1S16A

Crystal structure of e. coli topoisomerase iv pare 43kda subunit complexed with adpnp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
380
Chain Sequence
TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Escherichia coli topoisomerase IV ParE subunit (24 and 43 kilodaltons): a single residue dictates differences in novobiocin potency against topoisomerase IV and DNA gyrase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Topoisomerase IV subunit B
total genus 114
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 5.99.1.-:
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00204 DNA_gyraseB DNA gyrase B
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1s16A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1s16A01
5LL6R 4QPJA 5D7DA 2OI2A 1YC3A 3QDDA 4LF5E 1Z0WA 2IOPA 5D6PA 2YEHA 4XDMA 1IBLI 2WEQA 3FV5A 2CH4A 2VWCA 4YY3E 2XX4A 4LFCE 4JYAE 4DR6I 1HR0I 3B24A 2YGEA 1US7A 1UYKA 4HYMA 2FYPA 2H8MA 3T0ZA 3T1HE 3GONA 5D7CA 2V8PA 4HXWA 2UXBI 1TH8A 1AM1A 1U0ZA 2HK2A 2VF3A 3WU6A 2GFDA 4V25A 4JI7I 4DV3I 2R3VA 1IBKE 4GKJE 1XNRE 4O09A 2YKCA 5CTXA 4MYTA 3T10A 5IWAI 4O04A 1YSZA 3R4MA 4JAUA 4XKKA 4GEEA 3WHAA 1GKXA 1UYDA 4EEHA 1YSRA 5M4EA 1I5AA 4X9LA 5IT9C 2XJXA 4GCZA 4HZ0A 5LMUI 4CWNA 2EXLA 2UUCI 2YEGA 4X62I 4KP4A 5IN9A 4DR2E 3LPSA 2BZ5A 3HULA 3M6AA 3PYFA 3D36A 3EHFA 3H80A 3OMUA 2R42A 2VQFI 3D0BA 2ZM6I 2E1RA 1N36E 1TIDA 3RLPA 4LWEA 2BRCA 3ZXQA 5GMEA 3EHJA 2XK2A 4XKOA 4KHPE 4NH7A 5J6AA 4JAVA 1AH6A 3ZZ0A 4MOTA 4LWIA 2YJXA 2IWUA 1S4EA 3WU3A 3R92A 4B3MI 3D2RA 2X36A 3ZM7A 4JI4I 3INXA 3TZ4A 2IWXA 4CWQA 1FKAE 4NH8A 3J81Q 3B25A 4Z7CA 3A0XA 4LFBI 3A0WA 3INWA 1XMOE 3D4JA 1I94E 3ZZUA 3IEDA 3ZKBA 1PKPA 4M1KA 1IBLE 2AKPA 3TUHA 4LFAI 4PRXA 4URMA 4MP7A 2QG2A 3BMYA 4DV4E 4O05A 2GS8A 2DEJA 4AWOA 2YE8A 4FCRA 2VQEE 1ZXMA 3DGEA 3Q5LA 1S14A 3SL2A 2V2QA 1UY7A 4CWSA 4DV0E 3PYEA 1FJGE 4GKKE 4H81A 4R3MA 1ZM9A 4CWRA 1PIEA 3V5RA 1NHIA 1ZWHA 1IBMI 1B63A 4FWHA 1Y4UA 3K1JA 2CZ9A 2IORA 4P52A 4DPTA 3JZ3A 4E00A 2HCHA 1HNZE 1GKZA 2YEJA 3R4OA 4CWTA 3T1YI 2ESAA 4B3SE 4GQTA 2ZDYA 4B7PA 2WI6A 2E0AA 4PL9A 4DV5I 3G7EA 5BR8I 1Y8NA 4GFNA 1I5DA 3WU4A 4LFAE 3CGZA 2VQFE 1YT0A 3Q5KA 5CTYA 4BQGA 1U2RA 1BYQA 2YE6A 1A6FA 1UEKA 3R4NA 4X62E 2UXBE 3MNRP 2UUBE 1U2OA 1N34I 4H7QA 2ZDXA 4DV7I 4E01A 1BKNA 3OTOI 4YKXA 1H72C 1N34E 4HYPA 1FJGI 4XITA 4I5SA 4K0KI 3GIGA 1XNQE 4B3RI 4KHPI 2A2CA 1KZNA 2YEBA 4ZVIA 4KQVA 5FLXC 4GGLA 2HHHE 4MYUA 4CE2A 4DV2I 2UXDI 2UXCE 4GT8A 5FWKA 4DU8A 2CCSA 2YE2A 4AQYI 4DV7E 3RLRA 3T2SA 1HNWE 5M4KA 2UU9E 4CE3A 3WU5A 4LFCI 2FXSA 3J7AG 1ID0A 4XE2A 4BIZA 2XHRA 2E5LI 2YEEA 1VISA 2O1UA 2YK2A 2Q2EB 4LPBA 1ZXNA 5GMDA 1A4HA 4MB9A 4DUZI 4DR4I 4JI6E 5CTUA 4FW9A 2JJCA 1WUUA 4JQLA 5LMNI 3B82A 3A0ZA 4OX9E 4DR3I 1ZM2A 4P7AA 2XDKA 2YKEA 2UUBI 1IBME 1KIJA 5F5RA 2Q8FA 4BAEA 2BT0A 4XCLA 1ZM3A 2XABA 1N32E 4L90A 2WI1A 1KTVA 3RLQA 5C93A 1J5EE 2HFUA 3PYDA 2GQPA 4URNA 2YE9A 2YKIA 4LF7E 4LF6I 1UYMA 3FT5A 3VHCA 4CWPA 1DARA 3FT8A 2HFSA 1MG7A 3TZ5A 2ZITA 4DR7E 1S16A 4B3TI 4XCJA 1B3QA 4KFGA 4K0KE 2BSMA 1GJVA 1THNA 2UUCE 1Z5AA 4HXZA 1EI1A 1MU5A 4WUDA 3OW6A 4XTJA 3CRLA 2Q8IA 2XCMA 2BU8A 4JG4A 3B8HA 1TILA 4DV6I 3OPDA 2XHTA 1IBKI 4UROA 1KKHA 4DV1E 1D6TA 3G75A 1FWLA 3J80Q 4DUYI 1FI4A 1AMWA 1I58A 5GGZA 3B27A 4JI2I 4UT4A 1H7UA 3HZ1A 3J81C 1XMQE 4GKJI 2BYIA 5M4HA 5BOCA 4YKQA 2YI6A 4DV0I 1XHKA 1XMOI 2Q8GA 4YY3I 1Z0VA 4DUZE 2V34A 2NPFA 3A0TA 2XDLA 4XIQA 4JI5E 4JI3I 4CWFA 2FWZA 5IDJA 4JI4E 2ZM6E 3K98A 5LMNE 5A2QQ 3R91A 2IOQA 4DXLA 2H55A 4WUBA 4DPYA 1BXDA 4DPUA 4KTNA 2AJ4A 4DV3E 3K97A 3QT6A 1QY8A 4JV5E 4CE1A 4FCPA 2YE3A 3Q5JA 4EGHA 2YKJA 5BODA 3T1HI 5M4PA 2HHHI 5IT9Q 3ZZTA 4NH9A 3V2UC 3B78A 1TC0A 4FN5A 2YEIA 4AWPA 1Z59A 4MPCA 3J80C 4JI7E 1Z5CA 1I59A 3HEKA 4JI2E 4B3TE 2BU2A 2YI0A 4P8OA 4BIUA 4DUHA 4X65E 4LWFA 1QYEA 1N33I 2V2ZA 1OJ4A 2BU5A 3K60A 4LF7I 1Z0BA 4DR5I 4YKYA 3ZXOA 2BU7A 3O0IA 3BM9A 1Z0TA 2VCIA 3ZKDA 5A2QC 1UYCA 3T1KA 4EM7A 2YE4A 3O6OA 3K99A 2UXCI 3QT5A 4X66I 2YE7A 5CTWA 2IWSA 1H7SA 2WI5A 1YESA 4L94A 1L0OA 4Q20A 4X66E 5FNFA 1EA6A 4LF4E 4DR1I 1UY6A 2BREA 4LWHA 4YKTA 4YKRA 1RREA 2ZBKB 4DV4I 4PU9A 4OX9I 2UWDA 4FWGA 5FLXQ 3LNUA 4NXME 3Q1QA 4AWQA 1QZRA 4DR6E 1NHHA 4R3AA 3TTZA 2CCTA 2LJPA 4ASGA 3U67A 2YGFA 3EKOA 2WERA 2XEXA 2VQEI 4JI3E 5L3JA 2XHXA 4DUYE 3J7AM 3KE6A 4KSHA 4XC0A 5M4NA 4JYAI 4MBCA 3HZ5A 3T0HA 4U93A 1HNZI 3QT8A 4DR5E 1UYGA 1KVKA 4JI8E 4JI0E 2BYHA 2YECA 1JM6A 2K5BA 2BM0A 1ELOA 3EKRA 2UXDE 4EMVA 2YEAA 1TC6A 4AS9A 4U7NA 4EMDA 3LTOA 4HACB 4JI0I 4ASBA 4E02A 4EGKA 3CWVA 4LF9E 3R4PA 1Y8PA 3PYGA 2WW4A 1Y4SA 4JI1I 1XMQI 1YC1A 2A2DA 3HYZA 4HY6A 4NXMI 4W7TA 2HG1A 1N36I 4YKZA 4LF5I 4JI8I 1ZW9A 4R1FA 4DV5E 1N33E 2XDSA 4JI5I 4DZYA 4ZKIA 4I3HA 4X64E 5F3KA 2EFGA 4DPWA 2UU9I 1UYEA 1HNXE 2YE5A 1B62A 3OWDA 2YJWA 4USMA 4DV2E 2ZKJA 4DR2I 1R62A 1UY8A 1UY9A 4FMTA 3TZ2A 1XNRI 4DR7I 1HNWI 2HKJA 4URLA 2QFOA 2BM1A 1UYHA 2WI2A 2WI7A 1K47A 4XIRA 4FPPA 4ASAA 3NMQA 4DR1E 4JV5I 3B28A 1HNXI 2J7KA 4XIPA 3VHDA 4O07A 4L91A 1XNQI 4B3RE 4YKWA 1N32I 3F0NA 3GIGB 3U2DA 3B26A 3OWBA 2VW5A 5D6QA 1AH8A 1UYIA 1UYLA 3C11A 4HZ5A 4YHHE 2Q8HA 2CG9A 4V26A 3G7BA 4HY1A 4H85A 1MX0A 4K4OA 5FNDA 4L93A 3GIEA 3H4LA 2YEDA 1Z0CA 4MPEA 2XD6A 3U2KA 4DPXA 3T1YE 5M4MA 2BU6A 3C0EA 2WEPA 3CRKA 4JI6I 4HACA 2YI7A 2YKBA 4QPKA 4BXIA 2O1VA 2HK3A 2F4VE 5D7RA 4X64I 2E5LE 4MPNA 4Z7YA 2XDXA 3TZ0A 3O2FA 3PEHA 1J5EI 2JKIA 4CWOA 4LF4I 3RKZA 3CGYA 2F4VI 1BGQA 3A0RA 2X7IA 1I94I 4DV6E 4DR4E 2XJGA 5FNCA 3JAMC 4BQJA 4LF8E 2UUAE 1FNMA 1ZM4A 3VADA 2V2VA 3WQ9A 2BV3A 2FWYA 3HHUA 3VHAA 1Z0EA 5IDMA 1YERA 2HKEA 1UYFA 2YI5A 3K17A 2XX2A 1NZ0A 3JAMQ 5CPHA 3QTFA 3HYYA 4O0BA 4LF9I 4DU7A 2O1WA 1H73A 4NXNI 3OTOE 1YETA 4EFTA 1YT2A 4LF6E 1N0UA 2DEIA 2XDUA 4X65I 5J71A 4JI1E 2VCJA 4WUCA 4NXNE 4KSGA 1FWKA 1Z0GA 5IWAE 4PRVA 2QG0A 2YEFA 2YK9A 4USKA 1Z5BA 4GKKI 2CGFA 4RPFA 2CCUA 1N0VC 4LP0A 4LFBE 4EGIA 4FCQA 4DR3E 1I5CA 2C2AA 2YGAA 2WI3A 2UUAI 4MP2A 1H74A 5CF0A 2PNRA 4B3SI 4UTGA 2QF6A 4JASA 4L8ZA 4U7OA 2XX5A 3EHHA 1TBWA 5LMUE 4XD8A 1YS3A 3QT7A 4AQYE 5BR8E 1I5BA 2BTZA 4ED4A 4EFUA 2WI4A 4YHHI 1OSFA 1NHJA 4LF8I 3A0YA 3EHGA 4XKAA 1HR0E 3PEJA 3GIFA 4B6CA 1PVGA 4B3ME 4DV1I 1YC4A 1RR9A 4FWDA 4LWGA 1YT1A 1Y8OA 1AJ6A 2XJJA 4YKUA 4ASFA
chains in the Genus database with same CATH superfamily
5LL6R 4QPJA 5D7DA 2OI2A 1YC3A 3QDDA 4LF5E 1Z0WA 2IOPA 5D6PA 2YEHA 2BR2B 4XDMA 1IBLI 2WEQA 5EL9A 3FV5A 2BA0D 2CH4A 2VWCA 4YY3E 2XX4A 4LFCE 4JYAE 4DR6I 1HR0I 3B24A 2YGEA 2Z5CA 1US7A 1UYKA 4HYMA 5C0XC 2PNZA 3B4TA 2FYPA 2H8MA 3T0ZA 3T1HE 3GONA 5D7CA 5JEAE 1F51A 2V8PA 4HXWA 2UXBI 1TH8A 3Q6NA 1AM1A 1U0ZA 2HK2A 2VF3A 3WU6A 2GFDA 2PO0B 4JI7I 4DV3I 2R3VA 1IBKE 4GKJE 1XNRE 4O09A 2YKCA 4V25A 4MYTA 5CTXA 3T10A 5IWAI 4O04A 1YSZA 3R4MA 4JAUA 4XKKA 4GEEA 3WHAA 2IERA 1GKXA 1UYDA 4EEHA 1YSRA 5M4EA 1I5AA 4X9LA 5IT9C 2XJXA 4GCZA 4HZ0A 5LMUI 4NBQA 4CWNA 2EXLA 2UUCI 2YEGA 3LMMA 4X62I 4KP4A 5IN9A 4DR2E 4AM3A 3LPSA 2IESA 2BZ5A 1XXEA 3HULA 3M6AA 3PYFA 2WNRB 3D36A 3EHFA 3H80A 2R42A 2VQFI 3D0BA 3OMUA 2ZM6I 2E1RA 1N36E 1TIDA 3RLPA 1HK7A 4LWEA 2BRCA 3ZXQA 5GMEA 3EHJA 2XK2A 4XKOA 2PNLA 4KHPE 4NH7A 4JAVA 1AH6A 5J6AA 3ZZ0A 4MOTA 4LWIA 5JENA 2YJXA 2IWUA 1S4EA 3WU3A 2JE6B 3R92A 4B3MI 3D2RA 2X36A 3CDIA 3ZM7A 4JI4I 3INXA 3TZ4A 2IWXA 4CWQA 1FKAE 4NH8A 3J81Q 3B25A 3CDJA 1UDNA 4Z7CA 3A0XA 4LFBI 3A0WA 3INWA 1XMOE 3D4JA 1I94E 4E72A 3ZZUA 3M7NG 3ZKBA 1PKPA 3P3EA 4LCGA 4M1KA 1IBLE 4QNJA 2AKPA 4LFAI 3TUHA 4PRXA 4URMA 4MP7A 3H1CA 2QG2A 4DV4E 3BMYA 2GS8A 4O05A 2DEJA 4AWOA 2YE8A 4FCRA 2VQEE 1ZXMA 2BA1G 3DGEA 3Q5LA 2C1IA 1S14A 4BA2B 3SL2A 2V2QA 1UY7A 4CWSA 2Z5CB 4DV0E 3PYEA 1FJGE 4GKKE 4H81A 4R3MA 1OYSA 4ISAA 1ZM9A 4CWRA 1PIEA 3V5RA 1NHIA 1ZWHA 1IBMI 4OO1C 4LCHA 1B63A 4FWHA 3PS3A 1Y4UA 1IXMA 3K1JA 2CZ9A 2IORA 4P52A 4DPTA 3JZ3A 4E00A 2HCHA 1HNZE 1GKZA 2Z5BA 2YEJA 4BA1B 3R4OA 4CWTA 3T1YI 5K36B 2C38B 4B3SE 2ESAA 4GQTA 4MU1A 5K36D 2ZDYA 4B7PA 2WI6A 2E0AA 4PL9A 4DV5I 3G7EA 3U1YA 5BR8I 4FW7A 1I5DA 1Y8NA 3WU4A 4LFAE 3CGZA 2VQFE 1YT0A 3Q5KA 3UHMA 5CTYA 4MU4A 4BQGA 1OYPA 1U2RA 1BYQA 2YE6A 1A6FA 1UEKA 4U3BA 4X62E 2UXBE 2C39A 2UUBE 3MNRP 1U2OA 1N34I 5K36E 2ZDXA 4H7QA 4QNKA 5C0XF 4DV7I 4E01A 1BKNA 3OTOI 4YKXA 1H72C 1N34E 4HYPA 1FJGI 4XITA 4I5SA 4K0KI 3GIGA 4FW4A 1XNQE 4B3RI 4KHPI 2A2CA 1KZNA 2YEBA 4ZVIA 4KQVA 5FLXC 4GGLA 2HHHE 4LCFA 4MYUA 4CE2A 4DV2I 2UXDI 2UXCE 4GT8A 5FWKA 2WP8B 4DU8A 2CCSA 5EKWA 4AQYI 2YE2A 4DV7E 3RLRA 3T2SA 1HNWE 5M4KA 2UU9E 4CE3A 3WU5A 3PRYA 4LFCI 2FXSA 3J7AG 2O1TA 1ID0A 4XE2A 4BIZA 2XHRA 2E5LI 2YEEA 1VISA 2O1UA 1UDOA 2Q2EB 2YK2A 4LPBA 4IZKB 1ZXNA 5GMDA 1A4HA 4MB9A 2PO2B 4DUZI 3K85A 4AIMA 4DR4I 4JI6E 5CTUA 4FW9A 2JJCA 1WUUA 2CVEA 4JQLA 5LMNI 3B82A 3A0ZA 3R4NA 4OX9E 2Z5BB 4MQYA 4DR3I 1ZM2A 4P7AA 2XDKA 2YKEA 2C38A 2UUBI 1IBME 3CYGA 1KIJA 5F5RA 2Q8FA 4BAEA 2BT0A 4XCLA 1ZM3A 2XABA 1N32E 4L90A 2WI1A 1KTVA 3RLQA 5C93A 1J5EE 2HFUA 3PYDA 2GQPA 4URNA 2YE9A 2YKIA 4LF7E 4LF6I 1UYMA 3FT5A 3VHCA 4CWPA 1DARA 1RHYA 3FT8A 2HFSA 1MG7A 3TZ5A 2ZITA 4DR7E 1S16A 4B3TI 1E3HA 4XCJA 1B3QA 4KFGA 4K0KE 2BSMA 1GJVA 1YH8A 1THNA 2UUCE 3GMEA 1Z5AA 4HXZA 4IFDD 1EI1A 1MU5A 4WUDA 4IFDB 3OW6A 4LPFA 4XTJA 3CRLA 3S5TA 2Q8IA 2NN6A 3P3GA 5DRPA 2XCMA 2BU8A 4JG4A 3B8HA 1TILA 4DV6I 3OPDA 2XHTA 1IBKI 4UROA 1KKHA 4DV1E 1D6TA 3G75A 5DRQA 1FWLA 2Z5EA 5DROA 3J80Q 4FW6A 1FI4A 4DUYI 1AMWA 1I58A 5GGZA 3B27A 2GO4A 4JI2I 4UT4A 1H7UA 3HZ1A 3J81C 1XMQE 4GKJI 2BYIA 5M4HA 5BOCA 4OO1B 2YI6A 4DV0I 1XHKA 1XMOI 4YKQA 2Q8GA 4YY3I 1Z0VA 4DUZE 2V34A 2NPFA 3A0TA 2PO2A 2XDLA 4XIQA 4OO1A 4JI5E 4JI3I 4CWFA 2FWZA 5IDJA 4JI4E 2BA1D 2ZM6E 2C1GA 3K98A 5LMNE 5A2QQ 3R91A 2IOQA 4DXLA 2H55A 4WUBA 4DPYA 1BXDA 4DPUA 1R6LA 4KTNA 2AJ4A 3M7ND 4DV3E 3K97A 3QT6A 4MU3A 1QY8A 4JV5E 4CE1A 3PS2A 2YE3A 3Q5JA 4FCPA 2NN6F 3L7ZB 2YKJA 4EGHA 5BODA 3T1HI 5M4PA 2HHHI 5IT9Q 3ZZTA 4NH9A 3V2UC 3B78A 1TC0A 3IEDA 4FN5A 2YEIA 4AWPA 1Z59A 4MPCA 3J80C 4JI7E 3U1KA 1Z5CA 5C0XD 1I59A 3HEKA 4JI2E 4B3TE 5JEAF 2BU2A 2YI0A 4P8OA 4BIUA 4DUHA 4X65E 4LWFA 4IZKA 1QYEA 1N33I 1Y60A 2V2ZA 3Q6MA 3PS1A 1OJ4A 2BU5A 5DRRA 4LF7I 4IFDE 1Z0BA 4DR5I 3K60A 4YKYA 3ZXOA 1USVA 2BU7A 3O0IA 2GQ0A 3BM9A 1Z0TA 4GQUA 1E3PA 2VCIA 3ZKDA 5A2QC 1UYCA 3T1KA 4EM7A 2YE4A 3O6OA 3K99A 2UXCI 2O3ZA 4MDTA 3QT5A 4OZEA 4X66I 2YE7A 5CTWA 2IWSA 1H7SA 2WI5A 5K36A 1UDQA 1YESA 4L94A 1L0OA 4Q20A 4X66E 4IS9A 5FNFA 1EA6A 4LF4E 4DR1I 1UY6A 2BREA 4LWHA 4YKTA 3GCMA 4YKRA 1RREA 2ZBKB 4DV4I 4PU9A 4OX9I 2BR2A 2UWDA 4FWGA 5FLXQ 2JEBA 2NN6C 5JEAB 3LNUA 5C0XE 4NXME 4MU0A 3Q1QA 4AWQA 5JEAD 1QZRA 4DR6E 4LOMA 1NHHA 4R3AA 2PO1A 3TTZA 2CCTA 2LJPA 1USUA 4ASGA 3U67A 2YGFA 3EKOA 2WERA 2JE6A 2XEXA 2NN6B 2VQEI 4JI3E 5L3JA 2XHXA 1Y6ZA 4DUYE 3J7AM 4AIDA 3KE6A 4KSHA 4XC0A 4JYAI 5M4NA 2PNZB 4MBCA 3HZ5A 3DD6A 3T0HA 4U93A 2HHIA 1HNZI 3QT8A 4DR5E 1UYGA 1KVKA 4JI8E 4JI0E 2BYHA 2YECA 4GFNA 1JM6A 1R6MA 1ELOA 2BM0A 2K5BA 3EKRA 2UXDE 4EMVA 2YEAA 1TC6A 4AS9A 4U7NA 4EMDA 3LTOA 4HACB 4JI0I 4ASBA 1YHCA 4E02A 3CWVA 1OYRA 4LF9E 3R4PA 4EGKA 1Y8PA 5JEAA 4OO1F 3P06A 3PYGA 2WW4A 1Y4SA 4JI1I 1XMQI 1YC1A 2A2DA 3HYZA 2JEBB 4HY6A 4NXMI 4BA2A 4W7TA 2HG1A 1N36I 4YKZA 3GLLA 4LF5I 2PNMA 4JI8I 4R1FA 4DV5E 1N33E 1ZW9A 4JI5I 2FTKA 2XDSA 4DZYA 4ZKIA 4I3HA 3M85G 4X64E 5F3KA 2EFGA 4DPWA 2UU9I 3L7ZA 1UYEA 1HNXE 2YE5A 4IFDF 1B62A 3OWDA 2YJWA 4USMA 4DV2E 4EFUA 5JEAC 2ZKJA 4DR2I 1R62A 1UY8A 1UY9A 4FMTA 2F1DA 3TZ2A 1XNRI 4DR7I 1HNWI 2HKJA 3HKMA 4URLA 2QFOA 2BM1A 1UYHA 2WI2A 2WI7A 1K47A 4XIRA 4FPPA 4ASAA 3NMQA 1Y5YA 4J3DA 4DR1E 2NN6E 4JV5I 3B28A 3P3CA 2J7KA 1HNXI 4XIPA 2WNRA 4N3OA 3VHDA 4O07A 4L91A 1XNQI 4B3RE 4YKWA 1N32I 3F0NA 3GIGB 3U2DA 3KRNA 3B26A 2VW5A 3OWBA 1AH8A 1UYIA 5D6QA 1UYLA 3C11A 4HZ5A 4YHHE 2Q8HA 2CG9A 4V26A 1UDSA 3G7BA 4HY1A 4H85A 1MX0A 4K4OA 5FNDA 4L93A 3GIEA 2J65A 3H4LA 4FW5A 3NZKA 2YEDA 1Z0CA 4MPEA 2XD6A 3U2KA 4DPXA 3T1YE 5M4MA 5DNXA 2BU6A 3C0EA 2WEPA 4OO1E 4JI6I 4HACA 2YI7A 2YKBA 3CRKA 4QPKA 2O1VA 2HK3A 2WP8A 2F4VE 5D7RA 4BXIA 4X64I 2C37B 2E5LE 4MPNA 4Z7YA 2XDXA 3TZ0A 4OO1D 3O2FA 3PEHA 1J5EI 4IZJA 2JKIA 4CWOA 4IFDC 4LF4I 3RKZA 3CGYA 2F4VI 2GO3A 1BGQA 3A0RA 2X7IA 1I94I 4DV6E 5ELWA 4DR4E 2XJGA 5FNCA 3JAMC 4BQJA 4LF8E 2UUAE 1FNMA 1ZM4A 3VADA 2V2VA 3WQ9A 2BV3A 2FWYA 3HHUA 3VHAA 1Z0EA 5IDMA 1YERA 2HKEA 1UYFA 2YI5A 3K17A 5K36C 2AE8A 2XX2A 1NZ0A 3JAMQ 5CPHA 3QTFA 2NN6D 3HYYA 4O0BA 4DU7A 2O1WA 4U3DA 4LF9I 1H73A 4NXNI 3OTOE 1YETA 4EFTA 2VESA 4IFDA 3P76A 4LF6E 1YT2A 1N0UA 2DEIA 1VI7A 4X65I 2XDUA 5C0XB 5J71A 4JI1E 2VCJA 4WUCA 4NXNE 2JEAA 4KSGA 1FWKA 1Z0GA 4BA1A 5IWAE 4FW3A 4PRVA 2QG0A 2C37A 2YEFA 2YK9A 4USKA 1Z5BA 4GKKI 2CGFA 4RPFA 2CCUA 3HJCA 1N0VC 4LP0A 4LFBE 4EGIA 4FCQA 4DR3E 1I5CA 2C2AA 2C39B 2YGAA 2PO1B 2WI3A 2UUAI 4MP2A 1H74A 5CF0A 5K36F 2PNRA 4B3SI 2JT2A 3M85D 4UTGA 2QF6A 4OKGA 4JASA 4L8ZA 4U7OA 2XX5A 3EHHA 1TBWA 5LMUE 4XD8A 2PO0A 3QT7A 4AQYE 5BR8E 1I5BA 1P42A 2BA0G 4ED4A 1YS3A 4YHHI 5C0XA 2BTZA 2WI4A 1OSFA 1NHJA 4LF8I 3A0YA 3EHGA 2JEAB 4XKAA 1HR0E 5DNLA 4IZJD 3PEJA 3GIFA 4B6CA 1PVGA 2CGEA 4DV1I 4B3ME 1YC4A 4IZJB 1RR9A 4FWDA 4LWGA 1YT1A 1Y8OA 1AJ6A 2XJJA 4YKUA 4ASFA
chains in the Genus database with same CATH topology
5LL6R 4QPJA 5D7DA 2OI2A 1YC3A 3QDDA 4LF5E 1Z0WA 2IOPA 5D6PA 2YEHA 4XDMA 1IBLI 2WEQA 3FV5A 2CH4A 2VWCA 4YY3E 2XX4A 4LFCE 4JYAE 4DR6I 1HR0I 3B24A 2YGEA 2Z5CA 1US7A 1UYKA 4HYMA 2FYPA 2H8MA 3T0ZA 3T1HE 3GONA 5D7CA 2V8PA 4HXWA 2UXBI 1TH8A 3Q6NA 1AM1A 1U0ZA 2HK2A 2VF3A 3WU6A 2GFDA 4V25A 4JI7I 4DV3I 2R3VA 1IBKE 4GKJE 1XNRE 4O09A 2YKCA 5CTXA 4MYTA 3T10A 5IWAI 4O04A 1YSZA 3R4MA 4JAUA 4XKKA 4GEEA 3WHAA 1GKXA 1UYDA 4EEHA 1YSRA 5M4EA 1I5AA 4X9LA 5IT9C 2XJXA 4GCZA 4HZ0A 5LMUI 4CWNA 2EXLA 2UUCI 2YEGA 4X62I 4KP4A 5IN9A 4DR2E 3LPSA 2BZ5A 3HULA 3M6AA 3PYFA 3D36A 3EHFA 3H80A 3OMUA 2R42A 2VQFI 3D0BA 2ZM6I 2E1RA 1N36E 1TIDA 3RLPA 1HK7A 4LWEA 2BRCA 3ZXQA 5GMEA 3EHJA 2XK2A 4XKOA 2PNLA 4KHPE 4NH7A 4JAVA 1AH6A 5J6AA 3ZZ0A 4MOTA 4LWIA 2YJXA 2IWUA 1S4EA 3WU3A 3R92A 4B3MI 3D2RA 2X36A 3ZM7A 4JI4I 3INXA 3TZ4A 2IWXA 4CWQA 1FKAE 4NH8A 3J81Q 3B25A 4Z7CA 3A0XA 4LFBI 3A0WA 3INWA 1XMOE 3D4JA 1I94E 3ZZUA 3IEDA 3ZKBA 1PKPA 4M1KA 1IBLE 2AKPA 3TUHA 4LFAI 4PRXA 4URMA 4MP7A 2QG2A 3BMYA 4DV4E 4O05A 2GS8A 2DEJA 4AWOA 2YE8A 4FCRA 2VQEE 1ZXMA 3DGEA 3Q5LA 1S14A 3SL2A 2V2QA 1UY7A 4CWSA 2Z5CB 4DV0E 3PYEA 1FJGE 4GKKE 4H81A 4R3MA 1ZM9A 4CWRA 1PIEA 3V5RA 1NHIA 1ZWHA 1IBMI 1B63A 4FWHA 1Y4UA 3K1JA 2CZ9A 2IORA 4P52A 4DPTA 3JZ3A 4E00A 2HCHA 1HNZE 1GKZA 2Z5BA 2YEJA 3R4OA 4CWTA 3T1YI 2ESAA 4B3SE 4GQTA 2ZDYA 4B7PA 2WI6A 2E0AA 4PL9A 4DV5I 3G7EA 5BR8I 1Y8NA 4GFNA 1I5DA 3WU4A 4LFAE 3CGZA 2VQFE 1YT0A 3Q5KA 5CTYA 4BQGA 1U2RA 1BYQA 2YE6A 1A6FA 1UEKA 3R4NA 4X62E 2UXBE 3MNRP 2UUBE 1U2OA 1N34I 4H7QA 2ZDXA 4DV7I 4E01A 1BKNA 3OTOI 4YKXA 1H72C 1N34E 4HYPA 1FJGI 4XITA 4I5SA 4K0KI 3GIGA 1XNQE 4B3RI 4KHPI 2A2CA 1KZNA 2YEBA 4ZVIA 4KQVA 5FLXC 4GGLA 2HHHE 4MYUA 4CE2A 4DV2I 2UXDI 2UXCE 4GT8A 5FWKA 4DU8A 2CCSA 2YE2A 4AQYI 4DV7E 3RLRA 3T2SA 1HNWE 5M4KA 2UU9E 4CE3A 3WU5A 3PRYA 4LFCI 2FXSA 3J7AG 2O1TA 1ID0A 4XE2A 4BIZA 2XHRA 2E5LI 2YEEA 1VISA 2O1UA 2YK2A 2Q2EB 4LPBA 4IZKB 1ZXNA 5GMDA 1A4HA 4MB9A 4DUZI 3K85A 4DR4I 4JI6E 5CTUA 4FW9A 2JJCA 1WUUA 4JQLA 5LMNI 3B82A 3A0ZA 4OX9E 2Z5BB 4DR3I 1ZM2A 4P7AA 2XDKA 2YKEA 2UUBI 1IBME 1KIJA 5F5RA 2Q8FA 4BAEA 2BT0A 4XCLA 1ZM3A 2XABA 1N32E 4L90A 2WI1A 1KTVA 3RLQA 5C93A 1J5EE 2HFUA 3PYDA 2GQPA 4URNA 2YE9A 2YKIA 4LF7E 4LF6I 1UYMA 3FT5A 3VHCA 4CWPA 1DARA 3FT8A 2HFSA 1MG7A 3TZ5A 2ZITA 4DR7E 1S16A 4B3TI 4XCJA 1B3QA 4KFGA 4K0KE 2BSMA 1GJVA 1THNA 2UUCE 1Z5AA 4HXZA 1EI1A 1MU5A 4WUDA 3OW6A 4XTJA 3CRLA 2Q8IA 2XCMA 2BU8A 4JG4A 3B8HA 1TILA 4DV6I 3OPDA 2XHTA 1IBKI 4UROA 1KKHA 4DV1E 1D6TA 3G75A 1FWLA 2Z5EA 3J80Q 4DUYI 1FI4A 1AMWA 1I58A 5GGZA 3B27A 4JI2I 4UT4A 1H7UA 3HZ1A 3J81C 1XMQE 4GKJI 2BYIA 5M4HA 5BOCA 4YKQA 2YI6A 4DV0I 1XHKA 1XMOI 2Q8GA 4YY3I 1Z0VA 4DUZE 2V34A 2NPFA 3A0TA 2XDLA 4XIQA 4JI5E 4JI3I 4CWFA 2FWZA 5IDJA 4JI4E 2ZM6E 3K98A 5LMNE 5A2QQ 3R91A 2IOQA 4DXLA 2H55A 4WUBA 4DPYA 1BXDA 4DPUA 4KTNA 2AJ4A 4DV3E 3K97A 3QT6A 1QY8A 4JV5E 4CE1A 4FCPA 2YE3A 3Q5JA 4EGHA 2YKJA 5BODA 3T1HI 5M4PA 2HHHI 5IT9Q 3ZZTA 4NH9A 3V2UC 3B78A 1TC0A 4FN5A 2YEIA 4AWPA 1Z59A 4MPCA 3J80C 4JI7E 1Z5CA 1I59A 3HEKA 4JI2E 4B3TE 2BU2A 2YI0A 4P8OA 4BIUA 4DUHA 4X65E 4LWFA 4IZKA 1QYEA 1N33I 2V2ZA 3Q6MA 1OJ4A 2BU5A 3K60A 4LF7I 1Z0BA 4DR5I 4YKYA 3ZXOA 1USVA 2BU7A 3O0IA 2GQ0A 3BM9A 1Z0TA 2VCIA 3ZKDA 5A2QC 1UYCA 3T1KA 4EM7A 2YE4A 3O6OA 3K99A 2UXCI 3QT5A 4X66I 2YE7A 5CTWA 2IWSA 1H7SA 2WI5A 1YESA 4L94A 1L0OA 4Q20A 4X66E 5FNFA 1EA6A 4LF4E 4DR1I 1UY6A 2BREA 4LWHA 4YKTA 4YKRA 1RREA 2ZBKB 4DV4I 4PU9A 4OX9I 2UWDA 4FWGA 5FLXQ 3LNUA 4NXME 3Q1QA 4AWQA 1QZRA 4DR6E 1NHHA 4R3AA 3TTZA 2CCTA 2LJPA 1USUA 4ASGA 3U67A 2YGFA 3EKOA 2WERA 2XEXA 2VQEI 4JI3E 5L3JA 2XHXA 1Y6ZA 4DUYE 3J7AM 3KE6A 4KSHA 4XC0A 5M4NA 4JYAI 4MBCA 3HZ5A 3T0HA 4U93A 1HNZI 3QT8A 4DR5E 1UYGA 1KVKA 4JI8E 4JI0E 2BYHA 2YECA 1JM6A 2K5BA 2BM0A 1ELOA 3EKRA 2UXDE 4EMVA 2YEAA 1TC6A 4AS9A 4U7NA 4EMDA 3LTOA 4HACB 4JI0I 4ASBA 4E02A 4EGKA 3CWVA 4LF9E 3R4PA 1Y8PA 3P06A 3PYGA 2WW4A 1Y4SA 4JI1I 1XMQI 1YC1A 2A2DA 3HYZA 4HY6A 4NXMI 4W7TA 2HG1A 1N36I 4YKZA 4LF5I 2PNMA 4JI8I 4R1FA 4DV5E 1N33E 1ZW9A 4JI5I 2XDSA 4DZYA 4ZKIA 4I3HA 4X64E 5F3KA 2EFGA 4DPWA 2UU9I 1UYEA 1HNXE 2YE5A 1B62A 3OWDA 2YJWA 4USMA 4DV2E 2ZKJA 4DR2I 1R62A 1UY8A 1UY9A 4FMTA 3TZ2A 1XNRI 4DR7I 1HNWI 2HKJA 4URLA 2QFOA 2BM1A 1UYHA 2WI2A 2WI7A 1K47A 4XIRA 4FPPA 4ASAA 3NMQA 4DR1E 4JV5I 3B28A 1HNXI 2J7KA 4XIPA 4N3OA 3VHDA 4O07A 4L91A 1XNQI 4B3RE 4YKWA 1N32I 3F0NA 3GIGB 3U2DA 3B26A 3OWBA 2VW5A 5D6QA 1AH8A 1UYIA 1UYLA 3C11A 4HZ5A 4YHHE 2Q8HA 2CG9A 4V26A 3G7BA 4HY1A 4H85A 1MX0A 4K4OA 5FNDA 4L93A 3GIEA 3H4LA 2YEDA 1Z0CA 4MPEA 2XD6A 3U2KA 4DPXA 3T1YE 5M4MA 2BU6A 3C0EA 2WEPA 3CRKA 4JI6I 4HACA 2YI7A 2YKBA 4QPKA 4BXIA 2O1VA 2HK3A 2F4VE 5D7RA 4X64I 2E5LE 4MPNA 4Z7YA 2XDXA 3TZ0A 3O2FA 3PEHA 1J5EI 4IZJA 2JKIA 4CWOA 4LF4I 3RKZA 3CGYA 2F4VI 1BGQA 3A0RA 2X7IA 1I94I 4DV6E 4DR4E 2XJGA 5FNCA 3JAMC 4BQJA 4LF8E 2UUAE 1FNMA 1ZM4A 3VADA 2V2VA 3WQ9A 2BV3A 2FWYA 3HHUA 3VHAA 1Z0EA 5IDMA 1YERA 2HKEA 1UYFA 2YI5A 3K17A 2XX2A 1NZ0A 3JAMQ 5CPHA 3QTFA 3HYYA 4O0BA 4DU7A 2O1WA 4LF9I 1H73A 4NXNI 3OTOE 1YETA 4EFTA 1YT2A 4LF6E 1N0UA 2DEIA 2XDUA 4X65I 5J71A 4JI1E 2VCJA 4WUCA 4NXNE 4KSGA 1FWKA 1Z0GA 5IWAE 4PRVA 2QG0A 2YEFA 2YK9A 4USKA 1Z5BA 4GKKI 2CGFA 4RPFA 2CCUA 3HJCA 1N0VC 4LP0A 4LFBE 4EGIA 4FCQA 4DR3E 1I5CA 2C2AA 2YGAA 2WI3A 2UUAI 4MP2A 1H74A 5CF0A 2PNRA 4B3SI 4UTGA 2QF6A 4JASA 4L8ZA 4U7OA 2XX5A 3EHHA 1TBWA 5LMUE 4XD8A 1YS3A 3QT7A 4AQYE 5BR8E 1I5BA 2BTZA 4ED4A 4EFUA 2WI4A 4YHHI 1OSFA 1NHJA 4LF8I 3A0YA 3EHGA 4XKAA 1HR0E 4IZJD 3PEJA 3GIFA 4B6CA 1PVGA 2CGEA 4DV1I 4B3ME 1YC4A 4IZJB 1RR9A 4FWDA 4LWGA 1YT1A 1Y8OA 1AJ6A 2XJJA 4YKUA 4ASFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 R;  4QPJ A;  5D7D A;  2OI2 A;  1YC3 A;  3QDD A;  4LF5 E;  1Z0W A;  2IOP A;  5D6P A;  2YEH A;  4XDM A;  1IBL I;  2WEQ A;  3FV5 A;  2CH4 A;  2VWC A;  4YY3 E;  2XX4 A;  4LFC E;  4JYA E;  4DR6 I;  1HR0 I;  3B24 A;  2YGE A;  1US7 A;  1UYK A;  4HYM A;  2FYP A;  2H8M A;  3T0Z A;  3T1H E;  3GON A;  5D7C A;  2V8P A;  4HXW A;  2UXB I;  1TH8 A;  1AM1 A;  1U0Z A;  2HK2 A;  2VF3 A;  3WU6 A;  2GFD A;  4V25 A;  4JI7 I;  4DV3 I;  2R3V A;  1IBK E;  4GKJ E;  1XNR E;  4O09 A;  2YKC A;  5CTX A;  4MYT A;  3T10 A;  5IWA I;  4O04 A;  1YSZ A;  3R4M A;  4JAU A;  4XKK A;  4GEE A;  3WHA A;  1GKX A;  1UYD A;  4EEH A;  1YSR A;  5M4E A;  1I5A A;  4X9L A;  5IT9 C;  2XJX A;  4GCZ A;  4HZ0 A;  5LMU I;  4CWN A;  2EXL A;  2UUC I;  2YEG A;  4X62 I;  4KP4 A;  5IN9 A;  4DR2 E;  3LPS A;  2BZ5 A;  3HUL A;  3M6A A;  3PYF A;  3D36 A;  3EHF A;  3H80 A;  3OMU A;  2R42 A;  2VQF I;  3D0B A;  2ZM6 I;  2E1R A;  1N36 E;  1TID A;  3RLP A;  4LWE A;  2BRC A;  3ZXQ A;  5GME A;  3EHJ A;  2XK2 A;  4XKO A;  4KHP E;  4NH7 A;  5J6A A;  4JAV A;  1AH6 A;  3ZZ0 A;  4MOT A;  4LWI A;  2YJX A;  2IWU A;  1S4E A;  3WU3 A;  3R92 A;  4B3M I;  3D2R A;  2X36 A;  3ZM7 A;  4JI4 I;  3INX A;  3TZ4 A;  2IWX A;  4CWQ A;  1FKA E;  4NH8 A;  3J81 Q;  3B25 A;  4Z7C A;  3A0X A;  4LFB I;  3A0W A;  3INW A;  1XMO E;  3D4J A;  1I94 E;  3ZZU A;  3IED A;  3ZKB A;  1PKP A;  4M1K A;  1IBL E;  2AKP A;  3TUH A;  4LFA I;  4PRX A;  4URM A;  4MP7 A;  2QG2 A;  3BMY A;  4DV4 E;  4O05 A;  2GS8 A;  2DEJ A;  4AWO A;  2YE8 A;  4FCR A;  2VQE E;  1ZXM A;  3DGE A;  3Q5L A;  1S14 A;  3SL2 A;  2V2Q A;  1UY7 A;  4CWS A;  4DV0 E;  3PYE A;  1FJG E;  4GKK E;  4H81 A;  4R3M A;  1ZM9 A;  4CWR A;  1PIE A;  3V5R A;  1NHI A;  1ZWH A;  1IBM I;  1B63 A;  4FWH A;  1Y4U A;  3K1J A;  2CZ9 A;  2IOR A;  4P52 A;  4DPT A;  3JZ3 A;  4E00 A;  2HCH A;  1HNZ E;  1GKZ A;  2YEJ A;  3R4O A;  4CWT A;  3T1Y I;  2ESA A;  4B3S E;  4GQT A;  2ZDY A;  4B7P A;  2WI6 A;  2E0A A;  4PL9 A;  4DV5 I;  3G7E A;  5BR8 I;  1Y8N A;  4GFN A;  1I5D A;  3WU4 A;  4LFA E;  3CGZ A;  2VQF E;  1YT0 A;  3Q5K A;  5CTY A;  4BQG A;  1U2R A;  1BYQ A;  2YE6 A;  1A6F A;  1UEK A;  3R4N A;  4X62 E;  2UXB E;  3MNR P;  2UUB E;  1U2O A;  1N34 I;  4H7Q A;  2ZDX A;  4DV7 I;  4E01 A;  1BKN A;  3OTO I;  4YKX A;  1H72 C;  1N34 E;  4HYP A;  1FJG I;  4XIT A;  4I5S A;  4K0K I;  3GIG A;  1XNQ E;  4B3R I;  4KHP I;  2A2C A;  1KZN A;  2YEB A;  4ZVI A;  4KQV A;  5FLX C;  4GGL A;  2HHH E;  4MYU A;  4CE2 A;  4DV2 I;  2UXD I;  2UXC E;  4GT8 A;  5FWK A;  4DU8 A;  2CCS A;  2YE2 A;  4AQY I;  4DV7 E;  3RLR A;  3T2S A;  1HNW E;  5M4K A;  2UU9 E;  4CE3 A;  3WU5 A;  4LFC I;  2FXS A;  3J7A G;  1ID0 A;  4XE2 A;  4BIZ A;  2XHR A;  2E5L I;  2YEE A;  1VIS A;  2O1U A;  2YK2 A;  2Q2E B;  4LPB A;  1ZXN A;  5GMD A;  1A4H A;  4MB9 A;  4DUZ I;  4DR4 I;  4JI6 E;  5CTU A;  4FW9 A;  2JJC A;  1WUU A;  4JQL A;  5LMN I;  3B82 A;  3A0Z A;  4OX9 E;  4DR3 I;  1ZM2 A;  4P7A A;  2XDK A;  2YKE A;  2UUB I;  1IBM E;  1KIJ A;  5F5R A;  2Q8F A;  4BAE A;  2BT0 A;  4XCL A;  1ZM3 A;  2XAB A;  1N32 E;  4L90 A;  2WI1 A;  1KTV A;  3RLQ A;  5C93 A;  1J5E E;  2HFU A;  3PYD A;  2GQP A;  4URN A;  2YE9 A;  2YKI A;  4LF7 E;  4LF6 I;  1UYM A;  3FT5 A;  3VHC A;  4CWP A;  1DAR A;  3FT8 A;  2HFS A;  1MG7 A;  3TZ5 A;  2ZIT A;  4DR7 E;  1S16 A;  4B3T I;  4XCJ A;  1B3Q A;  4KFG A;  4K0K E;  2BSM A;  1GJV A;  1THN A;  2UUC E;  1Z5A A;  4HXZ A;  1EI1 A;  1MU5 A;  4WUD A;  3OW6 A;  4XTJ A;  3CRL A;  2Q8I A;  2XCM A;  2BU8 A;  4JG4 A;  3B8H A;  1TIL A;  4DV6 I;  3OPD A;  2XHT A;  1IBK I;  4URO A;  1KKH A;  4DV1 E;  1D6T A;  3G75 A;  1FWL A;  3J80 Q;  4DUY I;  1FI4 A;  1AMW A;  1I58 A;  5GGZ A;  3B27 A;  4JI2 I;  4UT4 A;  1H7U A;  3HZ1 A;  3J81 C;  1XMQ E;  4GKJ I;  2BYI A;  5M4H A;  5BOC A;  4YKQ A;  2YI6 A;  4DV0 I;  1XHK A;  1XMO I;  2Q8G A;  4YY3 I;  1Z0V A;  4DUZ E;  2V34 A;  2NPF A;  3A0T A;  2XDL A;  4XIQ A;  4JI5 E;  4JI3 I;  4CWF A;  2FWZ A;  5IDJ A;  4JI4 E;  2ZM6 E;  3K98 A;  5LMN E;  5A2Q Q;  3R91 A;  2IOQ A;  4DXL A;  2H55 A;  4WUB A;  4DPY A;  1BXD A;  4DPU A;  4KTN A;  2AJ4 A;  4DV3 E;  3K97 A;  3QT6 A;  1QY8 A;  4JV5 E;  4CE1 A;  4FCP A;  2YE3 A;  3Q5J A;  4EGH A;  2YKJ A;  5BOD A;  3T1H I;  5M4P A;  2HHH I;  5IT9 Q;  3ZZT A;  4NH9 A;  3V2U C;  3B78 A;  1TC0 A;  4FN5 A;  2YEI A;  4AWP A;  1Z59 A;  4MPC A;  3J80 C;  4JI7 E;  1Z5C A;  1I59 A;  3HEK A;  4JI2 E;  4B3T E;  2BU2 A;  2YI0 A;  4P8O A;  4BIU A;  4DUH A;  4X65 E;  4LWF A;  1QYE A;  1N33 I;  2V2Z A;  1OJ4 A;  2BU5 A;  3K60 A;  4LF7 I;  1Z0B A;  4DR5 I;  4YKY A;  3ZXO A;  2BU7 A;  3O0I A;  3BM9 A;  1Z0T A;  2VCI A;  3ZKD A;  5A2Q C;  1UYC A;  3T1K A;  4EM7 A;  2YE4 A;  3O6O A;  3K99 A;  2UXC I;  3QT5 A;  4X66 I;  2YE7 A;  5CTW A;  2IWS A;  1H7S A;  2WI5 A;  1YES A;  4L94 A;  1L0O A;  4Q20 A;  4X66 E;  5FNF A;  1EA6 A;  4LF4 E;  4DR1 I;  1UY6 A;  2BRE A;  4LWH A;  4YKT A;  4YKR A;  1RRE A;  2ZBK B;  4DV4 I;  4PU9 A;  4OX9 I;  2UWD A;  4FWG A;  5FLX Q;  3LNU A;  4NXM E;  3Q1Q A;  4AWQ A;  1QZR A;  4DR6 E;  1NHH A;  4R3A A;  3TTZ A;  2CCT A;  2LJP A;  4ASG A;  3U67 A;  2YGF A;  3EKO A;  2WER A;  2XEX A;  2VQE I;  4JI3 E;  5L3J A;  2XHX A;  4DUY E;  3J7A M;  3KE6 A;  4KSH A;  4XC0 A;  5M4N A;  4JYA I;  4MBC A;  3HZ5 A;  3T0H A;  4U93 A;  1HNZ I;  3QT8 A;  4DR5 E;  1UYG A;  1KVK A;  4JI8 E;  4JI0 E;  2BYH A;  2YEC A;  1JM6 A;  2K5B A;  2BM0 A;  1ELO A;  3EKR A;  2UXD E;  4EMV A;  2YEA A;  1TC6 A;  4AS9 A;  4U7N A;  4EMD A;  3LTO A;  4HAC B;  4JI0 I;  4ASB A;  4E02 A;  4EGK A;  3CWV A;  4LF9 E;  3R4P A;  1Y8P A;  3PYG A;  2WW4 A;  1Y4S A;  4JI1 I;  1XMQ I;  1YC1 A;  2A2D A;  3HYZ A;  4HY6 A;  4NXM I;  4W7T A;  2HG1 A;  1N36 I;  4YKZ A;  4LF5 I;  4JI8 I;  1ZW9 A;  4R1F A;  4DV5 E;  1N33 E;  2XDS A;  4JI5 I;  4DZY A;  4ZKI A;  4I3H A;  4X64 E;  5F3K A;  2EFG A;  4DPW A;  2UU9 I;  1UYE A;  1HNX E;  2YE5 A;  1B62 A;  3OWD A;  2YJW A;  4USM A;  4DV2 E;  2ZKJ A;  4DR2 I;  1R62 A;  1UY8 A;  1UY9 A;  4FMT A;  3TZ2 A;  1XNR I;  4DR7 I;  1HNW I;  2HKJ A;  4URL A;  2QFO A;  2BM1 A;  1UYH A;  2WI2 A;  2WI7 A;  1K47 A;  4XIR A;  4FPP A;  4ASA A;  3NMQ A;  4DR1 E;  4JV5 I;  3B28 A;  1HNX I;  2J7K A;  4XIP A;  3VHD A;  4O07 A;  4L91 A;  1XNQ I;  4B3R E;  4YKW A;  1N32 I;  3F0N A;  3GIG B;  3U2D A;  3B26 A;  3OWB A;  2VW5 A;  5D6Q A;  1AH8 A;  1UYI A;  1UYL A;  3C11 A;  4HZ5 A;  4YHH E;  2Q8H A;  2CG9 A;  4V26 A;  3G7B A;  4HY1 A;  4H85 A;  1MX0 A;  4K4O A;  5FND A;  4L93 A;  3GIE A;  3H4L A;  2YED A;  1Z0C A;  4MPE A;  2XD6 A;  3U2K A;  4DPX A;  3T1Y E;  5M4M A;  2BU6 A;  3C0E A;  2WEP A;  3CRK A;  4JI6 I;  4HAC A;  2YI7 A;  2YKB A;  4QPK A;  4BXI A;  2O1V A;  2HK3 A;  2F4V E;  5D7R A;  4X64 I;  2E5L E;  4MPN A;  4Z7Y A;  2XDX A;  3TZ0 A;  3O2F A;  3PEH A;  1J5E I;  2JKI A;  4CWO A;  4LF4 I;  3RKZ A;  3CGY A;  2F4V I;  1BGQ A;  3A0R A;  2X7I A;  1I94 I;  4DV6 E;  4DR4 E;  2XJG A;  5FNC A;  3JAM C;  4BQJ A;  4LF8 E;  2UUA E;  1FNM A;  1ZM4 A;  3VAD A;  2V2V A;  3WQ9 A;  2BV3 A;  2FWY A;  3HHU A;  3VHA A;  1Z0E A;  5IDM A;  1YER A;  2HKE A;  1UYF A;  2YI5 A;  3K17 A;  2XX2 A;  1NZ0 A;  3JAM Q;  5CPH A;  3QTF A;  3HYY A;  4O0B A;  4LF9 I;  4DU7 A;  2O1W A;  1H73 A;  4NXN I;  3OTO E;  1YET A;  4EFT A;  1YT2 A;  4LF6 E;  1N0U A;  2DEI A;  2XDU A;  4X65 I;  5J71 A;  4JI1 E;  2VCJ A;  4WUC A;  4NXN E;  4KSG A;  1FWK A;  1Z0G A;  5IWA E;  4PRV A;  2QG0 A;  2YEF A;  2YK9 A;  4USK A;  1Z5B A;  4GKK I;  2CGF A;  4RPF A;  2CCU A;  1N0V C;  4LP0 A;  4LFB E;  4EGI A;  4FCQ A;  4DR3 E;  1I5C A;  2C2A A;  2YGA A;  2WI3 A;  2UUA I;  4MP2 A;  1H74 A;  5CF0 A;  2PNR A;  4B3S I;  4UTG A;  2QF6 A;  4JAS A;  4L8Z A;  4U7O A;  2XX5 A;  3EHH A;  1TBW A;  5LMU E;  4XD8 A;  1YS3 A;  3QT7 A;  4AQY E;  5BR8 E;  1I5B A;  2BTZ A;  4ED4 A;  4EFU A;  2WI4 A;  4YHH I;  1OSF A;  1NHJ A;  4LF8 I;  3A0Y A;  3EHG A;  4XKA A;  1HR0 E;  3PEJ A;  3GIF A;  4B6C A;  1PVG A;  4B3M E;  4DV1 I;  1YC4 A;  1RR9 A;  4FWD A;  4LWG A;  1YT1 A;  1Y8O A;  1AJ6 A;  2XJJ A;  4YKU A;  4ASF A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  4QPJ A;  5D7D A;  2OI2 A;  1YC3 A;  3QDD A;  4LF5 E;  1Z0W A;  2IOP A;  5D6P A;  2YEH A;  2BR2 B;  4XDM A;  1IBL I;  2WEQ A;  5EL9 A;  3FV5 A;  2BA0 D;  2CH4 A;  2VWC A;  4YY3 E;  2XX4 A;  4LFC E;  4JYA E;  4DR6 I;  1HR0 I;  3B24 A;  2YGE A;  2Z5C A;  1US7 A;  1UYK A;  4HYM A;  5C0X C;  2PNZ A;  3B4T A;  2FYP A;  2H8M A;  3T0Z A;  3T1H E;  3GON A;  5D7C A;  5JEA E;  1F51 A;  2V8P A;  4HXW A;  2UXB I;  1TH8 A;  3Q6N A;  1AM1 A;  1U0Z A;  2HK2 A;  2VF3 A;  3WU6 A;  2GFD A;  2PO0 B;  4JI7 I;  4DV3 I;  2R3V A;  1IBK E;  4GKJ E;  1XNR E;  4O09 A;  2YKC A;  4V25 A;  4MYT A;  5CTX A;  3T10 A;  5IWA I;  4O04 A;  1YSZ A;  3R4M A;  4JAU A;  4XKK A;  4GEE A;  3WHA A;  2IER A;  1GKX A;  1UYD A;  4EEH A;  1YSR A;  5M4E A;  1I5A A;  4X9L A;  5IT9 C;  2XJX A;  4GCZ A;  4HZ0 A;  5LMU I;  4NBQ A;  4CWN A;  2EXL A;  2UUC I;  2YEG A;  3LMM A;  4X62 I;  4KP4 A;  5IN9 A;  4DR2 E;  4AM3 A;  3LPS A;  2IES A;  2BZ5 A;  1XXE A;  3HUL A;  3M6A A;  3PYF A;  2WNR B;  3D36 A;  3EHF A;  3H80 A;  2R42 A;  2VQF I;  3D0B A;  3OMU A;  2ZM6 I;  2E1R A;  1N36 E;  1TID A;  3RLP A;  1HK7 A;  4LWE A;  2BRC A;  3ZXQ A;  5GME A;  3EHJ A;  2XK2 A;  4XKO A;  2PNL A;  4KHP E;  4NH7 A;  4JAV A;  1AH6 A;  5J6A A;  3ZZ0 A;  4MOT A;  4LWI A;  5JEN A;  2YJX A;  2IWU A;  1S4E A;  3WU3 A;  2JE6 B;  3R92 A;  4B3M I;  3D2R A;  2X36 A;  3CDI A;  3ZM7 A;  4JI4 I;  3INX A;  3TZ4 A;  2IWX A;  4CWQ A;  1FKA E;  4NH8 A;  3J81 Q;  3B25 A;  3CDJ A;  1UDN A;  4Z7C A;  3A0X A;  4LFB I;  3A0W A;  3INW A;  1XMO E;  3D4J A;  1I94 E;  4E72 A;  3ZZU A;  3M7N G;  3ZKB A;  1PKP A;  3P3E A;  4LCG A;  4M1K A;  1IBL E;  4QNJ A;  2AKP A;  4LFA I;  3TUH A;  4PRX A;  4URM A;  4MP7 A;  3H1C A;  2QG2 A;  4DV4 E;  3BMY A;  2GS8 A;  4O05 A;  2DEJ A;  4AWO A;  2YE8 A;  4FCR A;  2VQE E;  1ZXM A;  2BA1 G;  3DGE A;  3Q5L A;  2C1I A;  1S14 A;  4BA2 B;  3SL2 A;  2V2Q A;  1UY7 A;  4CWS A;  2Z5C B;  4DV0 E;  3PYE A;  1FJG E;  4GKK E;  4H81 A;  4R3M A;  1OYS A;  4ISA A;  1ZM9 A;  4CWR A;  1PIE A;  3V5R A;  1NHI A;  1ZWH A;  1IBM I;  4OO1 C;  4LCH A;  1B63 A;  4FWH A;  3PS3 A;  1Y4U A;  1IXM A;  3K1J A;  2CZ9 A;  2IOR A;  4P52 A;  4DPT A;  3JZ3 A;  4E00 A;  2HCH A;  1HNZ E;  1GKZ A;  2Z5B A;  2YEJ A;  4BA1 B;  3R4O A;  4CWT A;  3T1Y I;  5K36 B;  2C38 B;  4B3S E;  2ESA A;  4GQT A;  4MU1 A;  5K36 D;  2ZDY A;  4B7P A;  2WI6 A;  2E0A A;  4PL9 A;  4DV5 I;  3G7E A;  3U1Y A;  5BR8 I;  4FW7 A;  1I5D A;  1Y8N A;  3WU4 A;  4LFA E;  3CGZ A;  2VQF E;  1YT0 A;  3Q5K A;  3UHM A;  5CTY A;  4MU4 A;  4BQG A;  1OYP A;  1U2R A;  1BYQ A;  2YE6 A;  1A6F A;  1UEK A;  4U3B A;  4X62 E;  2UXB E;  2C39 A;  2UUB E;  3MNR P;  1U2O A;  1N34 I;  5K36 E;  2ZDX A;  4H7Q A;  4QNK A;  5C0X F;  4DV7 I;  4E01 A;  1BKN A;  3OTO I;  4YKX A;  1H72 C;  1N34 E;  4HYP A;  1FJG I;  4XIT A;  4I5S A;  4K0K I;  3GIG A;  4FW4 A;  1XNQ E;  4B3R I;  4KHP I;  2A2C A;  1KZN A;  2YEB A;  4ZVI A;  4KQV A;  5FLX C;  4GGL A;  2HHH E;  4LCF A;  4MYU A;  4CE2 A;  4DV2 I;  2UXD I;  2UXC E;  4GT8 A;  5FWK A;  2WP8 B;  4DU8 A;  2CCS A;  5EKW A;  4AQY I;  2YE2 A;  4DV7 E;  3RLR A;  3T2S A;  1HNW E;  5M4K A;  2UU9 E;  4CE3 A;  3WU5 A;  3PRY A;  4LFC I;  2FXS A;  3J7A G;  2O1T A;  1ID0 A;  4XE2 A;  4BIZ A;  2XHR A;  2E5L I;  2YEE A;  1VIS A;  2O1U A;  1UDO A;  2Q2E B;  2YK2 A;  4LPB A;  4IZK B;  1ZXN A;  5GMD A;  1A4H A;  4MB9 A;  2PO2 B;  4DUZ I;  3K85 A;  4AIM A;  4DR4 I;  4JI6 E;  5CTU A;  4FW9 A;  2JJC A;  1WUU A;  2CVE A;  4JQL A;  5LMN I;  3B82 A;  3A0Z A;  3R4N A;  4OX9 E;  2Z5B B;  4MQY A;  4DR3 I;  1ZM2 A;  4P7A A;  2XDK A;  2YKE A;  2C38 A;  2UUB I;  1IBM E;  3CYG A;  1KIJ A;  5F5R A;  2Q8F A;  4BAE A;  2BT0 A;  4XCL A;  1ZM3 A;  2XAB A;  1N32 E;  4L90 A;  2WI1 A;  1KTV A;  3RLQ A;  5C93 A;  1J5E E;  2HFU A;  3PYD A;  2GQP A;  4URN A;  2YE9 A;  2YKI A;  4LF7 E;  4LF6 I;  1UYM A;  3FT5 A;  3VHC A;  4CWP A;  1DAR A;  1RHY A;  3FT8 A;  2HFS A;  1MG7 A;  3TZ5 A;  2ZIT A;  4DR7 E;  1S16 A;  4B3T I;  1E3H A;  4XCJ A;  1B3Q A;  4KFG A;  4K0K E;  2BSM A;  1GJV A;  1YH8 A;  1THN A;  2UUC E;  3GME A;  1Z5A A;  4HXZ A;  4IFD D;  1EI1 A;  1MU5 A;  4WUD A;  4IFD B;  3OW6 A;  4LPF A;  4XTJ A;  3CRL A;  3S5T A;  2Q8I A;  2NN6 A;  3P3G A;  5DRP A;  2XCM A;  2BU8 A;  4JG4 A;  3B8H A;  1TIL A;  4DV6 I;  3OPD A;  2XHT A;  1IBK I;  4URO A;  1KKH A;  4DV1 E;  1D6T A;  3G75 A;  5DRQ A;  1FWL A;  2Z5E A;  5DRO A;  3J80 Q;  4FW6 A;  1FI4 A;  4DUY I;  1AMW A;  1I58 A;  5GGZ A;  3B27 A;  2GO4 A;  4JI2 I;  4UT4 A;  1H7U A;  3HZ1 A;  3J81 C;  1XMQ E;  4GKJ I;  2BYI A;  5M4H A;  5BOC A;  4OO1 B;  2YI6 A;  4DV0 I;  1XHK A;  1XMO I;  4YKQ A;  2Q8G A;  4YY3 I;  1Z0V A;  4DUZ E;  2V34 A;  2NPF A;  3A0T A;  2PO2 A;  2XDL A;  4XIQ A;  4OO1 A;  4JI5 E;  4JI3 I;  4CWF A;  2FWZ A;  5IDJ A;  4JI4 E;  2BA1 D;  2ZM6 E;  2C1G A;  3K98 A;  5LMN E;  5A2Q Q;  3R91 A;  2IOQ A;  4DXL A;  2H55 A;  4WUB A;  4DPY A;  1BXD A;  4DPU A;  1R6L A;  4KTN A;  2AJ4 A;  3M7N D;  4DV3 E;  3K97 A;  3QT6 A;  4MU3 A;  1QY8 A;  4JV5 E;  4CE1 A;  3PS2 A;  2YE3 A;  3Q5J A;  4FCP A;  2NN6 F;  3L7Z B;  2YKJ A;  4EGH A;  5BOD A;  3T1H I;  5M4P A;  2HHH I;  5IT9 Q;  3ZZT A;  4NH9 A;  3V2U C;  3B78 A;  1TC0 A;  3IED A;  4FN5 A;  2YEI A;  4AWP A;  1Z59 A;  4MPC A;  3J80 C;  4JI7 E;  3U1K A;  1Z5C A;  5C0X D;  1I59 A;  3HEK A;  4JI2 E;  4B3T E;  5JEA F;  2BU2 A;  2YI0 A;  4P8O A;  4BIU A;  4DUH A;  4X65 E;  4LWF A;  4IZK A;  1QYE A;  1N33 I;  1Y60 A;  2V2Z A;  3Q6M A;  3PS1 A;  1OJ4 A;  2BU5 A;  5DRR A;  4LF7 I;  4IFD E;  1Z0B A;  4DR5 I;  3K60 A;  4YKY A;  3ZXO A;  1USV A;  2BU7 A;  3O0I A;  2GQ0 A;  3BM9 A;  1Z0T A;  4GQU A;  1E3P A;  2VCI A;  3ZKD A;  5A2Q C;  1UYC A;  3T1K A;  4EM7 A;  2YE4 A;  3O6O A;  3K99 A;  2UXC I;  2O3Z A;  4MDT A;  3QT5 A;  4OZE A;  4X66 I;  2YE7 A;  5CTW A;  2IWS A;  1H7S A;  2WI5 A;  5K36 A;  1UDQ A;  1YES A;  4L94 A;  1L0O A;  4Q20 A;  4X66 E;  4IS9 A;  5FNF A;  1EA6 A;  4LF4 E;  4DR1 I;  1UY6 A;  2BRE A;  4LWH A;  4YKT A;  3GCM A;  4YKR A;  1RRE A;  2ZBK B;  4DV4 I;  4PU9 A;  4OX9 I;  2BR2 A;  2UWD A;  4FWG A;  5FLX Q;  2JEB A;  2NN6 C;  5JEA B;  3LNU A;  5C0X E;  4NXM E;  4MU0 A;  3Q1Q A;  4AWQ A;  5JEA D;  1QZR A;  4DR6 E;  4LOM A;  1NHH A;  4R3A A;  2PO1 A;  3TTZ A;  2CCT A;  2LJP A;  1USU A;  4ASG A;  3U67 A;  2YGF A;  3EKO A;  2WER A;  2JE6 A;  2XEX A;  2NN6 B;  2VQE I;  4JI3 E;  5L3J A;  2XHX A;  1Y6Z A;  4DUY E;  3J7A M;  4AID A;  3KE6 A;  4KSH A;  4XC0 A;  4JYA I;  5M4N A;  2PNZ B;  4MBC A;  3HZ5 A;  3DD6 A;  3T0H A;  4U93 A;  2HHI A;  1HNZ I;  3QT8 A;  4DR5 E;  1UYG A;  1KVK A;  4JI8 E;  4JI0 E;  2BYH A;  2YEC A;  4GFN A;  1JM6 A;  1R6M A;  1ELO A;  2BM0 A;  2K5B A;  3EKR A;  2UXD E;  4EMV A;  2YEA A;  1TC6 A;  4AS9 A;  4U7N A;  4EMD A;  3LTO A;  4HAC B;  4JI0 I;  4ASB A;  1YHC A;  4E02 A;  3CWV A;  1OYR A;  4LF9 E;  3R4P A;  4EGK A;  1Y8P A;  5JEA A;  4OO1 F;  3P06 A;  3PYG A;  2WW4 A;  1Y4S A;  4JI1 I;  1XMQ I;  1YC1 A;  2A2D A;  3HYZ A;  2JEB B;  4HY6 A;  4NXM I;  4BA2 A;  4W7T A;  2HG1 A;  1N36 I;  4YKZ A;  3GLL A;  4LF5 I;  2PNM A;  4JI8 I;  4R1F A;  4DV5 E;  1N33 E;  1ZW9 A;  4JI5 I;  2FTK A;  2XDS A;  4DZY A;  4ZKI A;  4I3H A;  3M85 G;  4X64 E;  5F3K A;  2EFG A;  4DPW A;  2UU9 I;  3L7Z A;  1UYE A;  1HNX E;  2YE5 A;  4IFD F;  1B62 A;  3OWD A;  2YJW A;  4USM A;  4DV2 E;  4EFU A;  5JEA C;  2ZKJ A;  4DR2 I;  1R62 A;  1UY8 A;  1UY9 A;  4FMT A;  2F1D A;  3TZ2 A;  1XNR I;  4DR7 I;  1HNW I;  2HKJ A;  3HKM A;  4URL A;  2QFO A;  2BM1 A;  1UYH A;  2WI2 A;  2WI7 A;  1K47 A;  4XIR A;  4FPP A;  4ASA A;  3NMQ A;  1Y5Y A;  4J3D A;  4DR1 E;  2NN6 E;  4JV5 I;  3B28 A;  3P3C A;  2J7K A;  1HNX I;  4XIP A;  2WNR A;  4N3O A;  3VHD A;  4O07 A;  4L91 A;  1XNQ I;  4B3R E;  4YKW A;  1N32 I;  3F0N A;  3GIG B;  3U2D A;  3KRN A;  3B26 A;  2VW5 A;  3OWB A;  1AH8 A;  1UYI A;  5D6Q A;  1UYL A;  3C11 A;  4HZ5 A;  4YHH E;  2Q8H A;  2CG9 A;  4V26 A;  1UDS A;  3G7B A;  4HY1 A;  4H85 A;  1MX0 A;  4K4O A;  5FND A;  4L93 A;  3GIE A;  2J65 A;  3H4L A;  4FW5 A;  3NZK A;  2YED A;  1Z0C A;  4MPE A;  2XD6 A;  3U2K A;  4DPX A;  3T1Y E;  5M4M A;  5DNX A;  2BU6 A;  3C0E A;  2WEP A;  4OO1 E;  4JI6 I;  4HAC A;  2YI7 A;  2YKB A;  3CRK A;  4QPK A;  2O1V A;  2HK3 A;  2WP8 A;  2F4V E;  5D7R A;  4BXI A;  4X64 I;  2C37 B;  2E5L E;  4MPN A;  4Z7Y A;  2XDX A;  3TZ0 A;  4OO1 D;  3O2F A;  3PEH A;  1J5E I;  4IZJ A;  2JKI A;  4CWO A;  4IFD C;  4LF4 I;  3RKZ A;  3CGY A;  2F4V I;  2GO3 A;  1BGQ A;  3A0R A;  2X7I A;  1I94 I;  4DV6 E;  5ELW A;  4DR4 E;  2XJG A;  5FNC A;  3JAM C;  4BQJ A;  4LF8 E;  2UUA E;  1FNM A;  1ZM4 A;  3VAD A;  2V2V A;  3WQ9 A;  2BV3 A;  2FWY A;  3HHU A;  3VHA A;  1Z0E A;  5IDM A;  1YER A;  2HKE A;  1UYF A;  2YI5 A;  3K17 A;  5K36 C;  2AE8 A;  2XX2 A;  1NZ0 A;  3JAM Q;  5CPH A;  3QTF A;  2NN6 D;  3HYY A;  4O0B A;  4DU7 A;  2O1W A;  4U3D A;  4LF9 I;  1H73 A;  4NXN I;  3OTO E;  1YET A;  4EFT A;  2VES A;  4IFD A;  3P76 A;  4LF6 E;  1YT2 A;  1N0U A;  2DEI A;  1VI7 A;  4X65 I;  2XDU A;  5C0X B;  5J71 A;  4JI1 E;  2VCJ A;  4WUC A;  4NXN E;  2JEA A;  4KSG A;  1FWK A;  1Z0G A;  4BA1 A;  5IWA E;  4FW3 A;  4PRV A;  2QG0 A;  2C37 A;  2YEF A;  2YK9 A;  4USK A;  1Z5B A;  4GKK I;  2CGF A;  4RPF A;  2CCU A;  3HJC A;  1N0V C;  4LP0 A;  4LFB E;  4EGI A;  4FCQ A;  4DR3 E;  1I5C A;  2C2A A;  2C39 B;  2YGA A;  2PO1 B;  2WI3 A;  2UUA I;  4MP2 A;  1H74 A;  5CF0 A;  5K36 F;  2PNR A;  4B3S I;  2JT2 A;  3M85 D;  4UTG A;  2QF6 A;  4OKG A;  4JAS A;  4L8Z A;  4U7O A;  2XX5 A;  3EHH A;  1TBW A;  5LMU E;  4XD8 A;  2PO0 A;  3QT7 A;  4AQY E;  5BR8 E;  1I5B A;  1P42 A;  2BA0 G;  4ED4 A;  1YS3 A;  4YHH I;  5C0X A;  2BTZ A;  2WI4 A;  1OSF A;  1NHJ A;  4LF8 I;  3A0Y A;  3EHG A;  2JEA B;  4XKA A;  1HR0 E;  5DNL A;  4IZJ D;  3PEJ A;  3GIF A;  4B6C A;  1PVG A;  2CGE A;  4DV1 I;  4B3M E;  1YC4 A;  4IZJ B;  1RR9 A;  4FWD A;  4LWG A;  1YT1 A;  1Y8O A;  1AJ6 A;  2XJJ A;  4YKU A;  4ASF A; 
#chains in the Genus database with same CATH homology
 5LL6 R;  4QPJ A;  5D7D A;  2OI2 A;  1YC3 A;  3QDD A;  4LF5 E;  1Z0W A;  2IOP A;  5D6P A;  2YEH A;  4XDM A;  1IBL I;  2WEQ A;  3FV5 A;  2CH4 A;  2VWC A;  4YY3 E;  2XX4 A;  4LFC E;  4JYA E;  4DR6 I;  1HR0 I;  3B24 A;  2YGE A;  2Z5C A;  1US7 A;  1UYK A;  4HYM A;  2FYP A;  2H8M A;  3T0Z A;  3T1H E;  3GON A;  5D7C A;  2V8P A;  4HXW A;  2UXB I;  1TH8 A;  3Q6N A;  1AM1 A;  1U0Z A;  2HK2 A;  2VF3 A;  3WU6 A;  2GFD A;  4V25 A;  4JI7 I;  4DV3 I;  2R3V A;  1IBK E;  4GKJ E;  1XNR E;  4O09 A;  2YKC A;  5CTX A;  4MYT A;  3T10 A;  5IWA I;  4O04 A;  1YSZ A;  3R4M A;  4JAU A;  4XKK A;  4GEE A;  3WHA A;  1GKX A;  1UYD A;  4EEH A;  1YSR A;  5M4E A;  1I5A A;  4X9L A;  5IT9 C;  2XJX A;  4GCZ A;  4HZ0 A;  5LMU I;  4CWN A;  2EXL A;  2UUC I;  2YEG A;  4X62 I;  4KP4 A;  5IN9 A;  4DR2 E;  3LPS A;  2BZ5 A;  3HUL A;  3M6A A;  3PYF A;  3D36 A;  3EHF A;  3H80 A;  3OMU A;  2R42 A;  2VQF I;  3D0B A;  2ZM6 I;  2E1R A;  1N36 E;  1TID A;  3RLP A;  1HK7 A;  4LWE A;  2BRC A;  3ZXQ A;  5GME A;  3EHJ A;  2XK2 A;  4XKO A;  2PNL A;  4KHP E;  4NH7 A;  4JAV A;  1AH6 A;  5J6A A;  3ZZ0 A;  4MOT A;  4LWI A;  2YJX A;  2IWU A;  1S4E A;  3WU3 A;  3R92 A;  4B3M I;  3D2R A;  2X36 A;  3ZM7 A;  4JI4 I;  3INX A;  3TZ4 A;  2IWX A;  4CWQ A;  1FKA E;  4NH8 A;  3J81 Q;  3B25 A;  4Z7C A;  3A0X A;  4LFB I;  3A0W A;  3INW A;  1XMO E;  3D4J A;  1I94 E;  3ZZU A;  3IED A;  3ZKB A;  1PKP A;  4M1K A;  1IBL E;  2AKP A;  3TUH A;  4LFA I;  4PRX A;  4URM A;  4MP7 A;  2QG2 A;  3BMY A;  4DV4 E;  4O05 A;  2GS8 A;  2DEJ A;  4AWO A;  2YE8 A;  4FCR A;  2VQE E;  1ZXM A;  3DGE A;  3Q5L A;  1S14 A;  3SL2 A;  2V2Q A;  1UY7 A;  4CWS A;  2Z5C B;  4DV0 E;  3PYE A;  1FJG E;  4GKK E;  4H81 A;  4R3M A;  1ZM9 A;  4CWR A;  1PIE A;  3V5R A;  1NHI A;  1ZWH A;  1IBM I;  1B63 A;  4FWH A;  1Y4U A;  3K1J A;  2CZ9 A;  2IOR A;  4P52 A;  4DPT A;  3JZ3 A;  4E00 A;  2HCH A;  1HNZ E;  1GKZ A;  2Z5B A;  2YEJ A;  3R4O A;  4CWT A;  3T1Y I;  2ESA A;  4B3S E;  4GQT A;  2ZDY A;  4B7P A;  2WI6 A;  2E0A A;  4PL9 A;  4DV5 I;  3G7E A;  5BR8 I;  1Y8N A;  4GFN A;  1I5D A;  3WU4 A;  4LFA E;  3CGZ A;  2VQF E;  1YT0 A;  3Q5K A;  5CTY A;  4BQG A;  1U2R A;  1BYQ A;  2YE6 A;  1A6F A;  1UEK A;  3R4N A;  4X62 E;  2UXB E;  3MNR P;  2UUB E;  1U2O A;  1N34 I;  4H7Q A;  2ZDX A;  4DV7 I;  4E01 A;  1BKN A;  3OTO I;  4YKX A;  1H72 C;  1N34 E;  4HYP A;  1FJG I;  4XIT A;  4I5S A;  4K0K I;  3GIG A;  1XNQ E;  4B3R I;  4KHP I;  2A2C A;  1KZN A;  2YEB A;  4ZVI A;  4KQV A;  5FLX C;  4GGL A;  2HHH E;  4MYU A;  4CE2 A;  4DV2 I;  2UXD I;  2UXC E;  4GT8 A;  5FWK A;  4DU8 A;  2CCS A;  2YE2 A;  4AQY I;  4DV7 E;  3RLR A;  3T2S A;  1HNW E;  5M4K A;  2UU9 E;  4CE3 A;  3WU5 A;  3PRY A;  4LFC I;  2FXS A;  3J7A G;  2O1T A;  1ID0 A;  4XE2 A;  4BIZ A;  2XHR A;  2E5L I;  2YEE A;  1VIS A;  2O1U A;  2YK2 A;  2Q2E B;  4LPB A;  4IZK B;  1ZXN A;  5GMD A;  1A4H A;  4MB9 A;  4DUZ I;  3K85 A;  4DR4 I;  4JI6 E;  5CTU A;  4FW9 A;  2JJC A;  1WUU A;  4JQL A;  5LMN I;  3B82 A;  3A0Z A;  4OX9 E;  2Z5B B;  4DR3 I;  1ZM2 A;  4P7A A;  2XDK A;  2YKE A;  2UUB I;  1IBM E;  1KIJ A;  5F5R A;  2Q8F A;  4BAE A;  2BT0 A;  4XCL A;  1ZM3 A;  2XAB A;  1N32 E;  4L90 A;  2WI1 A;  1KTV A;  3RLQ A;  5C93 A;  1J5E E;  2HFU A;  3PYD A;  2GQP A;  4URN A;  2YE9 A;  2YKI A;  4LF7 E;  4LF6 I;  1UYM A;  3FT5 A;  3VHC A;  4CWP A;  1DAR A;  3FT8 A;  2HFS A;  1MG7 A;  3TZ5 A;  2ZIT A;  4DR7 E;  1S16 A;  4B3T I;  4XCJ A;  1B3Q A;  4KFG A;  4K0K E;  2BSM A;  1GJV A;  1THN A;  2UUC E;  1Z5A A;  4HXZ A;  1EI1 A;  1MU5 A;  4WUD A;  3OW6 A;  4XTJ A;  3CRL A;  2Q8I A;  2XCM A;  2BU8 A;  4JG4 A;  3B8H A;  1TIL A;  4DV6 I;  3OPD A;  2XHT A;  1IBK I;  4URO A;  1KKH A;  4DV1 E;  1D6T A;  3G75 A;  1FWL A;  2Z5E A;  3J80 Q;  4DUY I;  1FI4 A;  1AMW A;  1I58 A;  5GGZ A;  3B27 A;  4JI2 I;  4UT4 A;  1H7U A;  3HZ1 A;  3J81 C;  1XMQ E;  4GKJ I;  2BYI A;  5M4H A;  5BOC A;  4YKQ A;  2YI6 A;  4DV0 I;  1XHK A;  1XMO I;  2Q8G A;  4YY3 I;  1Z0V A;  4DUZ E;  2V34 A;  2NPF A;  3A0T A;  2XDL A;  4XIQ A;  4JI5 E;  4JI3 I;  4CWF A;  2FWZ A;  5IDJ A;  4JI4 E;  2ZM6 E;  3K98 A;  5LMN E;  5A2Q Q;  3R91 A;  2IOQ A;  4DXL A;  2H55 A;  4WUB A;  4DPY A;  1BXD A;  4DPU A;  4KTN A;  2AJ4 A;  4DV3 E;  3K97 A;  3QT6 A;  1QY8 A;  4JV5 E;  4CE1 A;  4FCP A;  2YE3 A;  3Q5J A;  4EGH A;  2YKJ A;  5BOD A;  3T1H I;  5M4P A;  2HHH I;  5IT9 Q;  3ZZT A;  4NH9 A;  3V2U C;  3B78 A;  1TC0 A;  4FN5 A;  2YEI A;  4AWP A;  1Z59 A;  4MPC A;  3J80 C;  4JI7 E;  1Z5C A;  1I59 A;  3HEK A;  4JI2 E;  4B3T E;  2BU2 A;  2YI0 A;  4P8O A;  4BIU A;  4DUH A;  4X65 E;  4LWF A;  4IZK A;  1QYE A;  1N33 I;  2V2Z A;  3Q6M A;  1OJ4 A;  2BU5 A;  3K60 A;  4LF7 I;  1Z0B A;  4DR5 I;  4YKY A;  3ZXO A;  1USV A;  2BU7 A;  3O0I A;  2GQ0 A;  3BM9 A;  1Z0T A;  2VCI A;  3ZKD A;  5A2Q C;  1UYC A;  3T1K A;  4EM7 A;  2YE4 A;  3O6O A;  3K99 A;  2UXC I;  3QT5 A;  4X66 I;  2YE7 A;  5CTW A;  2IWS A;  1H7S A;  2WI5 A;  1YES A;  4L94 A;  1L0O A;  4Q20 A;  4X66 E;  5FNF A;  1EA6 A;  4LF4 E;  4DR1 I;  1UY6 A;  2BRE A;  4LWH A;  4YKT A;  4YKR A;  1RRE A;  2ZBK B;  4DV4 I;  4PU9 A;  4OX9 I;  2UWD A;  4FWG A;  5FLX Q;  3LNU A;  4NXM E;  3Q1Q A;  4AWQ A;  1QZR A;  4DR6 E;  1NHH A;  4R3A A;  3TTZ A;  2CCT A;  2LJP A;  1USU A;  4ASG A;  3U67 A;  2YGF A;  3EKO A;  2WER A;  2XEX A;  2VQE I;  4JI3 E;  5L3J A;  2XHX A;  1Y6Z A;  4DUY E;  3J7A M;  3KE6 A;  4KSH A;  4XC0 A;  5M4N A;  4JYA I;  4MBC A;  3HZ5 A;  3T0H A;  4U93 A;  1HNZ I;  3QT8 A;  4DR5 E;  1UYG A;  1KVK A;  4JI8 E;  4JI0 E;  2BYH A;  2YEC A;  1JM6 A;  2K5B A;  2BM0 A;  1ELO A;  3EKR A;  2UXD E;  4EMV A;  2YEA A;  1TC6 A;  4AS9 A;  4U7N A;  4EMD A;  3LTO A;  4HAC B;  4JI0 I;  4ASB A;  4E02 A;  4EGK A;  3CWV A;  4LF9 E;  3R4P A;  1Y8P A;  3P06 A;  3PYG A;  2WW4 A;  1Y4S A;  4JI1 I;  1XMQ I;  1YC1 A;  2A2D A;  3HYZ A;  4HY6 A;  4NXM I;  4W7T A;  2HG1 A;  1N36 I;  4YKZ A;  4LF5 I;  2PNM A;  4JI8 I;  4R1F A;  4DV5 E;  1N33 E;  1ZW9 A;  4JI5 I;  2XDS A;  4DZY A;  4ZKI A;  4I3H A;  4X64 E;  5F3K A;  2EFG A;  4DPW A;  2UU9 I;  1UYE A;  1HNX E;  2YE5 A;  1B62 A;  3OWD A;  2YJW A;  4USM A;  4DV2 E;  2ZKJ A;  4DR2 I;  1R62 A;  1UY8 A;  1UY9 A;  4FMT A;  3TZ2 A;  1XNR I;  4DR7 I;  1HNW I;  2HKJ A;  4URL A;  2QFO A;  2BM1 A;  1UYH A;  2WI2 A;  2WI7 A;  1K47 A;  4XIR A;  4FPP A;  4ASA A;  3NMQ A;  4DR1 E;  4JV5 I;  3B28 A;  1HNX I;  2J7K A;  4XIP A;  4N3O A;  3VHD A;  4O07 A;  4L91 A;  1XNQ I;  4B3R E;  4YKW A;  1N32 I;  3F0N A;  3GIG B;  3U2D A;  3B26 A;  3OWB A;  2VW5 A;  5D6Q A;  1AH8 A;  1UYI A;  1UYL A;  3C11 A;  4HZ5 A;  4YHH E;  2Q8H A;  2CG9 A;  4V26 A;  3G7B A;  4HY1 A;  4H85 A;  1MX0 A;  4K4O A;  5FND A;  4L93 A;  3GIE A;  3H4L A;  2YED A;  1Z0C A;  4MPE A;  2XD6 A;  3U2K A;  4DPX A;  3T1Y E;  5M4M A;  2BU6 A;  3C0E A;  2WEP A;  3CRK A;  4JI6 I;  4HAC A;  2YI7 A;  2YKB A;  4QPK A;  4BXI A;  2O1V A;  2HK3 A;  2F4V E;  5D7R A;  4X64 I;  2E5L E;  4MPN A;  4Z7Y A;  2XDX A;  3TZ0 A;  3O2F A;  3PEH A;  1J5E I;  4IZJ A;  2JKI A;  4CWO A;  4LF4 I;  3RKZ A;  3CGY A;  2F4V I;  1BGQ A;  3A0R A;  2X7I A;  1I94 I;  4DV6 E;  4DR4 E;  2XJG A;  5FNC A;  3JAM C;  4BQJ A;  4LF8 E;  2UUA E;  1FNM A;  1ZM4 A;  3VAD A;  2V2V A;  3WQ9 A;  2BV3 A;  2FWY A;  3HHU A;  3VHA A;  1Z0E A;  5IDM A;  1YER A;  2HKE A;  1UYF A;  2YI5 A;  3K17 A;  2XX2 A;  1NZ0 A;  3JAM Q;  5CPH A;  3QTF A;  3HYY A;  4O0B A;  4DU7 A;  2O1W A;  4LF9 I;  1H73 A;  4NXN I;  3OTO E;  1YET A;  4EFT A;  1YT2 A;  4LF6 E;  1N0U A;  2DEI A;  2XDU A;  4X65 I;  5J71 A;  4JI1 E;  2VCJ A;  4WUC A;  4NXN E;  4KSG A;  1FWK A;  1Z0G A;  5IWA E;  4PRV A;  2QG0 A;  2YEF A;  2YK9 A;  4USK A;  1Z5B A;  4GKK I;  2CGF A;  4RPF A;  2CCU A;  3HJC A;  1N0V C;  4LP0 A;  4LFB E;  4EGI A;  4FCQ A;  4DR3 E;  1I5C A;  2C2A A;  2YGA A;  2WI3 A;  2UUA I;  4MP2 A;  1H74 A;  5CF0 A;  2PNR A;  4B3S I;  4UTG A;  2QF6 A;  4JAS A;  4L8Z A;  4U7O A;  2XX5 A;  3EHH A;  1TBW A;  5LMU E;  4XD8 A;  1YS3 A;  3QT7 A;  4AQY E;  5BR8 E;  1I5B A;  2BTZ A;  4ED4 A;  4EFU A;  2WI4 A;  4YHH I;  1OSF A;  1NHJ A;  4LF8 I;  3A0Y A;  3EHG A;  4XKA A;  1HR0 E;  4IZJ D;  3PEJ A;  3GIF A;  4B6C A;  1PVG A;  2CGE A;  4DV1 I;  4B3M E;  1YC4 A;  4IZJ B;  1RR9 A;  4FWD A;  4LWG A;  1YT1 A;  1Y8O A;  1AJ6 A;  2XJJ A;  4YKU A;  4ASF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...