1S1NA

Sh3 domain of human nephrocystin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
b'TGEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLEPYSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nephrocystin 1
publication title Solution NMR structure of the SH3 domain of human nephrocystin and analysis of a mutation-causing juvenile nephronophthisis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1s1nA00
2O2OA 2RQUA 2YUNA 2YT6A 5IXBA 4Y92A 1PWTA 3KFVA 2VVKA 1I07A 1X6GA 4RTUA 2KXDA 2J05A 1CKAA 3VS6A 2JTEA 3R6NA 3VS1A 4E6RA 1QKXA 1NG2A 5L23A 5FW9A 2EYYA 1UGVA 1PRMC 2XMFA 5IH2A 4JJDA 4CC7A 4IIMA 1AEYA 2A37A 3UF4A 1SHFA 2EVRA 3I5SA 2QDLA 3M0SA 1AWXA 2CREA 1NLPC 3GBQA 1VA7A 1UHCA 1YCSB 2DYBA 1SRLA 5IHKA 1AWWA 1NEGA 2RQVA 1PKSA 2AZVA 1YNZA 1AVZC 1JXOA 2DILA 2JMCA 3VS7A 5HCKA 4CC3A 1BK2A 2O31A 1UG1A 2FRWA 3UATA 4AG2C 2DL3A 1UJ0A 4AFUC 1ZLMA 2K6DA 2M0YA 2DBKA 1OV3A 1G2BA 2MOXA 4J9HA 4KRTA 1U5SA 4LE9A 1MV3A 3CQTA 2DRKA 4RTXA 3EG3A 2KRMA 2P4RA 1IO6A 1OEBA 2BZ8A 2HCKA 1U3OA 4J9EA 2RN8A 2DJQA 2EW3A 2YUOA 1FMKA 1ZSGA 2GTOA 2K9GA 4OMQA 1MUZA 2IIMA 2FPFA 2DX1A 4RTWA 1ABQA 2X3XD 4QT7A 2OI3A 2EYZA 2RNAA 3H41A 2V1RA 3A98A 1GFCA 2CUBA 1NEBA 1PHTA 1H3HA 1WI7A 3NHNA 4F16A 2RPNA 2DLPA 4DEYA 4OMPA 1T0HA 2EGAA 5FWCA 1CSKA 2KRNA 1ZUKA 2KT1A 1M27C 1UE9A 1M3AA 2BZYA 4OMLA 1MV0B 3UA7A 2D1XA 1PKTA 2EQIA 2H8HA 2KXCA 2CT3A 3NPFA 1HD3A 1H8KA 1QWFA 1VYTA 1E6GA 5IHIA 2FPEA 1JXMA 4OMNA 3U23A 4F17A 2YSQA 2ED1A 2JM8A 1GCQC 1JEGA 1ABOA 1YWPA 3PVLA 3NMZC 3QWYA 2CH4W 2L2PA 3PVQA 2D0NA 1LCKA 4LUEA 1HSQA 4ORZA 1VYUA 3VRZA 4M4ZA 1GFDA 1M30A 2GGRA 2JW4A 2LJ0A 4D8KA 1AOJA 1GCQA 2ECZA 1OPKA 3I9QA 2C0OA 2F2WA 2L3QA 2V1QA 5I22A 1UFFA 1NM7A 1ZUUA 3EHQA 1WLPB 2NWMA 3PE0A 3H0HA 1GRIA 1UDLA 3VS2A 2ROTA 2X3WD 2DE0X 1W6XA 2D8JA 4RTVA 4HXJA 5FWBA 3ULRB 1AWJA 1ZX6A 2CSIA 2YUQA 4LN2A 4IIOA 2AK5A 3M0TA 2DA9A 4JJCA 1I0CA 3TVTA 2J7IA 2KNBB 2LP5A 1X43A 2GTJA 1UJYA 4J9BA 2DF6A 3C0CA 4HVWA 2NUZA 1I1JA 2F2VA 4AFSC 2LZ6B 2LJ1A 1H92A 4HVUA 2KEAA 1GBRA 1W1FA 4A63B 2ENMA 2J06A 1WA7A 1GBQA 2M51A 5GJVB 1JO8A 2FO0A 3VS4A 3REAB 2KRSA 2A28A 2CSQA 2EPDA 1X27A 2RQTA 1J3TA 3TSWA 2GBQA 2W10A 4HVVA 2C0TA 4FSSA 3I5RA 1X2KA 1FYNA 1NYGA 2DL5A 2JS0A 2MIOA 3SHWA 4ZNXA 3EGUA 1QWEA 1YP5A 4AG1C 4ESRA 5I11A 4Z88A 3H0IA 2JMAA 2CUDA 3QWXX 2HBWA 1QCFA 1WXBA 1KJWA 3EHRA 3FJ5A 2ROLA 2CH4A 1N5ZA 2BZXA 2JS2A 4WCIA 1U06A 2I0NA 5ECAA 1SRMA 1WXUA 2J6OA 1QKWA 2KT8A 2AZSA 2RF0A 1KFZA 1GL5A 2ED0A 3EG2A 1YWOA 2SEMA 1JU5C 3JV3A 4AFQC 1SSHA 1TG0A 1TUDA 2LMJA 1V1CA 2KBTA 5EC7A 2JM9A 2J6FA 2EYWA 2LCSA 4GBQA 1K4US 2OAWA 1KSWA 3EG0A 2G6FX 4GLMA 2EBPA 2JXBA 2O88A 1JQQA 1AD5A 2DL4A 2FEIA 3M0RA 1ZUYA 2DMOA 2YDLA 4J9DA 2DBMA 1CKBA 4Z8AA 2RQWA 4JJBA 3RBBB 4X1VA 3IQLA 1EFNA 3VS0A 1K1ZA 2KR3A 2ABLA 4J9GA 1SEMA 2AKLA 1AZEA 4Z89A 1A0NB 2EGEA 4K11A 2F2XA 1PNJA 1T3LA 1YN8A 2K2MA 1GCPA 1BB9A 4RTZA 2LQNA 4R0KA 4OMMA 2PZ1A 4LNPA 4RTTA 3LH5A 2MCNA 2DL7A 2AKKA 4J9CA 4CC2A 1WFWA 1B07A 4RUGA 3O5ZA 2ESWA 2VWFA 4J9IA 4AFZC 1WIEA 1AZGB 3M0UA 1X69A 2BTTA 2KYBA 2RQRA 4F14A 2C0IA 3SEMA 1PRLC 2E5KA 2A36A 1X2QA 2VKNA 1SHGA 2KYMA 1RI9A 1QLYA 3M0QA 1UTIA 2LQWA 3VRYA 2L3SA 3H0FA 3RNJA 4CC4B 1E7OA 1K9AA 2CT4A 3VS5A 2SRCA 1Z9ZA 3VS3A 1UECA 2K79A 2L0AA 4JZ3A 1S1NA 2DRMA 1M8MA 2EYXA 4DEXA 1K0XA 3TSZA 1Y57A 1WDXA 2FRYA 4EIKA 2KE9A 1UUEA 5IHNA 2HDAA 2W0ZA 3NGPA 1M3BA 3REBB 2LX7A 2HEQA 2PTKA 1K0SA 1T0JA 2LNHB 2D8HA 2LJ3A 3THKA 2OJ2A 2FG0A 2KGTA 3ZL7C 1WXTA 2RMOA 4J9FA 2KROA 1RUWA 3EG1A 1K76A 1KIKA 5GJWB 2HSPA 4OMOA 1BBZA 4RTYA 2JT4A 1W70A 2EKHA 2J6KA 1WYXA 1OOTA 1M3CA 1T3SA 2K7AA 1RLQC 1VYVA 4JPBW 1NYFA 1RLPC 1UHFA 2DNUA 2EGCA 1E6HA 2CDTA 2DVJA 1AWOA 1NLOC 2B86A 1ZBJA 2L3PA 2O9VA 3I35A 2DL8A 1XOVA 1HJDA 1ARKA 1G83A 2GNCA 1Y0MA 2GQIA 1B3QA 1X6BA 4D8DA 2A08A 4JZ4A 1SPKA 2DM1A 2FPDA 1Z9QA 2O9SA 4LUDA 3M0PA 1BU1A 3UA6A 1TUCA 1OPLA 2YUPA 4HCKA 1WX6A 5IXFA 2PNIA 2K3BA
chains in the Genus database with same CATH superfamily
2YT6A 2OTLT 5IXBA 4Y92A 4DBHA 2KXDA 2BIVA 4RCCA 2HQXA 5AYFA 1VQ4T 1RAAB 1WPYA 3VS6A 1C0MA 3CPWS 4M78C 4BE0A 3RKXA 4E6RA 1QKXA 3HFNA 2ZZDA 1JB0E 1BKBA 4J6WA 2LCCA 5IH2A 2RB6A 1AWXA 2CREA 3A8LB 1C6VX 1VA7A 4OP0A 2OAUA 4B9XA 2RJFA 4C92A 4E7IA 5IHKA 1VQOA 1VQ7Q 2RQVA 4P5NA 4EMKB 5A2QE 5FU6C 3P8DA 4JLIA 1KC8R 5FRNA 2AZVA 3V8JA 1G8XA 1YNZA 2QASA 5GANd 2YLBA 2AT1B 2F1LA 2MI6A 2OTJQ 3WVDB 1RACB 1JJ2A 3OYNA 5CO7A 2E6ZA 1Q86U 4A53A 3G7ZA 5GAMd 1ZLMA 4M7DA 1MMNA 1ZHIA 1BI1A 1S72Q 1OV3A 4FW2A 3OYAA 3S6WA 1SG5A 5GMKm 3SWNA 5GAN3 2P4RA 2BZ8A 1U3OA 4J9EA 3RMQA 2GTOA 2FZKB 1MUZA 2WSCE 1K9MR 4RG2A 2IIMA 3FLGA 3V7CA 3SDZA 5CQYA 1YJ9Q 1ABQA 2X3XD 2QTXA 4QT7A 3TCJA 2QQBA 3CC2Q 3CC7A 1G5VA 2LVMA 3R6OA 1YHQA 3QIIA 3A98A 3CCVT 2CUBA 1NEBA 2DEUA 3G71A 1I8FA 2R5MA 3CBPA 1N9RA 4OMPA 2K5IA 1ZUKA 5L8RE 1UE9A 2EAYA 1VQKQ 4XTUA 1O75A 1IHWA 5GAOp 4EMKC 4KULA 1PD0A 2H8HA 3V8KA 3CCMT 1VQPQ 1WHGA 1M2VB 3NPFA 4PJOA 1X75C 3G4SQ 1QWFA 1Q81U 4IUVA 4FU6A 2CYZB 2FZGB 1BCMA 3MCAB 4M78F 2XU8A 2YSQA 2E41A 4XK8E 1JEGA 2GFUA 2QQ9A 1QVFA 3QWYA 1LCKA 4HCZA 4JS5A 4ORZA 2JW4A 2LJ0A 3JCMd 1GCQA 2ECZA 3OS0A 4M7AA 2L3QA 2JUFA 4BACA 1ZSZA 3OYLA 2WACA 3NTKA 3RKYA 3PGGA 3BY7A 4M78G 4C8QE 1YCYA 2EKOA 1W6XA 5GMKe 5KYYA 1GXIE 3OYYA 2MAMA 5FWBA 2QG9B 4LDVA 1ZX6A 3EGDB 2HL3A 3I56T 1YITT 1FMVA 4M75D 4LN2A 5GANh 1MMGA 4KUIA 2KNBB 3HPWA 1UJYA 2NUZA 1UB4A 2QQSA 5GAMh 1H92A 2C06A 1GBRA 1W1FA 1QQJA 2OTLA 3G6ET 3HP9A 4C5IA 3L1AA 3EFOB 3SB2A 2A28A 2EPDA 2ZPGB 1X27A 2RQTA 4CRIA 4MDWA 4L5GA 1K8AC 2MIOA 3PT9A 3SHWA 2DXCA 4ELZC 4ZNXA 3ZFJA 4Z88A 4PFPA 3H0IA 1WJSA 2MWPA 1KJWA 3FJ5A 2PVOB 1VQNT 1U06A 4Y28E 1SRMA 3BDUA 1KG1A 3CBMA 1QKWA 2KT8A 2AZSA 1C1AA 2LT4A 2P4TA 2KQWA 2SEMA 1JU5C 1SSHA 1TUDA 2KDSA 3N5BB 5IT9E 3QSUA 2JM9A 2J6FA 4A54A 2LCSA 5CKFA 2OAWA 4BE1A 3JB9F 4QKUA 2G6FX 4GLMA 1AD5A 4BY6C 3FB9A 1M5Q1 3M0RA 2R57A 3QJ6A 1BYMA 3OYIA 5D6YA 1VQLA 2YDLA 1R77A 2RK2A 2E5QA 1N9SA 1QP3A 2DBMA 2HKQB 1G3TA 3OYGA 3SD4A 1K1ZA 2PVDB 4Y91A 5KYXA 1YBYA 5CIUA 3VKIA 1AZEA 2DTOA 2EGEA 3CXCS 4K11A 2CZ6B 4L6V5 3JCMh 2RHIA 2F2XA 2VGMA 3VYHB 4Q5WA 1M90C 1UEBA 2QA4Q 1GCPA 3M54A 1BCOA 3UT1A 4R0KA 1YIJA 3CMEQ 4LNPA 3LH5A 2MCNA 2AKKA 4QW2A 4RUGA 1VQ9Q 1HK9A 2ESWA 3O5ZA 1AZGB 2VV5A 4J7FA 2EFIA 4GY5A 3SEMA 2E5KA 2X4JA 1WJRA 1IREB 4M78D 3E9FA 1VQ8T 4PLIA 4M77E 4KGZB 3UDCA 2X35A 2L3SA 4O6JA 3L2QA 1K9AA 3VS5A 1Z9ZA 3GF5A 3CD6T 3DB4A 2XI9A 1TWBA 4C0DC 3J80E 3CC4T 4MDXA 1S1NA 3FRNA 4F7UE 2XDDA 2DETA 1M8MA 1MGQA 2EYXA 4DEXA 4ZGEB 1W2BS 2F5KA 1OU9A 4EIKA 2KE9A 5IHNA 1VQMQ 1BI3A 3LYIA 1M3BA 4HKEA 1YJWA 1ZA2B 3ME9A 1EX4A 1YJNA 4OF1A 2D8HA 3THKA 4QQDA 1YI2A 4XU2A 3ZL7C 2QEXA 4C8QA 2KROA 2VXFA 1M90U 3A8OB 2GQVA 1NBEB 2WSFE 1PD1A 1WHMA 1NE8A 3JCMQ 2J6KA 1M1FA 3BE3A 1LVKA 1VYVA 3CMAA 1RLPC 1UHFA 2A0FB 4NL2A 1E6HA 2DVJA 4PJOC 2B86A 1BI2A 3FEOA 2ZPEB 2L3PA 4JRPA 3I35A 1FXXA 2X4YA 1XOVA 1PSEA 2GNCA 2CZ7B 1EZZB 2Y4XA 1RAEB 1Y0MA 1B3QA 1WHJA 2DERA 1SPKA 5J3BA 3G6EA 1QVGP 1NJIC 3LWIA 4ATOA 4V2SA 2H3EB 4M7DE 4IUQA 3E9GA 5GANg 1WX6A 4FYYB 2PNIA 2K3BA 4N0AC 5KE2A 3KFVA 4BE2A 3MP8A 1BI0A 1D09B 3MP1A 1I4K1 5GAMg 2JTEA 3VS1A 3A8GB 4DBRA 3OYJA 1ZSZC 5L23A 2PUKB 1UGVA 3OB9A 1VQNA 4JJDA 4CC7A 4IIMA 1AEYA 2A37A 4MZPA 2QDLA 2DIQA 1AT1B 3JB9D 2E3HA 3NTHA 1UHCA 1YCSB 5CKBA 3CEYA 4ZTFA 2XICA 2L8DA 1QP2A 3QBYA 1KQSP 1IRXA 1PSFA 3VJPA 1JXOA 1PG5B 5I21A 1D0YA 1UG1A 4AG2C 2KI7A 5KYWB 4BI4A 3CCEQ 3RR6A 2DBKA 4J9HA 1MV3A 3CQTA 1NJIU 3I55A 4RTXA 5KYNA 1IO6A 1OEBA 2HCKA 3MEVA 1H641 3EG9A 2DJQA 1FMKA 3CCUQ 2K9GA 4ZN3A 5D6WA 2NUPA 1Y96B 4DOWA 2DJZA 2JJ9A 4RTWA 2CP7A 2QI2A 2E4HA 1XQHA 4A4GA 5LJ5d 4J6XA 2EYZA 1K8AR 1WQWA 3QZ9B 3H41A 2V1RA 1GFCA 3S3OA 1WI7A 4JUVA 3PNWC 2DZCA 3CCLQ 3OS2A 1T0HA 1VQMT 1PM3A 4WTOB 2KAFA 4ZGJB 1K73U 1M27C 4PJJA 5I2MA 5CR2A 3JCMg 3FIFA 3UA7A 1MV0B 2Y90A 3V7SA 1ZA1B 4M75E 2D1XA 1OI1A 5C6SA 1Q86C 3Q1JA 8ATCB 3H8ZA 2RI5A 5M9OA 3CD6A 2CP5A 1JRIA 3BFMA 3CC4A 2NLUA 4PJOG 4II1A 5IHIA 1B34A 3OYHA 3QUIA 1Y7XA 4E7KA 1YJWQ 1ABOA 2DAQA 1YJNQ 2XG8D 4LUEA 1YI2Q 1HSQA 2F5TX 5C0MA 3VRZA 3EFRA 4M4ZA 2GGRA 1FWZA 3OYFA 1M2OA 2QEXQ 3I9QA 3OS5A 2FZCB 2P84A 5I22A 1WHHA 2XK0A 2RJCA 2K5FA 4E7ZA 4IUUA 2P0PA 1ZUUA 3CMAQ 3H0HA 1D0ZA 2RHYA 5FROA 5CKDA 4E47A 2DE0X 2VB6A 4RTVA 2LC4A 1AWJA 1NZ9A 2CSIA 2YUQA 4IUPA 1JJ2P 1WNLA 3M0TA 2PQWA 2ZCFB 1Q81C 4JJCA 3L2ZA 4J9BA 4EMGA 4OB0B 2F2VA 3M4YA 2KEAA 2RM4A 1WQ7A 4FL6A 3CXCP 4XU0A 5GMKj 2M51A 1RADB 3CCRA 1EIFA 1QVGS 3QYHB 1RI0A 5GMKl 4XTYA 1FYNA 1KK7A 1RAGB 3MP6A 1QCNA 2JS0A 1G3SA 3EGUA 1F1BB 1YP5A 5LJ3d 4AG1C 1M1GA 5FRMA 3HTRA 2CUDA 2ZAEA 4DA4A 5LJ5h 2ROLA 2YRDA 2CH4A 1VQ5Q 2JTMA 5CAIA 1TH7A 5FU7B 2BZXA 4BB7A 2J6OA 3OYMA 3CCSA 1VQ6Q 3CCUT 1MMDA 1KFZA 2K4YA 2KMTA 2CP6A 5LJ5j 3MEUA 2V8KA 1P92A 4QQGA 4ANJA 3GLXA 3CCJT 2QTVA 3J81E 1X01A 4KUDK 2DD4A 2KBTA 2QDYB 1W2BP 1KQSS 2O88A 2JXBA 5HKCA 2EQMA 2DL4A 2FEIA 1ZUYA 1TS9A 2Y4YA 4FM4B 3I55Q 1Q82U 1MHNA 4ZGDB 2DKGA 4BUGA 1FMWA 4J9DA 2HD0A 2PVGB 4A4EA 1D1BA 2JZ2A 3VUZA 3HFOA 4Z8AA 2CP0A 3RBBB 4X1VA 3IQLA 5CKEA 2KR3A 2HSEB 3L2RA 2ABLA 2XHCA 5FLXE 2ZGWA 2AKLA 4Z89A 4LDUA 3RESA 2X51A 1JBMA 5KYUB 3RIRA 4MMLA 1PNJA 3D7SB 2CZ0B 1U1TA 2G3RA 9ATCB 1V76A 4RTZA 2LQNA 4OMMA 1PCXA 2HKNA 4M75A 5FU7C 3AT1B 2DL7A 2DXBA 4CC2A 2ZPHB 3JCMP 1B07A 3EFSA 2VWFA 4J9IA 1OZ2A 1WIEA 2CP3A 4XAXB 4F7UB 2EIFA 2KYBA 2RQRA 4F14A 2C0IA 2P0QA 4BY6B 4DOVA 1TTHB 2VKNA 1UTIA 4OB2B 3HRSA 4LDYA 3VRYA 2DPPB 4QQ6A 1BIAA 3CCQA 4HA8A 2WSEE 3OQ5A 2DK3A 1VQ7T 2XDBA 3RKWA 2M0OA 3M57A 1UECA 2K79A 4JZ3A 2EJ9A 1VQ4A 2OTJT 4E2FB 3PFSA 1MNEA 2FVUA 3A5ZB 1IGUA 3TSZA 3OY9A 1WDXA 2M16A 1UUEA 2HDAA 4NOYA 2NUTB 3REBB 3UPUA 3UWNA 5GAN2 2HEQA 4C92B 1S72T 1K0SA 1T0JA 4KH1B 3OA6A 1TOVA 2OJ2A 5LJ3h 4BI3A 2CS7A 2FG0A 2VXEA 3QKJA 1VQOQ 4J9FA 2AHJB 4TVRA 3L42A 1W4SA 4M77C 5CQXA 1K76A 6AT1B 1KIKA 4XU3A 4OMOA 5DM7R 1H3ZA 3EGXB 1W70A 5LJ3j 1YJ9T 1IB8A 3OW2A 1R8OB 4YTLA 4C8QG 1G3WA 1WYXA 4FCYA 2L5QA 1OOTA 3LWHA 4M7DB 1M3CA 1T3SA 2HNIA 2K7AA 3V7RA 3CC2T 4JPBW 3JCMX 4ZN1A 1M4ZA 1M1KU 2A7YA 2L3RA 1Q7YU 1AWOA 3PIPA 5IN1A 3L2WA 4J5YA 2O9VA 2DL8A 4C0DB 3QO3A 1HJDA 1G83A 2A3LA 1Q86R 2A08A 1JJ2S 1VQKT 1VQ6T 2O9SA 7AT1B 4LUDA 2VGNA 3UA6A 1TUCA 1OPLA 3GNGA 3CCRQ 4FW1A 1IXDA 5IXFA 2QGFB 3QJYA 5HK0A 1VQPT 2O2OA 4AMCA 2RD1A 1PWTA 2VVKA 3CC7Q 2JNGA 1X6GA 4GLKA 2RHXA 1CKAA 3G4ST 1YHQQ 3CCVA 2JVVA 1ZBXA 2M02A 2RA2A 3R6NA 3G71Q 1UGPB 3MEWA 4XQ3A 4C92C 3QPHA 1NG2A 5LL6S 5FW9A 2EYYA 1XJWB 1N8RU 3CCSQ 2CP2A 1SHFA 3UF4A 4O5VA 5LJ5f 3M0SA 1NLPC 3GBQA 4KH0B 4PJOB 4M78A 2DYBA 3OSSC 3M58A 4J7IA 3CCMA 2LQ8A 3NTIA 1AWWA 4RMOA 4PKCC 1KD1U 2BUDA 4PFOA 5GANe 1KC8C 1PKSA 4M7DC 2DILA 2RH2A 3BDLA 2YRVA 3VS7A 3SWNC 4JRQA 4FYVB 1KHCA 1WHLA 2FHDA 1BK2A 2O31A 5AT1B 2FRWA 5GAMe 2HL5C 1YFNA 3BW1A 1TUGB 4PK4A 2K6DA 4PJNA 2EQUA 2M0YA 1Q81R 2D9TA 3OBYA 4KRTA 4LE9A 3OYKA 2HZYA 4M7AB 3EG3A 2XD0A 3DLLA 3OBWA 2RN8A 1ZSZB 2YUOA 3CPWA 1ZSGA 4OMQA 2L89A 5EG2A 2DX1A 2RI3A 4M77F 3VU3C 1QVFS 3HKSA 2OI3A 2E6NA 5KYYB 2E3IA 3E1SA 2RNAA 4C0FA 3JCMW 3HL8A 3RERA 1PHTA 2IPOB 1H3HA 8AT1B 5CVIA 3NHNA 4MZMA 2RPNA 4C0GA 2DLPA 2DXUA 5GAOr 4F7UF 4DEYA 1LOJA 3I56A 1YITA 5FWCA 1CSKA 4R55A 2KRNA 3M53A 4RKUE 1D1CA 1M3AA 3A8HB 4PFZA 1KC8U 2DFUA 4M77G 4VUBA 3OYCA 1VQ7A 2CT3A 2OTLQ 3JAME 1XNIA 2E65A 4JRIA 2VUBA 1UGQB 1VQ4Q 5D6XA 4EMKA 1N6AA 2EYQA 1E6GA 4F7UG 2FPEA 4OMNA 4F17A 2ED1A 2JM8A 1GCQC 4M7AC 4C92F 5GAN7 4F04B 2QAZA 2MPXC 3PVLA 3NMZC 2D0NA 3M4GA 1K9MU 2GFAA 2MMPA 1I5OB 3LGFA 1VYUA 4LDXA 3JCMe 1Q95G 1AOJA 3ZBDA 1B7TA 1UFFA 4ZTJA 4JDSA 5LJ3f 1M9SA 1K73C 1NM7A 2O4XB 3HRTA 5GAN4 4M7DF 2I2LA 4A4KA 3CC2A 3EHQA 1WZOA 3P8BB 2NWMA 4B6MA 4IKFA 3AHUA 4C92G 1YHQT 2Z0WA 3F70A 2ROTA 3FJPA 4RG8A 4FYWB 2X3WD 2E12A 4CI0C 3S3MA 1LPLA 2D8JA 2JTFA 3ULRB 2LNVA 2QA4T 4KBMB 4IIOA 1VQLQ 3V8LA 1TSFA 3LX7A 1QVPA 3CMET 3TVTA 2J7IA 2K57A 1KQSA 1VQ9T 3J7AF 1X43A 3C0CA 2DIGA 3OYDA 5KYXB 4OGCA 4KGVB 2LZ6B 4AFSC 4M7DG 4HVUA 4KT0E 4ME7A 1VQPA 2CGHA 3LH0A 2ENMA 2J06A 1WA7A 1KQ1A 1GBQA 2KVQG 3JSCA 5GJVB 3REAB 2KRSA 2CSQA 4Z02A 5KH6A 3CCVQ 1M2VA 1J3TA 2K3YA 3TSWA 1D3BB 2GBQA 2W10A 4HVVA 5CCAA 2COYA 3I5RA 1Y07A 1X2KA 2DL5A 3WVEB 2XIDA 1QWEA 1IGQA 5I11A 3TQ7P 4MMKA 1YIJQ 3QWXX 5HY6A 2HBWA 5IAYA 4FYXB 1UGRB 1QCFA 1WXBA 2X9HA 3EHRA 4PJOF 1N5ZA 3QDFA 5A0LA 4EPCA 2JS2A 3CCMQ 4AT1B 1WXUA 2RF0A 1GL5A 2ED0A 1VQ8A 2DZ9A 1YWOA 2LMJA 1RL2A 1V1CA 4X9DA 3GPLA 4GBQA 1KSWA 3EG0A 2X4WA 2MWOA 4EMHA 3MEAA 3H6ZA 2EBPA 1JQQA 3JRZA 4FT4A 5CKHA 4M7AF 5I2SA 2DMOA 2DEQA 3L2VA 2KSSA 3QG1A 3C94A 3EGDA 1CKBA 3KUFA 4C8QB 2E10A 2AIRB 2RQWA 5KE3A 2FYKA 3GIBA 2DO3A 1EFNA 3VS0A 5GAN5 1I81A 3C12A 2QQAA 3JB9H 2QXFA 5GMKi 1TU0B 2E1HA 5A0GA 3X28B 4M7AG 3EFOA 3I56Q 1M90R 1YITQ 1VUBA 2LQKA 1AHJB 2JN0A 2PZ1A 1TXQA 1WFWA 4AFZC 2HAXA 2NUTA 4M75G 1HYOA 2DVEA 2LX9A 2A36A 1VIEA 1SSFA 1X2QA 4QVCA 3G6EQ 5CK9A 5GMKh 2KYMA 2YXYA 4C92D 1RI9A 1QLYA 1UGSB 2M1HA 3X25B 4LD9K 1Q82C 4LD6A 5DY9A 3RNJA 3FDRA 4JRKA 4CC4B 1E7OA 5KCHA 1R0BG 2VYTA 3A1PA 3HSBA 3ASKA 4PL6A 3EGXA 2GF7A 1MMAA 2DRMA 2OX7A 2YHTA 4HT9A 2CKKA 2EQJA 1VQLT 4M7DD 1VQNQ 2W0ZA 4C8QC 3EH2A 3CCET 3CXCA 2V8JA 2LNHB 3T9NA 3C95A 2COWA 2RMOA 1LNXA 3EG1A 3DKMA 3MHXA 1BBZA 4RTYA 2JT4A 2X4XA 4M78E 1Y71A 2P0KA 2QA4A 2DNUA 2EGCA 2CDTA 2KY9A 4N4GA 1YIJT 1ZBJA 3CMEA 1VQ9A 4NL3A 3EG9B 1ARKA 3CCLT 1BIBA 2NUPB 1OU8A 1X6BA 2ATCB 4D8DA 2DM1A 1Z9QA 1WHKA 3INZA 1NJIR 1W2BA 2HQHA 3RUXA 2YUPA 1QVFP 2QK0A 4X34A 2EWNA 4PJOD 2RQUA 2YUNA 2E70A 2RJEA 3NFCA 4B9WA 1I07A 4RTUA 4XTWA 2J05A 4KGXB 4J8OA 3CPFA 4M77B 4A4FA 3H9NA 1U1SA 1OX9A 2V26A 1KQ2A 4N0AA 1VQMA 2D6FA 1PRMC 2XMFA 1R0CB 4XU1A 1YJWT 2EVRA 1YJNT 3I5SA 5J26A 1VQ8Q 2IVWA 3RMSA 2H3JA 1YI2T 1M1KC 2BE7D 1SRLA 5J39A 1Q7YC 1D0XA 1K73R 4M7AD 2V8IA 3LGLA 2QEXT 1NEGA 4JLGA 1I5LA 1O9SA 2DTIA 4LDWA 3CD6Q 4RCBA 1B34B 3P8HA 3M5AA 3CC4Q 3OMGA 1M8VA 1AVZC 2JMCA 3E2UA 1IHVA 5GAOn 5HCKA 4R56A 4CC3A 3CMAT 3UATA 2BE9B 2DL3A 1UJ0A 2XDPA 4AFUC 5GAOm 1G2BA 2MOXA 2YLCA 1U5SA 4C8QF 3M9QA 2E64A 2B8AA 2DXTA 2DRKA 2R5AA 2K2VA 2KRMA 3S3NA 5GANj 5DLQE 1DJ7B 1HXDA 2R58A 2K5LA 2EW3A 1WGSA 2FPFA 3TU4K 5GAOl 5LJ5e 5GAMj 1N8RC 5GAN6 3HRUA 3E19A 1NPRA 4A4HA 3OMCA 2DYIA 1KD1C 3QZ5B 4F16A 3OW2P 3EAEA 4BD3A 3C4SA 1X6OA 2EGAA 3SWNB 2FL7A 2KT1A 4D6WA 3JB9J 3A8MB 2BZYA 4OMLA 2RHZA 3HHTB 4PNOA 3MKDA 2GCXA 1PKTA 2BKDN 2EQIA 1VQ5T 1G3YA 2VASA 2RO0A 5DLOA 2KXCA 4WF2A 1HD3A 3PTAA 1H8KA 1VIFA 2O4XA 3M56A 4QVDA 2PU9B 1VYTA 1RAFB 3KXTA 1JXMA 3SFMA 3X24B 3GOXA 3U23A 1FX7A 3VV0A 1SF9A 5HK3A 4IURA 2M9UA 1WJQA 4E7LA 1D1AA 3CCEA 4HCCA 1YWPA 2XKOC 2CH4W 4N4IA 2L2PA 3PVQA 5KYWA 3I55T 1GFDA 5GAOq 1M30A 2F69A 2ZPFB 4D8KA 1OULA 4X9CA 1OPKA 3CCUA 2C0OA 2F2WA 1K8AU 2V1QA 4C5GA 4FSXA 3KBGA 3JB9G 3CCJA 4PJLA 3CBOA 1RAIB 1Y96A 2MK5A 1WLPB 5LJ5g 3PE0A 1GRIA 1UDLA 1D3BA 3VS2A 4NS5A 1QW1A 3JCMc 4PLLA 4HCBA 4HXJA 3CCLA 2ZPBB 4OB1B 2AK5A 2DA9A 1OX8A 1I0CA 3PMIA 3WXMB 2RJDA 2LP5A 2GTJA 3LW5E 3X20B 2DF6A 4E7JA 2RK1A 3GP8A 4HVWA 3TREA 2DD5A 1I1JA 1Q82R 2LJ1A 1QCOA 4E7HA 4A63B 1K9MC 3CPWP 4FT2A 1JO8A 2FO0A 3VS4A 5D7UA 3META 2C0TA 4FSSA 4M75B 4MZTA 3GNFB 5LJ3e 1NYGA 4DBFA 4ESRA 2JMAA 3RDVA 1SKUB 2RI2A 1LJOA 5KCOA 3PMTA 3QYGB 4WCIA 2I0NA 5ECAA 1VOMA 2EQKA 4EDUA 2QYZA 3EG2A 3QHSA 5GAN8 4J6YA 4DQ2A 3JV3A 4AFQC 2K3XA 1TG0A 4C8QD 3CCQQ 1VQOT 2VC8A 5EC7A 3TEEA 4C92E 2QGGA 4BDYA 2EYWA 4FIBA 1ZQ1A 1K4US 1MNDA 2OTJA 3MO8A 5GANf 1QVGA 4XTZA 1S72A 2EJGA 2FB7A 3JCMb 4DBQA 4PJMA 4JJBA 4BI8B 1N27A 4OVAA 5GAMf 2LDMA 4L59A 4J9GA 1SEMA 4M75C 3LLRA 3VUBA 2RHUA 3CCRT 1A0NB 1YJ9A 3OSVA 4OGEA 4LXCA 2O01E 2CZ1B 2NYSA 2YWWA 4OMFB 2LRQA 4J83A 3L2UA 3CC7T 1T3LA 2COZA 1YN8A 2K2MA 4XTVA 5A0DA 1BB9A 5LJ3g 2MYSA 4RTTA 3O8VA 1PC0A 4J9CA 4OB3B 3G71T 3EH1A 3DLMA 3MPUB 1VQ5A 3OYEA 1KHIA 3M0UA 3OW2S 1X69A 2BTTA 4N4HA 3PIOA 1M1KR 1Q7YR 2HBPA 1PRLC 1VQKA 3FC3A 3CCST 1VQ6A 1SHGA 3M59A 3M0QA 4ELYC 1RABB 2LQWA 3H0FA 2KK4A 3MJXA 3VYGA 2CT4A 1RAHB 2SRCA 3M55A 4UC4A 3VS3A 1OYXA 2L0AA 4JS4A 2LT1A 4PJOE 3G4SA 2MF2A 1OQKA 4BDZA 2PUOB 1K0XA 1Y57A 2ZPIB 2FRYA 2JOYA 4M78B 3NGPA 2EJFA 1ACMB 2LX7A 2PTKA 4C5HA 3ER0A 4E7SA 2LJ3A 3JB9I 1NPPA 2KGTA 3CCJQ 3QXEB 3X26B 1WXTA 3OYBA 1N8RR 1RUWA 4C0ZA 5GJWB 2HSPA 2EKHA 4M7AE 2QQRA 2HQEA 3QDRB 4QVZA 5FU6B 3JCMf 4HT8A 1KD1R 4C5EA 1RLQC 1NYFA 2YRCA 2D0QB 2LCLA 5KYUA 1NLOC 3DB3A 4M77A 2IG0A 3JCMV 4JJNK 1IZ6A 4XTXA 3URGA 4M77D 2GQIA 1OZ3A 1V29B 4IUTA 4JZ4A 3ZEHA 2HMAA 1QMCA 2FPDA 3M0PA 1BU1A 4F7UA 1XTDA 1U8RA 3G1JA 2DTHA 3OS1A 4HCKA 3CCQT 2LTOA 3JCMJ 4M75F
chains in the Genus database with same CATH topology
2O2OA 2RQUA 2YUNA 2YT6A 5IXBA 4Y92A 1PWTA 3KFVA 2VVKA 1I07A 1X6GA 4RTUA 2KXDA 2J05A 1CKAA 3VS6A 2JTEA 3R6NA 3VS1A 4E6RA 1QKXA 1NG2A 5L23A 5FW9A 2EYYA 1UGVA 1PRMC 2XMFA 5IH2A 4JJDA 4CC7A 4IIMA 1AEYA 2A37A 3UF4A 1SHFA 2EVRA 3I5SA 2QDLA 3M0SA 1AWXA 2CREA 1NLPC 3GBQA 1VA7A 1UHCA 1YCSB 2DYBA 1SRLA 5IHKA 1AWWA 1NEGA 2RQVA 1PKSA 2AZVA 1YNZA 1AVZC 1JXOA 2DILA 2JMCA 3VS7A 5HCKA 4CC3A 1BK2A 2O31A 1UG1A 2FRWA 3UATA 4AG2C 2DL3A 1UJ0A 4AFUC 1ZLMA 2K6DA 2M0YA 2DBKA 1OV3A 1G2BA 2MOXA 4J9HA 4KRTA 1U5SA 4LE9A 1MV3A 3CQTA 2DRKA 4RTXA 3EG3A 2KRMA 2P4RA 1IO6A 1OEBA 2BZ8A 2HCKA 1U3OA 4J9EA 2RN8A 2DJQA 2EW3A 2YUOA 1FMKA 1ZSGA 2GTOA 2K9GA 4OMQA 1MUZA 2IIMA 2FPFA 2DX1A 4RTWA 1ABQA 2X3XD 4QT7A 2OI3A 2EYZA 2RNAA 3H41A 2V1RA 3A98A 1GFCA 2CUBA 1NEBA 1PHTA 1H3HA 1WI7A 3NHNA 4F16A 2RPNA 2DLPA 4DEYA 4OMPA 1T0HA 2EGAA 5FWCA 1CSKA 2KRNA 1ZUKA 2KT1A 1M27C 1UE9A 1M3AA 2BZYA 4OMLA 1MV0B 3UA7A 2D1XA 1PKTA 2EQIA 2H8HA 2KXCA 2CT3A 3NPFA 1HD3A 1H8KA 1QWFA 1VYTA 1E6GA 5IHIA 2FPEA 1JXMA 4OMNA 3U23A 4F17A 2YSQA 2ED1A 2JM8A 1GCQC 1JEGA 1ABOA 1YWPA 3PVLA 3NMZC 3QWYA 2CH4W 2L2PA 3PVQA 2D0NA 1LCKA 4LUEA 1HSQA 4ORZA 1VYUA 3VRZA 4M4ZA 1GFDA 1M30A 2GGRA 2JW4A 2LJ0A 4D8KA 1AOJA 1GCQA 2ECZA 1OPKA 3I9QA 2C0OA 2F2WA 2L3QA 2V1QA 5I22A 1UFFA 1NM7A 1ZUUA 3EHQA 1WLPB 2NWMA 3PE0A 3H0HA 1GRIA 1UDLA 3VS2A 2ROTA 2X3WD 2DE0X 1W6XA 2D8JA 4RTVA 4HXJA 5FWBA 3ULRB 1AWJA 1ZX6A 2CSIA 2YUQA 4LN2A 4IIOA 2AK5A 3M0TA 2DA9A 4JJCA 1I0CA 3TVTA 2J7IA 2KNBB 2LP5A 1X43A 2GTJA 1UJYA 4J9BA 2DF6A 3C0CA 4HVWA 2NUZA 1I1JA 2F2VA 4AFSC 2LZ6B 2LJ1A 1H92A 4HVUA 2KEAA 1GBRA 1W1FA 4A63B 2ENMA 2J06A 1WA7A 1GBQA 2M51A 5GJVB 1JO8A 2FO0A 3VS4A 3REAB 2KRSA 2A28A 2CSQA 2EPDA 1X27A 2RQTA 1J3TA 3TSWA 2GBQA 2W10A 4HVVA 2C0TA 4FSSA 3I5RA 1X2KA 1FYNA 1NYGA 2DL5A 2JS0A 2MIOA 3SHWA 4ZNXA 3EGUA 1QWEA 1YP5A 4AG1C 4ESRA 5I11A 4Z88A 3H0IA 2JMAA 2CUDA 3QWXX 2HBWA 1QCFA 1WXBA 1KJWA 3EHRA 3FJ5A 2ROLA 2CH4A 1N5ZA 2BZXA 2JS2A 4WCIA 1U06A 2I0NA 5ECAA 1SRMA 1WXUA 2J6OA 1QKWA 2KT8A 2AZSA 2RF0A 1KFZA 1GL5A 2ED0A 3EG2A 1YWOA 2SEMA 1JU5C 3JV3A 4AFQC 1SSHA 1TG0A 1TUDA 2LMJA 1V1CA 2KBTA 5EC7A 2JM9A 2J6FA 2EYWA 2LCSA 4GBQA 1K4US 2OAWA 1KSWA 3EG0A 2G6FX 4GLMA 2EBPA 2JXBA 2O88A 1JQQA 1AD5A 2DL4A 2FEIA 3M0RA 1ZUYA 2DMOA 2YDLA 4J9DA 2DBMA 1CKBA 4Z8AA 2RQWA 4JJBA 3RBBB 4X1VA 3IQLA 1EFNA 3VS0A 1K1ZA 2KR3A 2ABLA 4J9GA 1SEMA 2AKLA 1AZEA 4Z89A 1A0NB 2EGEA 4K11A 2F2XA 1PNJA 1T3LA 1YN8A 2K2MA 1GCPA 1BB9A 4RTZA 2LQNA 4R0KA 4OMMA 2PZ1A 4LNPA 4RTTA 3LH5A 2MCNA 2DL7A 2AKKA 4J9CA 4CC2A 1WFWA 1B07A 4RUGA 3O5ZA 2ESWA 2VWFA 4J9IA 4AFZC 1WIEA 1AZGB 3M0UA 1X69A 2BTTA 2KYBA 2RQRA 4F14A 2C0IA 3SEMA 1PRLC 2E5KA 2A36A 1X2QA 2VKNA 1SHGA 2KYMA 1RI9A 1QLYA 3M0QA 1UTIA 2LQWA 3VRYA 2L3SA 3H0FA 3RNJA 4CC4B 1E7OA 1K9AA 2CT4A 3VS5A 2SRCA 1Z9ZA 3VS3A 1UECA 2K79A 2L0AA 4JZ3A 1S1NA 2DRMA 1M8MA 2EYXA 4DEXA 1K0XA 3TSZA 1Y57A 1WDXA 2FRYA 4EIKA 2KE9A 1UUEA 5IHNA 2HDAA 2W0ZA 3NGPA 1M3BA 3REBB 2LX7A 2HEQA 2PTKA 1K0SA 1T0JA 2LNHB 2D8HA 2LJ3A 3THKA 2OJ2A 2FG0A 2KGTA 3ZL7C 1WXTA 2RMOA 4J9FA 2KROA 1RUWA 3EG1A 1K76A 1KIKA 5GJWB 2HSPA 4OMOA 1BBZA 4RTYA 2JT4A 1W70A 2EKHA 2J6KA 1WYXA 1OOTA 1M3CA 1T3SA 2K7AA 1RLQC 1VYVA 4JPBW 1NYFA 1RLPC 1UHFA 2DNUA 2EGCA 1E6HA 2CDTA 2DVJA 1AWOA 1NLOC 2B86A 1ZBJA 2L3PA 2O9VA 3I35A 2DL8A 1XOVA 1HJDA 1ARKA 1G83A 2GNCA 1Y0MA 2GQIA 1B3QA 1X6BA 4D8DA 2A08A 4JZ4A 1SPKA 2DM1A 2FPDA 1Z9QA 2O9SA 4LUDA 3M0PA 1BU1A 3UA6A 1TUCA 1OPLA 2YUPA 4HCKA 1WX6A 5IXFA 2PNIA 2K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2O A;  2RQU A;  2YUN A;  2YT6 A;  5IXB A;  4Y92 A;  1PWT A;  3KFV A;  2VVK A;  1I07 A;  1X6G A;  4RTU A;  2KXD A;  2J05 A;  1CKA A;  3VS6 A;  2JTE A;  3R6N A;  3VS1 A;  4E6R A;  1QKX A;  1NG2 A;  5L23 A;  5FW9 A;  2EYY A;  1UGV A;  1PRM C;  2XMF A;  5IH2 A;  4JJD A;  4CC7 A;  4IIM A;  1AEY A;  2A37 A;  3UF4 A;  1SHF A;  2EVR A;  3I5S A;  2QDL A;  3M0S A;  1AWX A;  2CRE A;  1NLP C;  3GBQ A;  1VA7 A;  1UHC A;  1YCS B;  2DYB A;  1SRL A;  5IHK A;  1AWW A;  1NEG A;  2RQV A;  1PKS A;  2AZV A;  1YNZ A;  1AVZ C;  1JXO A;  2DIL A;  2JMC A;  3VS7 A;  5HCK A;  4CC3 A;  1BK2 A;  2O31 A;  1UG1 A;  2FRW A;  3UAT A;  4AG2 C;  2DL3 A;  1UJ0 A;  4AFU C;  1ZLM A;  2K6D A;  2M0Y A;  2DBK A;  1OV3 A;  1G2B A;  2MOX A;  4J9H A;  4KRT A;  1U5S A;  4LE9 A;  1MV3 A;  3CQT A;  2DRK A;  4RTX A;  3EG3 A;  2KRM A;  2P4R A;  1IO6 A;  1OEB A;  2BZ8 A;  2HCK A;  1U3O A;  4J9E A;  2RN8 A;  2DJQ A;  2EW3 A;  2YUO A;  1FMK A;  1ZSG A;  2GTO A;  2K9G A;  4OMQ A;  1MUZ A;  2IIM A;  2FPF A;  2DX1 A;  4RTW A;  1ABQ A;  2X3X D;  4QT7 A;  2OI3 A;  2EYZ A;  2RNA A;  3H41 A;  2V1R A;  3A98 A;  1GFC A;  2CUB A;  1NEB A;  1PHT A;  1H3H A;  1WI7 A;  3NHN A;  4F16 A;  2RPN A;  2DLP A;  4DEY A;  4OMP A;  1T0H A;  2EGA A;  5FWC A;  1CSK A;  2KRN A;  1ZUK A;  2KT1 A;  1M27 C;  1UE9 A;  1M3A A;  2BZY A;  4OML A;  1MV0 B;  3UA7 A;  2D1X A;  1PKT A;  2EQI A;  2H8H A;  2KXC A;  2CT3 A;  3NPF A;  1HD3 A;  1H8K A;  1QWF A;  1VYT A;  1E6G A;  5IHI A;  2FPE A;  1JXM A;  4OMN A;  3U23 A;  4F17 A;  2YSQ A;  2ED1 A;  2JM8 A;  1GCQ C;  1JEG A;  1ABO A;  1YWP A;  3PVL A;  3NMZ C;  3QWY A;  2CH4 W;  2L2P A;  3PVQ A;  2D0N A;  1LCK A;  4LUE A;  1HSQ A;  4ORZ A;  1VYU A;  3VRZ A;  4M4Z A;  1GFD A;  1M30 A;  2GGR A;  2JW4 A;  2LJ0 A;  4D8K A;  1AOJ A;  1GCQ A;  2ECZ A;  1OPK A;  3I9Q A;  2C0O A;  2F2W A;  2L3Q A;  2V1Q A;  5I22 A;  1UFF A;  1NM7 A;  1ZUU A;  3EHQ A;  1WLP B;  2NWM A;  3PE0 A;  3H0H A;  1GRI A;  1UDL A;  3VS2 A;  2ROT A;  2X3W D;  2DE0 X;  1W6X A;  2D8J A;  4RTV A;  4HXJ A;  5FWB A;  3ULR B;  1AWJ A;  1ZX6 A;  2CSI A;  2YUQ A;  4LN2 A;  4IIO A;  2AK5 A;  3M0T A;  2DA9 A;  4JJC A;  1I0C A;  3TVT A;  2J7I A;  2KNB B;  2LP5 A;  1X43 A;  2GTJ A;  1UJY A;  4J9B A;  2DF6 A;  3C0C A;  4HVW A;  2NUZ A;  1I1J A;  2F2V A;  4AFS C;  2LZ6 B;  2LJ1 A;  1H92 A;  4HVU A;  2KEA A;  1GBR A;  1W1F A;  4A63 B;  2ENM A;  2J06 A;  1WA7 A;  1GBQ A;  2M51 A;  5GJV B;  1JO8 A;  2FO0 A;  3VS4 A;  3REA B;  2KRS A;  2A28 A;  2CSQ A;  2EPD A;  1X27 A;  2RQT A;  1J3T A;  3TSW A;  2GBQ A;  2W10 A;  4HVV A;  2C0T A;  4FSS A;  3I5R A;  1X2K A;  1FYN A;  1NYG A;  2DL5 A;  2JS0 A;  2MIO A;  3SHW A;  4ZNX A;  3EGU A;  1QWE A;  1YP5 A;  4AG1 C;  4ESR A;  5I11 A;  4Z88 A;  3H0I A;  2JMA A;  2CUD A;  3QWX X;  2HBW A;  1QCF A;  1WXB A;  1KJW A;  3EHR A;  3FJ5 A;  2ROL A;  2CH4 A;  1N5Z A;  2BZX A;  2JS2 A;  4WCI A;  1U06 A;  2I0N A;  5ECA A;  1SRM A;  1WXU A;  2J6O A;  1QKW A;  2KT8 A;  2AZS A;  2RF0 A;  1KFZ A;  1GL5 A;  2ED0 A;  3EG2 A;  1YWO A;  2SEM A;  1JU5 C;  3JV3 A;  4AFQ C;  1SSH A;  1TG0 A;  1TUD A;  2LMJ A;  1V1C A;  2KBT A;  5EC7 A;  2JM9 A;  2J6F A;  2EYW A;  2LCS A;  4GBQ A;  1K4U S;  2OAW A;  1KSW A;  3EG0 A;  2G6F X;  4GLM A;  2EBP A;  2JXB A;  2O88 A;  1JQQ A;  1AD5 A;  2DL4 A;  2FEI A;  3M0R A;  1ZUY A;  2DMO A;  2YDL A;  4J9D A;  2DBM A;  1CKB A;  4Z8A A;  2RQW A;  4JJB A;  3RBB B;  4X1V A;  3IQL A;  1EFN A;  3VS0 A;  1K1Z A;  2KR3 A;  2ABL A;  4J9G A;  1SEM A;  2AKL A;  1AZE A;  4Z89 A;  1A0N B;  2EGE A;  4K11 A;  2F2X A;  1PNJ A;  1T3L A;  1YN8 A;  2K2M A;  1GCP A;  1BB9 A;  4RTZ A;  2LQN A;  4R0K A;  4OMM A;  2PZ1 A;  4LNP A;  4RTT A;  3LH5 A;  2MCN A;  2DL7 A;  2AKK A;  4J9C A;  4CC2 A;  1WFW A;  1B07 A;  4RUG A;  3O5Z A;  2ESW A;  2VWF A;  4J9I A;  4AFZ C;  1WIE A;  1AZG B;  3M0U A;  1X69 A;  2BTT A;  2KYB A;  2RQR A;  4F14 A;  2C0I A;  3SEM A;  1PRL C;  2E5K A;  2A36 A;  1X2Q A;  2VKN A;  1SHG A;  2KYM A;  1RI9 A;  1QLY A;  3M0Q A;  1UTI A;  2LQW A;  3VRY A;  2L3S A;  3H0F A;  3RNJ A;  4CC4 B;  1E7O A;  1K9A A;  2CT4 A;  3VS5 A;  2SRC A;  1Z9Z A;  3VS3 A;  1UEC A;  2K79 A;  2L0A A;  4JZ3 A;  1S1N A;  2DRM A;  1M8M A;  2EYX A;  4DEX A;  1K0X A;  3TSZ A;  1Y57 A;  1WDX A;  2FRY A;  4EIK A;  2KE9 A;  1UUE A;  5IHN A;  2HDA A;  2W0Z A;  3NGP A;  1M3B A;  3REB B;  2LX7 A;  2HEQ A;  2PTK A;  1K0S A;  1T0J A;  2LNH B;  2D8H A;  2LJ3 A;  3THK A;  2OJ2 A;  2FG0 A;  2KGT A;  3ZL7 C;  1WXT A;  2RMO A;  4J9F A;  2KRO A;  1RUW A;  3EG1 A;  1K76 A;  1KIK A;  5GJW B;  2HSP A;  4OMO A;  1BBZ A;  4RTY A;  2JT4 A;  1W70 A;  2EKH A;  2J6K A;  1WYX A;  1OOT A;  1M3C A;  1T3S A;  2K7A A;  1RLQ C;  1VYV A;  4JPB W;  1NYF A;  1RLP C;  1UHF A;  2DNU A;  2EGC A;  1E6H A;  2CDT A;  2DVJ A;  1AWO A;  1NLO C;  2B86 A;  1ZBJ A;  2L3P A;  2O9V A;  3I35 A;  2DL8 A;  1XOV A;  1HJD A;  1ARK A;  1G83 A;  2GNC A;  1Y0M A;  2GQI A;  1B3Q A;  1X6B A;  4D8D A;  2A08 A;  4JZ4 A;  1SPK A;  2DM1 A;  2FPD A;  1Z9Q A;  2O9S A;  4LUD A;  3M0P A;  1BU1 A;  3UA6 A;  1TUC A;  1OPL A;  2YUP A;  4HCK A;  1WX6 A;  5IXF A;  2PNI A;  2K3B A; 
#chains in the Genus database with same CATH topology
 2YT6 A;  2OTL T;  5IXB A;  4Y92 A;  4DBH A;  2KXD A;  2BIV A;  4RCC A;  2HQX A;  5AYF A;  1VQ4 T;  1RAA B;  1WPY A;  3VS6 A;  1C0M A;  3CPW S;  4M78 C;  4BE0 A;  3RKX A;  4E6R A;  1QKX A;  3HFN A;  2ZZD A;  1JB0 E;  1BKB A;  4J6W A;  2LCC A;  5IH2 A;  2RB6 A;  1AWX A;  2CRE A;  3A8L B;  1C6V X;  1VA7 A;  4OP0 A;  2OAU A;  4B9X A;  2RJF A;  4C92 A;  4E7I A;  5IHK A;  1VQO A;  1VQ7 Q;  2RQV A;  4P5N A;  4EMK B;  5A2Q E;  5FU6 C;  3P8D A;  4JLI A;  1KC8 R;  5FRN A;  2AZV A;  3V8J A;  1G8X A;  1YNZ A;  2QAS A;  5GAN d;  2YLB A;  2AT1 B;  2F1L A;  2MI6 A;  2OTJ Q;  3WVD B;  1RAC B;  1JJ2 A;  3OYN A;  5CO7 A;  2E6Z A;  1Q86 U;  4A53 A;  3G7Z A;  5GAM d;  1ZLM A;  4M7D A;  1MMN A;  1ZHI A;  1BI1 A;  1S72 Q;  1OV3 A;  4FW2 A;  3OYA A;  3S6W A;  1SG5 A;  5GMK m;  3SWN A;  5GAN 3;  2P4R A;  2BZ8 A;  1U3O A;  4J9E A;  3RMQ A;  2GTO A;  2FZK B;  1MUZ A;  2WSC E;  1K9M R;  4RG2 A;  2IIM A;  3FLG A;  3V7C A;  3SDZ A;  5CQY A;  1YJ9 Q;  1ABQ A;  2X3X D;  2QTX A;  4QT7 A;  3TCJ A;  2QQB A;  3CC2 Q;  3CC7 A;  1G5V A;  2LVM A;  3R6O A;  1YHQ A;  3QII A;  3A98 A;  3CCV T;  2CUB A;  1NEB A;  2DEU A;  3G71 A;  1I8F A;  2R5M A;  3CBP A;  1N9R A;  4OMP A;  2K5I A;  1ZUK A;  5L8R E;  1UE9 A;  2EAY A;  1VQK Q;  4XTU A;  1O75 A;  1IHW A;  5GAO p;  4EMK C;  4KUL A;  1PD0 A;  2H8H A;  3V8K A;  3CCM T;  1VQP Q;  1WHG A;  1M2V B;  3NPF A;  4PJO A;  1X75 C;  3G4S Q;  1QWF A;  1Q81 U;  4IUV A;  4FU6 A;  2CYZ B;  2FZG B;  1BCM A;  3MCA B;  4M78 F;  2XU8 A;  2YSQ A;  2E41 A;  4XK8 E;  1JEG A;  2GFU A;  2QQ9 A;  1QVF A;  3QWY A;  1LCK A;  4HCZ A;  4JS5 A;  4ORZ A;  2JW4 A;  2LJ0 A;  3JCM d;  1GCQ A;  2ECZ A;  3OS0 A;  4M7A A;  2L3Q A;  2JUF A;  4BAC A;  1ZSZ A;  3OYL A;  2WAC A;  3NTK A;  3RKY A;  3PGG A;  3BY7 A;  4M78 G;  4C8Q E;  1YCY A;  2EKO A;  1W6X A;  5GMK e;  5KYY A;  1GXI E;  3OYY A;  2MAM A;  5FWB A;  2QG9 B;  4LDV A;  1ZX6 A;  3EGD B;  2HL3 A;  3I56 T;  1YIT T;  1FMV A;  4M75 D;  4LN2 A;  5GAN h;  1MMG A;  4KUI A;  2KNB B;  3HPW A;  1UJY A;  2NUZ A;  1UB4 A;  2QQS A;  5GAM h;  1H92 A;  2C06 A;  1GBR A;  1W1F A;  1QQJ A;  2OTL A;  3G6E T;  3HP9 A;  4C5I A;  3L1A A;  3EFO B;  3SB2 A;  2A28 A;  2EPD A;  2ZPG B;  1X27 A;  2RQT A;  4CRI A;  4MDW A;  4L5G A;  1K8A C;  2MIO A;  3PT9 A;  3SHW A;  2DXC A;  4ELZ C;  4ZNX A;  3ZFJ A;  4Z88 A;  4PFP A;  3H0I A;  1WJS A;  2MWP A;  1KJW A;  3FJ5 A;  2PVO B;  1VQN T;  1U06 A;  4Y28 E;  1SRM A;  3BDU A;  1KG1 A;  3CBM A;  1QKW A;  2KT8 A;  2AZS A;  1C1A A;  2LT4 A;  2P4T A;  2KQW A;  2SEM A;  1JU5 C;  1SSH A;  1TUD A;  2KDS A;  3N5B B;  5IT9 E;  3QSU A;  2JM9 A;  2J6F A;  4A54 A;  2LCS A;  5CKF A;  2OAW A;  4BE1 A;  3JB9 F;  4QKU A;  2G6F X;  4GLM A;  1AD5 A;  4BY6 C;  3FB9 A;  1M5Q 1;  3M0R A;  2R57 A;  3QJ6 A;  1BYM A;  3OYI A;  5D6Y A;  1VQL A;  2YDL A;  1R77 A;  2RK2 A;  2E5Q A;  1N9S A;  1QP3 A;  2DBM A;  2HKQ B;  1G3T A;  3OYG A;  3SD4 A;  1K1Z A;  2PVD B;  4Y91 A;  5KYX A;  1YBY A;  5CIU A;  3VKI A;  1AZE A;  2DTO A;  2EGE A;  3CXC S;  4K11 A;  2CZ6 B;  4L6V 5;  3JCM h;  2RHI A;  2F2X A;  2VGM A;  3VYH B;  4Q5W A;  1M90 C;  1UEB A;  2QA4 Q;  1GCP A;  3M54 A;  1BCO A;  3UT1 A;  4R0K A;  1YIJ A;  3CME Q;  4LNP A;  3LH5 A;  2MCN A;  2AKK A;  4QW2 A;  4RUG A;  1VQ9 Q;  1HK9 A;  2ESW A;  3O5Z A;  1AZG B;  2VV5 A;  4J7F A;  2EFI A;  4GY5 A;  3SEM A;  2E5K A;  2X4J A;  1WJR A;  1IRE B;  4M78 D;  3E9F A;  1VQ8 T;  4PLI A;  4M77 E;  4KGZ B;  3UDC A;  2X35 A;  2L3S A;  4O6J A;  3L2Q A;  1K9A A;  3VS5 A;  1Z9Z A;  3GF5 A;  3CD6 T;  3DB4 A;  2XI9 A;  1TWB A;  4C0D C;  3J80 E;  3CC4 T;  4MDX A;  1S1N A;  3FRN A;  4F7U E;  2XDD A;  2DET A;  1M8M A;  1MGQ A;  2EYX A;  4DEX A;  4ZGE B;  1W2B S;  2F5K A;  1OU9 A;  4EIK A;  2KE9 A;  5IHN A;  1VQM Q;  1BI3 A;  3LYI A;  1M3B A;  4HKE A;  1YJW A;  1ZA2 B;  3ME9 A;  1EX4 A;  1YJN A;  4OF1 A;  2D8H A;  3THK A;  4QQD A;  1YI2 A;  4XU2 A;  3ZL7 C;  2QEX A;  4C8Q A;  2KRO A;  2VXF A;  1M90 U;  3A8O B;  2GQV A;  1NBE B;  2WSF E;  1PD1 A;  1WHM A;  1NE8 A;  3JCM Q;  2J6K A;  1M1F A;  3BE3 A;  1LVK A;  1VYV A;  3CMA A;  1RLP C;  1UHF A;  2A0F B;  4NL2 A;  1E6H A;  2DVJ A;  4PJO C;  2B86 A;  1BI2 A;  3FEO A;  2ZPE B;  2L3P A;  4JRP A;  3I35 A;  1FXX A;  2X4Y A;  1XOV A;  1PSE A;  2GNC A;  2CZ7 B;  1EZZ B;  2Y4X A;  1RAE B;  1Y0M A;  1B3Q A;  1WHJ A;  2DER A;  1SPK A;  5J3B A;  3G6E A;  1QVG P;  1NJI C;  3LWI A;  4ATO A;  4V2S A;  2H3E B;  4M7D E;  4IUQ A;  3E9G A;  5GAN g;  1WX6 A;  4FYY B;  2PNI A;  2K3B A;  4N0A C;  5KE2 A;  3KFV A;  4BE2 A;  3MP8 A;  1BI0 A;  1D09 B;  3MP1 A;  1I4K 1;  5GAM g;  2JTE A;  3VS1 A;  3A8G B;  4DBR A;  3OYJ A;  1ZSZ C;  5L23 A;  2PUK B;  1UGV A;  3OB9 A;  1VQN A;  4JJD A;  4CC7 A;  4IIM A;  1AEY A;  2A37 A;  4MZP A;  2QDL A;  2DIQ A;  1AT1 B;  3JB9 D;  2E3H A;  3NTH A;  1UHC A;  1YCS B;  5CKB A;  3CEY A;  4ZTF A;  2XIC A;  2L8D A;  1QP2 A;  3QBY A;  1KQS P;  1IRX A;  1PSF A;  3VJP A;  1JXO A;  1PG5 B;  5I21 A;  1D0Y A;  1UG1 A;  4AG2 C;  2KI7 A;  5KYW B;  4BI4 A;  3CCE Q;  3RR6 A;  2DBK A;  4J9H A;  1MV3 A;  3CQT A;  1NJI U;  3I55 A;  4RTX A;  5KYN A;  1IO6 A;  1OEB A;  2HCK A;  3MEV A;  1H64 1;  3EG9 A;  2DJQ A;  1FMK A;  3CCU Q;  2K9G A;  4ZN3 A;  5D6W A;  2NUP A;  1Y96 B;  4DOW A;  2DJZ A;  2JJ9 A;  4RTW A;  2CP7 A;  2QI2 A;  2E4H A;  1XQH A;  4A4G A;  5LJ5 d;  4J6X A;  2EYZ A;  1K8A R;  1WQW A;  3QZ9 B;  3H41 A;  2V1R A;  1GFC A;  3S3O A;  1WI7 A;  4JUV A;  3PNW C;  2DZC A;  3CCL Q;  3OS2 A;  1T0H A;  1VQM T;  1PM3 A;  4WTO B;  2KAF A;  4ZGJ B;  1K73 U;  1M27 C;  4PJJ A;  5I2M A;  5CR2 A;  3JCM g;  3FIF A;  3UA7 A;  1MV0 B;  2Y90 A;  3V7S A;  1ZA1 B;  4M75 E;  2D1X A;  1OI1 A;  5C6S A;  1Q86 C;  3Q1J A;  8ATC B;  3H8Z A;  2RI5 A;  5M9O A;  3CD6 A;  2CP5 A;  1JRI A;  3BFM A;  3CC4 A;  2NLU A;  4PJO G;  4II1 A;  5IHI A;  1B34 A;  3OYH A;  3QUI A;  1Y7X A;  4E7K A;  1YJW Q;  1ABO A;  2DAQ A;  1YJN Q;  2XG8 D;  4LUE A;  1YI2 Q;  1HSQ A;  2F5T X;  5C0M A;  3VRZ A;  3EFR A;  4M4Z A;  2GGR A;  1FWZ A;  3OYF A;  1M2O A;  2QEX Q;  3I9Q A;  3OS5 A;  2FZC B;  2P84 A;  5I22 A;  1WHH A;  2XK0 A;  2RJC A;  2K5F A;  4E7Z A;  4IUU A;  2P0P A;  1ZUU A;  3CMA Q;  3H0H A;  1D0Z A;  2RHY A;  5FRO A;  5CKD A;  4E47 A;  2DE0 X;  2VB6 A;  4RTV A;  2LC4 A;  1AWJ A;  1NZ9 A;  2CSI A;  2YUQ A;  4IUP A;  1JJ2 P;  1WNL A;  3M0T A;  2PQW A;  2ZCF B;  1Q81 C;  4JJC A;  3L2Z A;  4J9B A;  4EMG A;  4OB0 B;  2F2V A;  3M4Y A;  2KEA A;  2RM4 A;  1WQ7 A;  4FL6 A;  3CXC P;  4XU0 A;  5GMK j;  2M51 A;  1RAD B;  3CCR A;  1EIF A;  1QVG S;  3QYH B;  1RI0 A;  5GMK l;  4XTY A;  1FYN A;  1KK7 A;  1RAG B;  3MP6 A;  1QCN A;  2JS0 A;  1G3S A;  3EGU A;  1F1B B;  1YP5 A;  5LJ3 d;  4AG1 C;  1M1G A;  5FRM A;  3HTR A;  2CUD A;  2ZAE A;  4DA4 A;  5LJ5 h;  2ROL A;  2YRD A;  2CH4 A;  1VQ5 Q;  2JTM A;  5CAI A;  1TH7 A;  5FU7 B;  2BZX A;  4BB7 A;  2J6O A;  3OYM A;  3CCS A;  1VQ6 Q;  3CCU T;  1MMD A;  1KFZ A;  2K4Y A;  2KMT A;  2CP6 A;  5LJ5 j;  3MEU A;  2V8K A;  1P92 A;  4QQG A;  4ANJ A;  3GLX A;  3CCJ T;  2QTV A;  3J81 E;  1X01 A;  4KUD K;  2DD4 A;  2KBT A;  2QDY B;  1W2B P;  1KQS S;  2O88 A;  2JXB A;  5HKC A;  2EQM A;  2DL4 A;  2FEI A;  1ZUY A;  1TS9 A;  2Y4Y A;  4FM4 B;  3I55 Q;  1Q82 U;  1MHN A;  4ZGD B;  2DKG A;  4BUG A;  1FMW A;  4J9D A;  2HD0 A;  2PVG B;  4A4E A;  1D1B A;  2JZ2 A;  3VUZ A;  3HFO A;  4Z8A A;  2CP0 A;  3RBB B;  4X1V A;  3IQL A;  5CKE A;  2KR3 A;  2HSE B;  3L2R A;  2ABL A;  2XHC A;  5FLX E;  2ZGW A;  2AKL A;  4Z89 A;  4LDU A;  3RES A;  2X51 A;  1JBM A;  5KYU B;  3RIR A;  4MML A;  1PNJ A;  3D7S B;  2CZ0 B;  1U1T A;  2G3R A;  9ATC B;  1V76 A;  4RTZ A;  2LQN A;  4OMM A;  1PCX A;  2HKN A;  4M75 A;  5FU7 C;  3AT1 B;  2DL7 A;  2DXB A;  4CC2 A;  2ZPH B;  3JCM P;  1B07 A;  3EFS A;  2VWF A;  4J9I A;  1OZ2 A;  1WIE A;  2CP3 A;  4XAX B;  4F7U B;  2EIF A;  2KYB A;  2RQR A;  4F14 A;  2C0I A;  2P0Q A;  4BY6 B;  4DOV A;  1TTH B;  2VKN A;  1UTI A;  4OB2 B;  3HRS A;  4LDY A;  3VRY A;  2DPP B;  4QQ6 A;  1BIA A;  3CCQ A;  4HA8 A;  2WSE E;  3OQ5 A;  2DK3 A;  1VQ7 T;  2XDB A;  3RKW A;  2M0O A;  3M57 A;  1UEC A;  2K79 A;  4JZ3 A;  2EJ9 A;  1VQ4 A;  2OTJ T;  4E2F B;  3PFS A;  1MNE A;  2FVU A;  3A5Z B;  1IGU A;  3TSZ A;  3OY9 A;  1WDX A;  2M16 A;  1UUE A;  2HDA A;  4NOY A;  2NUT B;  3REB B;  3UPU A;  3UWN A;  5GAN 2;  2HEQ A;  4C92 B;  1S72 T;  1K0S A;  1T0J A;  4KH1 B;  3OA6 A;  1TOV A;  2OJ2 A;  5LJ3 h;  4BI3 A;  2CS7 A;  2FG0 A;  2VXE A;  3QKJ A;  1VQO Q;  4J9F A;  2AHJ B;  4TVR A;  3L42 A;  1W4S A;  4M77 C;  5CQX A;  1K76 A;  6AT1 B;  1KIK A;  4XU3 A;  4OMO A;  5DM7 R;  1H3Z A;  3EGX B;  1W70 A;  5LJ3 j;  1YJ9 T;  1IB8 A;  3OW2 A;  1R8O B;  4YTL A;  4C8Q G;  1G3W A;  1WYX A;  4FCY A;  2L5Q A;  1OOT A;  3LWH A;  4M7D B;  1M3C A;  1T3S A;  2HNI A;  2K7A A;  3V7R A;  3CC2 T;  4JPB W;  3JCM X;  4ZN1 A;  1M4Z A;  1M1K U;  2A7Y A;  2L3R A;  1Q7Y U;  1AWO A;  3PIP A;  5IN1 A;  3L2W A;  4J5Y A;  2O9V A;  2DL8 A;  4C0D B;  3QO3 A;  1HJD A;  1G83 A;  2A3L A;  1Q86 R;  2A08 A;  1JJ2 S;  1VQK T;  1VQ6 T;  2O9S A;  7AT1 B;  4LUD A;  2VGN A;  3UA6 A;  1TUC A;  1OPL A;  3GNG A;  3CCR Q;  4FW1 A;  1IXD A;  5IXF A;  2QGF B;  3QJY A;  5HK0 A;  1VQP T;  2O2O A;  4AMC A;  2RD1 A;  1PWT A;  2VVK A;  3CC7 Q;  2JNG A;  1X6G A;  4GLK A;  2RHX A;  1CKA A;  3G4S T;  1YHQ Q;  3CCV A;  2JVV A;  1ZBX A;  2M02 A;  2RA2 A;  3R6N A;  3G71 Q;  1UGP B;  3MEW A;  4XQ3 A;  4C92 C;  3QPH A;  1NG2 A;  5LL6 S;  5FW9 A;  2EYY A;  1XJW B;  1N8R U;  3CCS Q;  2CP2 A;  1SHF A;  3UF4 A;  4O5V A;  5LJ5 f;  3M0S A;  1NLP C;  3GBQ A;  4KH0 B;  4PJO B;  4M78 A;  2DYB A;  3OSS C;  3M58 A;  4J7I A;  3CCM A;  2LQ8 A;  3NTI A;  1AWW A;  4RMO A;  4PKC C;  1KD1 U;  2BUD A;  4PFO A;  5GAN e;  1KC8 C;  1PKS A;  4M7D C;  2DIL A;  2RH2 A;  3BDL A;  2YRV A;  3VS7 A;  3SWN C;  4JRQ A;  4FYV B;  1KHC A;  1WHL A;  2FHD A;  1BK2 A;  2O31 A;  5AT1 B;  2FRW A;  5GAM e;  2HL5 C;  1YFN A;  3BW1 A;  1TUG B;  4PK4 A;  2K6D A;  4PJN A;  2EQU A;  2M0Y A;  1Q81 R;  2D9T A;  3OBY A;  4KRT A;  4LE9 A;  3OYK A;  2HZY A;  4M7A B;  3EG3 A;  2XD0 A;  3DLL A;  3OBW A;  2RN8 A;  1ZSZ B;  2YUO A;  3CPW A;  1ZSG A;  4OMQ A;  2L89 A;  5EG2 A;  2DX1 A;  2RI3 A;  4M77 F;  3VU3 C;  1QVF S;  3HKS A;  2OI3 A;  2E6N A;  5KYY B;  2E3I A;  3E1S A;  2RNA A;  4C0F A;  3JCM W;  3HL8 A;  3RER A;  1PHT A;  2IPO B;  1H3H A;  8AT1 B;  5CVI A;  3NHN A;  4MZM A;  2RPN A;  4C0G A;  2DLP A;  2DXU A;  5GAO r;  4F7U F;  4DEY A;  1LOJ A;  3I56 A;  1YIT A;  5FWC A;  1CSK A;  4R55 A;  2KRN A;  3M53 A;  4RKU E;  1D1C A;  1M3A A;  3A8H B;  4PFZ A;  1KC8 U;  2DFU A;  4M77 G;  4VUB A;  3OYC A;  1VQ7 A;  2CT3 A;  2OTL Q;  3JAM E;  1XNI A;  2E65 A;  4JRI A;  2VUB A;  1UGQ B;  1VQ4 Q;  5D6X A;  4EMK A;  1N6A A;  2EYQ A;  1E6G A;  4F7U G;  2FPE A;  4OMN A;  4F17 A;  2ED1 A;  2JM8 A;  1GCQ C;  4M7A C;  4C92 F;  5GAN 7;  4F04 B;  2QAZ A;  2MPX C;  3PVL A;  3NMZ C;  2D0N A;  3M4G A;  1K9M U;  2GFA A;  2MMP A;  1I5O B;  3LGF A;  1VYU A;  4LDX A;  3JCM e;  1Q95 G;  1AOJ A;  3ZBD A;  1B7T A;  1UFF A;  4ZTJ A;  4JDS A;  5LJ3 f;  1M9S A;  1K73 C;  1NM7 A;  2O4X B;  3HRT A;  5GAN 4;  4M7D F;  2I2L A;  4A4K A;  3CC2 A;  3EHQ A;  1WZO A;  3P8B B;  2NWM A;  4B6M A;  4IKF A;  3AHU A;  4C92 G;  1YHQ T;  2Z0W A;  3F70 A;  2ROT A;  3FJP A;  4RG8 A;  4FYW B;  2X3W D;  2E12 A;  4CI0 C;  3S3M A;  1LPL A;  2D8J A;  2JTF A;  3ULR B;  2LNV A;  2QA4 T;  4KBM B;  4IIO A;  1VQL Q;  3V8L A;  1TSF A;  3LX7 A;  1QVP A;  3CME T;  3TVT A;  2J7I A;  2K57 A;  1KQS A;  1VQ9 T;  3J7A F;  1X43 A;  3C0C A;  2DIG A;  3OYD A;  5KYX B;  4OGC A;  4KGV B;  2LZ6 B;  4AFS C;  4M7D G;  4HVU A;  4KT0 E;  4ME7 A;  1VQP A;  2CGH A;  3LH0 A;  2ENM A;  2J06 A;  1WA7 A;  1KQ1 A;  1GBQ A;  2KVQ G;  3JSC A;  5GJV B;  3REA B;  2KRS A;  2CSQ A;  4Z02 A;  5KH6 A;  3CCV Q;  1M2V A;  1J3T A;  2K3Y A;  3TSW A;  1D3B B;  2GBQ A;  2W10 A;  4HVV A;  5CCA A;  2COY A;  3I5R A;  1Y07 A;  1X2K A;  2DL5 A;  3WVE B;  2XID A;  1QWE A;  1IGQ A;  5I11 A;  3TQ7 P;  4MMK A;  1YIJ Q;  3QWX X;  5HY6 A;  2HBW A;  5IAY A;  4FYX B;  1UGR B;  1QCF A;  1WXB A;  2X9H A;  3EHR A;  4PJO F;  1N5Z A;  3QDF A;  5A0L A;  4EPC A;  2JS2 A;  3CCM Q;  4AT1 B;  1WXU A;  2RF0 A;  1GL5 A;  2ED0 A;  1VQ8 A;  2DZ9 A;  1YWO A;  2LMJ A;  1RL2 A;  1V1C A;  4X9D A;  3GPL A;  4GBQ A;  1KSW A;  3EG0 A;  2X4W A;  2MWO A;  4EMH A;  3MEA A;  3H6Z A;  2EBP A;  1JQQ A;  3JRZ A;  4FT4 A;  5CKH A;  4M7A F;  5I2S A;  2DMO A;  2DEQ A;  3L2V A;  2KSS A;  3QG1 A;  3C94 A;  3EGD A;  1CKB A;  3KUF A;  4C8Q B;  2E10 A;  2AIR B;  2RQW A;  5KE3 A;  2FYK A;  3GIB A;  2DO3 A;  1EFN A;  3VS0 A;  5GAN 5;  1I81 A;  3C12 A;  2QQA A;  3JB9 H;  2QXF A;  5GMK i;  1TU0 B;  2E1H A;  5A0G A;  3X28 B;  4M7A G;  3EFO A;  3I56 Q;  1M90 R;  1YIT Q;  1VUB A;  2LQK A;  1AHJ B;  2JN0 A;  2PZ1 A;  1TXQ A;  1WFW A;  4AFZ C;  2HAX A;  2NUT A;  4M75 G;  1HYO A;  2DVE A;  2LX9 A;  2A36 A;  1VIE A;  1SSF A;  1X2Q A;  4QVC A;  3G6E Q;  5CK9 A;  5GMK h;  2KYM A;  2YXY A;  4C92 D;  1RI9 A;  1QLY A;  1UGS B;  2M1H A;  3X25 B;  4LD9 K;  1Q82 C;  4LD6 A;  5DY9 A;  3RNJ A;  3FDR A;  4JRK A;  4CC4 B;  1E7O A;  5KCH A;  1R0B G;  2VYT A;  3A1P A;  3HSB A;  3ASK A;  4PL6 A;  3EGX A;  2GF7 A;  1MMA A;  2DRM A;  2OX7 A;  2YHT A;  4HT9 A;  2CKK A;  2EQJ A;  1VQL T;  4M7D D;  1VQN Q;  2W0Z A;  4C8Q C;  3EH2 A;  3CCE T;  3CXC A;  2V8J A;  2LNH B;  3T9N A;  3C95 A;  2COW A;  2RMO A;  1LNX A;  3EG1 A;  3DKM A;  3MHX A;  1BBZ A;  4RTY A;  2JT4 A;  2X4X A;  4M78 E;  1Y71 A;  2P0K A;  2QA4 A;  2DNU A;  2EGC A;  2CDT A;  2KY9 A;  4N4G A;  1YIJ T;  1ZBJ A;  3CME A;  1VQ9 A;  4NL3 A;  3EG9 B;  1ARK A;  3CCL T;  1BIB A;  2NUP B;  1OU8 A;  1X6B A;  2ATC B;  4D8D A;  2DM1 A;  1Z9Q A;  1WHK A;  3INZ A;  1NJI R;  1W2B A;  2HQH A;  3RUX A;  2YUP A;  1QVF P;  2QK0 A;  4X34 A;  2EWN A;  4PJO D;  2RQU A;  2YUN A;  2E70 A;  2RJE A;  3NFC A;  4B9W A;  1I07 A;  4RTU A;  4XTW A;  2J05 A;  4KGX B;  4J8O A;  3CPF A;  4M77 B;  4A4F A;  3H9N A;  1U1S A;  1OX9 A;  2V26 A;  1KQ2 A;  4N0A A;  1VQM A;  2D6F A;  1PRM C;  2XMF A;  1R0C B;  4XU1 A;  1YJW T;  2EVR A;  1YJN T;  3I5S A;  5J26 A;  1VQ8 Q;  2IVW A;  3RMS A;  2H3J A;  1YI2 T;  1M1K C;  2BE7 D;  1SRL A;  5J39 A;  1Q7Y C;  1D0X A;  1K73 R;  4M7A D;  2V8I A;  3LGL A;  2QEX T;  1NEG A;  4JLG A;  1I5L A;  1O9S A;  2DTI A;  4LDW A;  3CD6 Q;  4RCB A;  1B34 B;  3P8H A;  3M5A A;  3CC4 Q;  3OMG A;  1M8V A;  1AVZ C;  2JMC A;  3E2U A;  1IHV A;  5GAO n;  5HCK A;  4R56 A;  4CC3 A;  3CMA T;  3UAT A;  2BE9 B;  2DL3 A;  1UJ0 A;  2XDP A;  4AFU C;  5GAO m;  1G2B A;  2MOX A;  2YLC A;  1U5S A;  4C8Q F;  3M9Q A;  2E64 A;  2B8A A;  2DXT A;  2DRK A;  2R5A A;  2K2V A;  2KRM A;  3S3N A;  5GAN j;  5DLQ E;  1DJ7 B;  1HXD A;  2R58 A;  2K5L A;  2EW3 A;  1WGS A;  2FPF A;  3TU4 K;  5GAO l;  5LJ5 e;  5GAM j;  1N8R C;  5GAN 6;  3HRU A;  3E19 A;  1NPR A;  4A4H A;  3OMC A;  2DYI A;  1KD1 C;  3QZ5 B;  4F16 A;  3OW2 P;  3EAE A;  4BD3 A;  3C4S A;  1X6O A;  2EGA A;  3SWN B;  2FL7 A;  2KT1 A;  4D6W A;  3JB9 J;  3A8M B;  2BZY A;  4OML A;  2RHZ A;  3HHT B;  4PNO A;  3MKD A;  2GCX A;  1PKT A;  2BKD N;  2EQI A;  1VQ5 T;  1G3Y A;  2VAS A;  2RO0 A;  5DLO A;  2KXC A;  4WF2 A;  1HD3 A;  3PTA A;  1H8K A;  1VIF A;  2O4X A;  3M56 A;  4QVD A;  2PU9 B;  1VYT A;  1RAF B;  3KXT A;  1JXM A;  3SFM A;  3X24 B;  3GOX A;  3U23 A;  1FX7 A;  3VV0 A;  1SF9 A;  5HK3 A;  4IUR A;  2M9U A;  1WJQ A;  4E7L A;  1D1A A;  3CCE A;  4HCC A;  1YWP A;  2XKO C;  2CH4 W;  4N4I A;  2L2P A;  3PVQ A;  5KYW A;  3I55 T;  1GFD A;  5GAO q;  1M30 A;  2F69 A;  2ZPF B;  4D8K A;  1OUL A;  4X9C A;  1OPK A;  3CCU A;  2C0O A;  2F2W A;  1K8A U;  2V1Q A;  4C5G A;  4FSX A;  3KBG A;  3JB9 G;  3CCJ A;  4PJL A;  3CBO A;  1RAI B;  1Y96 A;  2MK5 A;  1WLP B;  5LJ5 g;  3PE0 A;  1GRI A;  1UDL A;  1D3B A;  3VS2 A;  4NS5 A;  1QW1 A;  3JCM c;  4PLL A;  4HCB A;  4HXJ A;  3CCL A;  2ZPB B;  4OB1 B;  2AK5 A;  2DA9 A;  1OX8 A;  1I0C A;  3PMI A;  3WXM B;  2RJD A;  2LP5 A;  2GTJ A;  3LW5 E;  3X20 B;  2DF6 A;  4E7J A;  2RK1 A;  3GP8 A;  4HVW A;  3TRE A;  2DD5 A;  1I1J A;  1Q82 R;  2LJ1 A;  1QCO A;  4E7H A;  4A63 B;  1K9M C;  3CPW P;  4FT2 A;  1JO8 A;  2FO0 A;  3VS4 A;  5D7U A;  3MET A;  2C0T A;  4FSS A;  4M75 B;  4MZT A;  3GNF B;  5LJ3 e;  1NYG A;  4DBF A;  4ESR A;  2JMA A;  3RDV A;  1SKU B;  2RI2 A;  1LJO A;  5KCO A;  3PMT A;  3QYG B;  4WCI A;  2I0N A;  5ECA A;  1VOM A;  2EQK A;  4EDU A;  2QYZ A;  3EG2 A;  3QHS A;  5GAN 8;  4J6Y A;  4DQ2 A;  3JV3 A;  4AFQ C;  2K3X A;  1TG0 A;  4C8Q D;  3CCQ Q;  1VQO T;  2VC8 A;  5EC7 A;  3TEE A;  4C92 E;  2QGG A;  4BDY A;  2EYW A;  4FIB A;  1ZQ1 A;  1K4U S;  1MND A;  2OTJ A;  3MO8 A;  5GAN f;  1QVG A;  4XTZ A;  1S72 A;  2EJG A;  2FB7 A;  3JCM b;  4DBQ A;  4PJM A;  4JJB A;  4BI8 B;  1N27 A;  4OVA A;  5GAM f;  2LDM A;  4L59 A;  4J9G A;  1SEM A;  4M75 C;  3LLR A;  3VUB A;  2RHU A;  3CCR T;  1A0N B;  1YJ9 A;  3OSV A;  4OGE A;  4LXC A;  2O01 E;  2CZ1 B;  2NYS A;  2YWW A;  4OMF B;  2LRQ A;  4J83 A;  3L2U A;  3CC7 T;  1T3L A;  2COZ A;  1YN8 A;  2K2M A;  4XTV A;  5A0D A;  1BB9 A;  5LJ3 g;  2MYS A;  4RTT A;  3O8V A;  1PC0 A;  4J9C A;  4OB3 B;  3G71 T;  3EH1 A;  3DLM A;  3MPU B;  1VQ5 A;  3OYE A;  1KHI A;  3M0U A;  3OW2 S;  1X69 A;  2BTT A;  4N4H A;  3PIO A;  1M1K R;  1Q7Y R;  2HBP A;  1PRL C;  1VQK A;  3FC3 A;  3CCS T;  1VQ6 A;  1SHG A;  3M59 A;  3M0Q A;  4ELY C;  1RAB B;  2LQW A;  3H0F A;  2KK4 A;  3MJX A;  3VYG A;  2CT4 A;  1RAH B;  2SRC A;  3M55 A;  4UC4 A;  3VS3 A;  1OYX A;  2L0A A;  4JS4 A;  2LT1 A;  4PJO E;  3G4S A;  2MF2 A;  1OQK A;  4BDZ A;  2PUO B;  1K0X A;  1Y57 A;  2ZPI B;  2FRY A;  2JOY A;  4M78 B;  3NGP A;  2EJF A;  1ACM B;  2LX7 A;  2PTK A;  4C5H A;  3ER0 A;  4E7S A;  2LJ3 A;  3JB9 I;  1NPP A;  2KGT A;  3CCJ Q;  3QXE B;  3X26 B;  1WXT A;  3OYB A;  1N8R R;  1RUW A;  4C0Z A;  5GJW B;  2HSP A;  2EKH A;  4M7A E;  2QQR A;  2HQE A;  3QDR B;  4QVZ A;  5FU6 B;  3JCM f;  4HT8 A;  1KD1 R;  4C5E A;  1RLQ C;  1NYF A;  2YRC A;  2D0Q B;  2LCL A;  5KYU A;  1NLO C;  3DB3 A;  4M77 A;  2IG0 A;  3JCM V;  4JJN K;  1IZ6 A;  4XTX A;  3URG A;  4M77 D;  2GQI A;  1OZ3 A;  1V29 B;  4IUT A;  4JZ4 A;  3ZEH A;  2HMA A;  1QMC A;  2FPD A;  3M0P A;  1BU1 A;  4F7U A;  1XTD A;  1U8R A;  3G1J A;  2DTH A;  3OS1 A;  4HCK A;  3CCQ T;  2LTO A;  3JCM J;  4M75 F; 
#chains in the Genus database with same CATH homology
 2O2O A;  2RQU A;  2YUN A;  2YT6 A;  5IXB A;  4Y92 A;  1PWT A;  3KFV A;  2VVK A;  1I07 A;  1X6G A;  4RTU A;  2KXD A;  2J05 A;  1CKA A;  3VS6 A;  2JTE A;  3R6N A;  3VS1 A;  4E6R A;  1QKX A;  1NG2 A;  5L23 A;  5FW9 A;  2EYY A;  1UGV A;  1PRM C;  2XMF A;  5IH2 A;  4JJD A;  4CC7 A;  4IIM A;  1AEY A;  2A37 A;  3UF4 A;  1SHF A;  2EVR A;  3I5S A;  2QDL A;  3M0S A;  1AWX A;  2CRE A;  1NLP C;  3GBQ A;  1VA7 A;  1UHC A;  1YCS B;  2DYB A;  1SRL A;  5IHK A;  1AWW A;  1NEG A;  2RQV A;  1PKS A;  2AZV A;  1YNZ A;  1AVZ C;  1JXO A;  2DIL A;  2JMC A;  3VS7 A;  5HCK A;  4CC3 A;  1BK2 A;  2O31 A;  1UG1 A;  2FRW A;  3UAT A;  4AG2 C;  2DL3 A;  1UJ0 A;  4AFU C;  1ZLM A;  2K6D A;  2M0Y A;  2DBK A;  1OV3 A;  1G2B A;  2MOX A;  4J9H A;  4KRT A;  1U5S A;  4LE9 A;  1MV3 A;  3CQT A;  2DRK A;  4RTX A;  3EG3 A;  2KRM A;  2P4R A;  1IO6 A;  1OEB A;  2BZ8 A;  2HCK A;  1U3O A;  4J9E A;  2RN8 A;  2DJQ A;  2EW3 A;  2YUO A;  1FMK A;  1ZSG A;  2GTO A;  2K9G A;  4OMQ A;  1MUZ A;  2IIM A;  2FPF A;  2DX1 A;  4RTW A;  1ABQ A;  2X3X D;  4QT7 A;  2OI3 A;  2EYZ A;  2RNA A;  3H41 A;  2V1R A;  3A98 A;  1GFC A;  2CUB A;  1NEB A;  1PHT A;  1H3H A;  1WI7 A;  3NHN A;  4F16 A;  2RPN A;  2DLP A;  4DEY A;  4OMP A;  1T0H A;  2EGA A;  5FWC A;  1CSK A;  2KRN A;  1ZUK A;  2KT1 A;  1M27 C;  1UE9 A;  1M3A A;  2BZY A;  4OML A;  1MV0 B;  3UA7 A;  2D1X A;  1PKT A;  2EQI A;  2H8H A;  2KXC A;  2CT3 A;  3NPF A;  1HD3 A;  1H8K A;  1QWF A;  1VYT A;  1E6G A;  5IHI A;  2FPE A;  1JXM A;  4OMN A;  3U23 A;  4F17 A;  2YSQ A;  2ED1 A;  2JM8 A;  1GCQ C;  1JEG A;  1ABO A;  1YWP A;  3PVL A;  3NMZ C;  3QWY A;  2CH4 W;  2L2P A;  3PVQ A;  2D0N A;  1LCK A;  4LUE A;  1HSQ A;  4ORZ A;  1VYU A;  3VRZ A;  4M4Z A;  1GFD A;  1M30 A;  2GGR A;  2JW4 A;  2LJ0 A;  4D8K A;  1AOJ A;  1GCQ A;  2ECZ A;  1OPK A;  3I9Q A;  2C0O A;  2F2W A;  2L3Q A;  2V1Q A;  5I22 A;  1UFF A;  1NM7 A;  1ZUU A;  3EHQ A;  1WLP B;  2NWM A;  3PE0 A;  3H0H A;  1GRI A;  1UDL A;  3VS2 A;  2ROT A;  2X3W D;  2DE0 X;  1W6X A;  2D8J A;  4RTV A;  4HXJ A;  5FWB A;  3ULR B;  1AWJ A;  1ZX6 A;  2CSI A;  2YUQ A;  4LN2 A;  4IIO A;  2AK5 A;  3M0T A;  2DA9 A;  4JJC A;  1I0C A;  3TVT A;  2J7I A;  2KNB B;  2LP5 A;  1X43 A;  2GTJ A;  1UJY A;  4J9B A;  2DF6 A;  3C0C A;  4HVW A;  2NUZ A;  1I1J A;  2F2V A;  4AFS C;  2LZ6 B;  2LJ1 A;  1H92 A;  4HVU A;  2KEA A;  1GBR A;  1W1F A;  4A63 B;  2ENM A;  2J06 A;  1WA7 A;  1GBQ A;  2M51 A;  5GJV B;  1JO8 A;  2FO0 A;  3VS4 A;  3REA B;  2KRS A;  2A28 A;  2CSQ A;  2EPD A;  1X27 A;  2RQT A;  1J3T A;  3TSW A;  2GBQ A;  2W10 A;  4HVV A;  2C0T A;  4FSS A;  3I5R A;  1X2K A;  1FYN A;  1NYG A;  2DL5 A;  2JS0 A;  2MIO A;  3SHW A;  4ZNX A;  3EGU A;  1QWE A;  1YP5 A;  4AG1 C;  4ESR A;  5I11 A;  4Z88 A;  3H0I A;  2JMA A;  2CUD A;  3QWX X;  2HBW A;  1QCF A;  1WXB A;  1KJW A;  3EHR A;  3FJ5 A;  2ROL A;  2CH4 A;  1N5Z A;  2BZX A;  2JS2 A;  4WCI A;  1U06 A;  2I0N A;  5ECA A;  1SRM A;  1WXU A;  2J6O A;  1QKW A;  2KT8 A;  2AZS A;  2RF0 A;  1KFZ A;  1GL5 A;  2ED0 A;  3EG2 A;  1YWO A;  2SEM A;  1JU5 C;  3JV3 A;  4AFQ C;  1SSH A;  1TG0 A;  1TUD A;  2LMJ A;  1V1C A;  2KBT A;  5EC7 A;  2JM9 A;  2J6F A;  2EYW A;  2LCS A;  4GBQ A;  1K4U S;  2OAW A;  1KSW A;  3EG0 A;  2G6F X;  4GLM A;  2EBP A;  2JXB A;  2O88 A;  1JQQ A;  1AD5 A;  2DL4 A;  2FEI A;  3M0R A;  1ZUY A;  2DMO A;  2YDL A;  4J9D A;  2DBM A;  1CKB A;  4Z8A A;  2RQW A;  4JJB A;  3RBB B;  4X1V A;  3IQL A;  1EFN A;  3VS0 A;  1K1Z A;  2KR3 A;  2ABL A;  4J9G A;  1SEM A;  2AKL A;  1AZE A;  4Z89 A;  1A0N B;  2EGE A;  4K11 A;  2F2X A;  1PNJ A;  1T3L A;  1YN8 A;  2K2M A;  1GCP A;  1BB9 A;  4RTZ A;  2LQN A;  4R0K A;  4OMM A;  2PZ1 A;  4LNP A;  4RTT A;  3LH5 A;  2MCN A;  2DL7 A;  2AKK A;  4J9C A;  4CC2 A;  1WFW A;  1B07 A;  4RUG A;  3O5Z A;  2ESW A;  2VWF A;  4J9I A;  4AFZ C;  1WIE A;  1AZG B;  3M0U A;  1X69 A;  2BTT A;  2KYB A;  2RQR A;  4F14 A;  2C0I A;  3SEM A;  1PRL C;  2E5K A;  2A36 A;  1X2Q A;  2VKN A;  1SHG A;  2KYM A;  1RI9 A;  1QLY A;  3M0Q A;  1UTI A;  2LQW A;  3VRY A;  2L3S A;  3H0F A;  3RNJ A;  4CC4 B;  1E7O A;  1K9A A;  2CT4 A;  3VS5 A;  2SRC A;  1Z9Z A;  3VS3 A;  1UEC A;  2K79 A;  2L0A A;  4JZ3 A;  1S1N A;  2DRM A;  1M8M A;  2EYX A;  4DEX A;  1K0X A;  3TSZ A;  1Y57 A;  1WDX A;  2FRY A;  4EIK A;  2KE9 A;  1UUE A;  5IHN A;  2HDA A;  2W0Z A;  3NGP A;  1M3B A;  3REB B;  2LX7 A;  2HEQ A;  2PTK A;  1K0S A;  1T0J A;  2LNH B;  2D8H A;  2LJ3 A;  3THK A;  2OJ2 A;  2FG0 A;  2KGT A;  3ZL7 C;  1WXT A;  2RMO A;  4J9F A;  2KRO A;  1RUW A;  3EG1 A;  1K76 A;  1KIK A;  5GJW B;  2HSP A;  4OMO A;  1BBZ A;  4RTY A;  2JT4 A;  1W70 A;  2EKH A;  2J6K A;  1WYX A;  1OOT A;  1M3C A;  1T3S A;  2K7A A;  1RLQ C;  1VYV A;  4JPB W;  1NYF A;  1RLP C;  1UHF A;  2DNU A;  2EGC A;  1E6H A;  2CDT A;  2DVJ A;  1AWO A;  1NLO C;  2B86 A;  1ZBJ A;  2L3P A;  2O9V A;  3I35 A;  2DL8 A;  1XOV A;  1HJD A;  1ARK A;  1G83 A;  2GNC A;  1Y0M A;  2GQI A;  1B3Q A;  1X6B A;  4D8D A;  2A08 A;  4JZ4 A;  1SPK A;  2DM1 A;  2FPD A;  1Z9Q A;  2O9S A;  4LUD A;  3M0P A;  1BU1 A;  3UA6 A;  1TUC A;  1OPL A;  2YUP A;  4HCK A;  1WX6 A;  5IXF A;  2PNI A;  2K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...