1S1NA

Sh3 domain of human nephrocystin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
TGEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLEPYSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nephrocystin 1
publication title Solution NMR structure of the SH3 domain of human nephrocystin and analysis of a mutation-causing juvenile nephronophthisis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1s1nA00
2D0NA 3UF4A 2HEQA 1KIKA 2JT4A 1SRMA 2LJ0A 1AWJA 2SRCA 4JJDA 1IO6A 1OPLA 2KROA 3IQLA 4R0KA 5GJWB 3M0QA 4KRTA 1UJ0A 2CT4A 2ROTA 2RQVA 2YSQA 1PRLC 2OI3A 2FEIA 2FO0A 4AG2C 1YP5A 1H8KA 2LX7A 2KXDA 4J9DA 1K4US 1K0SA 2EGAA 1UHCA 2L2PA 1WYXA 2DL4A 2RQWA 1M8MA 2DL8A 3EHQA 1WDXA 4GBQA 1ABQA 1YWPA 4CC3A 2GTOA 1QCFA 4Z88A 2YUOA 2LQNA 1TG0A 2DX1A 1WLPB 2D8HA 1S1NA 4HVWA 2F2XA 3VRZA 4F16A 4A63B 5ECAA 2AK5A 3UATA 1TUDA 1PKTA 1TUCA 1ZBJA 3VS5A 4D8KA 2LJ1A 1X6GA 2CH4A 2EGCA 4IIMA 1LCKA 2L3PA 3H41A 4Z89A 2D1XA 2KXCA 1M3AA 1T0JA 2SEMA 2O9VA 1X6BA 3NHNA 2DL7A 3TSZA 2RF0A 1RLPC 1AEYA 1GCPA 1PWTA 5IHNA 4CC4B 2FPDA 4RTZA 1YNZA 2RPNA 3I5RA 2V1RA 1NEBA 1ABOA 1GL5A 4RUGA 2ENMA 2O2OA 4AFUC 2DRMA 2OJ2A 2YUPA 1G2BA 4HVVA 3M0PA 2LZ6B 4CC2A 4JJCA 1OOTA 3R6NA 2KRNA 1ZSGA 1T0HA 2B86A 3KFVA 1WX6A 4OMPA 2YT6A 3CQTA 1X69A 2KRSA 4M4ZA 4ZNXA 2EPDA 1AOJA 1CKBA 1E7OA 1UDLA 1ZUYA 1WIEA 2A28A 1X43A 1ZUUA 1YCSB 2JS0A 3EG2A 1UTIA 4OMNA 4QT7A 2RQUA 5IHIA 4RTTA 2DVJA 4K11A 4EIKA 2GNCA 1JQQA 2E5KA 1WXBA 1WFWA 3U23A 2A08A 1W70A 2LP5A 3GBQA 1K76A 4J9GA 4J9BA 1NYGA 4J9FA 2ABLA 2GGRA 2CT3A 2P4RA 1HD3A 4F14A 2KEAA 2J6FA 1VA7A 4OMMA 3H0FA 1GRIA 2DYBA 4LNPA 4CC7A 3EHRA 1BBZA 4WCIA 4Z8AA 2O88A 5EC7A 3PVQA 1M3CA 2RQRA 1UFFA 3VS0A 2O31A 2FRWA 1Z9ZA 1U5SA 3PE0A 1HJDA 3I35A 1M30A 2L0AA 3I9QA 3M0UA 1VYUA 1GCQC 2K7AA 2K9GA 4J9EA 1MUZA 3TSWA 1PNJA 1ZX6A 2HBWA 1ARKA 2DF6A 2K2MA 3VS1A 5IH2A 4AG1C 1UG1A 4JZ4A 2EW3A 3VRYA 1FYNA 2KGTA 2CUBA 1KFZA 1PKSA 2ECZA 5I22A 2M0YA 3FJ5A 2KT1A 1Z9QA 2GQIA 2YUQA 1AZGB 1GFCA 5FWBA 1BB9A 3RNJA 2BZYA 2KR3A 3VS7A 1T3LA 2KRMA 2W0ZA 2CREA 4HCKA 3M0RA 1K9AA 2JW4A 2V1QA 2EYXA 1AD5A 2J06A 2FPEA 4DEXA 1RUWA 2LQWA 1MV3A 2LMJA 2KNBB 2K3BA 2KE9A 1G83A 1GFDA 2CSIA 4OMQA 1GBRA 1K0XA 3M0SA 1FMKA 2C0TA 1VYTA 4J9IA 1SHFA 2BZ8A 2EYYA 2HCKA 3REAB 2MOXA 3ZL7C 4ESRA 3QWXX 2VWFA 1NM7A 4JPBW 4E6RA 2M51A 4FSSA 2DNUA 2DL5A 1JEGA 2GBQA 1I0CA 1PRMC 1YN8A 2MIOA 1I1JA 2H8HA 2PNIA 2HDAA 2ED1A 3TVTA 4AFQC 2EBPA 2NWMA 2KYBA 2FPFA 2KYMA 5IXFA 1JU5C 1RI9A 2AKLA 2XMFA 2JXBA 2J05A 4X1VA 2GTJA 1SEMA 2X3WD 2L3SA 2NUZA 1N5ZA 1W6XA 2G6FX 2RN8A 1KSWA 1EFNA 1YWOA 3THKA 1AVZC 1B3QA 1Y0MA 2LNHB 1QWEA 2JS2A 1OPKA 2AZVA 4GLMA 2DE0X 5I11A 2CUDA 2JM9A 1NYFA 1QKXA 4ORZA 4D8DA 2RQTA 1U3OA 2JM8A 1BK2A 2DL3A 1V1CA 1UJYA 3M0TA 4LUDA 3A98A 1CSKA 2CSQA 3VS3A 1AWOA 4OMOA 4HVUA 1WXUA 2VKNA 3REBB 3O5ZA 2F2VA 2DBKA 1SPKA 1HSQA 4JZ3A 4DEYA 3ULRB 2OAWA 2RMOA 3I5SA 1PHTA 2CDTA 3QWYA 1GBQA 2FG0A 1CKAA 2KT8A 1KJWA 2BZXA 2X3XD 4F17A 3PVLA 5IXBA 3JV3A 2JTEA 1AWXA 2CH4W 1JO8A 1E6GA 4RTWA 1UHFA 2FRYA 1RLQC 2PZ1A 2ROLA 2AKKA 4RTUA 2J6KA 1NEGA 1M3BA 3LH5A 1UGVA 1X2KA 2DBMA 2AZSA 1NG2A 4AFZC 5IHKA 4RTXA 3H0IA 4IIOA 1UUEA 1SSHA 2D8JA 1NLOC 1JXMA 1I07A 2K6DA 4J9CA 1Y57A 1QKWA 2EGEA 1QWFA 1J3TA 3H0HA 1H92A 2MCNA 4AFSC 2QDLA 1OEBA 1VYVA 2C0OA 2BTTA 2I0NA 4LN2A 2KBTA 1M27C 2JMAA 4LUEA 5GJVB 2L3QA 1ZLMA 2DM1A 2EKHA 1AZEA 2EYZA 3C0CA 4OMLA 2A37A 1B07A 3NPFA 2DLPA 2EYWA 1WA7A 2DRKA 3SEMA 2YUNA 3VS2A 3VS6A 4LE9A 1MV0B 2HSPA 2YDLA 1A0NB 2IIMA 1GCQA 2ESWA 1K1ZA 2A36A 2J7IA 2F2WA 2DJQA 1X2QA 2EVRA 1OV3A 1WI7A 3VS4A 2DA9A 1SHGA 3RBBB 2O9SA 2W10A 1XOVA 1E6HA 5FWCA 4J9HA 2ED0A 5L23A 3NMZC 3EGUA 1UECA 1NLPC 2DMOA 3NGPA 4JJBA 1AWWA 2J6OA 2K79A 1T3SA 2C0IA 4RTYA 3EG3A 1WXTA 2DILA 1UE9A 3UA6A 2JMCA 1U06A 3EG0A 1ZUKA 1BU1A 4HXJA 2VVKA 3UA7A 5HCKA 2RNAA 3EG1A 2PTKA 1QLYA 2LCSA 3SHWA 4RTVA 2LJ3A 1SRLA 2EQIA 1H3HA 4Y92A 1JXOA 1X27A 5FW9A 1W1FA
chains in the Genus database with same CATH superfamily
3UF4A 3C12A 2E70A 2HEQA 3RDVA 2JT4A 2CP0A 1AWJA 4JJDA 3QBYA 4R0KA 4JRKA 5GJWB 2KVQG 4KRTA 1UJ0A 2ROTA 2RQVA 1VQPQ 4MZMA 1PRLC 4OB2B 3PGGA 1R8OB 1I5LA 5LJ3d 1KQSA 5GMKh 2HL3A 2O4XA 2EYQA 2VGNA 2KXDA 3CCMQ 5GAMg 1PM3A 4J7FA 2DJZA 2EGAA 5CR2A 3OYJA 2DL4A 1WDXA 3G7ZA 1YWPA 1VQ8Q 5LJ5j 1VQNA 1YJ9T 2DX1A 4KH1B 2D8HA 3J80E 2F2XA 4F16A 2M16A 4IUQA 4ZGJB 3MHXA 3PT9A 4C0DB 1ZBJA 3TQ7P 3MEWA 2YWWA 2QTXA 4C0DC 2L3PA 5CKEA 1DJ7B 1SG5A 1T0JA 1X6BA 3CCUQ 2DL7A 4M7AD 2GQVA 4EMKB 2RK1A 3RMSA 1N9SA 2MWOA 4C92G 4CC4B 3A8MB 2JUFA 4EMGA 2LQ8A 4R55A 2RHXA 2CP6A 2YLBA 4RUGA 3QYHB 1VQMQ 2ENMA 4FYYB 2O2OA 1SSFA 4L59A 4N4IA 2OJ2A 2YUPA 4LDXA 4D6WA 1VQ7A 3CXCP 4JUVA 3UPUA 4NOYA 1PSFA 2JNGA 1VQLA 2OTLT 1LNXA 1T0HA 2JTFA 2B86A 4CRIA 1R0BG 3OQ5A 2KRSA 3MEVA 4M75F 3RIRA 4M4ZA 4ZNXA 2EPDA 3LYIA 4PJOE 1CKBA 1HK9A 2L8DA 1ZUUA 2FZKB 2LT1A 3CCSQ 1K8AC 5CKHA 1BCMA 2PQWA 4IKFA 3EG9A 2ZPFB 3BDLA 3ASKA 3KXTA 3CCET 4M7AF 3I55T 4EIKA 2OTJQ 1WFWA 2QTVA 3OYEA 1QVGP 1UGSB 1EX4A 4J9GA 1NYGA 4J9FA 4XTXA 2CP5A 2NYSA 2P4RA 3G6EA 1JRIA 4F14A 2J6FA 2LT4A 1VA7A 4OMMA 3H0FA 2DYBA 1QVFS 1ZSZA 1BBZA 4DBRA 2LVMA 3I56T 4WCIA 4Z8AA 2RQRA 2LC4A 3JCMX 4M78E 2O31A 1QQJA 2MI6A 5LJ5h 1HJDA 1WPYA 1V29B 1VYUA 4RG8A 1RAFB 3VYHB 4J9EA 1YIJQ 4M77G 3TSWA 1PNJA 2HBWA 2RJDA 4A54A 1O9SA 4ZTJA 1YITT 2MPXC 2EW3A 3VRYA 3OS2A 1N6AA 3HRSA 5CQXA 2K5IA 2KT1A 1Z9QA 2YUQA 1AZGB 3OYLA 1T3LA 3QKJA 4PFZA 2W0ZA 2CREA 1K9AA 2FPEA 3OBWA 2FVUA 4P5NA 3HRUA 1GFDA 4QQGA 2QA4T 1GBRA 3NTHA 1FMKA 1KQSP 2CKKA 2ZPIB 4MZPA 3SWNA 3LH0A 4M7DB 2HCKA 4M7DC 1WHHA 2JZ2A 4JPBW 3LW5E 4XU2A 4FSSA 3A8GB 2DL5A 2MIOA 2D0QB 1I1JA 4YTLA 1AHJB 2EBPA 1YJ9A 2KYBA 1PC0A 3CMET 1ZSZB 1ZA2B 5GAN3 1Y07A 1Q95G 1ZSZC 3TCJA 1NE8A 2AKLA 1KK7A 4OMFB 2J05A 3VUZA 4X1VA 3MPUB 3X28B 3M4YA 2X3WD 3G4SQ 3FIFA 1KSWA 2HNIA 1EFNA 2VC8A 3THKA 2LNHB 3S6WA 2AZVA 3URGA 4GLMA 4M77D 1S72T 3CC2Q 3FRNA 1NYFA 1P92A 4C8QB 4RG2A 4ORZA 5KYUA 4C8QC 1BK2A 2DL3A 1D09B 2LRQA 3QSUA 4LUDA 2QQAA 2YRVA 4HVUA 1M1FA 1YHQT 3OYYA 5KYWA 3CCVT 2E6NA 2VKNA 4O6JA 2YXYA 5KCOA 5GAMd 2CP7A 4JZ3A 3CXCS 1GBQA 2OAUA 1ZQ1A 3SB2A 2KT8A 3PVLA 2MK5A 1QVFA 1NJIU 5GAOm 2JTEA 2CH4W 2OTLA 1JO8A 4RTWA 2X35A 1UHFA 5HKCA 5LJ3g 5GAN8 4WTOB 2J6KA 1M3BA 1UGVA 1X2KA 1D3BA 4AFZC 1NJIR 3H0IA 4J83A 3OSVA 1PG5B 1UUEA 3MP1A 2D8JA 3CCRT 2V8KA 3T9NA 1JXMA 5D6WA 4J6XA 3OS0A 4XU1A 2A0FB 1QKWA 3CCEA 3H0HA 2PUOB 2Y4XA 3I55A 2R5MA 1H92A 2MCNA 3RMQA 4F7UG 1M2VB 1N8RU 4ELZC 2KBTA 1PCXA 1IZ6A 2L3QA 2XHCA 3VU3C 5KYYA 4C92A 2RI2A 4DOWA 1BKBA 1I5OB 5I21A 3FDRA 1N8RR 2DLPA 1WQWA 1WA7A 3SEMA 3CEYA 3JCMP 3RKWA 1TU0B 2DXBA 3I56A 1M5Q1 3E9GA 4LDVA 2VXFA 1ZBXA 4ATOA 2A36A 2EJ9A 2J7IA 4N0AC 3CBPA 3JCMQ 1X2QA 2BE7D 2EVRA 5GAOr 3RESA 2ZCFB 1OU9A 5KYUB 4LD9K 1RADB 1D1BA 2RI5A 1YJNQ 2O9SA 1N27A 1XOVA 3CD6T 1VIFA 3GF5A 5KYWB 2ED0A 5L23A 3NMZC 3A5ZB 1YITA 2XDBA 2LTOA 2E4HA 4A53A 2K79A 4E7HA 2C0IA 2E64A 4ZN3A 4XTUA 1WXTA 2DILA 2BE9B 2E6ZA 2JMCA 2E3IA 1YJWT 1ZUKA 3LWHA 1JB0E 5CCAA 4FCYA 5LJ3f 1D3BB 4XTZA 3EG1A 2QA4A 3EFOB 3ER0A 5FW9A 3CBOA 4E7SA 3NTKA 3X25B 1TSFA 2QAZA 2JJ9A 1SRMA 3OYGA 1IO6A 2LCCA 3X26B 3C94A 3L2VA 3M0QA 3VV0A 3PMIA 1IREB 5KYYB 3CCLQ 2BUDA 2QDYB 2CP2A 4AG2C 2LX7A 3FLGA 2QEXQ 2L2PA 1M8MA 4M77A 2DL8A 2LCLA 3EHQA 3MJXA 2RK2A 2RJEA 3CCJQ 3UWNA 4Z88A 2YUOA 3WVDB 1TG0A 3CPWA 4QQDA 3CC7T 2YHTA 1S1NA 3VRZA 4L5GA 5ECAA 2RO0A 2AK5A 2P4TA 2MAMA 1HYOA 3OSSC 3VS5A 3OYCA 3M54A 2KQWA 1PD1A 4IIMA 1F1BB 2EGCA 1S72A 3DB4A 3ZBDA 2NUPA 2KXCA 1M3AA 1ACMB 2SEMA 1JJ2A 3RERA 4KUDK 1Y71A 4BE2A 2HAXA 2DXCA 1YHQA 2EQMA 1GCPA 3CCVA 3CMAQ 4ZTFA 2FPDA 4PJOA 4RTZA 5A0GA 2RPNA 3JCMd 3I5RA 5KE3A 1QVFP 1N8RC 4M75G 1K8AU 1YI2Q 1Y96A 3CCQQ 1G2BA 3GNGA 4HVVA 1VQ5Q 2E10A 3M0PA 4C92E 2R5AA 4CC2A 4M7DD 1K8AR 1OOTA 4M7AG 1M2OA 2KRNA 1ZSGA 3EGDA 1WX6A 1W2BA 1Q7YU 2YT6A 2IPOB 3OY9A 4A4EA 2HQEA 5CAIA 2DZCA 3CCRA 1E7OA 1VQOT 1X43A 2VGMA 2XIDA 1YCSB 1XJWB 1QCNA 1Q7YR 4FIBA 5DLOA 4OMNA 4OF1A 5IHIA 3V8KA 1RACB 2GNCA 2E5KA 3MP6A 4KH0B 1W70A 1K76A 3KUFA 2QI2A 2ABLA 4BACA 2GGRA 1M4ZA 3GP8A 2VB6A 1M1GA 4C8QD 3CBMA 3QIIA 4JDSA 3PVQA 5L8RE 1OQKA 3QHSA 2XD0A 4M7DF 3CD6A 3EGXB 2KMTA 2FRWA 1Z9ZA 3LLRA 3PE0A 4PLLA 4PJOB 3I35A 2L0AA 1NZ9A 3M0UA 3HSBA 1GCQC 2K7AA 4PJOC 2WSEE 1MUZA 2JOYA 3G71T 3V7RA 2DF6A 5GAOl 4FM4B 5CKFA 2X4YA 4M75D 5IH2A 4AG1C 2ZGWA 4JZ4A 4X9DA 2CS7A 4XQ3A 1D1CA 2KGTA 2CUBA 1KFZA 2VXEA 1Y96B 1YJWA 2AT1B 3QO3A 2M0YA 2E1HA 1JBMA 5FWBA 1BB9A 1G3YA 3VS7A 2KRMA 1B7TA 4EMKC 1EIFA 2MMPA 2JW4A 2V1QA 2EYXA 4E7ZA 4M77E 1RUWA 2LQWA 1MV3A 2KE9A 2CSIA 4C8QF 3DB3A 3G1JA 5GANg 4M78B 2DZ9A 2BZ8A 4QVDA 2EYYA 4M78C 4XTYA 4ESRA 5GAMh 3X20B 2D6FA 2VWFA 3TEEA 5CKBA 4RCCA 3MEAA 2Z0WA 2DNUA 1BI1A 1JEGA 2CZ0B 4FW1A 1YN8A 2M02A 3HFNA 4FT2A 3LX7A 3L2QA 2ED1A 3TVTA 2RI3A 1QMCA 2KYMA 4KGZB 4IUTA 3CC7A 2O4XB 1RI9A 2HD0A 5LJ5g 5FRNA 4NS5A 2O01E 1WJRA 1JJ2P 1QP3A 1RAAB 2GTJA 1IXDA 1VQ4T 2V26A 1RABB 5GAMf 2IVWA 1U8RA 1VQ6Q 2RN8A 4E7LA 1AVZC 4DBHA 4PJLA 1B3QA 1Y0MA 4QQ6A 2EJGA 3PIPA 3QDRB 2DE0X 5I11A 1WHGA 1QKXA 1Q7YC 2RB6A 1TWBA 2V8JA 2JM8A 2COYA 3CC4Q 3VUBA 3JCMW 2A7YA 1WHKA 2CSQA 3PFSA 1C6VX 1SPKA 5FLXE 1OU8A 5GAN4 1VQKT 2P0PA 2E3HA 2NUTA 3I5SA 3QWYA 2RM4A 1WNLA 5KYXA 1W2BP 1VIEA 3JV3A 1UGQB 2KAFA 4ZGEB 1E6GA 4BB7A 3EH2A 3SFMA 1VQPT 2HZYA 5GAMe 4RTUA 1LVKA 2L89A 1G3SA 2RH2A 5IHKA 1VQOA 2K5FA 4PK4A 3CCMT 5A0DA 1NLOC 4HA8A 3S3OA 1I07A 1VQ9Q 3H9NA 4A4FA 1QP2A 4AFSC 1VQ8T 1Q86U 2I0NA 3OBYA 2VASA 1UGRB 2JMAA 2ZZDA 4LUEA 5HK3A 1ZLMA 2DM1A 2PVOB 1PD0A 4ME7A 3C0CA 4KBMB 3V8LA 2A37A 1Q86R 3EG9B 3RKYA 4LXCA 2DRKA 2HSEB 2NLUA 2HSPA 3CCUT 3L42A 4M75A 3JCMg 4F7UE 2EQJA 3OYIA 2DJQA 2DAQA 1LJOA 2G3RA 3SD4A 3E2UA 2EQKA 4JLGA 4KULA 2ZPGB 3VS4A 4DBQA 4M7AA 1VQNQ 5LJ3j 1E6HA 4OGCA 5GAN5 3G71A 1VQMT 1YBYA 2ZPEB 5GAN7 4BE0A 2QQBA 2P0KA 4J8OA 3GNFB 4O5VA 3EGUA 3NGPA 4C5IA 4JJBA 2NUTB 5FROA 2DD5A 4FYVB 1UE9A 3HKSA 1BU1A 1U1TA 1ZA1B 4E7KA 3M58A 4HXJA 1KC8R 2VVKA 3UA7A 1KQ1A 4OVAA 5HCKA 2XK0A 2PVDB 2RNAA 4R56A 2LCSA 3CCST 1KD1U 2LJ3A 1SRLA 3JB9J 2D0NA 3QJYA 3GLXA 2OTJT 4PL6A 4HCCA 3META 1KD1R 2YRDA 4BI8B 2Y4YA 1VQ7Q 2CT4A 4PJMA 5GAOp 4ELYC 2CZ1B 2YSQA 5D7UA 1VQLQ 3M59A 1KHCA 3CPWS 2CZ6B 2OI3A 2FEIA 3L2ZA 4XK8E 1YP5A 1H8KA 3HP9A 4J9DA 4JS4A 3BFMA 4KT0E 3SWNB 4OB3B 4DBFA 1UHCA 2RHUA 4RKUE 2HQHA 3QJ6A 3M56A 3SWNC 1TS9A 3RKXA 3JAME 4HCBA 2GTOA 1QCFA 6AT1B 1D0ZA 5GAN2 1JJ2S 2KK4A 1WLPB 4A4KA 1VQ4A 4HVWA 4PLIA 4A63B 5D6YA 3QXEB 2M1HA 1PKTA 1X75C 5CQYA 1TUCA 4QVCA 1YIJT 4D8KA 2LJ1A 2CH4A 3L1AA 1LCKA 1RL2A 3H41A 4Z89A 2D1XA 5J26A 5GANd 2CZ7B 2Y90A 3G6EQ 3OYDA 1K73C 4EPCA 4B6MA 3QUIA 1Q82U 2RF0A 4XU0A 2RJFA 4KGXB 4MMKA 1PWTA 3LGFA 3JB9G 4QVZA 5GAN6 1YNZA 3Q1JA 9ATCB 1BI0A 3KBGA 1VQKA 4EMHA 1IHVA 2EWNA 2V1RA 1Q82R 1NEBA 1ABOA 1GL5A 1Q86C 1W2BS 1MMGA 5LJ3h 1G8XA 2DRMA 2HKNA 2DXTA 4ZGDB 4F04B 2DPPB 5EG2A 4HKEA 2QK0A 5FRMA 1VQPA 5HK0A 3JCMJ 5LJ5d 3VYGA 3R6NA 4J6YA 4Q5WA 1B34A 3CCMA 3CQTA 1X69A 4PJOF 2QXFA 4JRIA 1AOJA 1ZUYA 1WIEA 4M75E 1FWZA 1VQ8A 4OB0B 1UTIA 2E65A 1RAIB 1MGQA 4RTTA 3QZ9B 5IN1A 4K11A 5J39A 3MEUA 1JQQA 4M7AE 1WXBA 3ZEHA 2EIFA 3SDZA 3U23A 3G4ST 4M7DG 5GAOq 3VJPA 3M4GA 3OYKA 2CT3A 1KC8C 1HD3A 3CCUA 5CK9A 3WXMB 3QDFA 3CC2T 1IRXA 2XU8A 1GRIA 4LNPA 4CC7A 4C92B 1M90U 1G5VA 3M55A 4C92C 1M8VA 1M3CA 2DERA 2QQ9A 4M78F 1UEBA 1AT1B 4OGEA 3OYFA 1YJ9Q 1KD1C 3CMEA 2HMAA 1VQMA 3JB9D 1U5SA 2GCXA 1M30A 5HY6A 1M90R 2K9GA 5LJ3e 5KCHA 2JTMA 1ARKA 4FYWB 2E12A 1FYNA 4PNOA 2M9UA 4C8QG 1Q81C 2DEQA 1W4SA 2BZYA 2KR3A 4XAXB 4DA4A 2QGGA 1MNEA 3CCSA 3M0RA 2J06A 1TH7A 2K3YA 2LMJA 2K3BA 1SKUB 1G83A 2OTJA 2FZCB 2DTIA 4OMQA 1K0XA 2F5TX 1U1SA 3M0SA 4C5EA 1FXXA 2FHDA 3TU4K 2RHIA 2PU9B 1SHFA 4MDWA 1IHWA 3REAB 4PJJA 4GY5A 1FX7A 2MOXA 3ZL7C 1QVGA 2D9TA 1R77A 2OTLQ 2KDSA 1VOMA 2P84A 1LOJA 3JB9F 5GAMj 4E6RA 1Q82C 3A8LB 2GBQA 1I0CA 2YRCA 5DM7R 2IG0A 1GXIE 1UGPB 4JRQA 2H8HA 2PNIA 1NPRA 4AFQC 2X9HA 3CCEQ 3HFOA 3I55Q 2WACA 1YJNT 3NFCA 1TTHB 2QQRA 1YIJA 2HQXA 1I4K1 1SEMA 4M77B 3A8HB 5C0MA 2H3EB 1N5ZA 3LWIA 2G6FX 4N4GA 4M77C 1RAEB 4QW2A 1YWOA 3AHUA 4AMCA 1SF9A 2JVVA 1OPKA 2JM9A 4V2SA 2R58A 4D8DA 2RQTA 2DIGA 1U3OA 3I56Q 2QQSA 1V1CA 1YFNA 1UJYA 3A98A 3EAEA 4ANJA 1CSKA 1KQ2A 4OB1B 4UC4A 2NUPB 4E7JA 2XDPA 4TVRA 4JJNK 1WXUA 3F70A 2A3LA 3E19A 2F2VA 2DBKA 3OS5A 1HSQA 5CKDA 4L6V5 3H8ZA 2BIVA 1MMAA 1XNIA 4DEYA 2X51A 3ULRB 2OAWA 4Z02A 2K2VA 2DEUA 1CKAA 4F17A 4IUPA 4XTWA 1YITQ 5IXBA 1AWXA 4Y91A 2PZ1A 2ROLA 3J7AF 3JCMV 1NEGA 2DBMA 3CCLT 2BKDN 2AZSA 1D1AA 4RTXA 3HHTB 1M90C 4IIOA 4F7UA 2QG9B 2QEXT 4LD6A 2M0OA 2HKQB 1SSHA 5KE2A 2RJCA 4J9CA 1WGSA 1Y57A 2GF7A 1J3TA 1QWFA 3EGDB 3CCJT 1OX8A 1OEBA 2HBPA 1XTDA 1PSEA 2QA4Q 2BTTA 3OA6A 1QW1A 4LN2A 5GJVB 3G4SA 4OP0A 3QZ5B 2RA2A 1N9RA 2JN0A 4FT4A 3V7SA 3CC2A 3DLLA 1C0MA 2YUNA 3V8JA 4LE9A 3OMCA 2XI9A 1QVPA 4BDYA 2YDLA 1A0NB 3E1SA 1VUBA 2F2WA 2E41A 2EQUA 3CMAT 3CMEQ 1WI7A 3CPWP 1IGQA 5CO7A 1YCYA 3BW1A 2XG8D 1G3TA 4AT1B 2W10A 1OX9A 5FWCA 4J9HA 2YLCA 1EZZB 1YI2T 4BD3A 3CCQT 1UECA 2DMOA 1FMVA 3BE3A 2J6OA 3JB9H 3BY7A 1VQ5T 1S72Q 4A4GA 5GMKe 3EG3A 3PNWC 4XU3A 2EKOA 3UA6A 3EH1A 4HT9A 1U06A 3EG0A 2EFIA 1YHQQ 3HL8A 3CCVQ 2MF2A 2FZGB 4ZN1A 5GANh 2ZPHB 4M7DA 2PTKA 2RHZA 2K4YA 4EDUA 2COZA 5I2MA 4RTVA 4F7UB 1M1KU 4RCBA 1R0CB 1X27A 4KGVB 3L2WA 3RR6A 4IUUA 1KIKA 2LJ0A 2SRCA 4BDZA 3EFSA 1OPLA 2KROA 3IQLA 1BCOA 1H3ZA 1M1KR 4FU6A 1MHNA 4C5HA 3OMGA 3OB9A 2KI7A 2E5QA 2FO0A 1K4US 2EAYA 2DXUA 1K0SA 4GLKA 2FB7A 5GANf 1K73U 2LQKA 4MZTA 1WYXA 4C92D 2GFAA 3CCRQ 2RQWA 1G3WA 4GBQA 1ABQA 4CC3A 1YJNA 2LQNA 4PJNA 2L3RA 1K73R 4C8QA 1V76A 2L5QA 4Y28E 3UATA 1TUDA 3FJPA 4C0FA 2HL5C 1OZ3A 4WF2A 1OI1A 1X6GA 3QG1A 2K5LA 3M5AA 3OW2S 3EFRA 2O9VA 5AT1B 3NHNA 3TSZA 1RLPC 1AEYA 2WSCE 2DKGA 5LJ5f 2F5KA 2COWA 1NBEB 5IHNA 3OYNA 2F69A 5GANe 3CD6Q 1OZ2A 1MNDA 4PFPA 4PJOG 1OYXA 4PFOA 4AFUC 2ZPBB 4C92F 3D7SB 3M53A 3PTAA 2LZ6B 4JJCA 4NL2A 4E7IA 3CCLA 3JCMc 1YJWQ 2PVGB 3KFVA 4BI3A 4OMPA 2P0QA 5GMKm 3QYGB 1IB8A 3S3MA 1M2VA 5KYXB 1KC8U 4QKUA 2QEXA 3CPFA 3X24B 3NTIA 1UDLA 8AT1B 3RUXA 2A28A 3HPWA 2MYSA 4PKCC 4HCZA 2QGFB 2JS0A 3CCJA 3EG2A 5LJ5e 2DYIA 4LDWA 2RQUA 4QT7A 2DVJA 1BI3A 3GOXA 1KG1A 2DIQA 3AT1B 4FL6A 4IURA 3UDCA 4N0AA 3MKDA 3OYMA 2DTOA 4M78G 2A08A 2LP5A 1FMWA 3GBQA 4J9BA 1UB4A 3N5BB 4J7IA 1VQ6T 3HTRA 3JCMh 2C06A 1WHJA 2CP3A 2KEAA 3FEOA 3M9QA 2CYZB 2ATCB 5AYFA 2KSSA 3EHRA 3OYHA 3CMAA 3CC4T 3M57A 2DETA 1Q81U 2O88A 5EC7A 3OS1A 4CI0C 1C1AA 3BDUA 1UFFA 3C95A 4MDXA 1BYMA 3VS0A 1WHMA 1M1KC 3CC7Q 4M7DE 8ATCB 4M75B 3I9QA 1YI2A 1Q81R 5IT9E 3CCQA 2OX7A 3R6OA 2DVEA 4M75C 1RAGB 3P8HA 1VQ5A 3JCMf 1ZX6A 4X9CA 2K2MA 4PJOD 3INZA 3VS1A 2VV5A 1OULA 1UG1A 4XTVA 4FYXB 3ZFJA 1D0XA 4M7AB 3V7CA 1PKSA 2ECZA 4E47A 5I22A 4M7AC 3FJ5A 3EFOA 3JRZA 2GQIA 4DOVA 1GFCA 3RNJA 3DKMA 1TXQA 5DLQE 5FU6B 4LDUA 2RD1A 4M77F 2B8AA 2I2LA 4HCKA 1WJQA 1WJSA 1AD5A 2X4JA 5FU6C 2QASA 1QVGS 4DEXA 1VQ9T 2QYZA 4VUBA 3MCAB 2KNBB 3A8OB 1I8FA 1TUGB 5FU7B 3OW2A 4X34A 5A0LA 4MMLA 5GAOn 1NPPA 3O8VA 2C0TA 5FU7C 4C8QE 2MWPA 1VYTA 4FW2A 4J9IA 3QWXX 3OYBA 3JCMe 3J81E 4M78D 5KH6A 2XDDA 1NM7A 1MMNA 2M51A 2VUBA 1LPLA 1PRMC 2XICA 4BE1A 1MMDA 1QCOA 3GPLA 1VQOQ 2LNVA 1I81A 4DQ2A 1BIAA 3OYAA 2HDAA 2CGHA 3P8DA 2VYTA 3S3NA 2NWMA 2FPFA 5IXFA 7AT1B 1M9SA 1JU5C 1H641 1K9MU 2XMFA 2X4WA 2JXBA 1VQNT 1WQ7A 4J6WA 2L3SA 2NUZA 1X6OA 3MP8A 1W6XA 3JCMb 1K9MR 1QWEA 2JS2A 3PIOA 1O75A 2CUDA 5CIUA 4B9WA 1WHLA 2RHYA 1ZHIA 4C0GA 3M0TA 3VS3A 1AWOA 4OMOA 5C6SA 3REBB 1KQSS 3O5ZA 1XQHA 4IUVA 4LDYA 2DO3A 4B9XA 2H3JA 2RMOA 5LL6S 1PHTA 2CDTA 3G71Q 2FG0A 1KJWA 2BZXA 2X3XD 4JLIA 2DD4A 1IGUA 2DK3A 3LGLA 2FRYA 1VQ7T 2K3XA 1RLQC 1WZOA 2AKKA 1TOVA 1W1FA 3TREA 3C4SA 5GMKj 3LH5A 1VQLT 1RAHB 2DFUA 1NG2A 3FB9A 3CXCA 3JSCA 4JS5A 2AHJB 5M9OA 4FSXA 5GMKi 4NL3A 3QPHA 2K6DA 2EGEA 2QDLA 1B34B 1VYVA 1RI0A 2C0OA 2LDMA 5A2QE 2X4XA 3VKIA 3MO8A 1NJIC 1M27C 2F1LA 2LX9A 1VQ6A 2GFUA 2EKHA 1AZEA 3JB9I 2EYZA 5KYNA 4OMLA 1B07A 3GIBA 1HXDA 3NPFA 2EYWA 2AIRB 3FC3A 4KUIA 3VS2A 2KY9A 3VS6A 3EGXA 1MV0B 3CC4A 3G6ET 3ME9A 2K57A 3DLMA 2IIMA 1GCQA 4F7UF 2ESWA 1K1ZA 4JRPA 4HT8A 4A4HA 3UT1A 4J5YA 2DTHA 1D0YA 1OV3A 3WVEB 3E9FA 4C0ZA 4C5GA 1Y7XA 2DA9A 1SHGA 3RBBB 4BI4A 3A1PA 2PUKB 1VQ4Q 2FYKA 4BUGA 5IAYA 4BY6B 5J3BA 1NLPC 4EMKA 1BI2A 1AWWA 2EJFA 4BY6C 1T3SA 3PMTA 1KHIA 3L2UA 4RTYA 4E2FB 4RMOA 5GMKl 2FL7A 3P8BB 3HRTA 2R57A 2WSFE 5I2SA 2V8IA 3OW2P 5D6XA 3H6ZA 1VQ9A 4M78A 2XKOC 4II1A 1BIBA 5DY9A 1QLYA 5GANj 1VQKQ 4N4HA 3SHWA 2ZAEA 2EQIA 1K9MC 5CVIA 1H3HA 4Y92A 1JXOA 3L2RA 1X01A
chains in the Genus database with same CATH topology
2D0NA 3UF4A 2HEQA 1KIKA 2JT4A 1SRMA 2LJ0A 1AWJA 2SRCA 4JJDA 1IO6A 1OPLA 2KROA 3IQLA 4R0KA 5GJWB 3M0QA 4KRTA 1UJ0A 2CT4A 2ROTA 2RQVA 2YSQA 1PRLC 2OI3A 2FEIA 2FO0A 4AG2C 1YP5A 1H8KA 2LX7A 2KXDA 4J9DA 1K4US 1K0SA 2EGAA 1UHCA 2L2PA 1WYXA 2DL4A 2RQWA 1M8MA 2DL8A 3EHQA 1WDXA 4GBQA 1ABQA 1YWPA 4CC3A 2GTOA 1QCFA 4Z88A 2YUOA 2LQNA 1TG0A 2DX1A 1WLPB 2D8HA 1S1NA 4HVWA 2F2XA 3VRZA 4F16A 4A63B 5ECAA 2AK5A 3UATA 1TUDA 1PKTA 1TUCA 1ZBJA 3VS5A 4D8KA 2LJ1A 1X6GA 2CH4A 2EGCA 4IIMA 1LCKA 2L3PA 3H41A 4Z89A 2D1XA 2KXCA 1M3AA 1T0JA 2SEMA 2O9VA 1X6BA 3NHNA 2DL7A 3TSZA 2RF0A 1RLPC 1AEYA 1GCPA 1PWTA 5IHNA 4CC4B 2FPDA 4RTZA 1YNZA 2RPNA 3I5RA 2V1RA 1NEBA 1ABOA 1GL5A 4RUGA 2ENMA 2O2OA 4AFUC 2DRMA 2OJ2A 2YUPA 1G2BA 4HVVA 3M0PA 2LZ6B 4CC2A 4JJCA 1OOTA 3R6NA 2KRNA 1ZSGA 1T0HA 2B86A 3KFVA 1WX6A 4OMPA 2YT6A 3CQTA 1X69A 2KRSA 4M4ZA 4ZNXA 2EPDA 1AOJA 1CKBA 1E7OA 1UDLA 1ZUYA 1WIEA 2A28A 1X43A 1ZUUA 1YCSB 2JS0A 3EG2A 1UTIA 4OMNA 4QT7A 2RQUA 5IHIA 4RTTA 2DVJA 4K11A 4EIKA 2GNCA 1JQQA 2E5KA 1WXBA 1WFWA 3U23A 2A08A 1W70A 2LP5A 3GBQA 1K76A 4J9GA 4J9BA 1NYGA 4J9FA 2ABLA 2GGRA 2CT3A 2P4RA 1HD3A 4F14A 2KEAA 2J6FA 1VA7A 4OMMA 3H0FA 1GRIA 2DYBA 4LNPA 4CC7A 3EHRA 1BBZA 4WCIA 4Z8AA 2O88A 5EC7A 3PVQA 1M3CA 2RQRA 1UFFA 3VS0A 2O31A 2FRWA 1Z9ZA 1U5SA 3PE0A 1HJDA 3I35A 1M30A 2L0AA 3I9QA 3M0UA 1VYUA 1GCQC 2K7AA 2K9GA 4J9EA 1MUZA 3TSWA 1PNJA 1ZX6A 2HBWA 1ARKA 2DF6A 2K2MA 3VS1A 5IH2A 4AG1C 1UG1A 4JZ4A 2EW3A 3VRYA 1FYNA 2KGTA 2CUBA 1KFZA 1PKSA 2ECZA 5I22A 2M0YA 3FJ5A 2KT1A 1Z9QA 2GQIA 2YUQA 1AZGB 1GFCA 5FWBA 1BB9A 3RNJA 2BZYA 2KR3A 3VS7A 1T3LA 2KRMA 2W0ZA 2CREA 4HCKA 3M0RA 1K9AA 2JW4A 2V1QA 2EYXA 1AD5A 2J06A 2FPEA 4DEXA 1RUWA 2LQWA 1MV3A 2LMJA 2KNBB 2K3BA 2KE9A 1G83A 1GFDA 2CSIA 4OMQA 1GBRA 1K0XA 3M0SA 1FMKA 2C0TA 1VYTA 4J9IA 1SHFA 2BZ8A 2EYYA 2HCKA 3REAB 2MOXA 3ZL7C 4ESRA 3QWXX 2VWFA 1NM7A 4JPBW 4E6RA 2M51A 4FSSA 2DNUA 2DL5A 1JEGA 2GBQA 1I0CA 1PRMC 1YN8A 2MIOA 1I1JA 2H8HA 2PNIA 2HDAA 2ED1A 3TVTA 4AFQC 2EBPA 2NWMA 2KYBA 2FPFA 2KYMA 5IXFA 1JU5C 1RI9A 2AKLA 2XMFA 2JXBA 2J05A 4X1VA 2GTJA 1SEMA 2X3WD 2L3SA 2NUZA 1N5ZA 1W6XA 2G6FX 2RN8A 1KSWA 1EFNA 1YWOA 3THKA 1AVZC 1B3QA 1Y0MA 2LNHB 1QWEA 2JS2A 1OPKA 2AZVA 4GLMA 2DE0X 5I11A 2CUDA 2JM9A 1NYFA 1QKXA 4ORZA 4D8DA 2RQTA 1U3OA 2JM8A 1BK2A 2DL3A 1V1CA 1UJYA 3M0TA 4LUDA 3A98A 1CSKA 2CSQA 3VS3A 1AWOA 4OMOA 4HVUA 1WXUA 2VKNA 3REBB 3O5ZA 2F2VA 2DBKA 1SPKA 1HSQA 4JZ3A 4DEYA 3ULRB 2OAWA 2RMOA 3I5SA 1PHTA 2CDTA 3QWYA 1GBQA 2FG0A 1CKAA 2KT8A 1KJWA 2BZXA 2X3XD 4F17A 3PVLA 5IXBA 3JV3A 2JTEA 1AWXA 2CH4W 1JO8A 1E6GA 4RTWA 1UHFA 2FRYA 1RLQC 2PZ1A 2ROLA 2AKKA 4RTUA 2J6KA 1NEGA 1M3BA 3LH5A 1UGVA 1X2KA 2DBMA 2AZSA 1NG2A 4AFZC 5IHKA 4RTXA 3H0IA 4IIOA 1UUEA 1SSHA 2D8JA 1NLOC 1JXMA 1I07A 2K6DA 4J9CA 1Y57A 1QKWA 2EGEA 1QWFA 1J3TA 3H0HA 1H92A 2MCNA 4AFSC 2QDLA 1OEBA 1VYVA 2C0OA 2BTTA 2I0NA 4LN2A 2KBTA 1M27C 2JMAA 4LUEA 5GJVB 2L3QA 1ZLMA 2DM1A 2EKHA 1AZEA 2EYZA 3C0CA 4OMLA 2A37A 1B07A 3NPFA 2DLPA 2EYWA 1WA7A 2DRKA 3SEMA 2YUNA 3VS2A 3VS6A 4LE9A 1MV0B 2HSPA 2YDLA 1A0NB 2IIMA 1GCQA 2ESWA 1K1ZA 2A36A 2J7IA 2F2WA 2DJQA 1X2QA 2EVRA 1OV3A 1WI7A 3VS4A 2DA9A 1SHGA 3RBBB 2O9SA 2W10A 1XOVA 1E6HA 5FWCA 4J9HA 2ED0A 5L23A 3NMZC 3EGUA 1UECA 1NLPC 2DMOA 3NGPA 4JJBA 1AWWA 2J6OA 2K79A 1T3SA 2C0IA 4RTYA 3EG3A 1WXTA 2DILA 1UE9A 3UA6A 2JMCA 1U06A 3EG0A 1ZUKA 1BU1A 4HXJA 2VVKA 3UA7A 5HCKA 2RNAA 3EG1A 2PTKA 1QLYA 2LCSA 3SHWA 4RTVA 2LJ3A 1SRLA 2EQIA 1H3HA 4Y92A 1JXOA 1X27A 5FW9A 1W1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0N A;  3UF4 A;  2HEQ A;  1KIK A;  2JT4 A;  1SRM A;  2LJ0 A;  1AWJ A;  2SRC A;  4JJD A;  1IO6 A;  1OPL A;  2KRO A;  3IQL A;  4R0K A;  5GJW B;  3M0Q A;  4KRT A;  1UJ0 A;  2CT4 A;  2ROT A;  2RQV A;  2YSQ A;  1PRL C;  2OI3 A;  2FEI A;  2FO0 A;  4AG2 C;  1YP5 A;  1H8K A;  2LX7 A;  2KXD A;  4J9D A;  1K4U S;  1K0S A;  2EGA A;  1UHC A;  2L2P A;  1WYX A;  2DL4 A;  2RQW A;  1M8M A;  2DL8 A;  3EHQ A;  1WDX A;  4GBQ A;  1ABQ A;  1YWP A;  4CC3 A;  2GTO A;  1QCF A;  4Z88 A;  2YUO A;  2LQN A;  1TG0 A;  2DX1 A;  1WLP B;  2D8H A;  1S1N A;  4HVW A;  2F2X A;  3VRZ A;  4F16 A;  4A63 B;  5ECA A;  2AK5 A;  3UAT A;  1TUD A;  1PKT A;  1TUC A;  1ZBJ A;  3VS5 A;  4D8K A;  2LJ1 A;  1X6G A;  2CH4 A;  2EGC A;  4IIM A;  1LCK A;  2L3P A;  3H41 A;  4Z89 A;  2D1X A;  2KXC A;  1M3A A;  1T0J A;  2SEM A;  2O9V A;  1X6B A;  3NHN A;  2DL7 A;  3TSZ A;  2RF0 A;  1RLP C;  1AEY A;  1GCP A;  1PWT A;  5IHN A;  4CC4 B;  2FPD A;  4RTZ A;  1YNZ A;  2RPN A;  3I5R A;  2V1R A;  1NEB A;  1ABO A;  1GL5 A;  4RUG A;  2ENM A;  2O2O A;  4AFU C;  2DRM A;  2OJ2 A;  2YUP A;  1G2B A;  4HVV A;  3M0P A;  2LZ6 B;  4CC2 A;  4JJC A;  1OOT A;  3R6N A;  2KRN A;  1ZSG A;  1T0H A;  2B86 A;  3KFV A;  1WX6 A;  4OMP A;  2YT6 A;  3CQT A;  1X69 A;  2KRS A;  4M4Z A;  4ZNX A;  2EPD A;  1AOJ A;  1CKB A;  1E7O A;  1UDL A;  1ZUY A;  1WIE A;  2A28 A;  1X43 A;  1ZUU A;  1YCS B;  2JS0 A;  3EG2 A;  1UTI A;  4OMN A;  4QT7 A;  2RQU A;  5IHI A;  4RTT A;  2DVJ A;  4K11 A;  4EIK A;  2GNC A;  1JQQ A;  2E5K A;  1WXB A;  1WFW A;  3U23 A;  2A08 A;  1W70 A;  2LP5 A;  3GBQ A;  1K76 A;  4J9G A;  4J9B A;  1NYG A;  4J9F A;  2ABL A;  2GGR A;  2CT3 A;  2P4R A;  1HD3 A;  4F14 A;  2KEA A;  2J6F A;  1VA7 A;  4OMM A;  3H0F A;  1GRI A;  2DYB A;  4LNP A;  4CC7 A;  3EHR A;  1BBZ A;  4WCI A;  4Z8A A;  2O88 A;  5EC7 A;  3PVQ A;  1M3C A;  2RQR A;  1UFF A;  3VS0 A;  2O31 A;  2FRW A;  1Z9Z A;  1U5S A;  3PE0 A;  1HJD A;  3I35 A;  1M30 A;  2L0A A;  3I9Q A;  3M0U A;  1VYU A;  1GCQ C;  2K7A A;  2K9G A;  4J9E A;  1MUZ A;  3TSW A;  1PNJ A;  1ZX6 A;  2HBW A;  1ARK A;  2DF6 A;  2K2M A;  3VS1 A;  5IH2 A;  4AG1 C;  1UG1 A;  4JZ4 A;  2EW3 A;  3VRY A;  1FYN A;  2KGT A;  2CUB A;  1KFZ A;  1PKS A;  2ECZ A;  5I22 A;  2M0Y A;  3FJ5 A;  2KT1 A;  1Z9Q A;  2GQI A;  2YUQ A;  1AZG B;  1GFC A;  5FWB A;  1BB9 A;  3RNJ A;  2BZY A;  2KR3 A;  3VS7 A;  1T3L A;  2KRM A;  2W0Z A;  2CRE A;  4HCK A;  3M0R A;  1K9A A;  2JW4 A;  2V1Q A;  2EYX A;  1AD5 A;  2J06 A;  2FPE A;  4DEX A;  1RUW A;  2LQW A;  1MV3 A;  2LMJ A;  2KNB B;  2K3B A;  2KE9 A;  1G83 A;  1GFD A;  2CSI A;  4OMQ A;  1GBR A;  1K0X A;  3M0S A;  1FMK A;  2C0T A;  1VYT A;  4J9I A;  1SHF A;  2BZ8 A;  2EYY A;  2HCK A;  3REA B;  2MOX A;  3ZL7 C;  4ESR A;  3QWX X;  2VWF A;  1NM7 A;  4JPB W;  4E6R A;  2M51 A;  4FSS A;  2DNU A;  2DL5 A;  1JEG A;  2GBQ A;  1I0C A;  1PRM C;  1YN8 A;  2MIO A;  1I1J A;  2H8H A;  2PNI A;  2HDA A;  2ED1 A;  3TVT A;  4AFQ C;  2EBP A;  2NWM A;  2KYB A;  2FPF A;  2KYM A;  5IXF A;  1JU5 C;  1RI9 A;  2AKL A;  2XMF A;  2JXB A;  2J05 A;  4X1V A;  2GTJ A;  1SEM A;  2X3W D;  2L3S A;  2NUZ A;  1N5Z A;  1W6X A;  2G6F X;  2RN8 A;  1KSW A;  1EFN A;  1YWO A;  3THK A;  1AVZ C;  1B3Q A;  1Y0M A;  2LNH B;  1QWE A;  2JS2 A;  1OPK A;  2AZV A;  4GLM A;  2DE0 X;  5I11 A;  2CUD A;  2JM9 A;  1NYF A;  1QKX A;  4ORZ A;  4D8D A;  2RQT A;  1U3O A;  2JM8 A;  1BK2 A;  2DL3 A;  1V1C A;  1UJY A;  3M0T A;  4LUD A;  3A98 A;  1CSK A;  2CSQ A;  3VS3 A;  1AWO A;  4OMO A;  4HVU A;  1WXU A;  2VKN A;  3REB B;  3O5Z A;  2F2V A;  2DBK A;  1SPK A;  1HSQ A;  4JZ3 A;  4DEY A;  3ULR B;  2OAW A;  2RMO A;  3I5S A;  1PHT A;  2CDT A;  3QWY A;  1GBQ A;  2FG0 A;  1CKA A;  2KT8 A;  1KJW A;  2BZX A;  2X3X D;  4F17 A;  3PVL A;  5IXB A;  3JV3 A;  2JTE A;  1AWX A;  2CH4 W;  1JO8 A;  1E6G A;  4RTW A;  1UHF A;  2FRY A;  1RLQ C;  2PZ1 A;  2ROL A;  2AKK A;  4RTU A;  2J6K A;  1NEG A;  1M3B A;  3LH5 A;  1UGV A;  1X2K A;  2DBM A;  2AZS A;  1NG2 A;  4AFZ C;  5IHK A;  4RTX A;  3H0I A;  4IIO A;  1UUE A;  1SSH A;  2D8J A;  1NLO C;  1JXM A;  1I07 A;  2K6D A;  4J9C A;  1Y57 A;  1QKW A;  2EGE A;  1QWF A;  1J3T A;  3H0H A;  1H92 A;  2MCN A;  4AFS C;  2QDL A;  1OEB A;  1VYV A;  2C0O A;  2BTT A;  2I0N A;  4LN2 A;  2KBT A;  1M27 C;  2JMA A;  4LUE A;  5GJV B;  2L3Q A;  1ZLM A;  2DM1 A;  2EKH A;  1AZE A;  2EYZ A;  3C0C A;  4OML A;  2A37 A;  1B07 A;  3NPF A;  2DLP A;  2EYW A;  1WA7 A;  2DRK A;  3SEM A;  2YUN A;  3VS2 A;  3VS6 A;  4LE9 A;  1MV0 B;  2HSP A;  2YDL A;  1A0N B;  2IIM A;  1GCQ A;  2ESW A;  1K1Z A;  2A36 A;  2J7I A;  2F2W A;  2DJQ A;  1X2Q A;  2EVR A;  1OV3 A;  1WI7 A;  3VS4 A;  2DA9 A;  1SHG A;  3RBB B;  2O9S A;  2W10 A;  1XOV A;  1E6H A;  5FWC A;  4J9H A;  2ED0 A;  5L23 A;  3NMZ C;  3EGU A;  1UEC A;  1NLP C;  2DMO A;  3NGP A;  4JJB A;  1AWW A;  2J6O A;  2K79 A;  1T3S A;  2C0I A;  4RTY A;  3EG3 A;  1WXT A;  2DIL A;  1UE9 A;  3UA6 A;  2JMC A;  1U06 A;  3EG0 A;  1ZUK A;  1BU1 A;  4HXJ A;  2VVK A;  3UA7 A;  5HCK A;  2RNA A;  3EG1 A;  2PTK A;  1QLY A;  2LCS A;  3SHW A;  4RTV A;  2LJ3 A;  1SRL A;  2EQI A;  1H3H A;  4Y92 A;  1JXO A;  1X27 A;  5FW9 A;  1W1F A; 
#chains in the Genus database with same CATH topology
 3UF4 A;  3C12 A;  2E70 A;  2HEQ A;  3RDV A;  2JT4 A;  2CP0 A;  1AWJ A;  4JJD A;  3QBY A;  4R0K A;  4JRK A;  5GJW B;  2KVQ G;  4KRT A;  1UJ0 A;  2ROT A;  2RQV A;  1VQP Q;  4MZM A;  1PRL C;  4OB2 B;  3PGG A;  1R8O B;  1I5L A;  5LJ3 d;  1KQS A;  5GMK h;  2HL3 A;  2O4X A;  2EYQ A;  2VGN A;  2KXD A;  3CCM Q;  5GAM g;  1PM3 A;  4J7F A;  2DJZ A;  2EGA A;  5CR2 A;  3OYJ A;  2DL4 A;  1WDX A;  3G7Z A;  1YWP A;  1VQ8 Q;  5LJ5 j;  1VQN A;  1YJ9 T;  2DX1 A;  4KH1 B;  2D8H A;  3J80 E;  2F2X A;  4F16 A;  2M16 A;  4IUQ A;  4ZGJ B;  3MHX A;  3PT9 A;  4C0D B;  1ZBJ A;  3TQ7 P;  3MEW A;  2YWW A;  2QTX A;  4C0D C;  2L3P A;  5CKE A;  1DJ7 B;  1SG5 A;  1T0J A;  1X6B A;  3CCU Q;  2DL7 A;  4M7A D;  2GQV A;  4EMK B;  2RK1 A;  3RMS A;  1N9S A;  2MWO A;  4C92 G;  4CC4 B;  3A8M B;  2JUF A;  4EMG A;  2LQ8 A;  4R55 A;  2RHX A;  2CP6 A;  2YLB A;  4RUG A;  3QYH B;  1VQM Q;  2ENM A;  4FYY B;  2O2O A;  1SSF A;  4L59 A;  4N4I A;  2OJ2 A;  2YUP A;  4LDX A;  4D6W A;  1VQ7 A;  3CXC P;  4JUV A;  3UPU A;  4NOY A;  1PSF A;  2JNG A;  1VQL A;  2OTL T;  1LNX A;  1T0H A;  2JTF A;  2B86 A;  4CRI A;  1R0B G;  3OQ5 A;  2KRS A;  3MEV A;  4M75 F;  3RIR A;  4M4Z A;  4ZNX A;  2EPD A;  3LYI A;  4PJO E;  1CKB A;  1HK9 A;  2L8D A;  1ZUU A;  2FZK B;  2LT1 A;  3CCS Q;  1K8A C;  5CKH A;  1BCM A;  2PQW A;  4IKF A;  3EG9 A;  2ZPF B;  3BDL A;  3ASK A;  3KXT A;  3CCE T;  4M7A F;  3I55 T;  4EIK A;  2OTJ Q;  1WFW A;  2QTV A;  3OYE A;  1QVG P;  1UGS B;  1EX4 A;  4J9G A;  1NYG A;  4J9F A;  4XTX A;  2CP5 A;  2NYS A;  2P4R A;  3G6E A;  1JRI A;  4F14 A;  2J6F A;  2LT4 A;  1VA7 A;  4OMM A;  3H0F A;  2DYB A;  1QVF S;  1ZSZ A;  1BBZ A;  4DBR A;  2LVM A;  3I56 T;  4WCI A;  4Z8A A;  2RQR A;  2LC4 A;  3JCM X;  4M78 E;  2O31 A;  1QQJ A;  2MI6 A;  5LJ5 h;  1HJD A;  1WPY A;  1V29 B;  1VYU A;  4RG8 A;  1RAF B;  3VYH B;  4J9E A;  1YIJ Q;  4M77 G;  3TSW A;  1PNJ A;  2HBW A;  2RJD A;  4A54 A;  1O9S A;  4ZTJ A;  1YIT T;  2MPX C;  2EW3 A;  3VRY A;  3OS2 A;  1N6A A;  3HRS A;  5CQX A;  2K5I A;  2KT1 A;  1Z9Q A;  2YUQ A;  1AZG B;  3OYL A;  1T3L A;  3QKJ A;  4PFZ A;  2W0Z A;  2CRE A;  1K9A A;  2FPE A;  3OBW A;  2FVU A;  4P5N A;  3HRU A;  1GFD A;  4QQG A;  2QA4 T;  1GBR A;  3NTH A;  1FMK A;  1KQS P;  2CKK A;  2ZPI B;  4MZP A;  3SWN A;  3LH0 A;  4M7D B;  2HCK A;  4M7D C;  1WHH A;  2JZ2 A;  4JPB W;  3LW5 E;  4XU2 A;  4FSS A;  3A8G B;  2DL5 A;  2MIO A;  2D0Q B;  1I1J A;  4YTL A;  1AHJ B;  2EBP A;  1YJ9 A;  2KYB A;  1PC0 A;  3CME T;  1ZSZ B;  1ZA2 B;  5GAN 3;  1Y07 A;  1Q95 G;  1ZSZ C;  3TCJ A;  1NE8 A;  2AKL A;  1KK7 A;  4OMF B;  2J05 A;  3VUZ A;  4X1V A;  3MPU B;  3X28 B;  3M4Y A;  2X3W D;  3G4S Q;  3FIF A;  1KSW A;  2HNI A;  1EFN A;  2VC8 A;  3THK A;  2LNH B;  3S6W A;  2AZV A;  3URG A;  4GLM A;  4M77 D;  1S72 T;  3CC2 Q;  3FRN A;  1NYF A;  1P92 A;  4C8Q B;  4RG2 A;  4ORZ A;  5KYU A;  4C8Q C;  1BK2 A;  2DL3 A;  1D09 B;  2LRQ A;  3QSU A;  4LUD A;  2QQA A;  2YRV A;  4HVU A;  1M1F A;  1YHQ T;  3OYY A;  5KYW A;  3CCV T;  2E6N A;  2VKN A;  4O6J A;  2YXY A;  5KCO A;  5GAM d;  2CP7 A;  4JZ3 A;  3CXC S;  1GBQ A;  2OAU A;  1ZQ1 A;  3SB2 A;  2KT8 A;  3PVL A;  2MK5 A;  1QVF A;  1NJI U;  5GAO m;  2JTE A;  2CH4 W;  2OTL A;  1JO8 A;  4RTW A;  2X35 A;  1UHF A;  5HKC A;  5LJ3 g;  5GAN 8;  4WTO B;  2J6K A;  1M3B A;  1UGV A;  1X2K A;  1D3B A;  4AFZ C;  1NJI R;  3H0I A;  4J83 A;  3OSV A;  1PG5 B;  1UUE A;  3MP1 A;  2D8J A;  3CCR T;  2V8K A;  3T9N A;  1JXM A;  5D6W A;  4J6X A;  3OS0 A;  4XU1 A;  2A0F B;  1QKW A;  3CCE A;  3H0H A;  2PUO B;  2Y4X A;  3I55 A;  2R5M A;  1H92 A;  2MCN A;  3RMQ A;  4F7U G;  1M2V B;  1N8R U;  4ELZ C;  2KBT A;  1PCX A;  1IZ6 A;  2L3Q A;  2XHC A;  3VU3 C;  5KYY A;  4C92 A;  2RI2 A;  4DOW A;  1BKB A;  1I5O B;  5I21 A;  3FDR A;  1N8R R;  2DLP A;  1WQW A;  1WA7 A;  3SEM A;  3CEY A;  3JCM P;  3RKW A;  1TU0 B;  2DXB A;  3I56 A;  1M5Q 1;  3E9G A;  4LDV A;  2VXF A;  1ZBX A;  4ATO A;  2A36 A;  2EJ9 A;  2J7I A;  4N0A C;  3CBP A;  3JCM Q;  1X2Q A;  2BE7 D;  2EVR A;  5GAO r;  3RES A;  2ZCF B;  1OU9 A;  5KYU B;  4LD9 K;  1RAD B;  1D1B A;  2RI5 A;  1YJN Q;  2O9S A;  1N27 A;  1XOV A;  3CD6 T;  1VIF A;  3GF5 A;  5KYW B;  2ED0 A;  5L23 A;  3NMZ C;  3A5Z B;  1YIT A;  2XDB A;  2LTO A;  2E4H A;  4A53 A;  2K79 A;  4E7H A;  2C0I A;  2E64 A;  4ZN3 A;  4XTU A;  1WXT A;  2DIL A;  2BE9 B;  2E6Z A;  2JMC A;  2E3I A;  1YJW T;  1ZUK A;  3LWH A;  1JB0 E;  5CCA A;  4FCY A;  5LJ3 f;  1D3B B;  4XTZ A;  3EG1 A;  2QA4 A;  3EFO B;  3ER0 A;  5FW9 A;  3CBO A;  4E7S A;  3NTK A;  3X25 B;  1TSF A;  2QAZ A;  2JJ9 A;  1SRM A;  3OYG A;  1IO6 A;  2LCC A;  3X26 B;  3C94 A;  3L2V A;  3M0Q A;  3VV0 A;  3PMI A;  1IRE B;  5KYY B;  3CCL Q;  2BUD A;  2QDY B;  2CP2 A;  4AG2 C;  2LX7 A;  3FLG A;  2QEX Q;  2L2P A;  1M8M A;  4M77 A;  2DL8 A;  2LCL A;  3EHQ A;  3MJX A;  2RK2 A;  2RJE A;  3CCJ Q;  3UWN A;  4Z88 A;  2YUO A;  3WVD B;  1TG0 A;  3CPW A;  4QQD A;  3CC7 T;  2YHT A;  1S1N A;  3VRZ A;  4L5G A;  5ECA A;  2RO0 A;  2AK5 A;  2P4T A;  2MAM A;  1HYO A;  3OSS C;  3VS5 A;  3OYC A;  3M54 A;  2KQW A;  1PD1 A;  4IIM A;  1F1B B;  2EGC A;  1S72 A;  3DB4 A;  3ZBD A;  2NUP A;  2KXC A;  1M3A A;  1ACM B;  2SEM A;  1JJ2 A;  3RER A;  4KUD K;  1Y71 A;  4BE2 A;  2HAX A;  2DXC A;  1YHQ A;  2EQM A;  1GCP A;  3CCV A;  3CMA Q;  4ZTF A;  2FPD A;  4PJO A;  4RTZ A;  5A0G A;  2RPN A;  3JCM d;  3I5R A;  5KE3 A;  1QVF P;  1N8R C;  4M75 G;  1K8A U;  1YI2 Q;  1Y96 A;  3CCQ Q;  1G2B A;  3GNG A;  4HVV A;  1VQ5 Q;  2E10 A;  3M0P A;  4C92 E;  2R5A A;  4CC2 A;  4M7D D;  1K8A R;  1OOT A;  4M7A G;  1M2O A;  2KRN A;  1ZSG A;  3EGD A;  1WX6 A;  1W2B A;  1Q7Y U;  2YT6 A;  2IPO B;  3OY9 A;  4A4E A;  2HQE A;  5CAI A;  2DZC A;  3CCR A;  1E7O A;  1VQO T;  1X43 A;  2VGM A;  2XID A;  1YCS B;  1XJW B;  1QCN A;  1Q7Y R;  4FIB A;  5DLO A;  4OMN A;  4OF1 A;  5IHI A;  3V8K A;  1RAC B;  2GNC A;  2E5K A;  3MP6 A;  4KH0 B;  1W70 A;  1K76 A;  3KUF A;  2QI2 A;  2ABL A;  4BAC A;  2GGR A;  1M4Z A;  3GP8 A;  2VB6 A;  1M1G A;  4C8Q D;  3CBM A;  3QII A;  4JDS A;  3PVQ A;  5L8R E;  1OQK A;  3QHS A;  2XD0 A;  4M7D F;  3CD6 A;  3EGX B;  2KMT A;  2FRW A;  1Z9Z A;  3LLR A;  3PE0 A;  4PLL A;  4PJO B;  3I35 A;  2L0A A;  1NZ9 A;  3M0U A;  3HSB A;  1GCQ C;  2K7A A;  4PJO C;  2WSE E;  1MUZ A;  2JOY A;  3G71 T;  3V7R A;  2DF6 A;  5GAO l;  4FM4 B;  5CKF A;  2X4Y A;  4M75 D;  5IH2 A;  4AG1 C;  2ZGW A;  4JZ4 A;  4X9D A;  2CS7 A;  4XQ3 A;  1D1C A;  2KGT A;  2CUB A;  1KFZ A;  2VXE A;  1Y96 B;  1YJW A;  2AT1 B;  3QO3 A;  2M0Y A;  2E1H A;  1JBM A;  5FWB A;  1BB9 A;  1G3Y A;  3VS7 A;  2KRM A;  1B7T A;  4EMK C;  1EIF A;  2MMP A;  2JW4 A;  2V1Q A;  2EYX A;  4E7Z A;  4M77 E;  1RUW A;  2LQW A;  1MV3 A;  2KE9 A;  2CSI A;  4C8Q F;  3DB3 A;  3G1J A;  5GAN g;  4M78 B;  2DZ9 A;  2BZ8 A;  4QVD A;  2EYY A;  4M78 C;  4XTY A;  4ESR A;  5GAM h;  3X20 B;  2D6F A;  2VWF A;  3TEE A;  5CKB A;  4RCC A;  3MEA A;  2Z0W A;  2DNU A;  1BI1 A;  1JEG A;  2CZ0 B;  4FW1 A;  1YN8 A;  2M02 A;  3HFN A;  4FT2 A;  3LX7 A;  3L2Q A;  2ED1 A;  3TVT A;  2RI3 A;  1QMC A;  2KYM A;  4KGZ B;  4IUT A;  3CC7 A;  2O4X B;  1RI9 A;  2HD0 A;  5LJ5 g;  5FRN A;  4NS5 A;  2O01 E;  1WJR A;  1JJ2 P;  1QP3 A;  1RAA B;  2GTJ A;  1IXD A;  1VQ4 T;  2V26 A;  1RAB B;  5GAM f;  2IVW A;  1U8R A;  1VQ6 Q;  2RN8 A;  4E7L A;  1AVZ C;  4DBH A;  4PJL A;  1B3Q A;  1Y0M A;  4QQ6 A;  2EJG A;  3PIP A;  3QDR B;  2DE0 X;  5I11 A;  1WHG A;  1QKX A;  1Q7Y C;  2RB6 A;  1TWB A;  2V8J A;  2JM8 A;  2COY A;  3CC4 Q;  3VUB A;  3JCM W;  2A7Y A;  1WHK A;  2CSQ A;  3PFS A;  1C6V X;  1SPK A;  5FLX E;  1OU8 A;  5GAN 4;  1VQK T;  2P0P A;  2E3H A;  2NUT A;  3I5S A;  3QWY A;  2RM4 A;  1WNL A;  5KYX A;  1W2B P;  1VIE A;  3JV3 A;  1UGQ B;  2KAF A;  4ZGE B;  1E6G A;  4BB7 A;  3EH2 A;  3SFM A;  1VQP T;  2HZY A;  5GAM e;  4RTU A;  1LVK A;  2L89 A;  1G3S A;  2RH2 A;  5IHK A;  1VQO A;  2K5F A;  4PK4 A;  3CCM T;  5A0D A;  1NLO C;  4HA8 A;  3S3O A;  1I07 A;  1VQ9 Q;  3H9N A;  4A4F A;  1QP2 A;  4AFS C;  1VQ8 T;  1Q86 U;  2I0N A;  3OBY A;  2VAS A;  1UGR B;  2JMA A;  2ZZD A;  4LUE A;  5HK3 A;  1ZLM A;  2DM1 A;  2PVO B;  1PD0 A;  4ME7 A;  3C0C A;  4KBM B;  3V8L A;  2A37 A;  1Q86 R;  3EG9 B;  3RKY A;  4LXC A;  2DRK A;  2HSE B;  2NLU A;  2HSP A;  3CCU T;  3L42 A;  4M75 A;  3JCM g;  4F7U E;  2EQJ A;  3OYI A;  2DJQ A;  2DAQ A;  1LJO A;  2G3R A;  3SD4 A;  3E2U A;  2EQK A;  4JLG A;  4KUL A;  2ZPG B;  3VS4 A;  4DBQ A;  4M7A A;  1VQN Q;  5LJ3 j;  1E6H A;  4OGC A;  5GAN 5;  3G71 A;  1VQM T;  1YBY A;  2ZPE B;  5GAN 7;  4BE0 A;  2QQB A;  2P0K A;  4J8O A;  3GNF B;  4O5V A;  3EGU A;  3NGP A;  4C5I A;  4JJB A;  2NUT B;  5FRO A;  2DD5 A;  4FYV B;  1UE9 A;  3HKS A;  1BU1 A;  1U1T A;  1ZA1 B;  4E7K A;  3M58 A;  4HXJ A;  1KC8 R;  2VVK A;  3UA7 A;  1KQ1 A;  4OVA A;  5HCK A;  2XK0 A;  2PVD B;  2RNA A;  4R56 A;  2LCS A;  3CCS T;  1KD1 U;  2LJ3 A;  1SRL A;  3JB9 J;  2D0N A;  3QJY A;  3GLX A;  2OTJ T;  4PL6 A;  4HCC A;  3MET A;  1KD1 R;  2YRD A;  4BI8 B;  2Y4Y A;  1VQ7 Q;  2CT4 A;  4PJM A;  5GAO p;  4ELY C;  2CZ1 B;  2YSQ A;  5D7U A;  1VQL Q;  3M59 A;  1KHC A;  3CPW S;  2CZ6 B;  2OI3 A;  2FEI A;  3L2Z A;  4XK8 E;  1YP5 A;  1H8K A;  3HP9 A;  4J9D A;  4JS4 A;  3BFM A;  4KT0 E;  3SWN B;  4OB3 B;  4DBF A;  1UHC A;  2RHU A;  4RKU E;  2HQH A;  3QJ6 A;  3M56 A;  3SWN C;  1TS9 A;  3RKX A;  3JAM E;  4HCB A;  2GTO A;  1QCF A;  6AT1 B;  1D0Z A;  5GAN 2;  1JJ2 S;  2KK4 A;  1WLP B;  4A4K A;  1VQ4 A;  4HVW A;  4PLI A;  4A63 B;  5D6Y A;  3QXE B;  2M1H A;  1PKT A;  1X75 C;  5CQY A;  1TUC A;  4QVC A;  1YIJ T;  4D8K A;  2LJ1 A;  2CH4 A;  3L1A A;  1LCK A;  1RL2 A;  3H41 A;  4Z89 A;  2D1X A;  5J26 A;  5GAN d;  2CZ7 B;  2Y90 A;  3G6E Q;  3OYD A;  1K73 C;  4EPC A;  4B6M A;  3QUI A;  1Q82 U;  2RF0 A;  4XU0 A;  2RJF A;  4KGX B;  4MMK A;  1PWT A;  3LGF A;  3JB9 G;  4QVZ A;  5GAN 6;  1YNZ A;  3Q1J A;  9ATC B;  1BI0 A;  3KBG A;  1VQK A;  4EMH A;  1IHV A;  2EWN A;  2V1R A;  1Q82 R;  1NEB A;  1ABO A;  1GL5 A;  1Q86 C;  1W2B S;  1MMG A;  5LJ3 h;  1G8X A;  2DRM A;  2HKN A;  2DXT A;  4ZGD B;  4F04 B;  2DPP B;  5EG2 A;  4HKE A;  2QK0 A;  5FRM A;  1VQP A;  5HK0 A;  3JCM J;  5LJ5 d;  3VYG A;  3R6N A;  4J6Y A;  4Q5W A;  1B34 A;  3CCM A;  3CQT A;  1X69 A;  4PJO F;  2QXF A;  4JRI A;  1AOJ A;  1ZUY A;  1WIE A;  4M75 E;  1FWZ A;  1VQ8 A;  4OB0 B;  1UTI A;  2E65 A;  1RAI B;  1MGQ A;  4RTT A;  3QZ9 B;  5IN1 A;  4K11 A;  5J39 A;  3MEU A;  1JQQ A;  4M7A E;  1WXB A;  3ZEH A;  2EIF A;  3SDZ A;  3U23 A;  3G4S T;  4M7D G;  5GAO q;  3VJP A;  3M4G A;  3OYK A;  2CT3 A;  1KC8 C;  1HD3 A;  3CCU A;  5CK9 A;  3WXM B;  3QDF A;  3CC2 T;  1IRX A;  2XU8 A;  1GRI A;  4LNP A;  4CC7 A;  4C92 B;  1M90 U;  1G5V A;  3M55 A;  4C92 C;  1M8V A;  1M3C A;  2DER A;  2QQ9 A;  4M78 F;  1UEB A;  1AT1 B;  4OGE A;  3OYF A;  1YJ9 Q;  1KD1 C;  3CME A;  2HMA A;  1VQM A;  3JB9 D;  1U5S A;  2GCX A;  1M30 A;  5HY6 A;  1M90 R;  2K9G A;  5LJ3 e;  5KCH A;  2JTM A;  1ARK A;  4FYW B;  2E12 A;  1FYN A;  4PNO A;  2M9U A;  4C8Q G;  1Q81 C;  2DEQ A;  1W4S A;  2BZY A;  2KR3 A;  4XAX B;  4DA4 A;  2QGG A;  1MNE A;  3CCS A;  3M0R A;  2J06 A;  1TH7 A;  2K3Y A;  2LMJ A;  2K3B A;  1SKU B;  1G83 A;  2OTJ A;  2FZC B;  2DTI A;  4OMQ A;  1K0X A;  2F5T X;  1U1S A;  3M0S A;  4C5E A;  1FXX A;  2FHD A;  3TU4 K;  2RHI A;  2PU9 B;  1SHF A;  4MDW A;  1IHW A;  3REA B;  4PJJ A;  4GY5 A;  1FX7 A;  2MOX A;  3ZL7 C;  1QVG A;  2D9T A;  1R77 A;  2OTL Q;  2KDS A;  1VOM A;  2P84 A;  1LOJ A;  3JB9 F;  5GAM j;  4E6R A;  1Q82 C;  3A8L B;  2GBQ A;  1I0C A;  2YRC A;  5DM7 R;  2IG0 A;  1GXI E;  1UGP B;  4JRQ A;  2H8H A;  2PNI A;  1NPR A;  4AFQ C;  2X9H A;  3CCE Q;  3HFO A;  3I55 Q;  2WAC A;  1YJN T;  3NFC A;  1TTH B;  2QQR A;  1YIJ A;  2HQX A;  1I4K 1;  1SEM A;  4M77 B;  3A8H B;  5C0M A;  2H3E B;  1N5Z A;  3LWI A;  2G6F X;  4N4G A;  4M77 C;  1RAE B;  4QW2 A;  1YWO A;  3AHU A;  4AMC A;  1SF9 A;  2JVV A;  1OPK A;  2JM9 A;  4V2S A;  2R58 A;  4D8D A;  2RQT A;  2DIG A;  1U3O A;  3I56 Q;  2QQS A;  1V1C A;  1YFN A;  1UJY A;  3A98 A;  3EAE A;  4ANJ A;  1CSK A;  1KQ2 A;  4OB1 B;  4UC4 A;  2NUP B;  4E7J A;  2XDP A;  4TVR A;  4JJN K;  1WXU A;  3F70 A;  2A3L A;  3E19 A;  2F2V A;  2DBK A;  3OS5 A;  1HSQ A;  5CKD A;  4L6V 5;  3H8Z A;  2BIV A;  1MMA A;  1XNI A;  4DEY A;  2X51 A;  3ULR B;  2OAW A;  4Z02 A;  2K2V A;  2DEU A;  1CKA A;  4F17 A;  4IUP A;  4XTW A;  1YIT Q;  5IXB A;  1AWX A;  4Y91 A;  2PZ1 A;  2ROL A;  3J7A F;  3JCM V;  1NEG A;  2DBM A;  3CCL T;  2BKD N;  2AZS A;  1D1A A;  4RTX A;  3HHT B;  1M90 C;  4IIO A;  4F7U A;  2QG9 B;  2QEX T;  4LD6 A;  2M0O A;  2HKQ B;  1SSH A;  5KE2 A;  2RJC A;  4J9C A;  1WGS A;  1Y57 A;  2GF7 A;  1J3T A;  1QWF A;  3EGD B;  3CCJ T;  1OX8 A;  1OEB A;  2HBP A;  1XTD A;  1PSE A;  2QA4 Q;  2BTT A;  3OA6 A;  1QW1 A;  4LN2 A;  5GJV B;  3G4S A;  4OP0 A;  3QZ5 B;  2RA2 A;  1N9R A;  2JN0 A;  4FT4 A;  3V7S A;  3CC2 A;  3DLL A;  1C0M A;  2YUN A;  3V8J A;  4LE9 A;  3OMC A;  2XI9 A;  1QVP A;  4BDY A;  2YDL A;  1A0N B;  3E1S A;  1VUB A;  2F2W A;  2E41 A;  2EQU A;  3CMA T;  3CME Q;  1WI7 A;  3CPW P;  1IGQ A;  5CO7 A;  1YCY A;  3BW1 A;  2XG8 D;  1G3T A;  4AT1 B;  2W10 A;  1OX9 A;  5FWC A;  4J9H A;  2YLC A;  1EZZ B;  1YI2 T;  4BD3 A;  3CCQ T;  1UEC A;  2DMO A;  1FMV A;  3BE3 A;  2J6O A;  3JB9 H;  3BY7 A;  1VQ5 T;  1S72 Q;  4A4G A;  5GMK e;  3EG3 A;  3PNW C;  4XU3 A;  2EKO A;  3UA6 A;  3EH1 A;  4HT9 A;  1U06 A;  3EG0 A;  2EFI A;  1YHQ Q;  3HL8 A;  3CCV Q;  2MF2 A;  2FZG B;  4ZN1 A;  5GAN h;  2ZPH B;  4M7D A;  2PTK A;  2RHZ A;  2K4Y A;  4EDU A;  2COZ A;  5I2M A;  4RTV A;  4F7U B;  1M1K U;  4RCB A;  1R0C B;  1X27 A;  4KGV B;  3L2W A;  3RR6 A;  4IUU A;  1KIK A;  2LJ0 A;  2SRC A;  4BDZ A;  3EFS A;  1OPL A;  2KRO A;  3IQL A;  1BCO A;  1H3Z A;  1M1K R;  4FU6 A;  1MHN A;  4C5H A;  3OMG A;  3OB9 A;  2KI7 A;  2E5Q A;  2FO0 A;  1K4U S;  2EAY A;  2DXU A;  1K0S A;  4GLK A;  2FB7 A;  5GAN f;  1K73 U;  2LQK A;  4MZT A;  1WYX A;  4C92 D;  2GFA A;  3CCR Q;  2RQW A;  1G3W A;  4GBQ A;  1ABQ A;  4CC3 A;  1YJN A;  2LQN A;  4PJN A;  2L3R A;  1K73 R;  4C8Q A;  1V76 A;  2L5Q A;  4Y28 E;  3UAT A;  1TUD A;  3FJP A;  4C0F A;  2HL5 C;  1OZ3 A;  4WF2 A;  1OI1 A;  1X6G A;  3QG1 A;  2K5L A;  3M5A A;  3OW2 S;  3EFR A;  2O9V A;  5AT1 B;  3NHN A;  3TSZ A;  1RLP C;  1AEY A;  2WSC E;  2DKG A;  5LJ5 f;  2F5K A;  2COW A;  1NBE B;  5IHN A;  3OYN A;  2F69 A;  5GAN e;  3CD6 Q;  1OZ2 A;  1MND A;  4PFP A;  4PJO G;  1OYX A;  4PFO A;  4AFU C;  2ZPB B;  4C92 F;  3D7S B;  3M53 A;  3PTA A;  2LZ6 B;  4JJC A;  4NL2 A;  4E7I A;  3CCL A;  3JCM c;  1YJW Q;  2PVG B;  3KFV A;  4BI3 A;  4OMP A;  2P0Q A;  5GMK m;  3QYG B;  1IB8 A;  3S3M A;  1M2V A;  5KYX B;  1KC8 U;  4QKU A;  2QEX A;  3CPF A;  3X24 B;  3NTI A;  1UDL A;  8AT1 B;  3RUX A;  2A28 A;  3HPW A;  2MYS A;  4PKC C;  4HCZ A;  2QGF B;  2JS0 A;  3CCJ A;  3EG2 A;  5LJ5 e;  2DYI A;  4LDW A;  2RQU A;  4QT7 A;  2DVJ A;  1BI3 A;  3GOX A;  1KG1 A;  2DIQ A;  3AT1 B;  4FL6 A;  4IUR A;  3UDC A;  4N0A A;  3MKD A;  3OYM A;  2DTO A;  4M78 G;  2A08 A;  2LP5 A;  1FMW A;  3GBQ A;  4J9B A;  1UB4 A;  3N5B B;  4J7I A;  1VQ6 T;  3HTR A;  3JCM h;  2C06 A;  1WHJ A;  2CP3 A;  2KEA A;  3FEO A;  3M9Q A;  2CYZ B;  2ATC B;  5AYF A;  2KSS A;  3EHR A;  3OYH A;  3CMA A;  3CC4 T;  3M57 A;  2DET A;  1Q81 U;  2O88 A;  5EC7 A;  3OS1 A;  4CI0 C;  1C1A A;  3BDU A;  1UFF A;  3C95 A;  4MDX A;  1BYM A;  3VS0 A;  1WHM A;  1M1K C;  3CC7 Q;  4M7D E;  8ATC B;  4M75 B;  3I9Q A;  1YI2 A;  1Q81 R;  5IT9 E;  3CCQ A;  2OX7 A;  3R6O A;  2DVE A;  4M75 C;  1RAG B;  3P8H A;  1VQ5 A;  3JCM f;  1ZX6 A;  4X9C A;  2K2M A;  4PJO D;  3INZ A;  3VS1 A;  2VV5 A;  1OUL A;  1UG1 A;  4XTV A;  4FYX B;  3ZFJ A;  1D0X A;  4M7A B;  3V7C A;  1PKS A;  2ECZ A;  4E47 A;  5I22 A;  4M7A C;  3FJ5 A;  3EFO A;  3JRZ A;  2GQI A;  4DOV A;  1GFC A;  3RNJ A;  3DKM A;  1TXQ A;  5DLQ E;  5FU6 B;  4LDU A;  2RD1 A;  4M77 F;  2B8A A;  2I2L A;  4HCK A;  1WJQ A;  1WJS A;  1AD5 A;  2X4J A;  5FU6 C;  2QAS A;  1QVG S;  4DEX A;  1VQ9 T;  2QYZ A;  4VUB A;  3MCA B;  2KNB B;  3A8O B;  1I8F A;  1TUG B;  5FU7 B;  3OW2 A;  4X34 A;  5A0L A;  4MML A;  5GAO n;  1NPP A;  3O8V A;  2C0T A;  5FU7 C;  4C8Q E;  2MWP A;  1VYT A;  4FW2 A;  4J9I A;  3QWX X;  3OYB A;  3JCM e;  3J81 E;  4M78 D;  5KH6 A;  2XDD A;  1NM7 A;  1MMN A;  2M51 A;  2VUB A;  1LPL A;  1PRM C;  2XIC A;  4BE1 A;  1MMD A;  1QCO A;  3GPL A;  1VQO Q;  2LNV A;  1I81 A;  4DQ2 A;  1BIA A;  3OYA A;  2HDA A;  2CGH A;  3P8D A;  2VYT A;  3S3N A;  2NWM A;  2FPF A;  5IXF A;  7AT1 B;  1M9S A;  1JU5 C;  1H64 1;  1K9M U;  2XMF A;  2X4W A;  2JXB A;  1VQN T;  1WQ7 A;  4J6W A;  2L3S A;  2NUZ A;  1X6O A;  3MP8 A;  1W6X A;  3JCM b;  1K9M R;  1QWE A;  2JS2 A;  3PIO A;  1O75 A;  2CUD A;  5CIU A;  4B9W A;  1WHL A;  2RHY A;  1ZHI A;  4C0G A;  3M0T A;  3VS3 A;  1AWO A;  4OMO A;  5C6S A;  3REB B;  1KQS S;  3O5Z A;  1XQH A;  4IUV A;  4LDY A;  2DO3 A;  4B9X A;  2H3J A;  2RMO A;  5LL6 S;  1PHT A;  2CDT A;  3G71 Q;  2FG0 A;  1KJW A;  2BZX A;  2X3X D;  4JLI A;  2DD4 A;  1IGU A;  2DK3 A;  3LGL A;  2FRY A;  1VQ7 T;  2K3X A;  1RLQ C;  1WZO A;  2AKK A;  1TOV A;  1W1F A;  3TRE A;  3C4S A;  5GMK j;  3LH5 A;  1VQL T;  1RAH B;  2DFU A;  1NG2 A;  3FB9 A;  3CXC A;  3JSC A;  4JS5 A;  2AHJ B;  5M9O A;  4FSX A;  5GMK i;  4NL3 A;  3QPH A;  2K6D A;  2EGE A;  2QDL A;  1B34 B;  1VYV A;  1RI0 A;  2C0O A;  2LDM A;  5A2Q E;  2X4X A;  3VKI A;  3MO8 A;  1NJI C;  1M27 C;  2F1L A;  2LX9 A;  1VQ6 A;  2GFU A;  2EKH A;  1AZE A;  3JB9 I;  2EYZ A;  5KYN A;  4OML A;  1B07 A;  3GIB A;  1HXD A;  3NPF A;  2EYW A;  2AIR B;  3FC3 A;  4KUI A;  3VS2 A;  2KY9 A;  3VS6 A;  3EGX A;  1MV0 B;  3CC4 A;  3G6E T;  3ME9 A;  2K57 A;  3DLM A;  2IIM A;  1GCQ A;  4F7U F;  2ESW A;  1K1Z A;  4JRP A;  4HT8 A;  4A4H A;  3UT1 A;  4J5Y A;  2DTH A;  1D0Y A;  1OV3 A;  3WVE B;  3E9F A;  4C0Z A;  4C5G A;  1Y7X A;  2DA9 A;  1SHG A;  3RBB B;  4BI4 A;  3A1P A;  2PUK B;  1VQ4 Q;  2FYK A;  4BUG A;  5IAY A;  4BY6 B;  5J3B A;  1NLP C;  4EMK A;  1BI2 A;  1AWW A;  2EJF A;  4BY6 C;  1T3S A;  3PMT A;  1KHI A;  3L2U A;  4RTY A;  4E2F B;  4RMO A;  5GMK l;  2FL7 A;  3P8B B;  3HRT A;  2R57 A;  2WSF E;  5I2S A;  2V8I A;  3OW2 P;  5D6X A;  3H6Z A;  1VQ9 A;  4M78 A;  2XKO C;  4II1 A;  1BIB A;  5DY9 A;  1QLY A;  5GAN j;  1VQK Q;  4N4H A;  3SHW A;  2ZAE A;  2EQI A;  1K9M C;  5CVI A;  1H3H A;  4Y92 A;  1JXO A;  3L2R A;  1X01 A; 
#chains in the Genus database with same CATH homology
 2D0N A;  3UF4 A;  2HEQ A;  1KIK A;  2JT4 A;  1SRM A;  2LJ0 A;  1AWJ A;  2SRC A;  4JJD A;  1IO6 A;  1OPL A;  2KRO A;  3IQL A;  4R0K A;  5GJW B;  3M0Q A;  4KRT A;  1UJ0 A;  2CT4 A;  2ROT A;  2RQV A;  2YSQ A;  1PRL C;  2OI3 A;  2FEI A;  2FO0 A;  4AG2 C;  1YP5 A;  1H8K A;  2LX7 A;  2KXD A;  4J9D A;  1K4U S;  1K0S A;  2EGA A;  1UHC A;  2L2P A;  1WYX A;  2DL4 A;  2RQW A;  1M8M A;  2DL8 A;  3EHQ A;  1WDX A;  4GBQ A;  1ABQ A;  1YWP A;  4CC3 A;  2GTO A;  1QCF A;  4Z88 A;  2YUO A;  2LQN A;  1TG0 A;  2DX1 A;  1WLP B;  2D8H A;  1S1N A;  4HVW A;  2F2X A;  3VRZ A;  4F16 A;  4A63 B;  5ECA A;  2AK5 A;  3UAT A;  1TUD A;  1PKT A;  1TUC A;  1ZBJ A;  3VS5 A;  4D8K A;  2LJ1 A;  1X6G A;  2CH4 A;  2EGC A;  4IIM A;  1LCK A;  2L3P A;  3H41 A;  4Z89 A;  2D1X A;  2KXC A;  1M3A A;  1T0J A;  2SEM A;  2O9V A;  1X6B A;  3NHN A;  2DL7 A;  3TSZ A;  2RF0 A;  1RLP C;  1AEY A;  1GCP A;  1PWT A;  5IHN A;  4CC4 B;  2FPD A;  4RTZ A;  1YNZ A;  2RPN A;  3I5R A;  2V1R A;  1NEB A;  1ABO A;  1GL5 A;  4RUG A;  2ENM A;  2O2O A;  4AFU C;  2DRM A;  2OJ2 A;  2YUP A;  1G2B A;  4HVV A;  3M0P A;  2LZ6 B;  4CC2 A;  4JJC A;  1OOT A;  3R6N A;  2KRN A;  1ZSG A;  1T0H A;  2B86 A;  3KFV A;  1WX6 A;  4OMP A;  2YT6 A;  3CQT A;  1X69 A;  2KRS A;  4M4Z A;  4ZNX A;  2EPD A;  1AOJ A;  1CKB A;  1E7O A;  1UDL A;  1ZUY A;  1WIE A;  2A28 A;  1X43 A;  1ZUU A;  1YCS B;  2JS0 A;  3EG2 A;  1UTI A;  4OMN A;  4QT7 A;  2RQU A;  5IHI A;  4RTT A;  2DVJ A;  4K11 A;  4EIK A;  2GNC A;  1JQQ A;  2E5K A;  1WXB A;  1WFW A;  3U23 A;  2A08 A;  1W70 A;  2LP5 A;  3GBQ A;  1K76 A;  4J9G A;  4J9B A;  1NYG A;  4J9F A;  2ABL A;  2GGR A;  2CT3 A;  2P4R A;  1HD3 A;  4F14 A;  2KEA A;  2J6F A;  1VA7 A;  4OMM A;  3H0F A;  1GRI A;  2DYB A;  4LNP A;  4CC7 A;  3EHR A;  1BBZ A;  4WCI A;  4Z8A A;  2O88 A;  5EC7 A;  3PVQ A;  1M3C A;  2RQR A;  1UFF A;  3VS0 A;  2O31 A;  2FRW A;  1Z9Z A;  1U5S A;  3PE0 A;  1HJD A;  3I35 A;  1M30 A;  2L0A A;  3I9Q A;  3M0U A;  1VYU A;  1GCQ C;  2K7A A;  2K9G A;  4J9E A;  1MUZ A;  3TSW A;  1PNJ A;  1ZX6 A;  2HBW A;  1ARK A;  2DF6 A;  2K2M A;  3VS1 A;  5IH2 A;  4AG1 C;  1UG1 A;  4JZ4 A;  2EW3 A;  3VRY A;  1FYN A;  2KGT A;  2CUB A;  1KFZ A;  1PKS A;  2ECZ A;  5I22 A;  2M0Y A;  3FJ5 A;  2KT1 A;  1Z9Q A;  2GQI A;  2YUQ A;  1AZG B;  1GFC A;  5FWB A;  1BB9 A;  3RNJ A;  2BZY A;  2KR3 A;  3VS7 A;  1T3L A;  2KRM A;  2W0Z A;  2CRE A;  4HCK A;  3M0R A;  1K9A A;  2JW4 A;  2V1Q A;  2EYX A;  1AD5 A;  2J06 A;  2FPE A;  4DEX A;  1RUW A;  2LQW A;  1MV3 A;  2LMJ A;  2KNB B;  2K3B A;  2KE9 A;  1G83 A;  1GFD A;  2CSI A;  4OMQ A;  1GBR A;  1K0X A;  3M0S A;  1FMK A;  2C0T A;  1VYT A;  4J9I A;  1SHF A;  2BZ8 A;  2EYY A;  2HCK A;  3REA B;  2MOX A;  3ZL7 C;  4ESR A;  3QWX X;  2VWF A;  1NM7 A;  4JPB W;  4E6R A;  2M51 A;  4FSS A;  2DNU A;  2DL5 A;  1JEG A;  2GBQ A;  1I0C A;  1PRM C;  1YN8 A;  2MIO A;  1I1J A;  2H8H A;  2PNI A;  2HDA A;  2ED1 A;  3TVT A;  4AFQ C;  2EBP A;  2NWM A;  2KYB A;  2FPF A;  2KYM A;  5IXF A;  1JU5 C;  1RI9 A;  2AKL A;  2XMF A;  2JXB A;  2J05 A;  4X1V A;  2GTJ A;  1SEM A;  2X3W D;  2L3S A;  2NUZ A;  1N5Z A;  1W6X A;  2G6F X;  2RN8 A;  1KSW A;  1EFN A;  1YWO A;  3THK A;  1AVZ C;  1B3Q A;  1Y0M A;  2LNH B;  1QWE A;  2JS2 A;  1OPK A;  2AZV A;  4GLM A;  2DE0 X;  5I11 A;  2CUD A;  2JM9 A;  1NYF A;  1QKX A;  4ORZ A;  4D8D A;  2RQT A;  1U3O A;  2JM8 A;  1BK2 A;  2DL3 A;  1V1C A;  1UJY A;  3M0T A;  4LUD A;  3A98 A;  1CSK A;  2CSQ A;  3VS3 A;  1AWO A;  4OMO A;  4HVU A;  1WXU A;  2VKN A;  3REB B;  3O5Z A;  2F2V A;  2DBK A;  1SPK A;  1HSQ A;  4JZ3 A;  4DEY A;  3ULR B;  2OAW A;  2RMO A;  3I5S A;  1PHT A;  2CDT A;  3QWY A;  1GBQ A;  2FG0 A;  1CKA A;  2KT8 A;  1KJW A;  2BZX A;  2X3X D;  4F17 A;  3PVL A;  5IXB A;  3JV3 A;  2JTE A;  1AWX A;  2CH4 W;  1JO8 A;  1E6G A;  4RTW A;  1UHF A;  2FRY A;  1RLQ C;  2PZ1 A;  2ROL A;  2AKK A;  4RTU A;  2J6K A;  1NEG A;  1M3B A;  3LH5 A;  1UGV A;  1X2K A;  2DBM A;  2AZS A;  1NG2 A;  4AFZ C;  5IHK A;  4RTX A;  3H0I A;  4IIO A;  1UUE A;  1SSH A;  2D8J A;  1NLO C;  1JXM A;  1I07 A;  2K6D A;  4J9C A;  1Y57 A;  1QKW A;  2EGE A;  1QWF A;  1J3T A;  3H0H A;  1H92 A;  2MCN A;  4AFS C;  2QDL A;  1OEB A;  1VYV A;  2C0O A;  2BTT A;  2I0N A;  4LN2 A;  2KBT A;  1M27 C;  2JMA A;  4LUE A;  5GJV B;  2L3Q A;  1ZLM A;  2DM1 A;  2EKH A;  1AZE A;  2EYZ A;  3C0C A;  4OML A;  2A37 A;  1B07 A;  3NPF A;  2DLP A;  2EYW A;  1WA7 A;  2DRK A;  3SEM A;  2YUN A;  3VS2 A;  3VS6 A;  4LE9 A;  1MV0 B;  2HSP A;  2YDL A;  1A0N B;  2IIM A;  1GCQ A;  2ESW A;  1K1Z A;  2A36 A;  2J7I A;  2F2W A;  2DJQ A;  1X2Q A;  2EVR A;  1OV3 A;  1WI7 A;  3VS4 A;  2DA9 A;  1SHG A;  3RBB B;  2O9S A;  2W10 A;  1XOV A;  1E6H A;  5FWC A;  4J9H A;  2ED0 A;  5L23 A;  3NMZ C;  3EGU A;  1UEC A;  1NLP C;  2DMO A;  3NGP A;  4JJB A;  1AWW A;  2J6O A;  2K79 A;  1T3S A;  2C0I A;  4RTY A;  3EG3 A;  1WXT A;  2DIL A;  1UE9 A;  3UA6 A;  2JMC A;  1U06 A;  3EG0 A;  1ZUK A;  1BU1 A;  4HXJ A;  2VVK A;  3UA7 A;  5HCK A;  2RNA A;  3EG1 A;  2PTK A;  1QLY A;  2LCS A;  3SHW A;  4RTV A;  2LJ3 A;  1SRL A;  2EQI A;  1H3H A;  4Y92 A;  1JXO A;  1X27 A;  5FW9 A;  1W1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...