2D A;  3PYD A;  1BYQ A;  2YKC A;  3HEK A;  2YKE A;  3JZ3 A;  4KQV A;  4L8Z A;  4PL9 A;  4BIZ A;  4CWP A;  4PRX A;  1ZXM A;  3J81 C;  1HNW E;  4LWH A;  2YEH A;  1KVK A;  1Y4S A;  1IBM I;  3B24 A;  4YY3 I;  2Q8F A;  1I5D A;  5M4K A;  3HZ1 A;  5FND A;  5M4H A;  5BR8 E;  1Y8P A;  1H7U A;  2O1U A;  4JI8 I;  3A0Z A;  4NH9 A;  4LF6 E;  4YKQ A;  2EXL A;  5GGZ A;  1Z0B A;  4B3T I;  4DR7 I;  1IBK I;  5CTX A;  1H74 A;  4DUY I;  4MOT A;  2HKE A;  1UYE A;  1S4E A;  2VQF I;  4NXM E;  3BMY A;  3G75 A;  4U7N A;  4WUB A;  4DR6 I;  2BU7 A;  4L90 A;  1J5E E;  4EMV A;  2UUB I;  4CE3 A;  3K85 A;  3B28 A;  4EM7 A;  2HFS A;  4USK A;  2UXD E;  2YE7 A;  3INW A;  2AJ4 A;  1THN A;  2DEJ A;  3F0N A;  2XCM A;  2BTZ A;  4RPF A;  4MP2 A;  3A0T A;  2QG0 A;  3QT8 A;  4YKX A;  1XNR I;  3J7A M;  2OI2 A;  1B63 A;  4X66 I;  5LMU I;  1ZM4 A;  4CWS A;  4GKJ I;  4JAS A;  2VCI A;  4ZKI A;  2QF6 A;  3RLQ A;  2XDL A;  1ZWH A;  2YEE A;  4FMT A;  4B3R I;  1UYM A;  4X64 I;  4MPC A;  2FWY A;  1XNQ E;  2XDK A;  2Q2E B;  1WUU A;  3FV5 A;  4JG4 A;  1KTV A;  3GIF A;  2DEI A;  1AH8 A;  1I94 I;  3C0E A;  4HZ0 A;  3RLR A;  4HZ5 A;  4DV3 E;  2WI3 A;  1NHH A;  1FJG E;  1NHI A;  2F4V I;  2BRE A;  4K0K E;  2X7I A;  4JI4 I;  2YEF A;  3T1H E;  3DGE A;  4R3A A;  2CCU A;  3TUH A;  4JAV A;  3T0Z A;  2CGF A;  4DV6 I;  4O05 A;  3U67 A;  4DR1 I;  1L0O A;  2YGE A;  1UEK A;  1N33 I;  1ELO A;  4O09 A;  5IT9 Q;  3U2K A;  1EA6 A;  2YKI A;  4HYP A;  2HKJ A;  3D2R A;  1MG7 A;  3TZ4 A;  2YI0 A;  4DV7 E;  2ZKJ A;  5BOD A;  2H8M A;  3HJC A;  4MPE A;  4FCQ A;  1YET A;  3HHU A;  2WI2 A;  2VWC A;  4Z7Y A;  2GFD A;  2YI7 A;  2JKI A;  1HNZ I;  2YK2 A;  2H55 A;  2V2Z A;  4GEE A;  2VQE E;  1NZ0 A;  2FXS A;  2UU9 I;  4AQY E;  1GKZ A;  3CWV A;  1QYE A;  1Z0W A;  3ZKD A;  3GIG A;  4JV5 E;  4JQL A;  4XTJ A;  1FKA E;  2YEC A;  2BU2 A;  4HAC B;  2HHH E;  4JI0 E;  4MP7 A;  1UY6 A;  2BU6 A;  3Q6M A;  4XIQ A;  4DV0 I;  1PKP A;  3WQ9 A;  4X9L A;  4DUZ E;  4H7Q A;  4B3S I;  2YJW A;  4DR5 I;  4YKU A;  4LFA I;  4GQT A;  1HR0 I;  5CTY A;  1FI4 A;  4AWO A;  4JI2 I;  3R4P A;  3PYF A;  3RKZ A;  5J6A A;  3PEJ A;  5A2Q Q;  1TC0 A;  3K99 A;  4LF4 I;  4LF8 E;  4JI6 E;  4LF9 E;  4DV5 I;  4L93 A;  5FWK A;  2BV3 A;  3HYY A;  4BQG A;  4GCZ A;  1IBL E;  5D7C A;  2ZIT A;  1S16 A;  3QT6 A;  1XHK A;  1I5A A;  4GT8 A;  1Z0T A;  2YK9 A;  3V5R A;  4IZJ A;  4L91 A;  4LWF A;  4O0B A;  3OW6 A;  1Z59 A;  1YT1 A;  1N36 E;  1U0Z A;  2IOR A;  2XHX A;  4EEH A;  4I5S A;  1RR9 A;  2HK3 A;  3SL2 A;  2Z5B B;  3C11 A;  3R92 A;  2Z5E A;  1UYH A;  2XX5 A;  4JI5 I;  3K98 A;  4V25 A;  4YKZ A;  3PYE A;  4ZVI A;  2V34 A;  3J80 Q;  3B26 A;  4B3M I;  2VW5 A;  4YKT A;  2NPF A;  4DR2 I;  4CWO A;  1YC3 A;  5D7D A;  1ZXN A;  1ZM3 A;  3QTF A;  1US7 A;  2GQP A;  3V2U C;  4MB9 A;  4WUC A;  2XJX A;  2WI7 A;  1BXD A;  1Z0C A;  5IDJ A;  3K1J A;  2UXC I;  2WI4 A;  2IOP A;  4FWD A;  4OX9 I;  4LFB I;  2UUA E;  5LMN I;  2BT0 A;  2WEQ A;  3PEH A;  2XEX A;  2YEJ A;  2C2A A;  1YC4 A;  4W7T A;  3B82 A;  1GJV A;  3EHJ A;  3INX A;  3CGZ A;  3FT5 A;  4LWI A;  3K17 A;  4DPX A;  4DPW A;  1N32 E;  1UYF A;  2ZDX A;  4U93 A;  1Z0E A;  2PNL A;  2BM0 A;  4LF7 I;  1YSR A;  3J7A G;  4DU7 A;  1XMO E;  4AWP A;  2XDX A;  2UUC I;  3K60 A;  4ASB A;  2XD6 A;  1UY8 A;  1B62 A;  4M1K A;  3ZZU A;  4DV1 E;  2O1T A;  2UWD A;  5C93 A;  2O1W A;  4AWQ A;  4GKK E;  1HNW I;  1UY7 A;  1UYL A;  4BAE A;  4DR4 E;  2WI6 A;  4PU9 A;  4QPJ A;  2WER A;  5BR8 I;  4X65 E;  2CCS A;  4LF6 I;  4I3H A;  4P7A A;  4B7P A;  1TC6 A;  4UT4 A;  4LFC E;  4LWE A;  3T1Y E;  4H85 A;  1R62 A;  3A0W A;  4CWF A;  4N3O A;  4NXM I;  2CG9 A;  2YGA A;  4JI3 E;  4HXZ A;  1J5E I;  2R42 A;  4MYT A;  4DV4 E;  3Q5J A;  3ZXQ A;  3PYG A;  3OMU A;  4JAU A;  4HY1 A;  4HXW A;  2V8P A;  3R91 A;  3QT7 A;  3GON A;  2UXD I;  3WU5 A;  2PNR A;  1A6F A;  4DR3 E;  4URM A;  2XAB A;  5IWA E;  4NH8 A;  4Q20 A;  3ZM7 A;  4DUH A;  3Q5L A;  1YT2 A;  4FW9 A;  2E5L E;  1QZR A;  4DV2 E;  2WEP A;  3G7E A;  2BYH A;  3O6O A;  2ZM6 E;  2YE5 A;  5FNC A;  1N0U A;  1ZW9 A;  3H80 A;  3VHA A;  1XMQ E;  2QG2 A;  4X62 E;  1N0V C;  4XIT A;  2UXB E;  3JAM C;  1DAR A;  2ZBK B;  1N34 E;  1XNQ I;  2HCH A;  5D7R A;  3OWD A;  4FPP A;  4R3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...