1S16A

Crystal structure of e. coli topoisomerase iv pare 43kda subunit complexed with adpnp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
380
Chain Sequence
TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Topoisomerase IV subunit B
publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 114
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s16A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s16A01
4ASAA 2WI6A 2ZBKB 4JQLA 5IN9A 2V2QA 3CRKA 3G7EA 4EGIA 4CWFA 4V26A 3OTOI 1UY6A 5CTUA 1YC3A 3ZKBA 4UT4A 4DPUA 2IORA 4LF8E 4YKRA 2HHHI 1YSRA 2YE4A 2YE9A 4NH9A 1YS3A 4K0KE 4MPEA 4JV5E 1XMOI 4OX9I 4LWIA 1HR0E 1MX0A 1UY7A 4NH8A 3RKZA 1FJGI 4PRXA 1IBMI 2YI6A 2ZDXA 2DEIA 3G75A 2YE6A 5FNDA 3TTZA 1MG7A 1TBWA 5CPHA 1ZM3A 2XDLA 3R91A 4YKXA 5IT9C 5FLXQ 4XCJA 1J5EE 4LFAE 1US7A 4BIUA 4HXWA 5IWAI 4XKAA 5LMUI 3PYDA 4LF5I 4USMA 1L0OA 4DR3E 1Y8NA 2AKPA 2IWXA 1I58A 1KIJA 2YEGA 3GIEA 4BAEA 1Y4SA 1UYCA 3JZ3A 4LPBA 2CCSA 4UROA 5M4HA 3KE6A 2O1VA 3M6AA 2ZM6E 2IOQA 2XJGA 4GKJI 4RPFA 4XKOA 2WERA 3QTFA 1QY8A 1Z0TA 3CGZA 3OMUA 3VHDA 4FCPA 4MOTA 3R4OA 5BOCA 4DV7E 2YKIA 3HHUA 3ZZUA 4JI2I 3CGYA 1NHIA 2UXDI 2UUBE 4X65E 1YC4A 2IWUA 2UXCE 4DU7A 1AJ6A 5IDMA 4XC0A 3Q1QA 4FWDA 2BU6A 4JI6E 4YKTA 4DV0E 2YGAA 4GQTA 4HYPA 1U2RA 4X66E 4GEEA 4JI0I 1S14A 4Q20A 2DEJA 4YKYA 2LJPA 2XX4A 4U7OA 1TC6A 3U2KA 4ZVIA 2EXLA 4JYAE 2FWYA 2GS8A 4DUYI 2CCUA 1N36I 4LF7I 1N34E 4YY3I 5L3JA 1YESA 4U93A 3RLQA 4O09A 1Z5CA 4MYUA 2VQEI 4DV2I 2UUCE 5CTXA 1HNXE 5IDJA 1EA6A 4USKA 2A2CA 4QPKA 4LFBI 4JI7E 3WU4A 3K1JA 2H8MA 4DV3E 3B82A 2JJCA 2WI1A 4AS9A 3O6OA 4B3TE 2YE7A 4JI3E 1S4EA 2QF6A 1ELOA 4JI5I 4R3AA 4LF6I 1BYQA 5F3KA 4HACB 1N33E 2EFGA 4FPPA 3K98A 3ZM7A 4DR2E 5F5RA 4AWPA 1IBKI 4URNA 4FMTA 4FWHA 4GT8A 3JAMC 3T2SA 3TZ0A 4NH7A 4DR1I 4URLA 4DR5I 4GCZA 2CGFA 1Z5AA 4FWGA 3T1YI 2UXBE 1XNRI 4CWTA 2YKEA 2UU9I 5BR8E 4HY6A 1UEKA 3R4MA 4X9LA 3OTOE 2BU5A 4XE2A 3H4LA 2HHHE 3BM9A 4NXNE 1ZXNA 4P8OA 5FWKA 4H7QA 2BT0A 2K5BA 1FWKA 3TZ4A 4LF9I 4BQJA 4DPXA 2VF3A 4JI4E 4OX9E 4HYMA 1BKNA 1FJGE 2YE2A 4L90A 5D6PA 3PEJA 5FLXC 2BTZA 4XKKA 4DUZI 2IWSA 2YGFA 1AMWA 4L93A 1PIEA 3LNUA 2HG1A 3GIGA 3T1KA 2R42A 1Z0VA 1XNQI 4XIPA 5IWAE 3HZ5A 4LF4E 5LMUE 2YKJA 5LMNI 2VQFE 4DV5I 1QZRA 2F4VE 4PU9A 4KSHA 4KTNA 4HZ5A 4DXLA 4PL9A 4PRVA 4CWPA 3MNRP 4B3MI 5CTWA 1PVGA 4FCQA 3EHHA 4DV6E 2QFOA 1ZWHA 4AWOA 1Z0WA 2A2DA 1AM1A 4GKJE 1RREA 4X64I 2X7IA 3D36A 2BM0A 3GONA 1XMQI 4DR7I 2PNRA 4ASBA 3V5RA 3F0NA 4JI2E 3O0IA 3J81Q 2UXDE 3HZ1A 4JAVA 2YEJA 3FT8A 1Z5BA 2WI7A 2V2ZA 5D7CA 1I5CA 3VHCA 4CWQA 3B78A 4JI0E 3PYEA 4MBCA 2E5LI 2QG2A 3INXA 3K99A 4DV4I 1Y8PA 3ZXOA 2OI2A 1Z0BA 4HACA 4E01A 2YKBA 2WI3A 3LTOA 4P7AA 2YI0A 4FN5A 3GIFA 4JASA 4DUYE 1N36E 4LF7E 4YY3E 3T0ZA 2V8PA 4B3RE 4CWOA 1B62A 4JI8I 2VQEE 4DV2E 3A0RA 4K4OA 4XIQA 5D7RA 2WW4A 4LFBE 1GKZA 4DPTA 4KQVA 1N32E 4L8ZA 2WEPA 4DR4I 2YEFA 3T10A 4KP4A 4LF6E 2BZ5A 2NPFA 1UY9A 1I94E 1K47A 1A4HA 4E02A 4X62I 3T1HE 4LF8I 2YEHA 4LFCI 4XITA 4EFTA 1FNMA 2BU8A 2O1WA 3Q5LA 3EHFA 2BYHA 4FCRA 4AWQA 2AJ4A 2UUAI 1XNRE 3PYFA 1KKHA 3TZ5A 2UU9E 4R3MA 1YT1A 2BRCA 1TILA 3EKOA 1UYLA 3V2UC 3D0BA 4CWNA 3K60A 2YEIA 2ZDYA 3R92A 4DR6E 3RLPA 4LFAI 1UYHA 4BIZA 4LWEA 1EI1A 2YKCA 1H72C 4CE2A 1UYIA 4L91A 4O04A 1IBLE 1Z59A 4JI1E 5CTYA 3ZXQA 2C2AA 3B8HA 5GMDA 4JG4A 3B28A 4MPCA 3O2FA 3RLRA 1OJ4A 4DV1I 2O1UA 1UYDA 2BV3A 1XNQE 2E1RA 1OSFA 1ZW9A 2CCTA 5FNFA 2WI2A 3C11A 3H80A 4MP7A 4BQGA 4ED4A 2XDUA 4LWHA 5LMNE 3B27A 4YKUA 2XDKA 3B24A 4H85A 3A0TA 2BU7A 4DV7I 2YEDA 3BMYA 2H55A 4AQYI 2YI7A 4B3ME 2XX5A 3ZZTA 2YJWA 2ESAA 4DV0I 4Z7CA 3A0ZA 1THNA 4ZKIA 3WU5A 3J81C 2ZITA 4X66I 1XMOE 1H7SA 2Q8FA 2XEXA 3HYYA 4XTJA 2YGEA 1XMQE 4DR7E 1IBME 4HY1A 1TC0A 1UYKA 2QG0A 1FI4A 1BXDA 1Z0CA 1ID0A 3PYGA 3WU3A 4JYAI 1AH6A 2CG9A 1R62A 3IEDA 1VISA 1N34I 4B3SI 5M4NA 2XHTA 1B3QA 1FKAE 3FT5A 1H73A 1AH8A 2YEBA 4NXMI 4LF5E 2HK3A 4MPNA 4DZYA 2E5LE 2XD6A 4I5SA 4DV4E 4DV3I 2FWZA 3J80Q 4YKZA 3J7AG 4B3TI 2YK9A 4KSGA 2XJXA 4HXZA 4UTGA 4JI8E 4MYTA 2Q8GA 1Y4UA 2WI5A 2BREA 3HYZA 1KVKA 2IOPA 2YI5A 5D7DA 4KHPI 2YE3A 2XDSA 2XHRA 3VADA 1KZNA 1YT0A 4GKKI 4O07A 3EHGA 4W7TA 3D4JA 4DR4E 2YECA 3CRLA 2YE8A 5BR8I 5M4MA 4Z7YA 1HNZI 4X62E 3A0YA 5D6QA 2XX2A 2YEEA 1Z0GA 3J7AM 3OWBA 4LFCE 4NXNI 5J71A 3Q5JA 1Y8OA 4CE3A 3OW6A 1HNWI 4O0BA 4JI4I 3QT5A 3U67A 2XABA 2UUAE 4YHHI 4CE1A 2YK2A 2VW5A 2BYIA 1KTVA 5M4KA 4V25A 4DUHA 4LWFA 4WUCA 2XK2A 4ASFA 2HCHA 3T0HA 3TUHA 1UYEA 4EFUA 4MB9A 4LP0A 1TH8A 3R4PA 1S16A 5CF0A 4LF4I 1GKXA 3G7BA 2V34A 4E00A 2FXSA 2VQFI 2VCJA 4JI5E 2F4VI 1H7UA 3EKRA 5A2QQ 3QT8A 1I5AA 1UYGA 1MU5A 2WEQA 1DARA 3INWA 1IBKE 2HKEA 4DV1E 4DV6I 3QT7A 4FW9A 4I3HA 4DR1E 3GIGB 4K0KI 4DR5E 2CH4A 2Q8IA 2HFUA 4EGKA 4JV5I 3T1YE 1HR0I 2GFDA 2Q2EB 5BODA 2J7KA 1GJVA 1U0ZA 1NHHA 1N0UA 4AQYE 1ZXMA 4EMVA 1UY8A 3TZ2A 1YSZA 4XD8A 3EHJA 1NHJA 1J5EI 4YKQA 4LF9E 4DR3I 1Z0EA 4DPYA 1I59A 5IT9Q 3QDDA 2HFSA 2UWDA 4DU8A 1YT2A 5FNCA 3HEKA 2VCIA 2VWCA 1RR9A 3A0XA 4DUZE 4QPJA 1NZ0A 3WU6A 4R1FA 3D2RA 2FYPA 4H81A 4BXIA 2XHXA 4L94A 1ZM2A 4B3SE 3FV5A 4B6CA 2ZM6I 4B3RI 2Q8HA 3J80C 3CWVA 1ZM4A 4NXME 3B26A 3R4NA 3WHAA 1A6FA 2XCMA 4DV5E 1YC1A 4LWGA 2XDXA 1N0VC 4DPWA 3Q5KA 5J6AA 4M1KA 3ZZ0A 2ZKJA 4EEHA 2UUBI 4X65I 1N32I 2WI4A 2UXCI 2YEAA 2HK2A 5GMEA 4KFGA 1JM6A 4U7NA 1I94I 4JI6I 2BSMA 3QT6A 1WUUA 3WQ9A 4YKWA 3T1HI 3VHAA 4URMA 4CWSA 4X64E 1I5BA 2JKIA 4MP2A 5M4PA 4KHPE 2YJXA 3DGEA 4WUDA 5GGZA 4GKKE 2YE5A 4HZ0A 2CZ9A 1TIDA 3ZKDA 3HULA 5M4EA 2BU2A 4CWRA 3C0EA 3B25A 2E0AA 4GFNA 1HNZE 1I5DA 2UUCI 4GGLA 3PEHA 4JAUA 1HNXI 3SL2A 2HKJA 4EM7A 4ASGA 4DR6I 4JI7I 1PKPA 2V2VA 3NMQA 1HNWE 2X36A 4XCLA 1XHKA 2GQPA 3K97A 1YERA 4XIRA 4P52A 4JI3I 4YHHE 1IBLI 4EMDA 4JI1I 3A0WA 3OPDA 3OWDA 5C93A 1ZM9A 1N33I 1B63A 4EGHA 1FWLA 1YETA 3K17A 4DR2I 2BM1A 5LL6R 3U2DA 1BGQA 2XJJA 3LPSA 1QYEA 4XDMA 1U2OA 1D6TA 2R3VA 1UYFA 1UYMA 5A2QC 4B7PA 1H74A 4WUBA 2UXBI 4O05A 3JAMQ
chains in the Genus database with same CATH superfamily
4ASAA 2WI6A 2ZBKB 4JQLA 5IN9A 2V2QA 5EKWA 4N3OA 3CRKA 3G7EA 4EGIA 4CWFA 4V26A 2C37B 3OTOI 1UY6A 5CTUA 1YC3A 3GLLA 3ZKBA 2C38B 4DPUA 4UT4A 4LF8E 2IORA 4YKRA 2HHHI 1YSRA 2YE4A 2YE9A 4NH9A 1YS3A 4K0KE 4OO1D 2PO1A 4MPEA 4JV5E 3DD6A 1XMOI 4OX9I 4LWIA 1HR0E 1MX0A 1UY7A 4NH8A 3RKZA 1FJGI 4PRXA 1IBMI 2YI6A 2ZDXA 2DEIA 3G75A 4MU0A 4BA2B 4OO1F 2YE6A 5FNDA 1MG7A 3TTZA 1Y6ZA 1TBWA 2C1GA 5CPHA 1ZM3A 1YH8A 2XDLA 3R91A 4YKXA 5IT9C 4AM3A 1OYPA 5FLXQ 4XCJA 1J5EE 4LFAE 1US7A 4BIUA 4HXWA 5IWAI 4XKAA 5LMUI 2GO4A 3PYDA 4LF5I 4USMA 1L0OA 4DR3E 1Y8NA 2AKPA 2IWXA 1I58A 1KIJA 2YEGA 3GIEA 4BAEA 1Y4SA 1UYCA 3JZ3A 4LPBA 2CCSA 3M7ND 4UROA 5M4HA 3KE6A 2O1VA 3M6AA 2ZM6E 4OO1B 2IOQA 4MU3A 2XJGA 3CDJA 4GKJI 4RPFA 4XKOA 2WERA 2CGEA 3QTFA 1QY8A 1Z0TA 4FW3A 3CGZA 3OMUA 3VHDA 4FCPA 4MOTA 3R4OA 5C0XA 5BOCA 3UHMA 4DV7E 2YKIA 3HHUA 3LMMA 3ZZUA 4JI2I 3CGYA 1NHIA 2UXDI 2UUBE 4X65E 4IFDE 1YC4A 2UXCE 2IWUA 4DU7A 1AJ6A 5IDMA 4XC0A 4MU4A 3Q1QA 4FWDA 2BU6A 3L7ZB 4JI6E 3M7NG 4YKTA 1R6MA 4IFDC 4DV0E 2YGAA 4GQTA 4HYPA 1E3HA 1U2RA 4X66E 4GEEA 4JI0I 1S14A 4Q20A 2DEJA 2GO3A 4YKYA 2LJPA 2XX4A 4QNKA 1TC6A 3K85A 4U7OA 3U2KA 4ZVIA 2EXLA 4JYAE 2PO0A 2FWYA 2GS8A 4DUYI 2CCUA 1N36I 4LF7I 1N34E 3NZKA 5L3JA 4YY3I 1YESA 4U93A 3RLQA 4O09A 1Z5CA 3P3EA 4MYUA 4MQYA 2VQEI 3PRYA 4DV2I 1HNXE 2UUCE 5CTXA 5IDJA 1EA6A 4USKA 2A2CA 4QPKA 4LFBI 4JI7E 3WU4A 3K1JA 5JEAC 1Y5YA 2JEAA 2H8MA 4DV3E 3B82A 2JJCA 2WI1A 4AS9A 3O6OA 4B3TE 2YE7A 4JI3E 1S4EA 4LPFA 1ELOA 2QF6A 4JI5I 3PS3A 4LF6I 1BYQA 4R3AA 4HACB 1N33E 5F3KA 2EFGA 2C38A 4FPPA 3K98A 3ZM7A 4DR2E 5F5RA 4AWPA 1IBKI 4URNA 4FMTA 2Z5BB 4FWHA 4GT8A 3JAMC 3T2SA 3TZ0A 4NH7A 4DR1I 3S5TA 4URLA 4DR5I 5K36C 4GCZA 2CGFA 1Z5AA 3P3CA 4FWGA 3T1YI 4BA2A 2UXBE 3PS1A 1XNRI 4CWTA 2YKEA 2UU9I 5BR8E 4HY6A 1UEKA 3R4MA 4X9LA 3OTOE 2BU5A 4XE2A 1OYRA 2BA0D 3H4LA 3GCMA 2HHHE 4NXNE 1ZXNA 3BM9A 1HK7A 4P8OA 5FWKA 4H7QA 3HKMA 2BT0A 1FWKA 2K5BA 3TZ4A 4LF9I 4BQJA 4DPXA 2NN6C 2VF3A 4JI4E 4OX9E 4HYMA 1BKNA 5C0XC 1FJGE 2YE2A 4L90A 5D6PA 3PEJA 5FLXC 2BTZA 4IS9A 4XKKA 4DUZI 2IWSA 2YGFA 1AMWA 4L93A 4OKGA 1PIEA 3LNUA 2HG1A 3GIGA 2WNRB 3T1KA 2R42A 1Z0VA 1USVA 1XNQI 4XIPA 5IWAE 3HZ5A 4LF4E 5LMUE 1OYSA 3B4TA 2YKJA 5LMNI 3CYGA 2J65A 2VQFE 4DV5I 1QZRA 2BR2B 2F4VE 4PU9A 4KSHA 4KTNA 4HZ5A 4DXLA 4PL9A 4PRVA 4CWPA 3MNRP 2IERA 3L7ZA 4B3MI 5CTWA 1PVGA 4FCQA 3EHHA 4DV6E 2QFOA 3M85G 1ZWHA 4AWOA 1Z0WA 2A2DA 1AM1A 1E3PA 4GKJE 1RREA 4X64I 2X7IA 3D36A 2BM0A 3PS2A 3GONA 1XMQI 4DR7I 2PNRA 4ASBA 3V5RA 3F0NA 4JI2E 3O0IA 4IZJD 3J81Q 5DROA 2UXDE 2F1DA 3HZ1A 4JAVA 2YEJA 3FT8A 1Z5BA 5DRQA 2WI7A 2IESA 2V2ZA 5D7CA 1I5CA 3VHCA 4CWQA 3B78A 3GMEA 4JI0E 2JEBB 2JE6B 4U3BA 3PYEA 4MBCA 2E5LI 2QG2A 3INXA 3K99A 4DV4I 5ELWA 1Y8PA 2OI2A 3ZXOA 1Z0BA 4HACA 4E01A 2YKBA 2WI3A 3LTOA 4P7AA 2YI0A 4FN5A 3GIFA 4JASA 3Q6NA 4DUYE 1N36E 2Z5BA 4LF7E 4YY3E 3T0ZA 2V8PA 4B3RE 4CWOA 1B62A 4JI8I 2VQEE 4DV2E 3A0RA 4K4OA 4XIQA 5D7RA 2WW4A 4LFBE 2PO2A 1GKZA 4DPTA 4KQVA 4IZJB 1N32E 4L8ZA 2WEPA 4DR4I 2YEFA 5JEAD 4OO1E 3T10A 4AIMA 4KP4A 4LF6E 2BZ5A 2NPFA 1UY9A 1I94E 1K47A 1A4HA 4E02A 3P06A 4X62I 2WP8B 3T1HE 2C1IA 5JEAF 4LF8I 2YEHA 4LFCI 3KRNA 2PNZB 4XITA 4IFDB 4U3DA 4EFTA 1FNMA 3U1KA 2O1WA 2BU8A 3Q5LA 3EHFA 2BYHA 4FCRA 4AWQA 2AJ4A 2UUAI 1XNRE 3PYFA 1KKHA 3TZ5A 2UU9E 4R3MA 5K36D 1YT1A 2BRCA 1TILA 3EKOA 1UYLA 3V2UC 4MDTA 3D0BA 4CWNA 3K60A 2YEIA 2ZDYA 3R92A 5K36F 4DR6E 1UDSA 3RLPA 4LFAI 1UYHA 4BIZA 4LWEA 1EI1A 2YKCA 1H72C 4CE2A 1UYIA 2PO1B 4L91A 4O04A 2C37A 5JEAB 1Z59A 1IBLE 4JI1E 5CTYA 3ZXQA 2C2AA 2NN6D 3B8HA 5GMDA 4JG4A 3B28A 5C0XD 4MPCA 3O2FA 3RLRA 1OJ4A 4DV1I 2Z5EA 4FW6A 2O1UA 1UYDA 2BV3A 4AIDA 1XNQE 2E1RA 1OSFA 2NN6F 1ZW9A 2CCTA 5FNFA 2WI2A 3C11A 3H80A 4MP7A 4BQGA 4ED4A 2XDUA 4LWHA 5LMNE 3B27A 4YKUA 5DNLA 2XDKA 3B24A 4H85A 3A0TA 2BU7A 4DV7I 5K36B 2YEDA 3BMYA 4J3DA 2H55A 4AQYI 2YI7A 4B3ME 2XX5A 3ZZTA 2YJWA 2ESAA 2JEBA 4DV0I 4Z7CA 3A0ZA 1THNA 4ZKIA 3WU5A 3J81C 2ZITA 4X66I 1XMOE 1H7SA 4IZKB 2Q8FA 2XEXA 3HYYA 4XTJA 2YGEA 1XMQE 4DR7E 1IBME 4HY1A 1TC0A 1UDQA 1UYKA 2QG0A 5DNXA 1FI4A 4BA1B 2NN6B 1BXDA 1Z0CA 5C0XB 1ID0A 3PYGA 2O3ZA 1XXEA 3WU3A 4JYAI 1AH6A 3HJCA 4OO1A 2CG9A 1R62A 3IEDA 1VISA 1N34I 2BA0G 4B3SI 5M4NA 2FTKA 2XHTA 1B3QA 1FKAE 3FT5A 1H73A 4FW4A 3P76A 1AH8A 4NXMI 2YEBA 3P3GA 2HK3A 4LF5E 4MPNA 4DZYA 4IZJA 2E5LE 2XD6A 4I5SA 4DV4E 4DV3I 4OZEA 2FWZA 3J80Q 2PNLA 4YKZA 3J7AG 4B3TI 2YK9A 4KSGA 2BA1D 2XJXA 2WP8A 1IXMA 4HXZA 1R6LA 4UTGA 2PNZA 4MYTA 4JI8E 2Q8GA 1Y4UA 2WI5A 2BREA 3HYZA 1KVKA 2IOPA 2YI5A 5D7DA 4KHPI 1UDNA 2YE3A 2XDSA 2XHRA 1P42A 3VADA 1KZNA 1YT0A 4GKKI 4O07A 2JEAB 3EHGA 4W7TA 3D4JA 4LCHA 4DR4E 2YECA 3CRLA 2YE8A 5BR8I 5M4MA 2BA1G 4Z7YA 1HNZI 4X62E 3A0YA 5D6QA 2XX2A 4EEHA 2YEEA 1Z0GA 4FW5A 3J7AM 3OWBA 4LFCE 4NXNI 5J71A 3Q5JA 4IFDD 1Y8OA 4CE3A 3OW6A 1HNWI 4O0BA 5JEAA 2HHIA 2O1TA 4JI4I 3QT5A 3U67A 2XABA 2UUAE 4LCGA 4YHHI 4CE1A 3CDIA 2YK2A 4IFDF 2VW5A 4LCFA 2BYIA 1Y60A 1KTVA 5M4KA 4V25A 2C39B 4DUHA 4LWFA 5JENA 3H1CA 4WUCA 2XK2A 4ASFA 5DRRA 2HCHA 3T0HA 1UYEA 4EFUA 4MB9A 3TUHA 4LP0A 2JT2A 1TH8A 3R4PA 1S16A 2Z5CB 5CF0A 4LF4I 1GKXA 3G7BA 2V34A 5K36A 4E00A 2FXSA 4E72A 2VQFI 2VCJA 4JI5E 2F4VI 1H7UA 3EKRA 5A2QQ 3QT8A 1I5AA 1UYGA 1MU5A 2WEQA 1DARA 4OO1C 1IBKE 3INWA 2HKEA 4DV1E 4DV6I 3QT7A 4FW9A 4I3HA 2VESA 4DR1E 4IZKA 3GIGB 4K0KI 4GQUA 4DR5E 2CH4A 2Q8IA 2HFUA 4EGKA 4JV5I 3T1YE 1HR0I 2GFDA 4BA1A 2NN6A 2Q2EB 5BODA 2J7KA 1GJVA 1U0ZA 1NHHA 1N0UA 2PNMA 2WNRA 1RHYA 2CVEA 4AQYE 1ZXMA 4EMVA 1UY8A 3TZ2A 1YHCA 1YSZA 4XD8A 3EHJA 1NHJA 1J5EI 4YKQA 4LF9E 2BR2A 1VI7A 4DR3I 1Z0EA 4DPYA 1I59A 2GQ0A 5IT9Q 2HFSA 2UWDA 4DU8A 1YT2A 3QDDA 5FNCA 3HEKA 2VCIA 2VWCA 1RR9A 3A0XA 4DUZE 4QPJA 1NZ0A 3WU6A 1UDOA 4R1FA 3D2RA 5DRPA 2FYPA 4H81A 4BXIA 2XHXA 4L94A 4QNJA 1ZM2A 4B3SE 3FV5A 4B6CA 2ZM6I 4B3RI 5JEAE 2Q8HA 3J80C 5C0XF 3CWVA 1ZM4A 4NXME 3B26A 3R4NA 3WHAA 1A6FA 4NBQA 4FW7A 2XCMA 4DV5E 1YC1A 4ISAA 4LWGA 2XDXA 1N0VC 4DPWA 3Q5KA 5J6AA 4M1KA 3ZZ0A 3Q6MA 2ZKJA 2UUBI 4X65I 2AE8A 1N32I 2UXCI 2WI4A 2HK2A 2YEAA 5GMEA 4KFGA 1JM6A 4U7NA 1I94I 4JI6I 2BSMA 3QT6A 1WUUA 2JE6A 3WQ9A 4YKWA 3T1HI 3VHAA 5K36E 4URMA 4CWSA 4X64E 1I5BA 2JKIA 4MP2A 5M4PA 4KHPE 2YJXA 3DGEA 1USUA 4WUDA 5GGZA 4GKKE 2PO2B 2YE5A 4HZ0A 2CZ9A 1TIDA 3ZKDA 3HULA 5M4EA 2BU2A 4CWRA 3C0EA 3B25A 2C39A 2E0AA 4GFNA 1HNZE 1I5DA 2UUCI 4GGLA 3PEHA 4JAUA 1HNXI 3SL2A 2HKJA 4EM7A 2NN6E 2Z5CA 4ASGA 4DR6I 4JI7I 5C0XE 1PKPA 2V2VA 3NMQA 1HNWE 2X36A 4XCLA 1XHKA 2GQPA 3K97A 1YERA 4XIRA 4P52A 4JI3I 4YHHE 1IBLI 4EMDA 4JI1I 3A0WA 3OPDA 3OWDA 5C93A 1ZM9A 1N33I 1B63A 4MU1A 1FWLA 4EGHA 4LOMA 3K17A 1YETA 4DR2I 2BM1A 5LL6R 2PO0B 3U2DA 1BGQA 3M85D 4IFDA 2XJJA 3LPSA 1QYEA 5EL9A 4XDMA 1U2OA 1D6TA 2R3VA 1UYFA 3U1YA 1UYMA 5A2QC 4B7PA 1H74A 4WUBA 1F51A 2UXBI 4O05A 3JAMQ
chains in the Genus database with same CATH topology
4ASAA 2WI6A 2ZBKB 4JQLA 5IN9A 2V2QA 4N3OA 3CRKA 3G7EA 4EGIA 4CWFA 4V26A 3OTOI 1UY6A 5CTUA 1YC3A 3ZKBA 4UT4A 4DPUA 2IORA 4LF8E 4YKRA 2HHHI 1YSRA 2YE4A 2YE9A 4NH9A 1YS3A 4K0KE 4MPEA 4JV5E 1XMOI 4OX9I 4LWIA 1HR0E 1MX0A 1UY7A 4NH8A 3RKZA 1FJGI 4PRXA 1IBMI 2YI6A 2ZDXA 2DEIA 3G75A 2YE6A 5FNDA 3TTZA 1MG7A 1Y6ZA 1TBWA 5CPHA 1ZM3A 2XDLA 3R91A 4YKXA 5IT9C 5FLXQ 4XCJA 1J5EE 4LFAE 1US7A 4BIUA 4HXWA 5IWAI 4XKAA 5LMUI 3PYDA 4LF5I 4USMA 1L0OA 4DR3E 1Y8NA 2AKPA 2IWXA 1I58A 1KIJA 2YEGA 3GIEA 4BAEA 1Y4SA 1UYCA 3JZ3A 4LPBA 2CCSA 4UROA 5M4HA 3KE6A 2O1VA 3M6AA 2ZM6E 2IOQA 2XJGA 4GKJI 4RPFA 4XKOA 2WERA 2CGEA 3QTFA 1QY8A 1Z0TA 3CGZA 3OMUA 3VHDA 4FCPA 4MOTA 3R4OA 5BOCA 4DV7E 2YKIA 3HHUA 3ZZUA 4JI2I 3CGYA 1NHIA 2UXDI 2UUBE 4X65E 1YC4A 2IWUA 2UXCE 4DU7A 1AJ6A 5IDMA 4XC0A 3Q1QA 4FWDA 2BU6A 4JI6E 4YKTA 4DV0E 2YGAA 4GQTA 4HYPA 1U2RA 4X66E 4GEEA 4JI0I 1S14A 4Q20A 2DEJA 4YKYA 2LJPA 2XX4A 4U7OA 1TC6A 3K85A 3U2KA 4ZVIA 2EXLA 4JYAE 2FWYA 2GS8A 4DUYI 2CCUA 1N36I 4LF7I 1N34E 4YY3I 5L3JA 1YESA 4U93A 3RLQA 4O09A 1Z5CA 4MYUA 2VQEI 4DV2I 2UUCE 3PRYA 1HNXE 5CTXA 5IDJA 1EA6A 4USKA 2A2CA 4QPKA 4LFBI 4JI7E 3WU4A 3K1JA 2H8MA 4DV3E 3B82A 2JJCA 2WI1A 4AS9A 3O6OA 4B3TE 2YE7A 4JI3E 1S4EA 2QF6A 1ELOA 4JI5I 4R3AA 4LF6I 1BYQA 5F3KA 4HACB 1N33E 2EFGA 4FPPA 3K98A 3ZM7A 4DR2E 5F5RA 4AWPA 1IBKI 4URNA 4FMTA 2Z5BB 4FWHA 4GT8A 3JAMC 3T2SA 3TZ0A 4NH7A 4DR1I 4URLA 4DR5I 4GCZA 2CGFA 1Z5AA 4FWGA 3T1YI 2UXBE 1XNRI 4CWTA 2YKEA 2UU9I 5BR8E 4HY6A 1UEKA 3R4MA 4X9LA 3OTOE 2BU5A 4XE2A 3H4LA 2HHHE 3BM9A 4NXNE 1ZXNA 4P8OA 1HK7A 5FWKA 4H7QA 2BT0A 2K5BA 1FWKA 3TZ4A 4LF9I 4BQJA 4DPXA 2VF3A 4JI4E 4OX9E 4HYMA 1BKNA 1FJGE 2YE2A 4L90A 5D6PA 3PEJA 5FLXC 2BTZA 4XKKA 4DUZI 2IWSA 2YGFA 1AMWA 4L93A 1PIEA 3LNUA 2HG1A 3GIGA 3T1KA 2R42A 1Z0VA 1USVA 1XNQI 4XIPA 5IWAE 3HZ5A 4LF4E 5LMUE 2YKJA 5LMNI 2VQFE 4DV5I 1QZRA 2F4VE 4PU9A 4KSHA 4KTNA 4HZ5A 4DXLA 4PL9A 4PRVA 4CWPA 3MNRP 4B3MI 5CTWA 1PVGA 4FCQA 3EHHA 4DV6E 2QFOA 1ZWHA 4AWOA 1Z0WA 2A2DA 1AM1A 4GKJE 1RREA 4X64I 2X7IA 3D36A 2BM0A 3GONA 1XMQI 4DR7I 2PNRA 4ASBA 3V5RA 3F0NA 4JI2E 3O0IA 4IZJD 3J81Q 2UXDE 3HZ1A 4JAVA 2YEJA 3FT8A 1Z5BA 2WI7A 2V2ZA 5D7CA 1I5CA 3VHCA 4CWQA 3B78A 4JI0E 3PYEA 4MBCA 2E5LI 2QG2A 3INXA 3K99A 4DV4I 1Y8PA 3ZXOA 2OI2A 1Z0BA 4HACA 4E01A 2YKBA 2WI3A 3LTOA 4P7AA 2YI0A 4FN5A 3GIFA 4JASA 3Q6NA 4DUYE 1N36E 2Z5BA 4LF7E 4YY3E 3T0ZA 2V8PA 4B3RE 4CWOA 1B62A 4JI8I 2VQEE 4DV2E 3A0RA 4K4OA 4XIQA 5D7RA 2WW4A 4LFBE 1GKZA 4DPTA 4KQVA 4IZJB 1N32E 4L8ZA 2WEPA 4DR4I 2YEFA 3T10A 4KP4A 4LF6E 2BZ5A 2NPFA 1UY9A 1I94E 1K47A 1A4HA 4E02A 3P06A 4X62I 3T1HE 4LF8I 2YEHA 4LFCI 4XITA 4EFTA 1FNMA 2O1WA 2BU8A 3Q5LA 3EHFA 2BYHA 4FCRA 4AWQA 2AJ4A 2UUAI 1XNRE 3PYFA 1KKHA 3TZ5A 2UU9E 4R3MA 1YT1A 2BRCA 1TILA 3EKOA 1UYLA 3V2UC 3D0BA 4CWNA 3K60A 2YEIA 2ZDYA 3R92A 4DR6E 3RLPA 4LFAI 1UYHA 4BIZA 4LWEA 1EI1A 2YKCA 1H72C 4CE2A 1UYIA 4L91A 4O04A 1IBLE 1Z59A 4JI1E 5CTYA 3ZXQA 2C2AA 3B8HA 5GMDA 4JG4A 3B28A 4MPCA 3O2FA 3RLRA 1OJ4A 4DV1I 2Z5EA 2O1UA 1UYDA 2BV3A 1XNQE 2E1RA 1OSFA 1ZW9A 2CCTA 5FNFA 2WI2A 3C11A 3H80A 4MP7A 4BQGA 4ED4A 2XDUA 4LWHA 5LMNE 3B27A 4YKUA 2XDKA 3B24A 4H85A 3A0TA 2BU7A 4DV7I 2YEDA 3BMYA 2H55A 4AQYI 2YI7A 4B3ME 2XX5A 3ZZTA 2YJWA 2ESAA 4DV0I 4Z7CA 3A0ZA 1THNA 4ZKIA 3WU5A 3J81C 2ZITA 4X66I 1XMOE 1H7SA 4IZKB 2Q8FA 2XEXA 3HYYA 4XTJA 2YGEA 1XMQE 4DR7E 1IBME 4HY1A 1TC0A 1UYKA 2QG0A 1FI4A 1BXDA 1Z0CA 1ID0A 3PYGA 3WU3A 4JYAI 1AH6A 3HJCA 2CG9A 1R62A 3IEDA 1VISA 1N34I 4B3SI 5M4NA 2XHTA 1B3QA 1FKAE 3FT5A 1H73A 1AH8A 2YEBA 4NXMI 4LF5E 2HK3A 4MPNA 4DZYA 4IZJA 2E5LE 2XD6A 4I5SA 4DV4E 4DV3I 2FWZA 3J80Q 2PNLA 4YKZA 3J7AG 4B3TI 2YK9A 4KSGA 2XJXA 4HXZA 4UTGA 4JI8E 4MYTA 2Q8GA 1Y4UA 2WI5A 2BREA 3HYZA 1KVKA 2IOPA 2YI5A 5D7DA 4KHPI 2YE3A 2XDSA 2XHRA 3VADA 1KZNA 1YT0A 4GKKI 4O07A 3EHGA 4W7TA 3D4JA 4DR4E 2YECA 3CRLA 2YE8A 5BR8I 5M4MA 4Z7YA 1HNZI 4X62E 3A0YA 5D6QA 2XX2A 2YEEA 1Z0GA 3J7AM 3OWBA 4LFCE 4NXNI 5J71A 3Q5JA 1Y8OA 4CE3A 3OW6A 1HNWI 4O0BA 2O1TA 4JI4I 3QT5A 3U67A 2XABA 2UUAE 4YHHI 4CE1A 2YK2A 2VW5A 2BYIA 1KTVA 5M4KA 4V25A 4DUHA 4LWFA 4WUCA 2XK2A 4ASFA 2HCHA 3T0HA 3TUHA 1UYEA 4EFUA 4MB9A 4LP0A 1TH8A 3R4PA 1S16A 2Z5CB 5CF0A 4LF4I 1GKXA 3G7BA 2V34A 4E00A 2FXSA 2VQFI 2VCJA 4JI5E 2F4VI 1H7UA 3EKRA 5A2QQ 3QT8A 1I5AA 1UYGA 1MU5A 2WEQA 1DARA 3INWA 1IBKE 2HKEA 4DV1E 4DV6I 3QT7A 4FW9A 4I3HA 4DR1E 4IZKA 3GIGB 4K0KI 4DR5E 2CH4A 2Q8IA 2HFUA 4EGKA 4JV5I 3T1YE 1HR0I 2GFDA 2Q2EB 5BODA 2J7KA 1GJVA 1U0ZA 1NHHA 1N0UA 2PNMA 4AQYE 1ZXMA 4EMVA 1UY8A 3TZ2A 1YSZA 4XD8A 3EHJA 1NHJA 1J5EI 4YKQA 4LF9E 4DR3I 1Z0EA 4DPYA 1I59A 2GQ0A 5IT9Q 2HFSA 2UWDA 4DU8A 1YT2A 3QDDA 5FNCA 3HEKA 2VCIA 2VWCA 1RR9A 3A0XA 4DUZE 4QPJA 1NZ0A 3WU6A 4R1FA 3D2RA 2FYPA 4H81A 4BXIA 2XHXA 4L94A 1ZM2A 4B3SE 3FV5A 4B6CA 2ZM6I 4B3RI 2Q8HA 3J80C 3CWVA 1ZM4A 4NXME 3B26A 3R4NA 3WHAA 1A6FA 2XCMA 4DV5E 1YC1A 4LWGA 2XDXA 1N0VC 4DPWA 3Q5KA 5J6AA 4M1KA 3ZZ0A 3Q6MA 2ZKJA 2UUBI 4X65I 1N32I 2WI4A 2UXCI 2YEAA 2HK2A 4EEHA 5GMEA 4KFGA 1JM6A 4U7NA 1I94I 4JI6I 2BSMA 3QT6A 1WUUA 3WQ9A 4YKWA 3T1HI 3VHAA 4URMA 4CWSA 4X64E 1I5BA 2JKIA 4MP2A 5M4PA 4KHPE 2YJXA 3DGEA 1USUA 4WUDA 5GGZA 4GKKE 2YE5A 4HZ0A 2CZ9A 1TIDA 3ZKDA 3HULA 5M4EA 2BU2A 4CWRA 3C0EA 3B25A 2E0AA 4GFNA 1HNZE 1I5DA 2UUCI 4GGLA 3PEHA 4JAUA 1HNXI 3SL2A 2HKJA 4EM7A 2Z5CA 4ASGA 4DR6I 4JI7I 1PKPA 2V2VA 3NMQA 1HNWE 2X36A 4XCLA 1XHKA 2GQPA 3K97A 1YERA 4XIRA 4P52A 4JI3I 4YHHE 1IBLI 4EMDA 4JI1I 3A0WA 3OPDA 3OWDA 5C93A 1ZM9A 1N33I 1B63A 4EGHA 1FWLA 1YETA 3K17A 4DR2I 2BM1A 5LL6R 3U2DA 1BGQA 2XJJA 3LPSA 1QYEA 4XDMA 1U2OA 1D6TA 2R3VA 1UYFA 1UYMA 5A2QC 4B7PA 1H74A 4WUBA 2UXBI 4O05A 3JAMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASA A;  2WI6 A;  2ZBK B;  4JQL A;  5IN9 A;  2V2Q A;  3CRK A;  3G7E A;  4EGI A;  4CWF A;  4V26 A;  3OTO I;  1UY6 A;  5CTU A;  1YC3 A;  3ZKB A;  4UT4 A;  4DPU A;  2IOR A;  4LF8 E;  4YKR A;  2HHH I;  1YSR A;  2YE4 A;  2YE9 A;  4NH9 A;  1YS3 A;  4K0K E;  4MPE A;  4JV5 E;  1XMO I;  4OX9 I;  4LWI A;  1HR0 E;  1MX0 A;  1UY7 A;  4NH8 A;  3RKZ A;  1FJG I;  4PRX A;  1IBM I;  2YI6 A;  2ZDX A;  2DEI A;  3G75 A;  2YE6 A;  5FND A;  3TTZ A;  1MG7 A;  1TBW A;  5CPH A;  1ZM3 A;  2XDL A;  3R91 A;  4YKX A;  5IT9 C;  5FLX Q;  4XCJ A;  1J5E E;  4LFA E;  1US7 A;  4BIU A;  4HXW A;  5IWA I;  4XKA A;  5LMU I;  3PYD A;  4LF5 I;  4USM A;  1L0O A;  4DR3 E;  1Y8N A;  2AKP A;  2IWX A;  1I58 A;  1KIJ A;  2YEG A;  3GIE A;  4BAE A;  1Y4S A;  1UYC A;  3JZ3 A;  4LPB A;  2CCS A;  4URO A;  5M4H A;  3KE6 A;  2O1V A;  3M6A A;  2ZM6 E;  2IOQ A;  2XJG A;  4GKJ I;  4RPF A;  4XKO A;  2WER A;  3QTF A;  1QY8 A;  1Z0T A;  3CGZ A;  3OMU A;  3VHD A;  4FCP A;  4MOT A;  3R4O A;  5BOC A;  4DV7 E;  2YKI A;  3HHU A;  3ZZU A;  4JI2 I;  3CGY A;  1NHI A;  2UXD I;  2UUB E;  4X65 E;  1YC4 A;  2IWU A;  2UXC E;  4DU7 A;  1AJ6 A;  5IDM A;  4XC0 A;  3Q1Q A;  4FWD A;  2BU6 A;  4JI6 E;  4YKT A;  4DV0 E;  2YGA A;  4GQT A;  4HYP A;  1U2R A;  4X66 E;  4GEE A;  4JI0 I;  1S14 A;  4Q20 A;  2DEJ A;  4YKY A;  2LJP A;  2XX4 A;  4U7O A;  1TC6 A;  3U2K A;  4ZVI A;  2EXL A;  4JYA E;  2FWY A;  2GS8 A;  4DUY I;  2CCU A;  1N36 I;  4LF7 I;  1N34 E;  4YY3 I;  5L3J A;  1YES A;  4U93 A;  3RLQ A;  4O09 A;  1Z5C A;  4MYU A;  2VQE I;  4DV2 I;  2UUC E;  5CTX A;  1HNX E;  5IDJ A;  1EA6 A;  4USK A;  2A2C A;  4QPK A;  4LFB I;  4JI7 E;  3WU4 A;  3K1J A;  2H8M A;  4DV3 E;  3B82 A;  2JJC A;  2WI1 A;  4AS9 A;  3O6O A;  4B3T E;  2YE7 A;  4JI3 E;  1S4E A;  2QF6 A;  1ELO A;  4JI5 I;  4R3A A;  4LF6 I;  1BYQ A;  5F3K A;  4HAC B;  1N33 E;  2EFG A;  4FPP A;  3K98 A;  3ZM7 A;  4DR2 E;  5F5R A;  4AWP A;  1IBK I;  4URN A;  4FMT A;  4FWH A;  4GT8 A;  3JAM C;  3T2S A;  3TZ0 A;  4NH7 A;  4DR1 I;  4URL A;  4DR5 I;  4GCZ A;  2CGF A;  1Z5A A;  4FWG A;  3T1Y I;  2UXB E;  1XNR I;  4CWT A;  2YKE A;  2UU9 I;  5BR8 E;  4HY6 A;  1UEK A;  3R4M A;  4X9L A;  3OTO E;  2BU5 A;  4XE2 A;  3H4L A;  2HHH E;  3BM9 A;  4NXN E;  1ZXN A;  4P8O A;  5FWK A;  4H7Q A;  2BT0 A;  2K5B A;  1FWK A;  3TZ4 A;  4LF9 I;  4BQJ A;  4DPX A;  2VF3 A;  4JI4 E;  4OX9 E;  4HYM A;  1BKN A;  1FJG E;  2YE2 A;  4L90 A;  5D6P A;  3PEJ A;  5FLX C;  2BTZ A;  4XKK A;  4DUZ I;  2IWS A;  2YGF A;  1AMW A;  4L93 A;  1PIE A;  3LNU A;  2HG1 A;  3GIG A;  3T1K A;  2R42 A;  1Z0V A;  1XNQ I;  4XIP A;  5IWA E;  3HZ5 A;  4LF4 E;  5LMU E;  2YKJ A;  5LMN I;  2VQF E;  4DV5 I;  1QZR A;  2F4V E;  4PU9 A;  4KSH A;  4KTN A;  4HZ5 A;  4DXL A;  4PL9 A;  4PRV A;  4CWP A;  3MNR P;  4B3M I;  5CTW A;  1PVG A;  4FCQ A;  3EHH A;  4DV6 E;  2QFO A;  1ZWH A;  4AWO A;  1Z0W A;  2A2D A;  1AM1 A;  4GKJ E;  1RRE A;  4X64 I;  2X7I A;  3D36 A;  2BM0 A;  3GON A;  1XMQ I;  4DR7 I;  2PNR A;  4ASB A;  3V5R A;  3F0N A;  4JI2 E;  3O0I A;  3J81 Q;  2UXD E;  3HZ1 A;  4JAV A;  2YEJ A;  3FT8 A;  1Z5B A;  2WI7 A;  2V2Z A;  5D7C A;  1I5C A;  3VHC A;  4CWQ A;  3B78 A;  4JI0 E;  3PYE A;  4MBC A;  2E5L I;  2QG2 A;  3INX A;  3K99 A;  4DV4 I;  1Y8P A;  3ZXO A;  2OI2 A;  1Z0B A;  4HAC A;  4E01 A;  2YKB A;  2WI3 A;  3LTO A;  4P7A A;  2YI0 A;  4FN5 A;  3GIF A;  4JAS A;  4DUY E;  1N36 E;  4LF7 E;  4YY3 E;  3T0Z A;  2V8P A;  4B3R E;  4CWO A;  1B62 A;  4JI8 I;  2VQE E;  4DV2 E;  3A0R A;  4K4O A;  4XIQ A;  5D7R A;  2WW4 A;  4LFB E;  1GKZ A;  4DPT A;  4KQV A;  1N32 E;  4L8Z A;  2WEP A;  4DR4 I;  2YEF A;  3T10 A;  4KP4 A;  4LF6 E;  2BZ5 A;  2NPF A;  1UY9 A;  1I94 E;  1K47 A;  1A4H A;  4E02 A;  4X62 I;  3T1H E;  4LF8 I;  2YEH A;  4LFC I;  4XIT A;  4EFT A;  1FNM A;  2BU8 A;  2O1W A;  3Q5L A;  3EHF A;  2BYH A;  4FCR A;  4AWQ A;  2AJ4 A;  2UUA I;  1XNR E;  3PYF A;  1KKH A;  3TZ5 A;  2UU9 E;  4R3M A;  1YT1 A;  2BRC A;  1TIL A;  3EKO A;  1UYL A;  3V2U C;  3D0B A;  4CWN A;  3K60 A;  2YEI A;  2ZDY A;  3R92 A;  4DR6 E;  3RLP A;  4LFA I;  1UYH A;  4BIZ A;  4LWE A;  1EI1 A;  2YKC A;  1H72 C;  4CE2 A;  1UYI A;  4L91 A;  4O04 A;  1IBL E;  1Z59 A;  4JI1 E;  5CTY A;  3ZXQ A;  2C2A A;  3B8H A;  5GMD A;  4JG4 A;  3B28 A;  4MPC A;  3O2F A;  3RLR A;  1OJ4 A;  4DV1 I;  2O1U A;  1UYD A;  2BV3 A;  1XNQ E;  2E1R A;  1OSF A;  1ZW9 A;  2CCT A;  5FNF A;  2WI2 A;  3C11 A;  3H80 A;  4MP7 A;  4BQG A;  4ED4 A;  2XDU A;  4LWH A;  5LMN E;  3B27 A;  4YKU A;  2XDK A;  3B24 A;  4H85 A;  3A0T A;  2BU7 A;  4DV7 I;  2YED A;  3BMY A;  2H55 A;  4AQY I;  2YI7 A;  4B3M E;  2XX5 A;  3ZZT A;  2YJW A;  2ESA A;  4DV0 I;  4Z7C A;  3A0Z A;  1THN A;  4ZKI A;  3WU5 A;  3J81 C;  2ZIT A;  4X66 I;  1XMO E;  1H7S A;  2Q8F A;  2XEX A;  3HYY A;  4XTJ A;  2YGE A;  1XMQ E;  4DR7 E;  1IBM E;  4HY1 A;  1TC0 A;  1UYK A;  2QG0 A;  1FI4 A;  1BXD A;  1Z0C A;  1ID0 A;  3PYG A;  3WU3 A;  4JYA I;  1AH6 A;  2CG9 A;  1R62 A;  3IED A;  1VIS A;  1N34 I;  4B3S I;  5M4N A;  2XHT A;  1B3Q A;  1FKA E;  3FT5 A;  1H73 A;  1AH8 A;  2YEB A;  4NXM I;  4LF5 E;  2HK3 A;  4MPN A;  4DZY A;  2E5L E;  2XD6 A;  4I5S A;  4DV4 E;  4DV3 I;  2FWZ A;  3J80 Q;  4YKZ A;  3J7A G;  4B3T I;  2YK9 A;  4KSG A;  2XJX A;  4HXZ A;  4UTG A;  4JI8 E;  4MYT A;  2Q8G A;  1Y4U A;  2WI5 A;  2BRE A;  3HYZ A;  1KVK A;  2IOP A;  2YI5 A;  5D7D A;  4KHP I;  2YE3 A;  2XDS A;  2XHR A;  3VAD A;  1KZN A;  1YT0 A;  4GKK I;  4O07 A;  3EHG A;  4W7T A;  3D4J A;  4DR4 E;  2YEC A;  3CRL A;  2YE8 A;  5BR8 I;  5M4M A;  4Z7Y A;  1HNZ I;  4X62 E;  3A0Y A;  5D6Q A;  2XX2 A;  2YEE A;  1Z0G A;  3J7A M;  3OWB A;  4LFC E;  4NXN I;  5J71 A;  3Q5J A;  1Y8O A;  4CE3 A;  3OW6 A;  1HNW I;  4O0B A;  4JI4 I;  3QT5 A;  3U67 A;  2XAB A;  2UUA E;  4YHH I;  4CE1 A;  2YK2 A;  2VW5 A;  2BYI A;  1KTV A;  5M4K A;  4V25 A;  4DUH A;  4LWF A;  4WUC A;  2XK2 A;  4ASF A;  2HCH A;  3T0H A;  3TUH A;  1UYE A;  4EFU A;  4MB9 A;  4LP0 A;  1TH8 A;  3R4P A;  1S16 A;  5CF0 A;  4LF4 I;  1GKX A;  3G7B A;  2V34 A;  4E00 A;  2FXS A;  2VQF I;  2VCJ A;  4JI5 E;  2F4V I;  1H7U A;  3EKR A;  5A2Q Q;  3QT8 A;  1I5A A;  1UYG A;  1MU5 A;  2WEQ A;  1DAR A;  3INW A;  1IBK E;  2HKE A;  4DV1 E;  4DV6 I;  3QT7 A;  4FW9 A;  4I3H A;  4DR1 E;  3GIG B;  4K0K I;  4DR5 E;  2CH4 A;  2Q8I A;  2HFU A;  4EGK A;  4JV5 I;  3T1Y E;  1HR0 I;  2GFD A;  2Q2E B;  5BOD A;  2J7K A;  1GJV A;  1U0Z A;  1NHH A;  1N0U A;  4AQY E;  1ZXM A;  4EMV A;  1UY8 A;  3TZ2 A;  1YSZ A;  4XD8 A;  3EHJ A;  1NHJ A;  1J5E I;  4YKQ A;  4LF9 E;  4DR3 I;  1Z0E A;  4DPY A;  1I59 A;  5IT9 Q;  3QDD A;  2HFS A;  2UWD A;  4DU8 A;  1YT2 A;  5FNC A;  3HEK A;  2VCI A;  2VWC A;  1RR9 A;  3A0X A;  4DUZ E;  4QPJ A;  1NZ0 A;  3WU6 A;  4R1F A;  3D2R A;  2FYP A;  4H81 A;  4BXI A;  2XHX A;  4L94 A;  1ZM2 A;  4B3S E;  3FV5 A;  4B6C A;  2ZM6 I;  4B3R I;  2Q8H A;  3J80 C;  3CWV A;  1ZM4 A;  4NXM E;  3B26 A;  3R4N A;  3WHA A;  1A6F A;  2XCM A;  4DV5 E;  1YC1 A;  4LWG A;  2XDX A;  1N0V C;  4DPW A;  3Q5K A;  5J6A A;  4M1K A;  3ZZ0 A;  2ZKJ A;  4EEH A;  2UUB I;  4X65 I;  1N32 I;  2WI4 A;  2UXC I;  2YEA A;  2HK2 A;  5GME A;  4KFG A;  1JM6 A;  4U7N A;  1I94 I;  4JI6 I;  2BSM A;  3QT6 A;  1WUU A;  3WQ9 A;  4YKW A;  3T1H I;  3VHA A;  4URM A;  4CWS A;  4X64 E;  1I5B A;  2JKI A;  4MP2 A;  5M4P A;  4KHP E;  2YJX A;  3DGE A;  4WUD A;  5GGZ A;  4GKK E;  2YE5 A;  4HZ0 A;  2CZ9 A;  1TID A;  3ZKD A;  3HUL A;  5M4E A;  2BU2 A;  4CWR A;  3C0E A;  3B25 A;  2E0A A;  4GFN A;  1HNZ E;  1I5D A;  2UUC I;  4GGL A;  3PEH A;  4JAU A;  1HNX I;  3SL2 A;  2HKJ A;  4EM7 A;  4ASG A;  4DR6 I;  4JI7 I;  1PKP A;  2V2V A;  3NMQ A;  1HNW E;  2X36 A;  4XCL A;  1XHK A;  2GQP A;  3K97 A;  1YER A;  4XIR A;  4P52 A;  4JI3 I;  4YHH E;  1IBL I;  4EMD A;  4JI1 I;  3A0W A;  3OPD A;  3OWD A;  5C93 A;  1ZM9 A;  1N33 I;  1B63 A;  4EGH A;  1FWL A;  1YET A;  3K17 A;  4DR2 I;  2BM1 A;  5LL6 R;  3U2D A;  1BGQ A;  2XJJ A;  3LPS A;  1QYE A;  4XDM A;  1U2O A;  1D6T A;  2R3V A;  1UYF A;  1UYM A;  5A2Q C;  4B7P A;  1H74 A;  4WUB A;  2UXB I;  4O05 A;  3JAM Q; 
#chains in the Genus database with same CATH topology
 4ASA A;  2WI6 A;  2ZBK B;  4JQL A;  5IN9 A;  2V2Q A;  5EKW A;  4N3O A;  3CRK A;  3G7E A;  4EGI A;  4CWF A;  4V26 A;  2C37 B;  3OTO I;  1UY6 A;  5CTU A;  1YC3 A;  3GLL A;  3ZKB A;  2C38 B;  4DPU A;  4UT4 A;  4LF8 E;  2IOR A;  4YKR A;  2HHH I;  1YSR A;  2YE4 A;  2YE9 A;  4NH9 A;  1YS3 A;  4K0K E;  4OO1 D;  2PO1 A;  4MPE A;  4JV5 E;  3DD6 A;  1XMO I;  4OX9 I;  4LWI A;  1HR0 E;  1MX0 A;  1UY7 A;  4NH8 A;  3RKZ A;  1FJG I;  4PRX A;  1IBM I;  2YI6 A;  2ZDX A;  2DEI A;  3G75 A;  4MU0 A;  4BA2 B;  4OO1 F;  2YE6 A;  5FND A;  1MG7 A;  3TTZ A;  1Y6Z A;  1TBW A;  2C1G A;  5CPH A;  1ZM3 A;  1YH8 A;  2XDL A;  3R91 A;  4YKX A;  5IT9 C;  4AM3 A;  1OYP A;  5FLX Q;  4XCJ A;  1J5E E;  4LFA E;  1US7 A;  4BIU A;  4HXW A;  5IWA I;  4XKA A;  5LMU I;  2GO4 A;  3PYD A;  4LF5 I;  4USM A;  1L0O A;  4DR3 E;  1Y8N A;  2AKP A;  2IWX A;  1I58 A;  1KIJ A;  2YEG A;  3GIE A;  4BAE A;  1Y4S A;  1UYC A;  3JZ3 A;  4LPB A;  2CCS A;  3M7N D;  4URO A;  5M4H A;  3KE6 A;  2O1V A;  3M6A A;  2ZM6 E;  4OO1 B;  2IOQ A;  4MU3 A;  2XJG A;  3CDJ A;  4GKJ I;  4RPF A;  4XKO A;  2WER A;  2CGE A;  3QTF A;  1QY8 A;  1Z0T A;  4FW3 A;  3CGZ A;  3OMU A;  3VHD A;  4FCP A;  4MOT A;  3R4O A;  5C0X A;  5BOC A;  3UHM A;  4DV7 E;  2YKI A;  3HHU A;  3LMM A;  3ZZU A;  4JI2 I;  3CGY A;  1NHI A;  2UXD I;  2UUB E;  4X65 E;  4IFD E;  1YC4 A;  2UXC E;  2IWU A;  4DU7 A;  1AJ6 A;  5IDM A;  4XC0 A;  4MU4 A;  3Q1Q A;  4FWD A;  2BU6 A;  3L7Z B;  4JI6 E;  3M7N G;  4YKT A;  1R6M A;  4IFD C;  4DV0 E;  2YGA A;  4GQT A;  4HYP A;  1E3H A;  1U2R A;  4X66 E;  4GEE A;  4JI0 I;  1S14 A;  4Q20 A;  2DEJ A;  2GO3 A;  4YKY A;  2LJP A;  2XX4 A;  4QNK A;  1TC6 A;  3K85 A;  4U7O A;  3U2K A;  4ZVI A;  2EXL A;  4JYA E;  2PO0 A;  2FWY A;  2GS8 A;  4DUY I;  2CCU A;  1N36 I;  4LF7 I;  1N34 E;  3NZK A;  5L3J A;  4YY3 I;  1YES A;  4U93 A;  3RLQ A;  4O09 A;  1Z5C A;  3P3E A;  4MYU A;  4MQY A;  2VQE I;  3PRY A;  4DV2 I;  1HNX E;  2UUC E;  5CTX A;  5IDJ A;  1EA6 A;  4USK A;  2A2C A;  4QPK A;  4LFB I;  4JI7 E;  3WU4 A;  3K1J A;  5JEA C;  1Y5Y A;  2JEA A;  2H8M A;  4DV3 E;  3B82 A;  2JJC A;  2WI1 A;  4AS9 A;  3O6O A;  4B3T E;  2YE7 A;  4JI3 E;  1S4E A;  4LPF A;  1ELO A;  2QF6 A;  4JI5 I;  3PS3 A;  4LF6 I;  1BYQ A;  4R3A A;  4HAC B;  1N33 E;  5F3K A;  2EFG A;  2C38 A;  4FPP A;  3K98 A;  3ZM7 A;  4DR2 E;  5F5R A;  4AWP A;  1IBK I;  4URN A;  4FMT A;  2Z5B B;  4FWH A;  4GT8 A;  3JAM C;  3T2S A;  3TZ0 A;  4NH7 A;  4DR1 I;  3S5T A;  4URL A;  4DR5 I;  5K36 C;  4GCZ A;  2CGF A;  1Z5A A;  3P3C A;  4FWG A;  3T1Y I;  4BA2 A;  2UXB E;  3PS1 A;  1XNR I;  4CWT A;  2YKE A;  2UU9 I;  5BR8 E;  4HY6 A;  1UEK A;  3R4M A;  4X9L A;  3OTO E;  2BU5 A;  4XE2 A;  1OYR A;  2BA0 D;  3H4L A;  3GCM A;  2HHH E;  4NXN E;  1ZXN A;  3BM9 A;  1HK7 A;  4P8O A;  5FWK A;  4H7Q A;  3HKM A;  2BT0 A;  1FWK A;  2K5B A;  3TZ4 A;  4LF9 I;  4BQJ A;  4DPX A;  2NN6 C;  2VF3 A;  4JI4 E;  4OX9 E;  4HYM A;  1BKN A;  5C0X C;  1FJG E;  2YE2 A;  4L90 A;  5D6P A;  3PEJ A;  5FLX C;  2BTZ A;  4IS9 A;  4XKK A;  4DUZ I;  2IWS A;  2YGF A;  1AMW A;  4L93 A;  4OKG A;  1PIE A;  3LNU A;  2HG1 A;  3GIG A;  2WNR B;  3T1K A;  2R42 A;  1Z0V A;  1USV A;  1XNQ I;  4XIP A;  5IWA E;  3HZ5 A;  4LF4 E;  5LMU E;  1OYS A;  3B4T A;  2YKJ A;  5LMN I;  3CYG A;  2J65 A;  2VQF E;  4DV5 I;  1QZR A;  2BR2 B;  2F4V E;  4PU9 A;  4KSH A;  4KTN A;  4HZ5 A;  4DXL A;  4PL9 A;  4PRV A;  4CWP A;  3MNR P;  2IER A;  3L7Z A;  4B3M I;  5CTW A;  1PVG A;  4FCQ A;  3EHH A;  4DV6 E;  2QFO A;  3M85 G;  1ZWH A;  4AWO A;  1Z0W A;  2A2D A;  1AM1 A;  1E3P A;  4GKJ E;  1RRE A;  4X64 I;  2X7I A;  3D36 A;  2BM0 A;  3PS2 A;  3GON A;  1XMQ I;  4DR7 I;  2PNR A;  4ASB A;  3V5R A;  3F0N A;  4JI2 E;  3O0I A;  4IZJ D;  3J81 Q;  5DRO A;  2UXD E;  2F1D A;  3HZ1 A;  4JAV A;  2YEJ A;  3FT8 A;  1Z5B A;  5DRQ A;  2WI7 A;  2IES A;  2V2Z A;  5D7C A;  1I5C A;  3VHC A;  4CWQ A;  3B78 A;  3GME A;  4JI0 E;  2JEB B;  2JE6 B;  4U3B A;  3PYE A;  4MBC A;  2E5L I;  2QG2 A;  3INX A;  3K99 A;  4DV4 I;  5ELW A;  1Y8P A;  2OI2 A;  3ZXO A;  1Z0B A;  4HAC A;  4E01 A;  2YKB A;  2WI3 A;  3LTO A;  4P7A A;  2YI0 A;  4FN5 A;  3GIF A;  4JAS A;  3Q6N A;  4DUY E;  1N36 E;  2Z5B A;  4LF7 E;  4YY3 E;  3T0Z A;  2V8P A;  4B3R E;  4CWO A;  1B62 A;  4JI8 I;  2VQE E;  4DV2 E;  3A0R A;  4K4O A;  4XIQ A;  5D7R A;  2WW4 A;  4LFB E;  2PO2 A;  1GKZ A;  4DPT A;  4KQV A;  4IZJ B;  1N32 E;  4L8Z A;  2WEP A;  4DR4 I;  2YEF A;  5JEA D;  4OO1 E;  3T10 A;  4AIM A;  4KP4 A;  4LF6 E;  2BZ5 A;  2NPF A;  1UY9 A;  1I94 E;  1K47 A;  1A4H A;  4E02 A;  3P06 A;  4X62 I;  2WP8 B;  3T1H E;  2C1I A;  5JEA F;  4LF8 I;  2YEH A;  4LFC I;  3KRN A;  2PNZ B;  4XIT A;  4IFD B;  4U3D A;  4EFT A;  1FNM A;  3U1K A;  2O1W A;  2BU8 A;  3Q5L A;  3EHF A;  2BYH A;  4FCR A;  4AWQ A;  2AJ4 A;  2UUA I;  1XNR E;  3PYF A;  1KKH A;  3TZ5 A;  2UU9 E;  4R3M A;  5K36 D;  1YT1 A;  2BRC A;  1TIL A;  3EKO A;  1UYL A;  3V2U C;  4MDT A;  3D0B A;  4CWN A;  3K60 A;  2YEI A;  2ZDY A;  3R92 A;  5K36 F;  4DR6 E;  1UDS A;  3RLP A;  4LFA I;  1UYH A;  4BIZ A;  4LWE A;  1EI1 A;  2YKC A;  1H72 C;  4CE2 A;  1UYI A;  2PO1 B;  4L91 A;  4O04 A;  2C37 A;  5JEA B;  1Z59 A;  1IBL E;  4JI1 E;  5CTY A;  3ZXQ A;  2C2A A;  2NN6 D;  3B8H A;  5GMD A;  4JG4 A;  3B28 A;  5C0X D;  4MPC A;  3O2F A;  3RLR A;  1OJ4 A;  4DV1 I;  2Z5E A;  4FW6 A;  2O1U A;  1UYD A;  2BV3 A;  4AID A;  1XNQ E;  2E1R A;  1OSF A;  2NN6 F;  1ZW9 A;  2CCT A;  5FNF A;  2WI2 A;  3C11 A;  3H80 A;  4MP7 A;  4BQG A;  4ED4 A;  2XDU A;  4LWH A;  5LMN E;  3B27 A;  4YKU A;  5DNL A;  2XDK A;  3B24 A;  4H85 A;  3A0T A;  2BU7 A;  4DV7 I;  5K36 B;  2YED A;  3BMY A;  4J3D A;  2H55 A;  4AQY I;  2YI7 A;  4B3M E;  2XX5 A;  3ZZT A;  2YJW A;  2ESA A;  2JEB A;  4DV0 I;  4Z7C A;  3A0Z A;  1THN A;  4ZKI A;  3WU5 A;  3J81 C;  2ZIT A;  4X66 I;  1XMO E;  1H7S A;  4IZK B;  2Q8F A;  2XEX A;  3HYY A;  4XTJ A;  2YGE A;  1XMQ E;  4DR7 E;  1IBM E;  4HY1 A;  1TC0 A;  1UDQ A;  1UYK A;  2QG0 A;  5DNX A;  1FI4 A;  4BA1 B;  2NN6 B;  1BXD A;  1Z0C A;  5C0X B;  1ID0 A;  3PYG A;  2O3Z A;  1XXE A;  3WU3 A;  4JYA I;  1AH6 A;  3HJC A;  4OO1 A;  2CG9 A;  1R62 A;  3IED A;  1VIS A;  1N34 I;  2BA0 G;  4B3S I;  5M4N A;  2FTK A;  2XHT A;  1B3Q A;  1FKA E;  3FT5 A;  1H73 A;  4FW4 A;  3P76 A;  1AH8 A;  4NXM I;  2YEB A;  3P3G A;  2HK3 A;  4LF5 E;  4MPN A;  4DZY A;  4IZJ A;  2E5L E;  2XD6 A;  4I5S A;  4DV4 E;  4DV3 I;  4OZE A;  2FWZ A;  3J80 Q;  2PNL A;  4YKZ A;  3J7A G;  4B3T I;  2YK9 A;  4KSG A;  2BA1 D;  2XJX A;  2WP8 A;  1IXM A;  4HXZ A;  1R6L A;  4UTG A;  2PNZ A;  4MYT A;  4JI8 E;  2Q8G A;  1Y4U A;  2WI5 A;  2BRE A;  3HYZ A;  1KVK A;  2IOP A;  2YI5 A;  5D7D A;  4KHP I;  1UDN A;  2YE3 A;  2XDS A;  2XHR A;  1P42 A;  3VAD A;  1KZN A;  1YT0 A;  4GKK I;  4O07 A;  2JEA B;  3EHG A;  4W7T A;  3D4J A;  4LCH A;  4DR4 E;  2YEC A;  3CRL A;  2YE8 A;  5BR8 I;  5M4M A;  2BA1 G;  4Z7Y A;  1HNZ I;  4X62 E;  3A0Y A;  5D6Q A;  2XX2 A;  4EEH A;  2YEE A;  1Z0G A;  4FW5 A;  3J7A M;  3OWB A;  4LFC E;  4NXN I;  5J71 A;  3Q5J A;  4IFD D;  1Y8O A;  4CE3 A;  3OW6 A;  1HNW I;  4O0B A;  5JEA A;  2HHI A;  2O1T A;  4JI4 I;  3QT5 A;  3U67 A;  2XAB A;  2UUA E;  4LCG A;  4YHH I;  4CE1 A;  3CDI A;  2YK2 A;  4IFD F;  2VW5 A;  4LCF A;  2BYI A;  1Y60 A;  1KTV A;  5M4K A;  4V25 A;  2C39 B;  4DUH A;  4LWF A;  5JEN A;  3H1C A;  4WUC A;  2XK2 A;  4ASF A;  5DRR A;  2HCH A;  3T0H A;  1UYE A;  4EFU A;  4MB9 A;  3TUH A;  4LP0 A;  2JT2 A;  1TH8 A;  3R4P A;  1S16 A;  2Z5C B;  5CF0 A;  4LF4 I;  1GKX A;  3G7B A;  2V34 A;  5K36 A;  4E00 A;  2FXS A;  4E72 A;  2VQF I;  2VCJ A;  4JI5 E;  2F4V I;  1H7U A;  3EKR A;  5A2Q Q;  3QT8 A;  1I5A A;  1UYG A;  1MU5 A;  2WEQ A;  1DAR A;  4OO1 C;  1IBK E;  3INW A;  2HKE A;  4DV1 E;  4DV6 I;  3QT7 A;  4FW9 A;  4I3H A;  2VES A;  4DR1 E;  4IZK A;  3GIG B;  4K0K I;  4GQU A;  4DR5 E;  2CH4 A;  2Q8I A;  2HFU A;  4EGK A;  4JV5 I;  3T1Y E;  1HR0 I;  2GFD A;  4BA1 A;  2NN6 A;  2Q2E B;  5BOD A;  2J7K A;  1GJV A;  1U0Z A;  1NHH A;  1N0U A;  2PNM A;  2WNR A;  1RHY A;  2CVE A;  4AQY E;  1ZXM A;  4EMV A;  1UY8 A;  3TZ2 A;  1YHC A;  1YSZ A;  4XD8 A;  3EHJ A;  1NHJ A;  1J5E I;  4YKQ A;  4LF9 E;  2BR2 A;  1VI7 A;  4DR3 I;  1Z0E A;  4DPY A;  1I59 A;  2GQ0 A;  5IT9 Q;  2HFS A;  2UWD A;  4DU8 A;  1YT2 A;  3QDD A;  5FNC A;  3HEK A;  2VCI A;  2VWC A;  1RR9 A;  3A0X A;  4DUZ E;  4QPJ A;  1NZ0 A;  3WU6 A;  1UDO A;  4R1F A;  3D2R A;  5DRP A;  2FYP A;  4H81 A;  4BXI A;  2XHX A;  4L94 A;  4QNJ A;  1ZM2 A;  4B3S E;  3FV5 A;  4B6C A;  2ZM6 I;  4B3R I;  5JEA E;  2Q8H A;  3J80 C;  5C0X F;  3CWV A;  1ZM4 A;  4NXM E;  3B26 A;  3R4N A;  3WHA A;  1A6F A;  4NBQ A;  4FW7 A;  2XCM A;  4DV5 E;  1YC1 A;  4ISA A;  4LWG A;  2XDX A;  1N0V C;  4DPW A;  3Q5K A;  5J6A A;  4M1K A;  3ZZ0 A;  3Q6M A;  2ZKJ A;  2UUB I;  4X65 I;  2AE8 A;  1N32 I;  2UXC I;  2WI4 A;  2HK2 A;  2YEA A;  5GME A;  4KFG A;  1JM6 A;  4U7N A;  1I94 I;  4JI6 I;  2BSM A;  3QT6 A;  1WUU A;  2JE6 A;  3WQ9 A;  4YKW A;  3T1H I;  3VHA A;  5K36 E;  4URM A;  4CWS A;  4X64 E;  1I5B A;  2JKI A;  4MP2 A;  5M4P A;  4KHP E;  2YJX A;  3DGE A;  1USU A;  4WUD A;  5GGZ A;  4GKK E;  2PO2 B;  2YE5 A;  4HZ0 A;  2CZ9 A;  1TID A;  3ZKD A;  3HUL A;  5M4E A;  2BU2 A;  4CWR A;  3C0E A;  3B25 A;  2C39 A;  2E0A A;  4GFN A;  1HNZ E;  1I5D A;  2UUC I;  4GGL A;  3PEH A;  4JAU A;  1HNX I;  3SL2 A;  2HKJ A;  4EM7 A;  2NN6 E;  2Z5C A;  4ASG A;  4DR6 I;  4JI7 I;  5C0X E;  1PKP A;  2V2V A;  3NMQ A;  1HNW E;  2X36 A;  4XCL A;  1XHK A;  2GQP A;  3K97 A;  1YER A;  4XIR A;  4P52 A;  4JI3 I;  4YHH E;  1IBL I;  4EMD A;  4JI1 I;  3A0W A;  3OPD A;  3OWD A;  5C93 A;  1ZM9 A;  1N33 I;  1B63 A;  4MU1 A;  1FWL A;  4EGH A;  4LOM A;  3K17 A;  1YET A;  4DR2 I;  2BM1 A;  5LL6 R;  2PO0 B;  3U2D A;  1BGQ A;  3M85 D;  4IFD A;  2XJJ A;  3LPS A;  1QYE A;  5EL9 A;  4XDM A;  1U2O A;  1D6T A;  2R3V A;  1UYF A;  3U1Y A;  1UYM A;  5A2Q C;  4B7P A;  1H74 A;  4WUB A;  1F51 A;  2UXB I;  4O05 A;  3JAM Q; 
#chains in the Genus database with same CATH homology
 4ASA A;  2WI6 A;  2ZBK B;  4JQL A;  5IN9 A;  2V2Q A;  4N3O A;  3CRK A;  3G7E A;  4EGI A;  4CWF A;  4V26 A;  3OTO I;  1UY6 A;  5CTU A;  1YC3 A;  3ZKB A;  4UT4 A;  4DPU A;  2IOR A;  4LF8 E;  4YKR A;  2HHH I;  1YSR A;  2YE4 A;  2YE9 A;  4NH9 A;  1YS3 A;  4K0K E;  4MPE A;  4JV5 E;  1XMO I;  4OX9 I;  4LWI A;  1HR0 E;  1MX0 A;  1UY7 A;  4NH8 A;  3RKZ A;  1FJG I;  4PRX A;  1IBM I;  2YI6 A;  2ZDX A;  2DEI A;  3G75 A;  2YE6 A;  5FND A;  3TTZ A;  1MG7 A;  1Y6Z A;  1TBW A;  5CPH A;  1ZM3 A;  2XDL A;  3R91 A;  4YKX A;  5IT9 C;  5FLX Q;  4XCJ A;  1J5E E;  4LFA E;  1US7 A;  4BIU A;  4HXW A;  5IWA I;  4XKA A;  5LMU I;  3PYD A;  4LF5 I;  4USM A;  1L0O A;  4DR3 E;  1Y8N A;  2AKP A;  2IWX A;  1I58 A;  1KIJ A;  2YEG A;  3GIE A;  4BAE A;  1Y4S A;  1UYC A;  3JZ3 A;  4LPB A;  2CCS A;  4URO A;  5M4H A;  3KE6 A;  2O1V A;  3M6A A;  2ZM6 E;  2IOQ A;  2XJG A;  4GKJ I;  4RPF A;  4XKO A;  2WER A;  2CGE A;  3QTF A;  1QY8 A;  1Z0T A;  3CGZ A;  3OMU A;  3VHD A;  4FCP A;  4MOT A;  3R4O A;  5BOC A;  4DV7 E;  2YKI A;  3HHU A;  3ZZU A;  4JI2 I;  3CGY A;  1NHI A;  2UXD I;  2UUB E;  4X65 E;  1YC4 A;  2IWU A;  2UXC E;  4DU7 A;  1AJ6 A;  5IDM A;  4XC0 A;  3Q1Q A;  4FWD A;  2BU6 A;  4JI6 E;  4YKT A;  4DV0 E;  2YGA A;  4GQT A;  4HYP A;  1U2R A;  4X66 E;  4GEE A;  4JI0 I;  1S14 A;  4Q20 A;  2DEJ A;  4YKY A;  2LJP A;  2XX4 A;  4U7O A;  1TC6 A;  3K85 A;  3U2K A;  4ZVI A;  2EXL A;  4JYA E;  2FWY A;  2GS8 A;  4DUY I;  2CCU A;  1N36 I;  4LF7 I;  1N34 E;  4YY3 I;  5L3J A;  1YES A;  4U93 A;  3RLQ A;  4O09 A;  1Z5C A;  4MYU A;  2VQE I;  4DV2 I;  2UUC E;  3PRY A;  1HNX E;  5CTX A;  5IDJ A;  1EA6 A;  4USK A;  2A2C A;  4QPK A;  4LFB I;  4JI7 E;  3WU4 A;  3K1J A;  2H8M A;  4DV3 E;  3B82 A;  2JJC A;  2WI1 A;  4AS9 A;  3O6O A;  4B3T E;  2YE7 A;  4JI3 E;  1S4E A;  2QF6 A;  1ELO A;  4JI5 I;  4R3A A;  4LF6 I;  1BYQ A;  5F3K A;  4HAC B;  1N33 E;  2EFG A;  4FPP A;  3K98 A;  3ZM7 A;  4DR2 E;  5F5R A;  4AWP A;  1IBK I;  4URN A;  4FMT A;  2Z5B B;  4FWH A;  4GT8 A;  3JAM C;  3T2S A;  3TZ0 A;  4NH7 A;  4DR1 I;  4URL A;  4DR5 I;  4GCZ A;  2CGF A;  1Z5A A;  4FWG A;  3T1Y I;  2UXB E;  1XNR I;  4CWT A;  2YKE A;  2UU9 I;  5BR8 E;  4HY6 A;  1UEK A;  3R4M A;  4X9L A;  3OTO E;  2BU5 A;  4XE2 A;  3H4L A;  2HHH E;  3BM9 A;  4NXN E;  1ZXN A;  4P8O A;  1HK7 A;  5FWK A;  4H7Q A;  2BT0 A;  2K5B A;  1FWK A;  3TZ4 A;  4LF9 I;  4BQJ A;  4DPX A;  2VF3 A;  4JI4 E;  4OX9 E;  4HYM A;  1BKN A;  1FJG E;  2YE2 A;  4L90 A;  5D6P A;  3PEJ A;  5FLX C;  2BTZ A;  4XKK A;  4DUZ I;  2IWS A;  2YGF A;  1AMW A;  4L93 A;  1PIE A;  3LNU A;  2HG1 A;  3GIG A;  3T1K A;  2R42 A;  1Z0V A;  1USV A;  1XNQ I;  4XIP A;  5IWA E;  3HZ5 A;  4LF4 E;  5LMU E;  2YKJ A;  5LMN I;  2VQF E;  4DV5 I;  1QZR A;  2F4V E;  4PU9 A;  4KSH A;  4KTN A;  4HZ5 A;  4DXL A;  4PL9 A;  4PRV A;  4CWP A;  3MNR P;  4B3M I;  5CTW A;  1PVG A;  4FCQ A;  3EHH A;  4DV6 E;  2QFO A;  1ZWH A;  4AWO A;  1Z0W A;  2A2D A;  1AM1 A;  4GKJ E;  1RRE A;  4X64 I;  2X7I A;  3D36 A;  2BM0 A;  3GON A;  1XMQ I;  4DR7 I;  2PNR A;  4ASB A;  3V5R A;  3F0N A;  4JI2 E;  3O0I A;  4IZJ D;  3J81 Q;  2UXD E;  3HZ1 A;  4JAV A;  2YEJ A;  3FT8 A;  1Z5B A;  2WI7 A;  2V2Z A;  5D7C A;  1I5C A;  3VHC A;  4CWQ A;  3B78 A;  4JI0 E;  3PYE A;  4MBC A;  2E5L I;  2QG2 A;  3INX A;  3K99 A;  4DV4 I;  1Y8P A;  3ZXO A;  2OI2 A;  1Z0B A;  4HAC A;  4E01 A;  2YKB A;  2WI3 A;  3LTO A;  4P7A A;  2YI0 A;  4FN5 A;  3GIF A;  4JAS A;  3Q6N A;  4DUY E;  1N36 E;  2Z5B A;  4LF7 E;  4YY3 E;  3T0Z A;  2V8P A;  4B3R E;  4CWO A;  1B62 A;  4JI8 I;  2VQE E;  4DV2 E;  3A0R A;  4K4O A;  4XIQ A;  5D7R A;  2WW4 A;  4LFB E;  1GKZ A;  4DPT A;  4KQV A;  4IZJ B;  1N32 E;  4L8Z A;  2WEP A;  4DR4 I;  2YEF A;  3T10 A;  4KP4 A;  4LF6 E;  2BZ5 A;  2NPF A;  1UY9 A;  1I94 E;  1K47 A;  1A4H A;  4E02 A;  3P06 A;  4X62 I;  3T1H E;  4LF8 I;  2YEH A;  4LFC I;  4XIT A;  4EFT A;  1FNM A;  2O1W A;  2BU8 A;  3Q5L A;  3EHF A;  2BYH A;  4FCR A;  4AWQ A;  2AJ4 A;  2UUA I;  1XNR E;  3PYF A;  1KKH A;  3TZ5 A;  2UU9 E;  4R3M A;  1YT1 A;  2BRC A;  1TIL A;  3EKO A;  1UYL A;  3V2U C;  3D0B A;  4CWN A;  3K60 A;  2YEI A;  2ZDY A;  3R92 A;  4DR6 E;  3RLP A;  4LFA I;  1UYH A;  4BIZ A;  4LWE A;  1EI1 A;  2YKC A;  1H72 C;  4CE2 A;  1UYI A;  4L91 A;  4O04 A;  1IBL E;  1Z59 A;  4JI1 E;  5CTY A;  3ZXQ A;  2C2A A;  3B8H A;  5GMD A;  4JG4 A;  3B28 A;  4MPC A;  3O2F A;  3RLR A;  1OJ4 A;  4DV1 I;  2Z5E A;  2O1U A;  1UYD A;  2BV3 A;  1XNQ E;  2E1R A;  1OSF A;  1ZW9 A;  2CCT A;  5FNF A;  2WI2 A;  3C11 A;  3H80 A;  4MP7 A;  4BQG A;  4ED4 A;  2XDU A;  4LWH A;  5LMN E;  3B27 A;  4YKU A;  2XDK A;  3B24 A;  4H85 A;  3A0T A;  2BU7 A;  4DV7 I;  2YED A;  3BMY A;  2H55 A;  4AQY I;  2YI7 A;  4B3M E;  2XX5 A;  3ZZT A;  2YJW A;  2ESA A;  4DV0 I;  4Z7C A;  3A0Z A;  1THN A;  4ZKI A;  3WU5 A;  3J81 C;  2ZIT A;  4X66 I;  1XMO E;  1H7S A;  4IZK B;  2Q8F A;  2XEX A;  3HYY A;  4XTJ A;  2YGE A;  1XMQ E;  4DR7 E;  1IBM E;  4HY1 A;  1TC0 A;  1UYK A;  2QG0 A;  1FI4 A;  1BXD A;  1Z0C A;  1ID0 A;  3PYG A;  3WU3 A;  4JYA I;  1AH6 A;  3HJC A;  2CG9 A;  1R62 A;  3IED A;  1VIS A;  1N34 I;  4B3S I;  5M4N A;  2XHT A;  1B3Q A;  1FKA E;  3FT5 A;  1H73 A;  1AH8 A;  2YEB A;  4NXM I;  4LF5 E;  2HK3 A;  4MPN A;  4DZY A;  4IZJ A;  2E5L E;  2XD6 A;  4I5S A;  4DV4 E;  4DV3 I;  2FWZ A;  3J80 Q;  2PNL A;  4YKZ A;  3J7A G;  4B3T I;  2YK9 A;  4KSG A;  2XJX A;  4HXZ A;  4UTG A;  4JI8 E;  4MYT A;  2Q8G A;  1Y4U A;  2WI5 A;  2BRE A;  3HYZ A;  1KVK A;  2IOP A;  2YI5 A;  5D7D A;  4KHP I;  2YE3 A;  2XDS A;  2XHR A;  3VAD A;  1KZN A;  1YT0 A;  4GKK I;  4O07 A;  3EHG A;  4W7T A;  3D4J A;  4DR4 E;  2YEC A;  3CRL A;  2YE8 A;  5BR8 I;  5M4M A;  4Z7Y A;  1HNZ I;  4X62 E;  3A0Y A;  5D6Q A;  2XX2 A;  2YEE A;  1Z0G A;  3J7A M;  3OWB A;  4LFC E;  4NXN I;  5J71 A;  3Q5J A;  1Y8O A;  4CE3 A;  3OW6 A;  1HNW I;  4O0B A;  2O1T A;  4JI4 I;  3QT5 A;  3U67 A;  2XAB A;  2UUA E;  4YHH I;  4CE1 A;  2YK2 A;  2VW5 A;  2BYI A;  1KTV A;  5M4K A;  4V25 A;  4DUH A;  4LWF A;  4WUC A;  2XK2 A;  4ASF A;  2HCH A;  3T0H A;  3TUH A;  1UYE A;  4EFU A;  4MB9 A;  4LP0 A;  1TH8 A;  3R4P A;  1S16 A;  2Z5C B;  5CF0 A;  4LF4 I;  1GKX A;  3G7B A;  2V34 A;  4E00 A;  2FXS A;  2VQF I;  2VCJ A;  4JI5 E;  2F4V I;  1H7U A;  3EKR A;  5A2Q Q;  3QT8 A;  1I5A A;  1UYG A;  1MU5 A;  2WEQ A;  1DAR A;  3INW A;  1IBK E;  2HKE A;  4DV1 E;  4DV6 I;  3QT7 A;  4FW9 A;  4I3H A;  4DR1 E;  4IZK A;  3GIG B;  4K0K I;  4DR5 E;  2CH4 A;  2Q8I A;  2HFU A;  4EGK A;  4JV5 I;  3T1Y E;  1HR0 I;  2GFD A;  2Q2E B;  5BOD A;  2J7K A;  1GJV A;  1U0Z A;  1NHH A;  1N0U A;  2PNM A;  4AQY E;  1ZXM A;  4EMV A;  1UY8 A;  3TZ2 A;  1YSZ A;  4XD8 A;  3EHJ A;  1NHJ A;  1J5E I;  4YKQ A;  4LF9 E;  4DR3 I;  1Z0E A;  4DPY A;  1I59 A;  2GQ0 A;  5IT9 Q;  2HFS A;  2UWD A;  4DU8 A;  1YT2 A;  3QDD A;  5FNC A;  3HEK A;  2VCI A;  2VWC A;  1RR9 A;  3A0X A;  4DUZ E;  4QPJ A;  1NZ0 A;  3WU6 A;  4R1F A;  3D2R A;  2FYP A;  4H81 A;  4BXI A;  2XHX A;  4L94 A;  1ZM2 A;  4B3S E;  3FV5 A;  4B6C A;  2ZM6 I;  4B3R I;  2Q8H A;  3J80 C;  3CWV A;  1ZM4 A;  4NXM E;  3B26 A;  3R4N A;  3WHA A;  1A6F A;  2XCM A;  4DV5 E;  1YC1 A;  4LWG A;  2XDX A;  1N0V C;  4DPW A;  3Q5K A;  5J6A A;  4M1K A;  3ZZ0 A;  3Q6M A;  2ZKJ A;  2UUB I;  4X65 I;  1N32 I;  2WI4 A;  2UXC I;  2YEA A;  2HK2 A;  4EEH A;  5GME A;  4KFG A;  1JM6 A;  4U7N A;  1I94 I;  4JI6 I;  2BSM A;  3QT6 A;  1WUU A;  3WQ9 A;  4YKW A;  3T1H I;  3VHA A;  4URM A;  4CWS A;  4X64 E;  1I5B A;  2JKI A;  4MP2 A;  5M4P A;  4KHP E;  2YJX A;  3DGE A;  1USU A;  4WUD A;  5GGZ A;  4GKK E;  2YE5 A;  4HZ0 A;  2CZ9 A;  1TID A;  3ZKD A;  3HUL A;  5M4E A;  2BU2 A;  4CWR A;  3C0E A;  3B25 A;  2E0A A;  4GFN A;  1HNZ E;  1I5D A;  2UUC I;  4GGL A;  3PEH A;  4JAU A;  1HNX I;  3SL2 A;  2HKJ A;  4EM7 A;  2Z5C A;  4ASG A;  4DR6 I;  4JI7 I;  1PKP A;  2V2V A;  3NMQ A;  1HNW E;  2X36 A;  4XCL A;  1XHK A;  2GQP A;  3K97 A;  1YER A;  4XIR A;  4P52 A;  4JI3 I;  4YHH E;  1IBL I;  4EMD A;  4JI1 I;  3A0W A;  3OPD A;  3OWD A;  5C93 A;  1ZM9 A;  1N33 I;  1B63 A;  4EGH A;  1FWL A;  1YET A;  3K17 A;  4DR2 I;  2BM1 A;  5LL6 R;  3U2D A;  1BGQ A;  2XJJ A;  3LPS A;  1QYE A;  4XDM A;  1U2O A;  1D6T A;  2R3V A;  1UYF A;  1UYM A;  5A2Q C;  4B7P A;  1H74 A;  4WUB A;  2UXB I;  4O05 A;  3JAM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...