1S1NA

Sh3 domain of human nephrocystin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
TGEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLEPYSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structure of the SH3 domain of human nephrocystin and analysis of a mutation-causing juvenile nephronophthisis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Nephrocystin 1
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1s1nA00
2AKLA 2M51A 2JW4A 4GBQA 1ZUKA 3H0HA 1MUZA 3SHWA 1OV3A 3PVLA 4HVWA 3RBBB 3LH5A 2DJQA 2D8JA 2SEMA 1OPKA 1QWEA 5I22A 1X6GA 3VS1A 4AFSC 1K1ZA 2PNIA 4CC3A 4D8DA 1WFWA 1SEMA 2LNHB 2L3SA 2C0IA 1E6GA 2GQIA 2HCKA 4RTTA 1YN8A 4RTXA 4AG2C 2VVKA 1TG0A 2CH4A 4E6RA 2DL3A 2O31A 3GBQA 2BTTA 2CUBA 3M0SA 3I5RA 2YUPA 2GTJA 1G83A 3EG3A 1UE9A 1WX6A 2EKHA 2D8HA 1AOJA 2DVJA 1QKWA 1K76A 2DL7A 2L2PA 5IHNA 2RQTA 1M3BA 1M3AA 1ZX6A 2K3BA 2RQUA 4LE9A 4ORZA 1BU1A 4HVUA 2D0NA 2EBPA 4J9DA 1ABQA 1X69A 2MOXA 1UHFA 1HJDA 3UATA 4J9IA 3VS3A 2JXBA 1M8MA 1NEGA 2DL4A 3UF4A 2I0NA 2KNBB 2EGCA 3SEMA 2O88A 1Y57A 2A28A 1K0XA 1UG1A 2RMOA 3VS6A 2EQIA 4D8KA 1KJWA 2VWFA 2HSPA 2HDAA 3RNJA 2DBKA 1WIEA 3O5ZA 2EGAA 1SSHA 2GNCA 4AFUC 2LJ1A 1ZUYA 2F2XA 1GBRA 1VYUA 3I5SA 4Z88A 4DEXA 2EYWA 2FRWA 1JQQA 2RF0A 4J9GA 1UJ0A 1TUCA 5IXBA 1E6HA 2CDTA 2KEAA 3H41A 3M0QA 2KT8A 3NHNA 4RTWA 3REAB 4LNPA 3VS0A 2K6DA 2D1XA 1S1NA 2L3QA 2AZVA 5FWBA 1JO8A 5FWCA 1MV0B 2O2OA 1WXUA 5FW9A 2DRKA 4AFZC 2MIOA 3M0TA 2F2VA 1PKTA 1QLYA 1CSKA 1UUEA 2JM8A 1G2BA 4OMOA 5EC7A 2E5KA 2J6FA 1FMKA 1U06A 1M27C 4CC2A 1B07A 2LJ3A 1GCPA 2X3WD 2EYZA 2EPDA 1NM7A 5IHKA 3NMZC 1H8KA 1RUWA 4IIOA 2JM9A 2RQVA 1I1JA 2DYBA 1AD5A 2DF6A 1VYVA 1X2KA 1WXBA 4LN2A 2YUNA 2DILA 1GRIA 1SPKA 2J6OA 2EYXA 1WYXA 2CUDA 1GCQC 2DMOA 1U3OA 3A98A 2OAWA 1ZSGA 4CC4B 4A63B 2DNUA 1NG2A 1CKBA 2CREA 4F16A 2KYMA 2GGRA 1GFDA 3EHQA 4J9HA 4F14A 2KRSA 1JXMA 1VA7A 1AWXA 2A37A 4HVVA 2K7AA 1I07A 1NEBA 3ZL7C 2J7IA 5GJWB 4WCIA 1HD3A 4F17A 2K2MA 2RNAA 1N5ZA 2IIMA 2BZXA 1Z9QA 1JU5C 1Z9ZA 2BZ8A 2GTOA 2JT4A 2SRCA 1X6BA 3EHRA 1YNZA 3KFVA 1BB9A 3H0FA 5IHIA 2PZ1A 2HEQA 2CH4W 4RUGA 2BZYA 3EGUA 1ZLMA 1KSWA 1M3CA 2LP5A 1W6XA 2KR3A 3THKA 1WLPB 1OOTA 2FO0A 2DBMA 1J3TA 3JV3A 2ESWA 4Z8AA 1AEYA 2JMAA 2OJ2A 1XOVA 3ULRB 2K79A 4RTZA 1ZBJA 2LQWA 3PVQA 1PWTA 1UECA 2DE0X 3TSZA 1YCSB 1SRMA 1NLPC 2EVRA 2FPEA 2JS2A 1E7OA 3NPFA 4OMMA 2MCNA 3R6NA 3UA7A 1PRMC 5IH2A 1CKAA 1SHGA 2O9VA 2AK5A 4LUEA 2V1QA 1MV3A 2P4RA 1QWFA 1K0SA 4RTVA 4M4ZA 1LCKA 1T0JA 2DL8A 2NWMA 2A36A 1NYGA 1Y0MA 2HBWA 1QCFA 4ESRA 2YT6A 1W1FA 1X27A 1WDXA 1QKXA 2CT4A 2L3PA 4DEYA 2A08A 1HSQA 3H0IA 4RTUA 2O9SA 1H92A 3C0CA 2EW3A 2OI3A 2M0YA 2YUOA 1GFCA 1FYNA 2K9GA 2KGTA 2EYYA 1UTIA 4OMPA 2LQNA 1M30A 3U23A 4JPBW 3VS5A 2LJ0A 1I0CA 1RLPC 2EGEA 4HCKA 2KYBA 1NLOC 1X2QA 3EG0A 4OMNA 1GCQA 1PHTA 3I35A 4JJDA 2J05A 1YWOA 1AZGB 1OEBA 1WI7A 1WXTA 2KE9A 2CT3A 2KXDA 4Y92A 2C0OA 1YWPA 1K9AA 1U5SA 1X43A 3VS2A 4KRTA 1KIKA 4JZ3A 2H8HA 4X1VA 1H3HA 2ED1A 3VRZA 1ZUUA 1PKSA 2FG0A 3QWXX 1K4US 3M0UA 1A0NB 4Z89A 2B86A 4IIMA 1T3LA 2ED0A 4AG1C 2ROLA 4LUDA 2FEIA 5GJVB 1TUDA 3EG2A 2XMFA 1UDLA 4QT7A 2C0TA 1UGVA 1SHFA 2NUZA 4J9BA 3VS4A 2PTKA 3M0PA 1WA7A 3I9QA 3QWYA 3FJ5A 4GLMA 2DA9A 1T0HA 2W10A 2DM1A 2YDLA 2KRMA 2ROTA 2FRYA 1AVZC 2RPNA 1OPLA 2KROA 1IO6A 2DRMA 4J9EA 2G6FX 1ARKA 1NYFA 2RQRA 2L0AA 3UA6A 1AWJA 2QDLA 2KRNA 2YSQA 1BBZA 3NGPA 1JXOA 3CQTA 2KBTA 1RLQC 1UFFA 1AWOA 1VYTA 2DLPA 2JS0A 2RN8A 2LMJA 4K11A 2CSIA 1YP5A 4R0KA 1V1CA 4OMQA 2J06A 1BK2A 5I11A 4ZNXA 1JEGA 3VRYA 3VS7A 4JJBA 2FPDA 2JTEA 1B3QA 2KXCA 2V1RA 4J9FA 5ECAA 3TVTA 2LZ6B 2F2WA 4FSSA 2CSQA 3EG1A 1SRLA 4OMLA 1AWWA 2LCSA 2LX7A 5L23A 2ECZA 1PRLC 2GBQA 3TSWA 2X3XD 1T3SA 4RTYA 2JMCA 4JZ4A 2YUQA 1UJYA 2VKNA 2AKKA 4AFQC 1ABOA 2KT1A 2AZSA 3PE0A 4JJCA 2DX1A 2W0ZA 2ABLA 2J6KA 4J9CA 1KFZA 3IQLA 1AZEA 2FPFA 4HXJA 1UHCA 1EFNA 3M0RA 2ENMA 4EIKA 3REBB 2DL5A 5HCKA 1W70A 1PNJA 1RI9A 1GBQA 1GL5A 5IXFA 2RQWA 4CC7A
chains in the Genus database with same CATH superfamily
2P0PA 3NTKA 4N0AA 2M51A 2A3LA 2JW4A 1R0BG 1ZUKA 3EFOB 4C8QB 2QQAA 4HVWA 4EMKB 3J7AF 2D6FA 2D8JA 3PT9A 1OPKA 1QWEA 4PNOA 3VS1A 4R56A 4PFZA 3EG9A 2HBPA 1YITA 5HY6A 1M1GA 2KVQG 2DIQA 3GPLA 3JCMh 1YN8A 4V2SA 2VVKA 1TG0A 2CH4A 3KXTA 2XKOC 3CMET 4PKCC 2CUBA 4PJLA 3H6ZA 2DAQA 2CGHA 3I5RA 2MF2A 2YUPA 2COYA 1PSEA 3CCVQ 1G83A 2CKKA 1UE9A 3OYKA 2D8HA 3ER0A 3RKYA 4PJOD 2RD1A 5GAMd 1K76A 5IHNA 4FU6A 4ORZA 1BU1A 4AMCA 1VQMA 4M7AF 1X69A 2XIDA 3CC7T 3I55Q 4J9IA 3VS3A 2JXBA 5GAN6 4MZTA 3L2VA 3KUFA 2I0NA 2RK2A 4XAXB 3FJPA 2O88A 1BI3A 3EH2A 2CZ0B 4JS5A 2OTLT 1VQPT 1K0XA 2RMOA 4D8KA 1KJWA 3HHTB 3PIOA 3RNJA 2HKNA 5FU7B 1SSHA 5AYFA 4AFUC 2LJ1A 5KE2A 3MO8A 1GBRA 5CO7A 1PC0A 3I5SA 4Z88A 4HA8A 1JQQA 5GAN8 3LW5E 4FYVB 4BY6C 1BCOA 4B9XA 1TUCA 3RMQA 5DLOA 3KBGA 3CCJQ 3A5ZB 4DOVA 2RHXA 3LGLA 4DBQA 2QQSA 3Q1JA 1SF9A 3X26B 4J83A 4L6V5 3VS0A 4F7UB 2K6DA 4PJJA 4OGCA 2EJGA 1D0XA 4ELYC 3J81E 1JO8A 3FIFA 3OYGA 2O2OA 3G71Q 5FW9A 3M0TA 3C4SA 4HCZA 1NJIR 4QKUA 5FROA 2OTJT 1G2BA 2RI3A 4J6WA 3CXCP 4R55A 4CC2A 4M7DB 4CRIA 2DXBA 1N9SA 2EPDA 4JRIA 4EPCA 5GANg 3M9QA 1RUWA 2KMTA 1EIFA 2QTXA 2DYBA 5CKHA 1G5VA 1ZQ1A 5GAOn 4OB1B 2RJDA 2J6OA 1WYXA 2QASA 1Q86R 2DMOA 2RHZA 4CC4B 2DNUA 3H8ZA 2CREA 2K5IA 1M90C 5LJ5h 4PJMA 1M90U 4QQDA 2R58A 3OMCA 1TH7A 2V8JA 4J9HA 5KYXB 4C8QD 1K8AC 3M56A 2LCLA 1D1BA 2A37A 1NEBA 5KYYA 3OYAA 4XTYA 4F17A 4M7AC 3UDCA 2MWPA 4E7LA 3CC2Q 2RNAA 1N5ZA 4L5GA 3EHRA 5FRMA 1QP2A 3R6OA 1BB9A 2LVMA 1BI2A 2PVGB 3CCVT 1RL2A 3VJPA 3EAEA 4IUUA 1M5Q1 4J6XA 2FO0A 2VB6A 2DBMA 3JV3A 3QDFA 4A4HA 3ULRB 1VQ9A 3M58A 4HT9A 1ZBJA 2FZKB 1UECA 1PD0A 2P0KA 4QQ6A 1LOJA 1NLPC 3JCMg 2XDDA 1VIEA 5IH2A 1SHGA 3QZ9B 5KE3A 4C92C 5LJ5d 2P4RA 1KC8U 1YI2A 4BI8B 4RTVA 1WHKA 2E6NA 2RB6A 1VIFA 4M77C 2KAFA 1LCKA 1TU0B 3CC4Q 1NYGA 1Y0MA 4QW2A 2HBWA 3LWIA 4PLIA 3L2UA 1W1FA 1KK7A 1WDXA 2PVDB 4A54A 1QKXA 2HKQB 5A0LA 1LPLA 1O75A 2MI6A 2QG9B 4JDSA 5IT9E 2A08A 4A4GA 4E7KA 4M75E 4RTUA 5A0DA 1ZBXA 4JRQA 2YUOA 3QG1A 2DO3A 1W2BS 4MMLA 3MEUA 5KCHA 5GAOm 1YHQT 1M9SA 2LJ0A 2ZCFB 1RLPC 4HCKA 1K9MR 1SG5A 3EG0A 3CCQT 2BKDN 1PHTA 3SWNA 2DYIA 4XTWA 1AHJB 1AZGB 2HQHA 2CT3A 2DIGA 5CR2A 2K3XA 2WSEE 3LLRA 4FM4B 4FT4A 1K9AA 1U5SA 4OB3B 3VS2A 2BE7D 4KRTA 4JZ3A 4C5HA 5C6SA 2H8HA 1MMGA 2O4XA 3VRZA 1P92A 3M0UA 2V26A 4M78B 4Z89A 3CCUT 1Y96B 4IIMA 4KGVB 3EG9B 4AG1C 1PM3A 2LDMA 2K57A 5LJ5f 3HTRA 2WSFE 3QIIA 1RADB 4MZPA 2ZPIB 3EFOA 2EQMA 1ZSZC 1UGRB 1NPPA 3VS4A 2PTKA 3I9QA 1K9MC 4OVAA 3J80E 2W10A 2EWNA 2DM1A 3DLMA 1X01A 4OMFB 5GANj 2OAUA 4XTXA 1B34A 2PUKB 4J9EA 1ARKA 2RQRA 2L0AA 3UA6A 3PGGA 4WTOB 5GAN3 1JXOA 3CQTA 1KQ1A 3E1SA 3GNGA 1M2VA 1RAIB 3S3OA 4C8QC 1MMAA 1VYTA 3I55A 2VV5A 2RN8A 3V8JA 1Q95G 1U8RA 1B34B 2X4JA 3L42A 4ZGJB 4P5NA 2DEQA 2MMPA 4JJBA 2FPDA 1B7TA 2V1RA 5ECAA 3JCMe 2ZPHB 2F2WA 3I56Q 2HQEA 2K5FA 3BY7A 3M57A 4BDZA 1KD1U 3JCMQ 3X24B 1YIJQ 2M1HA 2X3XD 1JJ2S 1ZA1B 2VKNA 4AFQC 4KULA 1IREB 3V7RA 4KBMB 1VQOA 4II1A 1M1KR 1KQSS 4PFPA 2DX1A 2ABLA 1Q7YU 1YBYA 1D0ZA 2F5KA 3CCLA 1Q7YC 5D6XA 1UHCA 3M0RA 3WVDB 4EIKA 2WSCE 2DFUA 4F04B 5HK0A 3REBB 4D6WA 1ZSZB 3HRUA 4LD6A 5IXFA 3HPWA 1YHQA 4BUGA 3I56A 4CC7A 1WNLA 2E3HA 3SB2A 3E9GA 2XICA 2AKLA 5CAIA 3RIRA 3H0HA 3SHWA 1TXQA 4KGXB 1RABB 4BDYA 1K8AR 2FZCB 4HCCA 2NLUA 2SEMA 2DXCA 1K8AU 4D8DA 4KUDK 3JCMJ 2LNHB 2RO0A 2QA4A 2A7YA 1E6GA 2EAYA 3TU4K 1VQ8T 4RTTA 2B8AA 4RTXA 5GAOp 4E6RA 2LCCA 3GBQA 2BTTA 3BW1A 2X4XA 3MKDA 5GAOr 2GTJA 1M4ZA 2R5MA 1VQ9T 2PVOB 2F1LA 2GCXA 3CBOA 4FW2A 3OW2A 3HKSA 1Y07A 4E2FB 4F7UE 2YRVA 2RQUA 5CKDA 4MDXA 1RACB 4HVUA 2D0NA 4MZMA 4J9DA 1HJDA 1UHFA 2DTIA 4C0GA 1VQ4Q 3X28B 3WVEB 5CCAA 5KYYB 5GAMh 1NEGA 4OP0A 1KC8C 3HRTA 1WHHA 3SEMA 1SKUB 1Y57A 5GAMg 1OU9A 2A28A 4JRPA 3RR6A 1C6VX 5D6YA 1Y96A 1UG1A 3ME9A 3L2WA 1WHMA 5CKEA 3G6EQ 3QDRB 3CMEQ 2EGAA 3CCJT 1KD1R 2GNCA 4FL6A 2JJ9A 5LJ5e 3L2ZA 4XU2A 2L8DA 5GANf 1VQ9Q 4DEXA 2F5TX 3CCQA 1UJ0A 4PJOA 3HP9A 3RUXA 2CDTA 1VOMA 3MEAA 2QEXQ 3M0QA 1WQWA 2KT8A 4QVZA 1V29B 3TEEA 4M7AE 4LNPA 2E12A 4B9WA 4M78C 3E2UA 2ZPEB 5J3BA 2D1XA 3SWNC 1WPYA 1OZ2A 5EG2A 5FWBA 1WXUA 4AFZC 1VQ6T 1YJ9Q 1PKTA 1QLYA 4PJOF 4PLLA 3P8HA 1YJ9T 2J6FA 3JCMc 5GAOq 1FMKA 1B07A 1GCPA 2X3WD 2EYZA 2PU9B 1NM7A 3G1JA 1H8KA 3EFSA 4IIOA 3QZ5B 2JM9A 5I2MA 1BI0A 2QTVA 4BACA 1X2KA 3D7SB 3QPHA 5GAOl 2XDBA 1SPKA 1YJWA 1UGQB 1ZSGA 2XG8D 3NFCA 3P8DA 4BI3A 1YI2Q 3JCMP 3A8LB 2BE9B 2VYTA 3MP8A 2KYMA 3VUZA 4DBRA 4E7ZA 4N4GA 4XTVA 4J7IA 2XU8A 3EHQA 2OTLA 3JCMW 2Y4YA 4F14A 1JXMA 3A8HB 1AWXA 2D0QB 1VQNA 3G7ZA 4KUIA 3MEVA 1VQLA 3OSVA 3OYMA 2K7AA 3ZL7C 2QA4T 1C0MA 4RKUE 4CI0C 4WCIA 4M77F 1WJRA 2YLCA 3NHNA 1FWZA 2IIMA 1X6BA 4LDVA 3G4SQ 3OW2S 2DERA 2HEQA 2KQWA 3FDRA 2G3RA 2FHDA 3QUIA 1KC8R 1AT1B 1W4SA 3MHXA 4ZN3A 1KSWA 2QGFB 2LP5A 2ZZDA 2FZGB 1PCXA 3OW2P 2QQRA 3PFSA 4LXCA 1YCYA 5M9OA 2HNIA 2LQWA 2K2VA 4IUVA 1YCSB 5HKCA 1BCMA 2ZPBB 1N27A 1SRMA 2EVRA 3UA7A 3NPFA 2MCNA 2IG0A 3QO3A 2DETA 3LGFA 2AK5A 3TCJA 1QVFP 4JUVA 3MEWA 4LUEA 1MV3A 1QWFA 2L5QA 1K0SA 4EMKA 1TOVA 1FX7A 4M4ZA 3QSUA 1NJIC 2QK0A 3V7SA 3EGDA 3OBWA 4ME7A 3PNWC 4ESRA 2CP7A 1X27A 2KY9A 4O5VA 3OYDA 2LNVA 4DEYA 1VQPA 1LJOA 4OB2B 3LWHA 5GMKj 4C0FA 1YIJA 1H92A 3C0CA 1Y71A 2M0YA 1N6AA 2E64A 1TS9A 1VQOQ 4OMPA 3CCRT 3U23A 3VS5A 1BKBA 1X6OA 4C92D 2EQKA 2KYBA 3CBPA 1X2QA 3CCLQ 4F7UG 1GCQA 2MWOA 2EJ9A 4A4FA 1YWOA 3JCMb 1OEBA 1WI7A 1ZSZA 2KE9A 1UB4A 1N9RA 1TUGB 1JRIA 1RAFB 2C0OA 1YWPA 4KGZB 4YTLA 1ZA2B 1X43A 1VQPQ 4KH1B 4RCBA 4M7DG 1M1KC 4DBHA 2CP3A 1ZUUA 1Q81C 2AT1B 3QWXX 1NJIU 1K4US 4ZGEB 1IGUA 3OS5A 1T3LA 2GQVA 2ED0A 4LUDA 4C5IA 3OYJA 1TUDA 1UDLA 2C0TA 1UGVA 1VQ7T 2NUZA 2LRQA 3NTHA 1YJNQ 2D9TA 1ACMB 2QGGA 1WA7A 1IZ6A 5LJ3g 2QXFA 4EMKC 1DJ7B 1S72A 2DA9A 2KRMA 4M78G 4PJNA 4FSXA 1IO6A 4ANJA 3PTAA 2YSQA 5DLQE 4JRKA 4XU1A 2VGNA 3JAME 1UFFA 1AWOA 2DLPA 5GAMe 4DA4A 1YJNA 1V1CA 4C92G 1M1KU 5GMKe 3SD4A 2J06A 1Q81U 3VS7A 3E9FA 4JLIA 2QA4Q 4J9FA 4C5GA 1JB0E 2X4YA 1NZ9A 2LZ6B 2BIVA 3EG1A 1SRLA 1R8OB 3TSWA 1KD1C 1VQ7A 1BIAA 5KYWB 2JMCA 2YUQA 3S3MA 1ABOA 1LNXA 1KFZA 3IQLA 1QVFA 3FC3A 2FPFA 1MGQA 1Y7XA 4HXJA 3JCMf 4EMGA 3RERA 2ENMA 3RESA 3F70A 1VQMT 5HCKA 4XTZA 1PNJA 1RI9A 1GBQA 1GL5A 4C0DB 3INZA 1WJQA 5GAN4 2RM4A 9ATCB 1U1SA 2E4HA 3CPWP 3JRZA 3BFMA 3PVLA 4IUTA 1YJ9A 3LH5A 2DJQA 1FXXA 2E5QA 1IRXA 1R77A 5I22A 4AFSC 4IKFA 3AHUA 2PNIA 1JJ2A 3CC4A 1WFWA 4WF2A 1SEMA 4XTUA 4N4HA 2L3SA 2C0IA 2RHIA 2GQIA 3QBYA 3CPWS 1WHGA 2DL3A 2O31A 1HXDA 2YRCA 3CCQQ 3L2QA 1D3BB 4LDWA 4Y28E 4X9CA 2NUPA 2EKHA 1XQHA 2QYZA 4PJOE 2Y4XA 4J6YA 3CMAQ 3CCET 4M78E 1K73C 1K73R 2BUDA 3HL8A 2E65A 1QKWA 2L2PA 1PD1A 4Z02A 1JBMA 1M3AA 1ZX6A 3OYBA 4TVRA 1QVFS 1FMVA 2QEXT 1VQLT 2OTLQ 2RH2A 4E7IA 3CCUA 5KYUA 4M75F 1KQSA 3DB3A 2DL4A 2JUFA 2EGCA 2A0FB 2FVUA 1Q81R 2HAXA 3G4SA 3EGXB 1M2OA 4PJOG 2YHTA 3S6WA 3VYHB 3VS6A 2EQIA 4JJNK 3TREA 1HK9A 2HDAA 3UT1A 1WIEA 3O5ZA 4A4KA 4NL3A 1ZUYA 2DJZA 3FRNA 1UEBA 2DTOA 3CD6T 4M75B 3FB9A 3OYYA 4M78D 1YJWQ 4F7UA 2FRWA 3JB9F 2CP6A 3MP6A 3GIBA 1M90R 5IXBA 1E6HA 3MCAB 1WGSA 4ELZC 2KEAA 3PIPA 4HKEA 1G3TA 3QHSA 2X4WA 2FL7A 5LJ5j 3ZBDA 2DKGA 1S1NA 3C12A 3OS1A 3WXMB 4M77A 5FWCA 3CMAT 1MV0B 4F7UF 2GF7A 3I56T 3M53A 4J8OA 2MAMA 4O6JA 3SDZA 4OMOA 5EC7A 2E5KA 1M27C 2DEUA 2NYSA 2LJ3A 2R5AA 1MHNA 5IHKA 4M77B 3NMZC 3JB9G 2KSSA 1QVGA 4GLKA 1AD5A 1VYVA 5GAN7 5CQYA 2RI2A 5I21A 2YUNA 1GRIA 1N8RU 2EYXA 4A4EA 2CUDA 2DPPB 1RAHB 1BYMA 1VQ5A 1CKBA 3M54A 1IHVA 2QQ9A 4F16A 3S3NA 4C5EA 3VYGA 2YLBA 3A8MB 2JNGA 3CEYA 1GFDA 4C92E 4RG2A 3DB4A 4M75C 4HVVA 1I07A 2J7IA 5GJWB 1OI1A 2E3IA 2K2MA 3OYFA 5LJ3e 5GAN5 1GXIE 3CCMQ 2BZXA 1Z9QA 1JU5C 3ZFJA 3A8GB 3E19A 1IHWA 5IHIA 2BZYA 3EGUA 2P84A 2M02A 1ZLMA 4PJOB 1K73U 3X25B 2RHUA 2KR3A 2HMAA 3JB9J 1S72Q 2HL3A 6AT1B 1OOTA 3X20B 3META 4GY5A 1AEYA 1RI0A 2JMAA 2OJ2A 1TSFA 3HFNA 1MNDA 1XOVA 1HYOA 2COWA 3PVQA 4M75G 4XU3A 2DE0X 4ZTJA 3CCRQ 1XJWB 3R6NA 2FPEA 2JS2A 1E7OA 4OMMA 4M77D 1PRMC 1CKAA 2XK0A 4E7HA 4M7DE 2O9VA 4BI4A 2EJFA 2K5LA 2LT4A 7AT1B 3O8VA 3EFRA 4PK4A 2WACA 2JOYA 2NUTA 2DL8A 2NWMA 1WHLA 2HD0A 2RJEA 2DZCA 2JN0A 1QCFA 2CZ6B 5GMKl 1IXDA 5CQXA 4E47A 3CC7Q 2KI7A 3CBMA 3CPFA 4E7SA 1VQKQ 4M75D 5LJ3j 4M75A 4BY6B 1VQ7Q 2EW3A 3QYHB 1GFCA 5GANh 1MMNA 1FYNA 2K9GA 2EYYA 2HL5C 2LQNA 5HK3A 4FT2A 1I0CA 3CMEA 5IAYA 2EGEA 2C06A 1LVKA 3FLGA 4HT8A 2XHCA 3OY9A 3I35A 2RJCA 5KYWA 4XQ3A 3GF5A 5KYXA 1OYXA 4XK8E 1WXTA 5GAMf 1OU8A 3GLXA 2KXDA 3CC7A 1BI1A 1NPRA 5L8RE 1XTDA 3VU3C 2QEXA 4X1VA 1H3HA 5KYNA 3CC4T 4C0ZA 2FG0A 5A0GA 2B86A 2LTOA 2FEIA 5GJVB 1VQNT 2LQKA 4EMHA 5CKFA 1VQKT 4QT7A 4JS4A 5GMKh 5GAN2 3G4ST 4VUBA 4N4IA 4C8QG 1WQ7A 3M0PA 4DQ2A 4LDXA 3QWYA 4M7DA 2QAZA 1YITT 1VQ5T 5CK9A 1T0HA 3UWNA 3EGDB 4A53A 5KH6A 2YDLA 4LDUA 2OX7A 1OPLA 4FYWB 1QVGP 4C92A 2KROA 2DRMA 2G6FX 1JJ2P 1NYFA 1AWJA 2HSEB 2E1HA 2QDLA 1H3ZA 2GFAA 3HSBA 4M77G 4UC4A 1BBZA 3OYLA 3NGPA 2EQUA 4ATOA 5GANe 4MDWA 3PMIA 2P0QA 2JS0A 3OYCA 3HFOA 1H641 1QQJA 4M7DF 1QCOA 2X51A 3OYHA 4N0AC 4OMQA 1VQ6Q 4ZGDB 4RCCA 5CKBA 3RMSA 4ZTFA 1O9SA 3VRYA 1JEGA 4OB0B 3QXEB 2JTEA 3VKIA 1B3QA 5FLXE 1VQNQ 1M2VB 3LYIA 2AHJB 2COZA 4NOYA 4LD9K 1AWWA 2LCSA 5L23A 2GBQA 3CD6Q 5FU6B 4Q5WA 4RTYA 5GMKi 4BE1A 4JZ4A 4PL6A 1UJYA 2L3RA 4MMKA 1Q82U 1Q7YR 2QDYB 1QW1A 1BIBA 2FYKA 2PUOB 2DD4A 4J9CA 5IN1A 1Q82R 3HRSA 4FYXB 2DK3A 3VV0A 2VASA 2EYQA 2DL5A 1W70A 2NUPB 1I8FA 4M78A 4J5YA 1RAAB 3MP1A 4HCBA 1WHJA 1VQ4T 1VUBA 1QVGS 4IUQA 1M8VA 3H9NA 1R0CB 4GBQA 1MUZA 3CCSA 1OV3A 4DBFA 3RBBB 4KH0B 4PJOC 3OS0A 4C8QE 1X6GA 1K1ZA 4CC3A 3JB9I 5LL6S 3CCEQ 2H3JA 4M7AD 2XDPA 8AT1B 2HCKA 4AG2C 4M7AB 4QVDA 3M0SA 1KHCA 3MJXA 4EDUA 3OYIA 2CZ7B 4FW1A 4BE0A 3EG3A 1WX6A 5FU6C 4FIBA 2LC4A 1AOJA 2DVJA 3CPWA 2DL7A 2KDSA 2RQTA 1M3BA 2K3BA 1D1AA 5LJ5g 2E10A 5LJ3d 4LE9A 4ZN1A 1QVPA 1I5OB 2EBPA 1ABQA 2EIFA 2MOXA 1OZ3A 1FMWA 1G3WA 2MPXC 3UATA 3FEOA 1M8MA 4NS5A 3CCMT 3A1PA 1YI2T 3UF4A 1YFNA 2EQJA 1PSFA 2M9UA 2KNBB 4KT0E 4M7DC 3DKMA 2VWFA 3I55T 3G71T 5DY9A 2HSPA 3V7CA 2ATCB 2DBKA 2Z0WA 1YITQ 1U1TA 2F2XA 2EKOA 1VYUA 3TQ7P 1MMDA 2EYWA 5GAMj 2RF0A 2Y90A 4J9GA 3CCVA 3G6ET 2QQBA 4C92B 1OULA 3H41A 3ASKA 5LJ3h 5CVIA 1W2BP 4RTWA 3PMTA 3REAB 3GP8A 3QKJA 2ZAEA 2L3QA 1VQMQ 2AZVA 4Y91A 2CZ1B 3GOXA 2DRKA 4C8QA 2MIOA 3CCMA 4M78F 2GFUA 4PFOA 2F2VA 1CSKA 2DD5A 1UUEA 2JM8A 1VQKA 5I2SA 1SSFA 5CIUA 4XU0A 1G3SA 2DZ9A 3SFMA 4M7DD 2RI5A 1U06A 2M0OA 2XD0A 1Q86U 4C8QF 1OX8A 3OMGA 3UPUA 3JSCA 3CCST 2E41A 2RQVA 1I1JA 2DF6A 1C1AA 1YJNT 1WXBA 4LN2A 5DM7R 1D3BA 4J7FA 2DILA 4E7JA 5FRNA 1GCQC 2YXYA 2F69A 1S72T 1U3OA 3A98A 3RKWA 2OAWA 3RDVA 5D6WA 4A63B 1NG2A 2LQ8A 1D0YA 1UGPB 2E70A 2RHYA 2AIRB 3AT1B 5FU7C 4B6MA 2GGRA 1I4K1 3OA6A 3SWNB 2KRSA 1VA7A 2RA2A 3RKXA 3QYGB 1VQOT 3M4YA 4LDYA 3N5BB 1KQ2A 4QQGA 2L89A 3JB9D 1HD3A 2PQWA 1VQ8Q 2X35A 1Z9ZA 2JT4A 3KFVA 2BZ8A 2GTOA 2HZYA 2IVWA 2SRCA 2V8KA 1YNZA 3OB9A 4OF1A 3H0FA 3LH0A 2PZ1A 2H3EB 2FB7A 2CP0A 2CH4W 4RUGA 4RMOA 4C92F 3VUBA 1Q86C 1I5LA 1M3CA 3JCMV 1W6XA 3THKA 1WLPB 2VXFA 1J3TA 1OX9A 2JZ2A 2ESWA 4Z8AA 3DLLA 3CCLT 2K79A 2ZGWA 4RTZA 1N8RC 1PWTA 4FCYA 1M1FA 3TSZA 3OS2A 3ZEHA 1YHQQ 1QP3A 3V8LA 1X75C 2CP2A 3OBYA 3CMAA 3CCJA 1VQ8A 2V1QA 2M16A 2XI9A 1UGSB 2VXEA 3CXCS 1T0JA 2VC8A 2A36A 3OQ5A 1F1BB 2E6ZA 2JVVA 2IPOB 3G71A 2YT6A 4BB7A 3CCUQ 1PG5B 3T9NA 2CT4A 2L3PA 1WZOA 2YRDA 3QJ6A 2CP5A 1HSQA 3H0IA 3CC2A 5AT1B 3QJYA 2O9SA 3CD6A 2OI3A 3GNFB 1IGQA 2KGTA 2LT1A 1UTIA 1M30A 2DXUA 4FYYB 4JPBW 2ZPGB 3M5AA 3M59A 1EZZB 1NLOC 4NL2A 4OMNA 1QMCA 5LJ3f 4JJDA 1I81A 2J05A 2NUTB 5GANd 1VQ4A 3C95A 1Q82C 4Y92A 5KYUB 5A2QE 3L1AA 1NBEB 1TWBA 3LX7A 2RJFA 1V76A 1KIKA 4RG8A 1VQ6A 2K4YA 2LX9A 4BE2A 2ED1A 1D1CA 2RK1A 1PKSA 3EGXA 1A0NB 3G6EA 2ROLA 1QCNA 2QI2A 8ATCB 3CCEA 4L59A 2CYZB 3EG2A 4M7AG 2DTHA 2XMFA 4C0DC 1SHFA 3M55A 3BDLA 4J9BA 1K9MU 5GMKm 3OYEA 1G3YA 1RAEB 3A8OB 5KCOA 1YIJT 4IUPA 3FJ5A 4X34A 1YJWT 4BD3A 4IURA 4GLMA 1NE8A 2ROTA 1KG1A 1D09B 2FRYA 1AVZC 2RPNA 1ZHIA 4M7AA 5J39A 3BDUA 2HQXA 2KRNA 1KQSP 2OTJQ 2O4XB 4DOWA 3OYNA 2KBTA 3M4GA 1RLQC 2I2LA 2DXTA 4OGEA 1VQ5Q 2YWWA 3URGA 2VGMA 3CCSQ 2LMJA 4QVCA 4K11A 2CSIA 2X9HA 1YP5A 1XNIA 2V8IA 4R0KA 4JLGA 2EFIA 3JCMX 1BK2A 2ZPFB 5I11A 3CXCA 2DVEA 4ZNXA 2MK5A 1EX4A 2KXCA 4X9DA 1KHIA 1TTHB 2JTMA 3TVTA 4AT1B 1N8RR 2K3YA 4FSSA 2CSQA 1MNEA 2VUBA 3JCMd 3EH1A 2OTJA 4OMLA 5C0MA 3JB9H 1OQKA 2LX7A 2ECZA 1PRLC 1T3SA 3C94A 5J26A 5D7UA 2MYSA 3NTIA 2AKKA 3P8BB 2KT1A 2AZSA 3PE0A 4M77E 4JJCA 3L2RA 2W0ZA 3V8KA 2J6KA 1AZEA 2P4TA 3BE3A 2CS7A 2O01E 2JTFA 1EFNA 3OSSC 3CC2T 1WJSA 1RAGB 1IB8A 3MPUB 1VQLQ 2RQWA 2R57A 1W2BA 3CCRA 2KK4A 1G8XA
chains in the Genus database with same CATH topology
2AKLA 2M51A 2JW4A 4GBQA 1ZUKA 3H0HA 1MUZA 3SHWA 1OV3A 3PVLA 4HVWA 3RBBB 3LH5A 2DJQA 2D8JA 2SEMA 1OPKA 1QWEA 5I22A 1X6GA 3VS1A 4AFSC 1K1ZA 2PNIA 4CC3A 4D8DA 1WFWA 1SEMA 2LNHB 2L3SA 2C0IA 1E6GA 2GQIA 2HCKA 4RTTA 1YN8A 4RTXA 4AG2C 2VVKA 1TG0A 2CH4A 4E6RA 2DL3A 2O31A 3GBQA 2BTTA 2CUBA 3M0SA 3I5RA 2YUPA 2GTJA 1G83A 3EG3A 1UE9A 1WX6A 2EKHA 2D8HA 1AOJA 2DVJA 1QKWA 1K76A 2DL7A 2L2PA 5IHNA 2RQTA 1M3BA 1M3AA 1ZX6A 2K3BA 2RQUA 4LE9A 4ORZA 1BU1A 4HVUA 2D0NA 2EBPA 4J9DA 1ABQA 1X69A 2MOXA 1UHFA 1HJDA 3UATA 4J9IA 3VS3A 2JXBA 1M8MA 1NEGA 2DL4A 3UF4A 2I0NA 2KNBB 2EGCA 3SEMA 2O88A 1Y57A 2A28A 1K0XA 1UG1A 2RMOA 3VS6A 2EQIA 4D8KA 1KJWA 2VWFA 2HSPA 2HDAA 3RNJA 2DBKA 1WIEA 3O5ZA 2EGAA 1SSHA 2GNCA 4AFUC 2LJ1A 1ZUYA 2F2XA 1GBRA 1VYUA 3I5SA 4Z88A 4DEXA 2EYWA 2FRWA 1JQQA 2RF0A 4J9GA 1UJ0A 1TUCA 5IXBA 1E6HA 2CDTA 2KEAA 3H41A 3M0QA 2KT8A 3NHNA 4RTWA 3REAB 4LNPA 3VS0A 2K6DA 2D1XA 1S1NA 2L3QA 2AZVA 5FWBA 1JO8A 5FWCA 1MV0B 2O2OA 1WXUA 5FW9A 2DRKA 4AFZC 2MIOA 3M0TA 2F2VA 1PKTA 1QLYA 1CSKA 1UUEA 2JM8A 1G2BA 4OMOA 5EC7A 2E5KA 2J6FA 1FMKA 1U06A 1M27C 4CC2A 1B07A 2LJ3A 1GCPA 2X3WD 2EYZA 2EPDA 1NM7A 5IHKA 3NMZC 1H8KA 1RUWA 4IIOA 2JM9A 2RQVA 1I1JA 2DYBA 1AD5A 2DF6A 1VYVA 1X2KA 1WXBA 4LN2A 2YUNA 2DILA 1GRIA 1SPKA 2J6OA 2EYXA 1WYXA 2CUDA 1GCQC 2DMOA 1U3OA 3A98A 2OAWA 1ZSGA 4CC4B 4A63B 2DNUA 1NG2A 1CKBA 2CREA 4F16A 2KYMA 2GGRA 1GFDA 3EHQA 4J9HA 4F14A 2KRSA 1JXMA 1VA7A 1AWXA 2A37A 4HVVA 2K7AA 1I07A 1NEBA 3ZL7C 2J7IA 5GJWB 4WCIA 1HD3A 4F17A 2K2MA 2RNAA 1N5ZA 2IIMA 2BZXA 1Z9QA 1JU5C 1Z9ZA 2BZ8A 2GTOA 2JT4A 2SRCA 1X6BA 3EHRA 1YNZA 3KFVA 1BB9A 3H0FA 5IHIA 2PZ1A 2HEQA 2CH4W 4RUGA 2BZYA 3EGUA 1ZLMA 1KSWA 1M3CA 2LP5A 1W6XA 2KR3A 3THKA 1WLPB 1OOTA 2FO0A 2DBMA 1J3TA 3JV3A 2ESWA 4Z8AA 1AEYA 2JMAA 2OJ2A 1XOVA 3ULRB 2K79A 4RTZA 1ZBJA 2LQWA 3PVQA 1PWTA 1UECA 2DE0X 3TSZA 1YCSB 1SRMA 1NLPC 2EVRA 2FPEA 2JS2A 1E7OA 3NPFA 4OMMA 2MCNA 3R6NA 3UA7A 1PRMC 5IH2A 1CKAA 1SHGA 2O9VA 2AK5A 4LUEA 2V1QA 1MV3A 2P4RA 1QWFA 1K0SA 4RTVA 4M4ZA 1LCKA 1T0JA 2DL8A 2NWMA 2A36A 1NYGA 1Y0MA 2HBWA 1QCFA 4ESRA 2YT6A 1W1FA 1X27A 1WDXA 1QKXA 2CT4A 2L3PA 4DEYA 2A08A 1HSQA 3H0IA 4RTUA 2O9SA 1H92A 3C0CA 2EW3A 2OI3A 2M0YA 2YUOA 1GFCA 1FYNA 2K9GA 2KGTA 2EYYA 1UTIA 4OMPA 2LQNA 1M30A 3U23A 4JPBW 3VS5A 2LJ0A 1I0CA 1RLPC 2EGEA 4HCKA 2KYBA 1NLOC 1X2QA 3EG0A 4OMNA 1GCQA 1PHTA 3I35A 4JJDA 2J05A 1YWOA 1AZGB 1OEBA 1WI7A 1WXTA 2KE9A 2CT3A 2KXDA 4Y92A 2C0OA 1YWPA 1K9AA 1U5SA 1X43A 3VS2A 4KRTA 1KIKA 4JZ3A 2H8HA 4X1VA 1H3HA 2ED1A 3VRZA 1ZUUA 1PKSA 2FG0A 3QWXX 1K4US 3M0UA 1A0NB 4Z89A 2B86A 4IIMA 1T3LA 2ED0A 4AG1C 2ROLA 4LUDA 2FEIA 5GJVB 1TUDA 3EG2A 2XMFA 1UDLA 4QT7A 2C0TA 1UGVA 1SHFA 2NUZA 4J9BA 3VS4A 2PTKA 3M0PA 1WA7A 3I9QA 3QWYA 3FJ5A 4GLMA 2DA9A 1T0HA 2W10A 2DM1A 2YDLA 2KRMA 2ROTA 2FRYA 1AVZC 2RPNA 1OPLA 2KROA 1IO6A 2DRMA 4J9EA 2G6FX 1ARKA 1NYFA 2RQRA 2L0AA 3UA6A 1AWJA 2QDLA 2KRNA 2YSQA 1BBZA 3NGPA 1JXOA 3CQTA 2KBTA 1RLQC 1UFFA 1AWOA 1VYTA 2DLPA 2JS0A 2RN8A 2LMJA 4K11A 2CSIA 1YP5A 4R0KA 1V1CA 4OMQA 2J06A 1BK2A 5I11A 4ZNXA 1JEGA 3VRYA 3VS7A 4JJBA 2FPDA 2JTEA 1B3QA 2KXCA 2V1RA 4J9FA 5ECAA 3TVTA 2LZ6B 2F2WA 4FSSA 2CSQA 3EG1A 1SRLA 4OMLA 1AWWA 2LCSA 2LX7A 5L23A 2ECZA 1PRLC 2GBQA 3TSWA 2X3XD 1T3SA 4RTYA 2JMCA 4JZ4A 2YUQA 1UJYA 2VKNA 2AKKA 4AFQC 1ABOA 2KT1A 2AZSA 3PE0A 4JJCA 2DX1A 2W0ZA 2ABLA 2J6KA 4J9CA 1KFZA 3IQLA 1AZEA 2FPFA 4HXJA 1UHCA 1EFNA 3M0RA 2ENMA 4EIKA 3REBB 2DL5A 5HCKA 1W70A 1PNJA 1RI9A 1GBQA 1GL5A 5IXFA 2RQWA 4CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKL A;  2M51 A;  2JW4 A;  4GBQ A;  1ZUK A;  3H0H A;  1MUZ A;  3SHW A;  1OV3 A;  3PVL A;  4HVW A;  3RBB B;  3LH5 A;  2DJQ A;  2D8J A;  2SEM A;  1OPK A;  1QWE A;  5I22 A;  1X6G A;  3VS1 A;  4AFS C;  1K1Z A;  2PNI A;  4CC3 A;  4D8D A;  1WFW A;  1SEM A;  2LNH B;  2L3S A;  2C0I A;  1E6G A;  2GQI A;  2HCK A;  4RTT A;  1YN8 A;  4RTX A;  4AG2 C;  2VVK A;  1TG0 A;  2CH4 A;  4E6R A;  2DL3 A;  2O31 A;  3GBQ A;  2BTT A;  2CUB A;  3M0S A;  3I5R A;  2YUP A;  2GTJ A;  1G83 A;  3EG3 A;  1UE9 A;  1WX6 A;  2EKH A;  2D8H A;  1AOJ A;  2DVJ A;  1QKW A;  1K76 A;  2DL7 A;  2L2P A;  5IHN A;  2RQT A;  1M3B A;  1M3A A;  1ZX6 A;  2K3B A;  2RQU A;  4LE9 A;  4ORZ A;  1BU1 A;  4HVU A;  2D0N A;  2EBP A;  4J9D A;  1ABQ A;  1X69 A;  2MOX A;  1UHF A;  1HJD A;  3UAT A;  4J9I A;  3VS3 A;  2JXB A;  1M8M A;  1NEG A;  2DL4 A;  3UF4 A;  2I0N A;  2KNB B;  2EGC A;  3SEM A;  2O88 A;  1Y57 A;  2A28 A;  1K0X A;  1UG1 A;  2RMO A;  3VS6 A;  2EQI A;  4D8K A;  1KJW A;  2VWF A;  2HSP A;  2HDA A;  3RNJ A;  2DBK A;  1WIE A;  3O5Z A;  2EGA A;  1SSH A;  2GNC A;  4AFU C;  2LJ1 A;  1ZUY A;  2F2X A;  1GBR A;  1VYU A;  3I5S A;  4Z88 A;  4DEX A;  2EYW A;  2FRW A;  1JQQ A;  2RF0 A;  4J9G A;  1UJ0 A;  1TUC A;  5IXB A;  1E6H A;  2CDT A;  2KEA A;  3H41 A;  3M0Q A;  2KT8 A;  3NHN A;  4RTW A;  3REA B;  4LNP A;  3VS0 A;  2K6D A;  2D1X A;  1S1N A;  2L3Q A;  2AZV A;  5FWB A;  1JO8 A;  5FWC A;  1MV0 B;  2O2O A;  1WXU A;  5FW9 A;  2DRK A;  4AFZ C;  2MIO A;  3M0T A;  2F2V A;  1PKT A;  1QLY A;  1CSK A;  1UUE A;  2JM8 A;  1G2B A;  4OMO A;  5EC7 A;  2E5K A;  2J6F A;  1FMK A;  1U06 A;  1M27 C;  4CC2 A;  1B07 A;  2LJ3 A;  1GCP A;  2X3W D;  2EYZ A;  2EPD A;  1NM7 A;  5IHK A;  3NMZ C;  1H8K A;  1RUW A;  4IIO A;  2JM9 A;  2RQV A;  1I1J A;  2DYB A;  1AD5 A;  2DF6 A;  1VYV A;  1X2K A;  1WXB A;  4LN2 A;  2YUN A;  2DIL A;  1GRI A;  1SPK A;  2J6O A;  2EYX A;  1WYX A;  2CUD A;  1GCQ C;  2DMO A;  1U3O A;  3A98 A;  2OAW A;  1ZSG A;  4CC4 B;  4A63 B;  2DNU A;  1NG2 A;  1CKB A;  2CRE A;  4F16 A;  2KYM A;  2GGR A;  1GFD A;  3EHQ A;  4J9H A;  4F14 A;  2KRS A;  1JXM A;  1VA7 A;  1AWX A;  2A37 A;  4HVV A;  2K7A A;  1I07 A;  1NEB A;  3ZL7 C;  2J7I A;  5GJW B;  4WCI A;  1HD3 A;  4F17 A;  2K2M A;  2RNA A;  1N5Z A;  2IIM A;  2BZX A;  1Z9Q A;  1JU5 C;  1Z9Z A;  2BZ8 A;  2GTO A;  2JT4 A;  2SRC A;  1X6B A;  3EHR A;  1YNZ A;  3KFV A;  1BB9 A;  3H0F A;  5IHI A;  2PZ1 A;  2HEQ A;  2CH4 W;  4RUG A;  2BZY A;  3EGU A;  1ZLM A;  1KSW A;  1M3C A;  2LP5 A;  1W6X A;  2KR3 A;  3THK A;  1WLP B;  1OOT A;  2FO0 A;  2DBM A;  1J3T A;  3JV3 A;  2ESW A;  4Z8A A;  1AEY A;  2JMA A;  2OJ2 A;  1XOV A;  3ULR B;  2K79 A;  4RTZ A;  1ZBJ A;  2LQW A;  3PVQ A;  1PWT A;  1UEC A;  2DE0 X;  3TSZ A;  1YCS B;  1SRM A;  1NLP C;  2EVR A;  2FPE A;  2JS2 A;  1E7O A;  3NPF A;  4OMM A;  2MCN A;  3R6N A;  3UA7 A;  1PRM C;  5IH2 A;  1CKA A;  1SHG A;  2O9V A;  2AK5 A;  4LUE A;  2V1Q A;  1MV3 A;  2P4R A;  1QWF A;  1K0S A;  4RTV A;  4M4Z A;  1LCK A;  1T0J A;  2DL8 A;  2NWM A;  2A36 A;  1NYG A;  1Y0M A;  2HBW A;  1QCF A;  4ESR A;  2YT6 A;  1W1F A;  1X27 A;  1WDX A;  1QKX A;  2CT4 A;  2L3P A;  4DEY A;  2A08 A;  1HSQ A;  3H0I A;  4RTU A;  2O9S A;  1H92 A;  3C0C A;  2EW3 A;  2OI3 A;  2M0Y A;  2YUO A;  1GFC A;  1FYN A;  2K9G A;  2KGT A;  2EYY A;  1UTI A;  4OMP A;  2LQN A;  1M30 A;  3U23 A;  4JPB W;  3VS5 A;  2LJ0 A;  1I0C A;  1RLP C;  2EGE A;  4HCK A;  2KYB A;  1NLO C;  1X2Q A;  3EG0 A;  4OMN A;  1GCQ A;  1PHT A;  3I35 A;  4JJD A;  2J05 A;  1YWO A;  1AZG B;  1OEB A;  1WI7 A;  1WXT A;  2KE9 A;  2CT3 A;  2KXD A;  4Y92 A;  2C0O A;  1YWP A;  1K9A A;  1U5S A;  1X43 A;  3VS2 A;  4KRT A;  1KIK A;  4JZ3 A;  2H8H A;  4X1V A;  1H3H A;  2ED1 A;  3VRZ A;  1ZUU A;  1PKS A;  2FG0 A;  3QWX X;  1K4U S;  3M0U A;  1A0N B;  4Z89 A;  2B86 A;  4IIM A;  1T3L A;  2ED0 A;  4AG1 C;  2ROL A;  4LUD A;  2FEI A;  5GJV B;  1TUD A;  3EG2 A;  2XMF A;  1UDL A;  4QT7 A;  2C0T A;  1UGV A;  1SHF A;  2NUZ A;  4J9B A;  3VS4 A;  2PTK A;  3M0P A;  1WA7 A;  3I9Q A;  3QWY A;  3FJ5 A;  4GLM A;  2DA9 A;  1T0H A;  2W10 A;  2DM1 A;  2YDL A;  2KRM A;  2ROT A;  2FRY A;  1AVZ C;  2RPN A;  1OPL A;  2KRO A;  1IO6 A;  2DRM A;  4J9E A;  2G6F X;  1ARK A;  1NYF A;  2RQR A;  2L0A A;  3UA6 A;  1AWJ A;  2QDL A;  2KRN A;  2YSQ A;  1BBZ A;  3NGP A;  1JXO A;  3CQT A;  2KBT A;  1RLQ C;  1UFF A;  1AWO A;  1VYT A;  2DLP A;  2JS0 A;  2RN8 A;  2LMJ A;  4K11 A;  2CSI A;  1YP5 A;  4R0K A;  1V1C A;  4OMQ A;  2J06 A;  1BK2 A;  5I11 A;  4ZNX A;  1JEG A;  3VRY A;  3VS7 A;  4JJB A;  2FPD A;  2JTE A;  1B3Q A;  2KXC A;  2V1R A;  4J9F A;  5ECA A;  3TVT A;  2LZ6 B;  2F2W A;  4FSS A;  2CSQ A;  3EG1 A;  1SRL A;  4OML A;  1AWW A;  2LCS A;  2LX7 A;  5L23 A;  2ECZ A;  1PRL C;  2GBQ A;  3TSW A;  2X3X D;  1T3S A;  4RTY A;  2JMC A;  4JZ4 A;  2YUQ A;  1UJY A;  2VKN A;  2AKK A;  4AFQ C;  1ABO A;  2KT1 A;  2AZS A;  3PE0 A;  4JJC A;  2DX1 A;  2W0Z A;  2ABL A;  2J6K A;  4J9C A;  1KFZ A;  3IQL A;  1AZE A;  2FPF A;  4HXJ A;  1UHC A;  1EFN A;  3M0R A;  2ENM A;  4EIK A;  3REB B;  2DL5 A;  5HCK A;  1W70 A;  1PNJ A;  1RI9 A;  1GBQ A;  1GL5 A;  5IXF A;  2RQW A;  4CC7 A; 
#chains in the Genus database with same CATH topology
 2P0P A;  3NTK A;  4N0A A;  2M51 A;  2A3L A;  2JW4 A;  1R0B G;  1ZUK A;  3EFO B;  4C8Q B;  2QQA A;  4HVW A;  4EMK B;  3J7A F;  2D6F A;  2D8J A;  3PT9 A;  1OPK A;  1QWE A;  4PNO A;  3VS1 A;  4R56 A;  4PFZ A;  3EG9 A;  2HBP A;  1YIT A;  5HY6 A;  1M1G A;  2KVQ G;  2DIQ A;  3GPL A;  3JCM h;  1YN8 A;  4V2S A;  2VVK A;  1TG0 A;  2CH4 A;  3KXT A;  2XKO C;  3CME T;  4PKC C;  2CUB A;  4PJL A;  3H6Z A;  2DAQ A;  2CGH A;  3I5R A;  2MF2 A;  2YUP A;  2COY A;  1PSE A;  3CCV Q;  1G83 A;  2CKK A;  1UE9 A;  3OYK A;  2D8H A;  3ER0 A;  3RKY A;  4PJO D;  2RD1 A;  5GAM d;  1K76 A;  5IHN A;  4FU6 A;  4ORZ A;  1BU1 A;  4AMC A;  1VQM A;  4M7A F;  1X69 A;  2XID A;  3CC7 T;  3I55 Q;  4J9I A;  3VS3 A;  2JXB A;  5GAN 6;  4MZT A;  3L2V A;  3KUF A;  2I0N A;  2RK2 A;  4XAX B;  3FJP A;  2O88 A;  1BI3 A;  3EH2 A;  2CZ0 B;  4JS5 A;  2OTL T;  1VQP T;  1K0X A;  2RMO A;  4D8K A;  1KJW A;  3HHT B;  3PIO A;  3RNJ A;  2HKN A;  5FU7 B;  1SSH A;  5AYF A;  4AFU C;  2LJ1 A;  5KE2 A;  3MO8 A;  1GBR A;  5CO7 A;  1PC0 A;  3I5S A;  4Z88 A;  4HA8 A;  1JQQ A;  5GAN 8;  3LW5 E;  4FYV B;  4BY6 C;  1BCO A;  4B9X A;  1TUC A;  3RMQ A;  5DLO A;  3KBG A;  3CCJ Q;  3A5Z B;  4DOV A;  2RHX A;  3LGL A;  4DBQ A;  2QQS A;  3Q1J A;  1SF9 A;  3X26 B;  4J83 A;  4L6V 5;  3VS0 A;  4F7U B;  2K6D A;  4PJJ A;  4OGC A;  2EJG A;  1D0X A;  4ELY C;  3J81 E;  1JO8 A;  3FIF A;  3OYG A;  2O2O A;  3G71 Q;  5FW9 A;  3M0T A;  3C4S A;  4HCZ A;  1NJI R;  4QKU A;  5FRO A;  2OTJ T;  1G2B A;  2RI3 A;  4J6W A;  3CXC P;  4R55 A;  4CC2 A;  4M7D B;  4CRI A;  2DXB A;  1N9S A;  2EPD A;  4JRI A;  4EPC A;  5GAN g;  3M9Q A;  1RUW A;  2KMT A;  1EIF A;  2QTX A;  2DYB A;  5CKH A;  1G5V A;  1ZQ1 A;  5GAO n;  4OB1 B;  2RJD A;  2J6O A;  1WYX A;  2QAS A;  1Q86 R;  2DMO A;  2RHZ A;  4CC4 B;  2DNU A;  3H8Z A;  2CRE A;  2K5I A;  1M90 C;  5LJ5 h;  4PJM A;  1M90 U;  4QQD A;  2R58 A;  3OMC A;  1TH7 A;  2V8J A;  4J9H A;  5KYX B;  4C8Q D;  1K8A C;  3M56 A;  2LCL A;  1D1B A;  2A37 A;  1NEB A;  5KYY A;  3OYA A;  4XTY A;  4F17 A;  4M7A C;  3UDC A;  2MWP A;  4E7L A;  3CC2 Q;  2RNA A;  1N5Z A;  4L5G A;  3EHR A;  5FRM A;  1QP2 A;  3R6O A;  1BB9 A;  2LVM A;  1BI2 A;  2PVG B;  3CCV T;  1RL2 A;  3VJP A;  3EAE A;  4IUU A;  1M5Q 1;  4J6X A;  2FO0 A;  2VB6 A;  2DBM A;  3JV3 A;  3QDF A;  4A4H A;  3ULR B;  1VQ9 A;  3M58 A;  4HT9 A;  1ZBJ A;  2FZK B;  1UEC A;  1PD0 A;  2P0K A;  4QQ6 A;  1LOJ A;  1NLP C;  3JCM g;  2XDD A;  1VIE A;  5IH2 A;  1SHG A;  3QZ9 B;  5KE3 A;  4C92 C;  5LJ5 d;  2P4R A;  1KC8 U;  1YI2 A;  4BI8 B;  4RTV A;  1WHK A;  2E6N A;  2RB6 A;  1VIF A;  4M77 C;  2KAF A;  1LCK A;  1TU0 B;  3CC4 Q;  1NYG A;  1Y0M A;  4QW2 A;  2HBW A;  3LWI A;  4PLI A;  3L2U A;  1W1F A;  1KK7 A;  1WDX A;  2PVD B;  4A54 A;  1QKX A;  2HKQ B;  5A0L A;  1LPL A;  1O75 A;  2MI6 A;  2QG9 B;  4JDS A;  5IT9 E;  2A08 A;  4A4G A;  4E7K A;  4M75 E;  4RTU A;  5A0D A;  1ZBX A;  4JRQ A;  2YUO A;  3QG1 A;  2DO3 A;  1W2B S;  4MML A;  3MEU A;  5KCH A;  5GAO m;  1YHQ T;  1M9S A;  2LJ0 A;  2ZCF B;  1RLP C;  4HCK A;  1K9M R;  1SG5 A;  3EG0 A;  3CCQ T;  2BKD N;  1PHT A;  3SWN A;  2DYI A;  4XTW A;  1AHJ B;  1AZG B;  2HQH A;  2CT3 A;  2DIG A;  5CR2 A;  2K3X A;  2WSE E;  3LLR A;  4FM4 B;  4FT4 A;  1K9A A;  1U5S A;  4OB3 B;  3VS2 A;  2BE7 D;  4KRT A;  4JZ3 A;  4C5H A;  5C6S A;  2H8H A;  1MMG A;  2O4X A;  3VRZ A;  1P92 A;  3M0U A;  2V26 A;  4M78 B;  4Z89 A;  3CCU T;  1Y96 B;  4IIM A;  4KGV B;  3EG9 B;  4AG1 C;  1PM3 A;  2LDM A;  2K57 A;  5LJ5 f;  3HTR A;  2WSF E;  3QII A;  1RAD B;  4MZP A;  2ZPI B;  3EFO A;  2EQM A;  1ZSZ C;  1UGR B;  1NPP A;  3VS4 A;  2PTK A;  3I9Q A;  1K9M C;  4OVA A;  3J80 E;  2W10 A;  2EWN A;  2DM1 A;  3DLM A;  1X01 A;  4OMF B;  5GAN j;  2OAU A;  4XTX A;  1B34 A;  2PUK B;  4J9E A;  1ARK A;  2RQR A;  2L0A A;  3UA6 A;  3PGG A;  4WTO B;  5GAN 3;  1JXO A;  3CQT A;  1KQ1 A;  3E1S A;  3GNG A;  1M2V A;  1RAI B;  3S3O A;  4C8Q C;  1MMA A;  1VYT A;  3I55 A;  2VV5 A;  2RN8 A;  3V8J A;  1Q95 G;  1U8R A;  1B34 B;  2X4J A;  3L42 A;  4ZGJ B;  4P5N A;  2DEQ A;  2MMP A;  4JJB A;  2FPD A;  1B7T A;  2V1R A;  5ECA A;  3JCM e;  2ZPH B;  2F2W A;  3I56 Q;  2HQE A;  2K5F A;  3BY7 A;  3M57 A;  4BDZ A;  1KD1 U;  3JCM Q;  3X24 B;  1YIJ Q;  2M1H A;  2X3X D;  1JJ2 S;  1ZA1 B;  2VKN A;  4AFQ C;  4KUL A;  1IRE B;  3V7R A;  4KBM B;  1VQO A;  4II1 A;  1M1K R;  1KQS S;  4PFP A;  2DX1 A;  2ABL A;  1Q7Y U;  1YBY A;  1D0Z A;  2F5K A;  3CCL A;  1Q7Y C;  5D6X A;  1UHC A;  3M0R A;  3WVD B;  4EIK A;  2WSC E;  2DFU A;  4F04 B;  5HK0 A;  3REB B;  4D6W A;  1ZSZ B;  3HRU A;  4LD6 A;  5IXF A;  3HPW A;  1YHQ A;  4BUG A;  3I56 A;  4CC7 A;  1WNL A;  2E3H A;  3SB2 A;  3E9G A;  2XIC A;  2AKL A;  5CAI A;  3RIR A;  3H0H A;  3SHW A;  1TXQ A;  4KGX B;  1RAB B;  4BDY A;  1K8A R;  2FZC B;  4HCC A;  2NLU A;  2SEM A;  2DXC A;  1K8A U;  4D8D A;  4KUD K;  3JCM J;  2LNH B;  2RO0 A;  2QA4 A;  2A7Y A;  1E6G A;  2EAY A;  3TU4 K;  1VQ8 T;  4RTT A;  2B8A A;  4RTX A;  5GAO p;  4E6R A;  2LCC A;  3GBQ A;  2BTT A;  3BW1 A;  2X4X A;  3MKD A;  5GAO r;  2GTJ A;  1M4Z A;  2R5M A;  1VQ9 T;  2PVO B;  2F1L A;  2GCX A;  3CBO A;  4FW2 A;  3OW2 A;  3HKS A;  1Y07 A;  4E2F B;  4F7U E;  2YRV A;  2RQU A;  5CKD A;  4MDX A;  1RAC B;  4HVU A;  2D0N A;  4MZM A;  4J9D A;  1HJD A;  1UHF A;  2DTI A;  4C0G A;  1VQ4 Q;  3X28 B;  3WVE B;  5CCA A;  5KYY B;  5GAM h;  1NEG A;  4OP0 A;  1KC8 C;  3HRT A;  1WHH A;  3SEM A;  1SKU B;  1Y57 A;  5GAM g;  1OU9 A;  2A28 A;  4JRP A;  3RR6 A;  1C6V X;  5D6Y A;  1Y96 A;  1UG1 A;  3ME9 A;  3L2W A;  1WHM A;  5CKE A;  3G6E Q;  3QDR B;  3CME Q;  2EGA A;  3CCJ T;  1KD1 R;  2GNC A;  4FL6 A;  2JJ9 A;  5LJ5 e;  3L2Z A;  4XU2 A;  2L8D A;  5GAN f;  1VQ9 Q;  4DEX A;  2F5T X;  3CCQ A;  1UJ0 A;  4PJO A;  3HP9 A;  3RUX A;  2CDT A;  1VOM A;  3MEA A;  2QEX Q;  3M0Q A;  1WQW A;  2KT8 A;  4QVZ A;  1V29 B;  3TEE A;  4M7A E;  4LNP A;  2E12 A;  4B9W A;  4M78 C;  3E2U A;  2ZPE B;  5J3B A;  2D1X A;  3SWN C;  1WPY A;  1OZ2 A;  5EG2 A;  5FWB A;  1WXU A;  4AFZ C;  1VQ6 T;  1YJ9 Q;  1PKT A;  1QLY A;  4PJO F;  4PLL A;  3P8H A;  1YJ9 T;  2J6F A;  3JCM c;  5GAO q;  1FMK A;  1B07 A;  1GCP A;  2X3W D;  2EYZ A;  2PU9 B;  1NM7 A;  3G1J A;  1H8K A;  3EFS A;  4IIO A;  3QZ5 B;  2JM9 A;  5I2M A;  1BI0 A;  2QTV A;  4BAC A;  1X2K A;  3D7S B;  3QPH A;  5GAO l;  2XDB A;  1SPK A;  1YJW A;  1UGQ B;  1ZSG A;  2XG8 D;  3NFC A;  3P8D A;  4BI3 A;  1YI2 Q;  3JCM P;  3A8L B;  2BE9 B;  2VYT A;  3MP8 A;  2KYM A;  3VUZ A;  4DBR A;  4E7Z A;  4N4G A;  4XTV A;  4J7I A;  2XU8 A;  3EHQ A;  2OTL A;  3JCM W;  2Y4Y A;  4F14 A;  1JXM A;  3A8H B;  1AWX A;  2D0Q B;  1VQN A;  3G7Z A;  4KUI A;  3MEV A;  1VQL A;  3OSV A;  3OYM A;  2K7A A;  3ZL7 C;  2QA4 T;  1C0M A;  4RKU E;  4CI0 C;  4WCI A;  4M77 F;  1WJR A;  2YLC A;  3NHN A;  1FWZ A;  2IIM A;  1X6B A;  4LDV A;  3G4S Q;  3OW2 S;  2DER A;  2HEQ A;  2KQW A;  3FDR A;  2G3R A;  2FHD A;  3QUI A;  1KC8 R;  1AT1 B;  1W4S A;  3MHX A;  4ZN3 A;  1KSW A;  2QGF B;  2LP5 A;  2ZZD A;  2FZG B;  1PCX A;  3OW2 P;  2QQR A;  3PFS A;  4LXC A;  1YCY A;  5M9O A;  2HNI A;  2LQW A;  2K2V A;  4IUV A;  1YCS B;  5HKC A;  1BCM A;  2ZPB B;  1N27 A;  1SRM A;  2EVR A;  3UA7 A;  3NPF A;  2MCN A;  2IG0 A;  3QO3 A;  2DET A;  3LGF A;  2AK5 A;  3TCJ A;  1QVF P;  4JUV A;  3MEW A;  4LUE A;  1MV3 A;  1QWF A;  2L5Q A;  1K0S A;  4EMK A;  1TOV A;  1FX7 A;  4M4Z A;  3QSU A;  1NJI C;  2QK0 A;  3V7S A;  3EGD A;  3OBW A;  4ME7 A;  3PNW C;  4ESR A;  2CP7 A;  1X27 A;  2KY9 A;  4O5V A;  3OYD A;  2LNV A;  4DEY A;  1VQP A;  1LJO A;  4OB2 B;  3LWH A;  5GMK j;  4C0F A;  1YIJ A;  1H92 A;  3C0C A;  1Y71 A;  2M0Y A;  1N6A A;  2E64 A;  1TS9 A;  1VQO Q;  4OMP A;  3CCR T;  3U23 A;  3VS5 A;  1BKB A;  1X6O A;  4C92 D;  2EQK A;  2KYB A;  3CBP A;  1X2Q A;  3CCL Q;  4F7U G;  1GCQ A;  2MWO A;  2EJ9 A;  4A4F A;  1YWO A;  3JCM b;  1OEB A;  1WI7 A;  1ZSZ A;  2KE9 A;  1UB4 A;  1N9R A;  1TUG B;  1JRI A;  1RAF B;  2C0O A;  1YWP A;  4KGZ B;  4YTL A;  1ZA2 B;  1X43 A;  1VQP Q;  4KH1 B;  4RCB A;  4M7D G;  1M1K C;  4DBH A;  2CP3 A;  1ZUU A;  1Q81 C;  2AT1 B;  3QWX X;  1NJI U;  1K4U S;  4ZGE B;  1IGU A;  3OS5 A;  1T3L A;  2GQV A;  2ED0 A;  4LUD A;  4C5I A;  3OYJ A;  1TUD A;  1UDL A;  2C0T A;  1UGV A;  1VQ7 T;  2NUZ A;  2LRQ A;  3NTH A;  1YJN Q;  2D9T A;  1ACM B;  2QGG A;  1WA7 A;  1IZ6 A;  5LJ3 g;  2QXF A;  4EMK C;  1DJ7 B;  1S72 A;  2DA9 A;  2KRM A;  4M78 G;  4PJN A;  4FSX A;  1IO6 A;  4ANJ A;  3PTA A;  2YSQ A;  5DLQ E;  4JRK A;  4XU1 A;  2VGN A;  3JAM E;  1UFF A;  1AWO A;  2DLP A;  5GAM e;  4DA4 A;  1YJN A;  1V1C A;  4C92 G;  1M1K U;  5GMK e;  3SD4 A;  2J06 A;  1Q81 U;  3VS7 A;  3E9F A;  4JLI A;  2QA4 Q;  4J9F A;  4C5G A;  1JB0 E;  2X4Y A;  1NZ9 A;  2LZ6 B;  2BIV A;  3EG1 A;  1SRL A;  1R8O B;  3TSW A;  1KD1 C;  1VQ7 A;  1BIA A;  5KYW B;  2JMC A;  2YUQ A;  3S3M A;  1ABO A;  1LNX A;  1KFZ A;  3IQL A;  1QVF A;  3FC3 A;  2FPF A;  1MGQ A;  1Y7X A;  4HXJ A;  3JCM f;  4EMG A;  3RER A;  2ENM A;  3RES A;  3F70 A;  1VQM T;  5HCK A;  4XTZ A;  1PNJ A;  1RI9 A;  1GBQ A;  1GL5 A;  4C0D B;  3INZ A;  1WJQ A;  5GAN 4;  2RM4 A;  9ATC B;  1U1S A;  2E4H A;  3CPW P;  3JRZ A;  3BFM A;  3PVL A;  4IUT A;  1YJ9 A;  3LH5 A;  2DJQ A;  1FXX A;  2E5Q A;  1IRX A;  1R77 A;  5I22 A;  4AFS C;  4IKF A;  3AHU A;  2PNI A;  1JJ2 A;  3CC4 A;  1WFW A;  4WF2 A;  1SEM A;  4XTU A;  4N4H A;  2L3S A;  2C0I A;  2RHI A;  2GQI A;  3QBY A;  3CPW S;  1WHG A;  2DL3 A;  2O31 A;  1HXD A;  2YRC A;  3CCQ Q;  3L2Q A;  1D3B B;  4LDW A;  4Y28 E;  4X9C A;  2NUP A;  2EKH A;  1XQH A;  2QYZ A;  4PJO E;  2Y4X A;  4J6Y A;  3CMA Q;  3CCE T;  4M78 E;  1K73 C;  1K73 R;  2BUD A;  3HL8 A;  2E65 A;  1QKW A;  2L2P A;  1PD1 A;  4Z02 A;  1JBM A;  1M3A A;  1ZX6 A;  3OYB A;  4TVR A;  1QVF S;  1FMV A;  2QEX T;  1VQL T;  2OTL Q;  2RH2 A;  4E7I A;  3CCU A;  5KYU A;  4M75 F;  1KQS A;  3DB3 A;  2DL4 A;  2JUF A;  2EGC A;  2A0F B;  2FVU A;  1Q81 R;  2HAX A;  3G4S A;  3EGX B;  1M2O A;  4PJO G;  2YHT A;  3S6W A;  3VYH B;  3VS6 A;  2EQI A;  4JJN K;  3TRE A;  1HK9 A;  2HDA A;  3UT1 A;  1WIE A;  3O5Z A;  4A4K A;  4NL3 A;  1ZUY A;  2DJZ A;  3FRN A;  1UEB A;  2DTO A;  3CD6 T;  4M75 B;  3FB9 A;  3OYY A;  4M78 D;  1YJW Q;  4F7U A;  2FRW A;  3JB9 F;  2CP6 A;  3MP6 A;  3GIB A;  1M90 R;  5IXB A;  1E6H A;  3MCA B;  1WGS A;  4ELZ C;  2KEA A;  3PIP A;  4HKE A;  1G3T A;  3QHS A;  2X4W A;  2FL7 A;  5LJ5 j;  3ZBD A;  2DKG A;  1S1N A;  3C12 A;  3OS1 A;  3WXM B;  4M77 A;  5FWC A;  3CMA T;  1MV0 B;  4F7U F;  2GF7 A;  3I56 T;  3M53 A;  4J8O A;  2MAM A;  4O6J A;  3SDZ A;  4OMO A;  5EC7 A;  2E5K A;  1M27 C;  2DEU A;  2NYS A;  2LJ3 A;  2R5A A;  1MHN A;  5IHK A;  4M77 B;  3NMZ C;  3JB9 G;  2KSS A;  1QVG A;  4GLK A;  1AD5 A;  1VYV A;  5GAN 7;  5CQY A;  2RI2 A;  5I21 A;  2YUN A;  1GRI A;  1N8R U;  2EYX A;  4A4E A;  2CUD A;  2DPP B;  1RAH B;  1BYM A;  1VQ5 A;  1CKB A;  3M54 A;  1IHV A;  2QQ9 A;  4F16 A;  3S3N A;  4C5E A;  3VYG A;  2YLB A;  3A8M B;  2JNG A;  3CEY A;  1GFD A;  4C92 E;  4RG2 A;  3DB4 A;  4M75 C;  4HVV A;  1I07 A;  2J7I A;  5GJW B;  1OI1 A;  2E3I A;  2K2M A;  3OYF A;  5LJ3 e;  5GAN 5;  1GXI E;  3CCM Q;  2BZX A;  1Z9Q A;  1JU5 C;  3ZFJ A;  3A8G B;  3E19 A;  1IHW A;  5IHI A;  2BZY A;  3EGU A;  2P84 A;  2M02 A;  1ZLM A;  4PJO B;  1K73 U;  3X25 B;  2RHU A;  2KR3 A;  2HMA A;  3JB9 J;  1S72 Q;  2HL3 A;  6AT1 B;  1OOT A;  3X20 B;  3MET A;  4GY5 A;  1AEY A;  1RI0 A;  2JMA A;  2OJ2 A;  1TSF A;  3HFN A;  1MND A;  1XOV A;  1HYO A;  2COW A;  3PVQ A;  4M75 G;  4XU3 A;  2DE0 X;  4ZTJ A;  3CCR Q;  1XJW B;  3R6N A;  2FPE A;  2JS2 A;  1E7O A;  4OMM A;  4M77 D;  1PRM C;  1CKA A;  2XK0 A;  4E7H A;  4M7D E;  2O9V A;  4BI4 A;  2EJF A;  2K5L A;  2LT4 A;  7AT1 B;  3O8V A;  3EFR A;  4PK4 A;  2WAC A;  2JOY A;  2NUT A;  2DL8 A;  2NWM A;  1WHL A;  2HD0 A;  2RJE A;  2DZC A;  2JN0 A;  1QCF A;  2CZ6 B;  5GMK l;  1IXD A;  5CQX A;  4E47 A;  3CC7 Q;  2KI7 A;  3CBM A;  3CPF A;  4E7S A;  1VQK Q;  4M75 D;  5LJ3 j;  4M75 A;  4BY6 B;  1VQ7 Q;  2EW3 A;  3QYH B;  1GFC A;  5GAN h;  1MMN A;  1FYN A;  2K9G A;  2EYY A;  2HL5 C;  2LQN A;  5HK3 A;  4FT2 A;  1I0C A;  3CME A;  5IAY A;  2EGE A;  2C06 A;  1LVK A;  3FLG A;  4HT8 A;  2XHC A;  3OY9 A;  3I35 A;  2RJC A;  5KYW A;  4XQ3 A;  3GF5 A;  5KYX A;  1OYX A;  4XK8 E;  1WXT A;  5GAM f;  1OU8 A;  3GLX A;  2KXD A;  3CC7 A;  1BI1 A;  1NPR A;  5L8R E;  1XTD A;  3VU3 C;  2QEX A;  4X1V A;  1H3H A;  5KYN A;  3CC4 T;  4C0Z A;  2FG0 A;  5A0G A;  2B86 A;  2LTO A;  2FEI A;  5GJV B;  1VQN T;  2LQK A;  4EMH A;  5CKF A;  1VQK T;  4QT7 A;  4JS4 A;  5GMK h;  5GAN 2;  3G4S T;  4VUB A;  4N4I A;  4C8Q G;  1WQ7 A;  3M0P A;  4DQ2 A;  4LDX A;  3QWY A;  4M7D A;  2QAZ A;  1YIT T;  1VQ5 T;  5CK9 A;  1T0H A;  3UWN A;  3EGD B;  4A53 A;  5KH6 A;  2YDL A;  4LDU A;  2OX7 A;  1OPL A;  4FYW B;  1QVG P;  4C92 A;  2KRO A;  2DRM A;  2G6F X;  1JJ2 P;  1NYF A;  1AWJ A;  2HSE B;  2E1H A;  2QDL A;  1H3Z A;  2GFA A;  3HSB A;  4M77 G;  4UC4 A;  1BBZ A;  3OYL A;  3NGP A;  2EQU A;  4ATO A;  5GAN e;  4MDW A;  3PMI A;  2P0Q A;  2JS0 A;  3OYC A;  3HFO A;  1H64 1;  1QQJ A;  4M7D F;  1QCO A;  2X51 A;  3OYH A;  4N0A C;  4OMQ A;  1VQ6 Q;  4ZGD B;  4RCC A;  5CKB A;  3RMS A;  4ZTF A;  1O9S A;  3VRY A;  1JEG A;  4OB0 B;  3QXE B;  2JTE A;  3VKI A;  1B3Q A;  5FLX E;  1VQN Q;  1M2V B;  3LYI A;  2AHJ B;  2COZ A;  4NOY A;  4LD9 K;  1AWW A;  2LCS A;  5L23 A;  2GBQ A;  3CD6 Q;  5FU6 B;  4Q5W A;  4RTY A;  5GMK i;  4BE1 A;  4JZ4 A;  4PL6 A;  1UJY A;  2L3R A;  4MMK A;  1Q82 U;  1Q7Y R;  2QDY B;  1QW1 A;  1BIB A;  2FYK A;  2PUO B;  2DD4 A;  4J9C A;  5IN1 A;  1Q82 R;  3HRS A;  4FYX B;  2DK3 A;  3VV0 A;  2VAS A;  2EYQ A;  2DL5 A;  1W70 A;  2NUP B;  1I8F A;  4M78 A;  4J5Y A;  1RAA B;  3MP1 A;  4HCB A;  1WHJ A;  1VQ4 T;  1VUB A;  1QVG S;  4IUQ A;  1M8V A;  3H9N A;  1R0C B;  4GBQ A;  1MUZ A;  3CCS A;  1OV3 A;  4DBF A;  3RBB B;  4KH0 B;  4PJO C;  3OS0 A;  4C8Q E;  1X6G A;  1K1Z A;  4CC3 A;  3JB9 I;  5LL6 S;  3CCE Q;  2H3J A;  4M7A D;  2XDP A;  8AT1 B;  2HCK A;  4AG2 C;  4M7A B;  4QVD A;  3M0S A;  1KHC A;  3MJX A;  4EDU A;  3OYI A;  2CZ7 B;  4FW1 A;  4BE0 A;  3EG3 A;  1WX6 A;  5FU6 C;  4FIB A;  2LC4 A;  1AOJ A;  2DVJ A;  3CPW A;  2DL7 A;  2KDS A;  2RQT A;  1M3B A;  2K3B A;  1D1A A;  5LJ5 g;  2E10 A;  5LJ3 d;  4LE9 A;  4ZN1 A;  1QVP A;  1I5O B;  2EBP A;  1ABQ A;  2EIF A;  2MOX A;  1OZ3 A;  1FMW A;  1G3W A;  2MPX C;  3UAT A;  3FEO A;  1M8M A;  4NS5 A;  3CCM T;  3A1P A;  1YI2 T;  3UF4 A;  1YFN A;  2EQJ A;  1PSF A;  2M9U A;  2KNB B;  4KT0 E;  4M7D C;  3DKM A;  2VWF A;  3I55 T;  3G71 T;  5DY9 A;  2HSP A;  3V7C A;  2ATC B;  2DBK A;  2Z0W A;  1YIT Q;  1U1T A;  2F2X A;  2EKO A;  1VYU A;  3TQ7 P;  1MMD A;  2EYW A;  5GAM j;  2RF0 A;  2Y90 A;  4J9G A;  3CCV A;  3G6E T;  2QQB A;  4C92 B;  1OUL A;  3H41 A;  3ASK A;  5LJ3 h;  5CVI A;  1W2B P;  4RTW A;  3PMT A;  3REA B;  3GP8 A;  3QKJ A;  2ZAE A;  2L3Q A;  1VQM Q;  2AZV A;  4Y91 A;  2CZ1 B;  3GOX A;  2DRK A;  4C8Q A;  2MIO A;  3CCM A;  4M78 F;  2GFU A;  4PFO A;  2F2V A;  1CSK A;  2DD5 A;  1UUE A;  2JM8 A;  1VQK A;  5I2S A;  1SSF A;  5CIU A;  4XU0 A;  1G3S A;  2DZ9 A;  3SFM A;  4M7D D;  2RI5 A;  1U06 A;  2M0O A;  2XD0 A;  1Q86 U;  4C8Q F;  1OX8 A;  3OMG A;  3UPU A;  3JSC A;  3CCS T;  2E41 A;  2RQV A;  1I1J A;  2DF6 A;  1C1A A;  1YJN T;  1WXB A;  4LN2 A;  5DM7 R;  1D3B A;  4J7F A;  2DIL A;  4E7J A;  5FRN A;  1GCQ C;  2YXY A;  2F69 A;  1S72 T;  1U3O A;  3A98 A;  3RKW A;  2OAW A;  3RDV A;  5D6W A;  4A63 B;  1NG2 A;  2LQ8 A;  1D0Y A;  1UGP B;  2E70 A;  2RHY A;  2AIR B;  3AT1 B;  5FU7 C;  4B6M A;  2GGR A;  1I4K 1;  3OA6 A;  3SWN B;  2KRS A;  1VA7 A;  2RA2 A;  3RKX A;  3QYG B;  1VQO T;  3M4Y A;  4LDY A;  3N5B B;  1KQ2 A;  4QQG A;  2L89 A;  3JB9 D;  1HD3 A;  2PQW A;  1VQ8 Q;  2X35 A;  1Z9Z A;  2JT4 A;  3KFV A;  2BZ8 A;  2GTO A;  2HZY A;  2IVW A;  2SRC A;  2V8K A;  1YNZ A;  3OB9 A;  4OF1 A;  3H0F A;  3LH0 A;  2PZ1 A;  2H3E B;  2FB7 A;  2CP0 A;  2CH4 W;  4RUG A;  4RMO A;  4C92 F;  3VUB A;  1Q86 C;  1I5L A;  1M3C A;  3JCM V;  1W6X A;  3THK A;  1WLP B;  2VXF A;  1J3T A;  1OX9 A;  2JZ2 A;  2ESW A;  4Z8A A;  3DLL A;  3CCL T;  2K79 A;  2ZGW A;  4RTZ A;  1N8R C;  1PWT A;  4FCY A;  1M1F A;  3TSZ A;  3OS2 A;  3ZEH A;  1YHQ Q;  1QP3 A;  3V8L A;  1X75 C;  2CP2 A;  3OBY A;  3CMA A;  3CCJ A;  1VQ8 A;  2V1Q A;  2M16 A;  2XI9 A;  1UGS B;  2VXE A;  3CXC S;  1T0J A;  2VC8 A;  2A36 A;  3OQ5 A;  1F1B B;  2E6Z A;  2JVV A;  2IPO B;  3G71 A;  2YT6 A;  4BB7 A;  3CCU Q;  1PG5 B;  3T9N A;  2CT4 A;  2L3P A;  1WZO A;  2YRD A;  3QJ6 A;  2CP5 A;  1HSQ A;  3H0I A;  3CC2 A;  5AT1 B;  3QJY A;  2O9S A;  3CD6 A;  2OI3 A;  3GNF B;  1IGQ A;  2KGT A;  2LT1 A;  1UTI A;  1M30 A;  2DXU A;  4FYY B;  4JPB W;  2ZPG B;  3M5A A;  3M59 A;  1EZZ B;  1NLO C;  4NL2 A;  4OMN A;  1QMC A;  5LJ3 f;  4JJD A;  1I81 A;  2J05 A;  2NUT B;  5GAN d;  1VQ4 A;  3C95 A;  1Q82 C;  4Y92 A;  5KYU B;  5A2Q E;  3L1A A;  1NBE B;  1TWB A;  3LX7 A;  2RJF A;  1V76 A;  1KIK A;  4RG8 A;  1VQ6 A;  2K4Y A;  2LX9 A;  4BE2 A;  2ED1 A;  1D1C A;  2RK1 A;  1PKS A;  3EGX A;  1A0N B;  3G6E A;  2ROL A;  1QCN A;  2QI2 A;  8ATC B;  3CCE A;  4L59 A;  2CYZ B;  3EG2 A;  4M7A G;  2DTH A;  2XMF A;  4C0D C;  1SHF A;  3M55 A;  3BDL A;  4J9B A;  1K9M U;  5GMK m;  3OYE A;  1G3Y A;  1RAE B;  3A8O B;  5KCO A;  1YIJ T;  4IUP A;  3FJ5 A;  4X34 A;  1YJW T;  4BD3 A;  4IUR A;  4GLM A;  1NE8 A;  2ROT A;  1KG1 A;  1D09 B;  2FRY A;  1AVZ C;  2RPN A;  1ZHI A;  4M7A A;  5J39 A;  3BDU A;  2HQX A;  2KRN A;  1KQS P;  2OTJ Q;  2O4X B;  4DOW A;  3OYN A;  2KBT A;  3M4G A;  1RLQ C;  2I2L A;  2DXT A;  4OGE A;  1VQ5 Q;  2YWW A;  3URG A;  2VGM A;  3CCS Q;  2LMJ A;  4QVC A;  4K11 A;  2CSI A;  2X9H A;  1YP5 A;  1XNI A;  2V8I A;  4R0K A;  4JLG A;  2EFI A;  3JCM X;  1BK2 A;  2ZPF B;  5I11 A;  3CXC A;  2DVE A;  4ZNX A;  2MK5 A;  1EX4 A;  2KXC A;  4X9D A;  1KHI A;  1TTH B;  2JTM A;  3TVT A;  4AT1 B;  1N8R R;  2K3Y A;  4FSS A;  2CSQ A;  1MNE A;  2VUB A;  3JCM d;  3EH1 A;  2OTJ A;  4OML A;  5C0M A;  3JB9 H;  1OQK A;  2LX7 A;  2ECZ A;  1PRL C;  1T3S A;  3C94 A;  5J26 A;  5D7U A;  2MYS A;  3NTI A;  2AKK A;  3P8B B;  2KT1 A;  2AZS A;  3PE0 A;  4M77 E;  4JJC A;  3L2R A;  2W0Z A;  3V8K A;  2J6K A;  1AZE A;  2P4T A;  3BE3 A;  2CS7 A;  2O01 E;  2JTF A;  1EFN A;  3OSS C;  3CC2 T;  1WJS A;  1RAG B;  1IB8 A;  3MPU B;  1VQL Q;  2RQW A;  2R57 A;  1W2B A;  3CCR A;  2KK4 A;  1G8X A; 
#chains in the Genus database with same CATH homology
 2AKL A;  2M51 A;  2JW4 A;  4GBQ A;  1ZUK A;  3H0H A;  1MUZ A;  3SHW A;  1OV3 A;  3PVL A;  4HVW A;  3RBB B;  3LH5 A;  2DJQ A;  2D8J A;  2SEM A;  1OPK A;  1QWE A;  5I22 A;  1X6G A;  3VS1 A;  4AFS C;  1K1Z A;  2PNI A;  4CC3 A;  4D8D A;  1WFW A;  1SEM A;  2LNH B;  2L3S A;  2C0I A;  1E6G A;  2GQI A;  2HCK A;  4RTT A;  1YN8 A;  4RTX A;  4AG2 C;  2VVK A;  1TG0 A;  2CH4 A;  4E6R A;  2DL3 A;  2O31 A;  3GBQ A;  2BTT A;  2CUB A;  3M0S A;  3I5R A;  2YUP A;  2GTJ A;  1G83 A;  3EG3 A;  1UE9 A;  1WX6 A;  2EKH A;  2D8H A;  1AOJ A;  2DVJ A;  1QKW A;  1K76 A;  2DL7 A;  2L2P A;  5IHN A;  2RQT A;  1M3B A;  1M3A A;  1ZX6 A;  2K3B A;  2RQU A;  4LE9 A;  4ORZ A;  1BU1 A;  4HVU A;  2D0N A;  2EBP A;  4J9D A;  1ABQ A;  1X69 A;  2MOX A;  1UHF A;  1HJD A;  3UAT A;  4J9I A;  3VS3 A;  2JXB A;  1M8M A;  1NEG A;  2DL4 A;  3UF4 A;  2I0N A;  2KNB B;  2EGC A;  3SEM A;  2O88 A;  1Y57 A;  2A28 A;  1K0X A;  1UG1 A;  2RMO A;  3VS6 A;  2EQI A;  4D8K A;  1KJW A;  2VWF A;  2HSP A;  2HDA A;  3RNJ A;  2DBK A;  1WIE A;  3O5Z A;  2EGA A;  1SSH A;  2GNC A;  4AFU C;  2LJ1 A;  1ZUY A;  2F2X A;  1GBR A;  1VYU A;  3I5S A;  4Z88 A;  4DEX A;  2EYW A;  2FRW A;  1JQQ A;  2RF0 A;  4J9G A;  1UJ0 A;  1TUC A;  5IXB A;  1E6H A;  2CDT A;  2KEA A;  3H41 A;  3M0Q A;  2KT8 A;  3NHN A;  4RTW A;  3REA B;  4LNP A;  3VS0 A;  2K6D A;  2D1X A;  1S1N A;  2L3Q A;  2AZV A;  5FWB A;  1JO8 A;  5FWC A;  1MV0 B;  2O2O A;  1WXU A;  5FW9 A;  2DRK A;  4AFZ C;  2MIO A;  3M0T A;  2F2V A;  1PKT A;  1QLY A;  1CSK A;  1UUE A;  2JM8 A;  1G2B A;  4OMO A;  5EC7 A;  2E5K A;  2J6F A;  1FMK A;  1U06 A;  1M27 C;  4CC2 A;  1B07 A;  2LJ3 A;  1GCP A;  2X3W D;  2EYZ A;  2EPD A;  1NM7 A;  5IHK A;  3NMZ C;  1H8K A;  1RUW A;  4IIO A;  2JM9 A;  2RQV A;  1I1J A;  2DYB A;  1AD5 A;  2DF6 A;  1VYV A;  1X2K A;  1WXB A;  4LN2 A;  2YUN A;  2DIL A;  1GRI A;  1SPK A;  2J6O A;  2EYX A;  1WYX A;  2CUD A;  1GCQ C;  2DMO A;  1U3O A;  3A98 A;  2OAW A;  1ZSG A;  4CC4 B;  4A63 B;  2DNU A;  1NG2 A;  1CKB A;  2CRE A;  4F16 A;  2KYM A;  2GGR A;  1GFD A;  3EHQ A;  4J9H A;  4F14 A;  2KRS A;  1JXM A;  1VA7 A;  1AWX A;  2A37 A;  4HVV A;  2K7A A;  1I07 A;  1NEB A;  3ZL7 C;  2J7I A;  5GJW B;  4WCI A;  1HD3 A;  4F17 A;  2K2M A;  2RNA A;  1N5Z A;  2IIM A;  2BZX A;  1Z9Q A;  1JU5 C;  1Z9Z A;  2BZ8 A;  2GTO A;  2JT4 A;  2SRC A;  1X6B A;  3EHR A;  1YNZ A;  3KFV A;  1BB9 A;  3H0F A;  5IHI A;  2PZ1 A;  2HEQ A;  2CH4 W;  4RUG A;  2BZY A;  3EGU A;  1ZLM A;  1KSW A;  1M3C A;  2LP5 A;  1W6X A;  2KR3 A;  3THK A;  1WLP B;  1OOT A;  2FO0 A;  2DBM A;  1J3T A;  3JV3 A;  2ESW A;  4Z8A A;  1AEY A;  2JMA A;  2OJ2 A;  1XOV A;  3ULR B;  2K79 A;  4RTZ A;  1ZBJ A;  2LQW A;  3PVQ A;  1PWT A;  1UEC A;  2DE0 X;  3TSZ A;  1YCS B;  1SRM A;  1NLP C;  2EVR A;  2FPE A;  2JS2 A;  1E7O A;  3NPF A;  4OMM A;  2MCN A;  3R6N A;  3UA7 A;  1PRM C;  5IH2 A;  1CKA A;  1SHG A;  2O9V A;  2AK5 A;  4LUE A;  2V1Q A;  1MV3 A;  2P4R A;  1QWF A;  1K0S A;  4RTV A;  4M4Z A;  1LCK A;  1T0J A;  2DL8 A;  2NWM A;  2A36 A;  1NYG A;  1Y0M A;  2HBW A;  1QCF A;  4ESR A;  2YT6 A;  1W1F A;  1X27 A;  1WDX A;  1QKX A;  2CT4 A;  2L3P A;  4DEY A;  2A08 A;  1HSQ A;  3H0I A;  4RTU A;  2O9S A;  1H92 A;  3C0C A;  2EW3 A;  2OI3 A;  2M0Y A;  2YUO A;  1GFC A;  1FYN A;  2K9G A;  2KGT A;  2EYY A;  1UTI A;  4OMP A;  2LQN A;  1M30 A;  3U23 A;  4JPB W;  3VS5 A;  2LJ0 A;  1I0C A;  1RLP C;  2EGE A;  4HCK A;  2KYB A;  1NLO C;  1X2Q A;  3EG0 A;  4OMN A;  1GCQ A;  1PHT A;  3I35 A;  4JJD A;  2J05 A;  1YWO A;  1AZG B;  1OEB A;  1WI7 A;  1WXT A;  2KE9 A;  2CT3 A;  2KXD A;  4Y92 A;  2C0O A;  1YWP A;  1K9A A;  1U5S A;  1X43 A;  3VS2 A;  4KRT A;  1KIK A;  4JZ3 A;  2H8H A;  4X1V A;  1H3H A;  2ED1 A;  3VRZ A;  1ZUU A;  1PKS A;  2FG0 A;  3QWX X;  1K4U S;  3M0U A;  1A0N B;  4Z89 A;  2B86 A;  4IIM A;  1T3L A;  2ED0 A;  4AG1 C;  2ROL A;  4LUD A;  2FEI A;  5GJV B;  1TUD A;  3EG2 A;  2XMF A;  1UDL A;  4QT7 A;  2C0T A;  1UGV A;  1SHF A;  2NUZ A;  4J9B A;  3VS4 A;  2PTK A;  3M0P A;  1WA7 A;  3I9Q A;  3QWY A;  3FJ5 A;  4GLM A;  2DA9 A;  1T0H A;  2W10 A;  2DM1 A;  2YDL A;  2KRM A;  2ROT A;  2FRY A;  1AVZ C;  2RPN A;  1OPL A;  2KRO A;  1IO6 A;  2DRM A;  4J9E A;  2G6F X;  1ARK A;  1NYF A;  2RQR A;  2L0A A;  3UA6 A;  1AWJ A;  2QDL A;  2KRN A;  2YSQ A;  1BBZ A;  3NGP A;  1JXO A;  3CQT A;  2KBT A;  1RLQ C;  1UFF A;  1AWO A;  1VYT A;  2DLP A;  2JS0 A;  2RN8 A;  2LMJ A;  4K11 A;  2CSI A;  1YP5 A;  4R0K A;  1V1C A;  4OMQ A;  2J06 A;  1BK2 A;  5I11 A;  4ZNX A;  1JEG A;  3VRY A;  3VS7 A;  4JJB A;  2FPD A;  2JTE A;  1B3Q A;  2KXC A;  2V1R A;  4J9F A;  5ECA A;  3TVT A;  2LZ6 B;  2F2W A;  4FSS A;  2CSQ A;  3EG1 A;  1SRL A;  4OML A;  1AWW A;  2LCS A;  2LX7 A;  5L23 A;  2ECZ A;  1PRL C;  2GBQ A;  3TSW A;  2X3X D;  1T3S A;  4RTY A;  2JMC A;  4JZ4 A;  2YUQ A;  1UJY A;  2VKN A;  2AKK A;  4AFQ C;  1ABO A;  2KT1 A;  2AZS A;  3PE0 A;  4JJC A;  2DX1 A;  2W0Z A;  2ABL A;  2J6K A;  4J9C A;  1KFZ A;  3IQL A;  1AZE A;  2FPF A;  4HXJ A;  1UHC A;  1EFN A;  3M0R A;  2ENM A;  4EIK A;  3REB B;  2DL5 A;  5HCK A;  1W70 A;  1PNJ A;  1RI9 A;  1GBQ A;  1GL5 A;  5IXF A;  2RQW A;  4CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...