1S1NA

Sh3 domain of human nephrocystin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
b'TGEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLEPYSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nephrocystin 1
molecule tags Cell adhesion
source organism Homo sapiens
publication title Solution NMR structure of the SH3 domain of human nephrocystin and analysis of a mutation-causing juvenile nephronophthisis.
pubmed doi rcsb
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1s1nA00
2FPEA 1GCQA 1SRLA 2F2VA 1OPLA 1UG1A 2O2OA 4LUEA 2EGEA 2AZVA 1BU1A 2F2XA 2K79A 1SEMA 2BZ8A 1UUEA 1T0HA 1WYXA 1B07A 1U5SA 2G6FX 2C0IA 2XMFA 4JPBW 5GJVB 4IIOA 2MCNA 1SHGA 1M3AA 2EW3A 1AZEA 2HSPA 2KEAA 2DNUA 3TSZA 2K9GA 4F14A 3H0IA 4JJBA 4A63B 2DF6A 4OMLA 3VS3A 1TG0A 4J9IA 2J05A 1YNZA 2J6KA 4JZ4A 2FPDA 1ZSGA 3CQTA 1AWOA 1JQQA 4R0KA 4RTZA 2KRMA 1QWEA 4HCKA 2DRKA 1JEGA 1X2KA 2CDTA 1OEBA 4OMOA 1X2QA 2LX7A 1PHTA 4ESRA 2K2MA 5GJWB 1ABOA 1A0NB 1GBQA 1YWPA 4AG1C 1VYVA 2A37A 2QDLA 5ECAA 2DBKA 1H8KA 2GTOA 1K4US 1X69A 2JS2A 1JXOA 4F16A 4K11A 2J7IA 2CT4A 2RQTA 4D8DA 3TVTA 4CC3A 2YUQA 1UGVA 4J9HA 1PKSA 2PTKA 1SSHA 4Z89A 1PWTA 2L3PA 3ZL7C 1UECA 1AWJA 1VYTA 3RBBB 1I1JA 1AZGB 4F17A 1WXBA 1GBRA 1CSKA 1GFCA 3VRYA 4J9CA 2KBTA 2LMJA 4D8KA 2YUNA 1RI9A 4LE9A 1JXMA 2MOXA 2LJ3A 4RTWA 4RTVA 3SHWA 2DX1A 1PKTA 4JJCA 2YSQA 2BTTA 4AFSC 1SHFA 2EYYA 2DBMA 2DL5A 2GGRA 1UHCA 1NEGA 3EHRA 4DEXA 1QKWA 2CH4A 1B3QA 1CKBA 2EBPA 4AG2C 2SRCA 2CT3A 2ED1A 3M0QA 2JMAA 2HDAA 1K76A 2RMOA 4CC7A 4CC4B 2LCSA 1E6HA 2AK5A 2YUPA 2H8HA 2ROTA 3QWYA 3LH5A 2KXDA 1I0CA 2NUZA 2P4RA 1W1FA 4FSSA 4ZNXA 1ABQA 2HBWA 2DL8A 3EG1A 3I35A 2V1RA 2EGCA 5IHNA 3UATA 4J9FA 1UE9A 2GNCA 4GBQA 1IO6A 1NLPC 3PVQA 4EIKA 1GFDA 2HCKA 2RN8A 2MIOA 3QWXX 2M0YA 3R6NA 3VS2A 2OAWA 5FWCA 2DRMA 1GL5A 3C0CA 2LJ0A 1KFZA 2DM1A 1UJYA 2KT1A 1AD5A 4Y92A 2YDLA 4JJDA 2RQWA 3SEMA 2VKNA 2JM9A 1J3TA 2F2WA 2GQIA 1RUWA 1AWXA 1NM7A 1ZUKA 1T3SA 2ENMA 2EYXA 1JO8A 2EKHA 1WI7A 4ORZA 1QWFA 1Y0MA 3JV3A 1MV3A 4X1VA 3I9QA 1BK2A 1GCQC 2DE0X 5I22A 1U06A 4QT7A 2CREA 2FRYA 1TUDA 1N5ZA 2M51A 2GTJA 1X27A 2D0NA 2K7AA 2ABLA 2FRWA 4Z8AA 3FJ5A 5IH2A 2O9VA 1GCPA 1UTIA 1XOVA 1Z9ZA 4J9DA 4J9BA 2JS0A 1WA7A 1KSWA 1AOJA 3M0RA 3TSWA 2EYZA 1AWWA 2BZYA 3VS7A 2ED0A 1UHFA 4IIMA 1W6XA 2A08A 2EPDA 5FWBA 1LCKA 3VS4A 1MUZA 1OOTA 2LP5A 1WIEA 2JM8A 2DYBA 1SPKA 1MV0B 4J9GA 2KRSA 4J9EA 1X6BA 2PZ1A 2RQUA 1UJ0A 3VS5A 4OMPA 1OPKA 1AVZC 3GBQA 4JZ3A 2D1XA 2L3SA 2DL3A 2KE9A 2GBQA 3UF4A 2W10A 2I0NA 2FG0A 2J06A 2KYMA 1HD3A 2KR3A 4RTTA 3H0HA 1I07A 4RUGA 2DILA 3ULRB 2CH4W 4GLMA 1E7OA 1WLPB 3A98A 3NMZC 1NG2A 1H3HA 4CC2A 1WXUA 3VS6A 1QCFA 2DMOA 2O31A 4DEYA 2ESWA 2V1QA 2K3BA 2LQNA 2LZ6B 4OMMA 2SEMA 2D8HA 1FMKA 1VYUA 3U23A 1FYNA 1Y57A 1ZUYA 3UA7A 1M30A 4LUDA 1H92A 1ZUUA 3VRZA 2L2PA 2RQRA 1HSQA 5IXBA 1KIKA 2OI3A 2EYWA 1ZX6A 2JMCA 1YP5A 2KYBA 2RQVA 4OMNA 2DL4A 1BBZA 2DJQA 4Z88A 3RNJA 3EGUA 1S1NA 2EVRA 1YN8A 1Z9QA 2JXBA 3M0UA 5IHIA 3M0PA 1ZLMA 4LNPA 4M4ZA 1QKXA 4LN2A 3VS1A 1BB9A 1U3OA 1PNJA 2CSIA 2DL7A 4RTXA 1TUCA 1RLPC 4AFUC 3THKA 1PRMC 3VS0A 2CSQA 2LQWA 1ZBJA 2VVKA 1YWOA 1GRIA 4E6RA 2KRNA 1G2BA 2IIMA 2X3WD 1HJDA 2RNAA 1NYGA 2YT6A 1QLYA 3REBB 2C0OA 4RTUA 2E5KA 3I5RA 4HVUA 3NHNA 2L3QA 2PNIA 3EG3A 5IXFA 3I5SA 2KXCA 1NEBA 2VWFA 4KRTA 3M0TA 5L23A 1E6GA 2DVJA 2FPFA 2W0ZA 1K0XA 2X3XD 1EFNA 2ECZA 1KJWA 2FO0A 3O5ZA 2AKKA 3EG0A 1M3BA 1OV3A 2KT8A 1K1ZA 1WFWA 2JTEA 2KGTA 2A28A 5FW9A 2J6OA 2EQIA 1PRLC 2AKLA 2O88A 2D8JA 1K0SA 4HVVA 2K6DA 1WXTA 4AFZC 2JT4A 2KROA 5HCKA 1UFFA 2BZXA 2J6FA 5IHKA 1WX6A 1M27C 2DLPA 1UDLA 1JU5C 2A36A 2RPNA 3PE0A 2C0TA 3EHQA 3KFVA 4HXJA 2NWMA 1RLQC 2CUBA 1M3CA 3NPFA 3M0SA 1T0JA 1YCSB 2B86A 4HVWA 2LJ1A 1X6GA 2JW4A 2LNHB 4OMQA 2HEQA 4RTYA 3EG2A 5EC7A 1WDXA 1X43A 3NGPA 1M8MA 3H41A 1AEYA 2AZSA 1NLOC 3H0FA 4AFQC 5I11A 2L0AA 3REAB 1ARKA 2KNBB 1T3LA 1CKAA 3PVLA 1VA7A 3UA6A 1NYFA 2FEIA 1V1CA 1G83A 2CUDA 2O9SA 1K9AA 2OJ2A 2DA9A 2ROLA 1SRMA 3IQLA 2YUOA 4WCIA 1W70A 2EGAA 2RF0A
chains in the Genus database with same CATH superfamily
3JB9D 1GCQA 1Q7YU 2R5AA 1YCYA 2DTOA 4F7UB 2O2OA 2AZVA 1BU1A 1SEMA 2FZGB 1UUEA 4XTZA 1D3BA 1T0HA 1B07A 1RADB 3JCMW 2DVEA 2DZCA 2C0IA 4JPBW 2BE9B 3G4ST 3E2UA 4M75A 5FU6B 1VQ7T 4ELZC 1D0XA 2LT4A 2Z0WA 2WACA 1FWZA 3TSZA 2CKKA 5GAMg 2XDPA 3H0IA 4A63B 2DF6A 1YBYA 4EDUA 4M7DA 5GMKj 3URGA 4J9IA 2RH2A 1W4SA 5GMKm 3V8JA 4XTWA 1YNZA 4RCCA 5GMKe 1YJ9A 3X20B 4JS4A 3CCRT 4OB2B 2DZ9A 2V26A 2DRKA 2XK0A 3OMCA 1D1AA 4FIBA 1OEBA 4OMOA 1BI0A 2DETA 3JCMV 2ZPEB 4BDYA 1YWPA 4ZTJA 2QASA 1VQ7Q 4KT0E 1QVGP 1Q81R 1N8RR 1H8KA 1RAIB 1X69A 2OTJA 2CT4A 3TVTA 5GAN7 4CC3A 2YUQA 1VQOT 1PSEA 3M55A 4C5GA 4E7KA 1AWJA 1VYTA 4NL2A 2E4HA 1I1JA 3CMEQ 4F17A 1Q7YR 1YFNA 4C0DB 3G6EA 2RB6A 2LMJA 4KULA 1VQOQ 1M1KU 1RI9A 4LE9A 4IUPA 4RTWA 1SKUB 4M7DG 3BY7A 2IVWA 2DBMA 3VYHB 1TS9A 1UGPB 1WHGA 3MEVA 3PMTA 1B3QA 4XK8E 2ED1A 2C06A 4KH0B 4CC7A 3G7ZA 2ZPFB 1WQ7A 1ZSZA 1Y71A 3L1AA 5GMKi 2GFUA 3CCUA 3G4SA 3RKWA 1WJRA 4DBFA 1ABQA 2HBWA 3OYEA 4EMKA 2ZCFB 3I35A 4M7AG 4LDWA 4J9FA 4PJMA 1BIAA 4X9CA 5GAMj 3CPWS 2KI7A 3FIFA 3BDUA 3V7SA 2KVQG 4E7JA 3C4SA 4J5YA 1GL5A 1OULA 3C0CA 2L3RA 4DOVA 1KFZA 2DM1A 4Y92A 3OMGA 1J3TA 4PJOD 1EIFA 2F2WA 2GQIA 3CC7A 5KYXB 3H6ZA 5KYWA 2VB6A 5CKDA 1WHKA 2EKHA 1WI7A 4JJNK 2LX9A 1N8RU 3M4GA 1MV3A 3I9QA 1GCQC 2CREA 2ZAEA 3CD6A 3CCEQ 1OYXA 2M51A 4BDZA 3WVDB 1D0YA 1K73C 2ABLA 3ASKA 5GANe 4QVCA 2L8DA 4Y28E 4C92B 4F7UG 1O75A 3JRZA 2VGNA 4J9DA 4J9BA 5LJ5h 2JS0A 1WA7A 1KSWA 4GY5A 4A53A 4EMKC 1AWWA 4N4HA 2ED0A 1VOMA 5KYYB 4FT2A 5FWBA 4JDSA 3HSBA 1LCKA 2LP5A 3MEUA 2P0QA 2JM8A 3CD6T 3TU4K 4J83A 3CCVA 2LRQA 2HQXA 4MDWA 4E47A 4IUVA 1SG5A 3NFCA 3VS5A 3OS5A 2PUOB 2RO0A 1AVZC 3RERA 3GBQA 5D7UA 2FB7A 2GBQA 4A4GA 2X4XA 3H0HA 3ULRB 3CCMA 3E19A 5KCOA 1K9MC 3G1JA 1WLPB 3LWIA 4PNOA 4CC2A 1WXUA 3VS6A 1Q82U 2QEXA 2V1QA 2K3BA 3M53A 3H8ZA 4HCZA 3X25B 2CP2A 4PJLA 3UA7A 2F1LA 1VQ6T 3BDLA 2XIDA 3L2RA 4C8QD 3SWNC 4AT1B 1KIKA 1YP5A 2DL4A 3OYYA 4XTXA 2DJQA 4Z88A 2KSSA 5CVIA 1TWBA 4BUGA 1Z9QA 3LLRA 3M0UA 3M0PA 1ZLMA 4M4ZA 1AT1B 5KYWB 1VQMA 1FMWA 1WHJA 2DD5A 1IXDA 4JRIA 3CCRQ 4RTXA 3CC4A 4QW2A 4EMKB 1PRMC 3EAEA 2LQWA 1M1KC 2VVKA 4XU1A 3VKIA 1HJDA 3CPFA 3O8VA 4M7DC 3REBB 2C0OA 4C8QG 2E5KA 2MK5A 4J6WA 3EFRA 4MZTA 4C5IA 1NEBA 1I81A 4QQ6A 1IZ6A 5L23A 2EQKA 3CEYA 4C5HA 2DAQA 1B7TA 3OW2P 1OZ2A 2EJFA 2ECZA 1KJWA 3L2VA 3EG0A 1M3BA 4NL3A 3L2UA 1N9SA 1OV3A 2KT8A 4JRKA 3ZEHA 2JTEA 2QQAA 2A28A 2J6OA 5IAYA 4QQDA 1W2BS 3KBGA 1K9MU 4M77B 2OTLA 4AFZC 2LC4A 1VQKA 2JT4A 1LJOA 1UFFA 2EFIA 2ZPIB 2J6FA 3SB2A 4KUDK 2A36A 2ATCB 2VGMA 3EHQA 2NWMA 1RLQC 1VQ6A 3M0SA 2WSEE 1YJNT 3JCMc 2M9UA 3GNGA 4HVWA 4M78C 2HEQA 1WDXA 4M77C 2K3YA 1AEYA 2QDYB 4HCCA 2DO3A 1T3LA 1PSFA 3JCMQ 1BI1A 2EJ9A 3RR6A 3EFOB 3EFOA 4NS5A 1M1FA 1XQHA 5DY9A 1V1CA 1G83A 4C8QB 4LDVA 5LJ3e 3UWNA 1VQ8Q 1QP3A 2OJ2A 2ROLA 3C95A 4M78B 1YJNA 3IQLA 3CMEA 3MCAB 1W70A 2L5QA 3I5RA 2L89A 3OYNA 2OTJQ 5C0MA 1OPLA 1YIJT 1IHWA 4ELYC 5J3BA 3QZ5B 4M78D 2F2XA 2K79A 1UB4A 2MAMA 1LNXA 1U1SA 1NE8A 5LJ3f 4C92C 1WYXA 2AHJB 1BI3A 4XU3A 3M5AA 1D1CA 4A4FA 2MCNA 2PQWA 1M3AA 2XU8A 4M7AB 1KD1U 1AZEA 2H3JA 5GAN8 2LQ8A 3VU3C 2COYA 1WPYA 4F14A 3D7SB 1Q82C 2E64A 4OMLA 4E7SA 4KGZB 5GAMh 1YHQT 3F70A 1FXXA 2DXUA 2NUTB 4CRIA 1RAAB 1EZZB 2J6KA 1ZSZC 4JZ4A 2FPDA 3INZA 5CIUA 4C92D 3QIIA 1Q7YC 1AWOA 4R0KA 3SFMA 1WQWA 3MKDA 2KRMA 1QWEA 4HCKA 4F7UE 4IUTA 4B6MA 1JEGA 1QVFP 3VV0A 1XNIA 3JB9G 2EQUA 1A0NB 2GCXA 1YHQQ 1QVGA 2HQHA 3PIOA 1M90U 4AG1C 4JRQA 2QDLA 3TEEA 4MZPA 2DBKA 3ER0A 2YHTA 1X75C 4PJOA 3PMIA 1UGRB 4PL6A 5KYXA 5GANh 1K4US 4C8QC 4F16A 4ATOA 2J7IA 4PJOE 5GAN6 1UGVA 2PTKA 1PWTA 5LJ5j 1YI2Q 1K8AC 2K4YA 4JLGA 1WXBA 2E3IA 1F1BB 1GBRA 3VRYA 5C6SA 4J9CA 3VJPA 2QEXT 3DB4A 1JXMA 2LJ3A 3M4YA 1VQPA 1PKTA 5KE2A 4AFSC 1ZHIA 4P5NA 1SHFA 2FHDA 2GGRA 2COWA 2O4XA 3QZ9B 1NEGA 3EHRA 4DEXA 5A0GA 3OYGA 1CKBA 1VQKT 4AG2C 4XU0A 5CKHA 1VQ9Q 4ME7A 3M0QA 1WHMA 2QI2A 1E6HA 1WHLA 2AK5A 1VQLT 4BE1A 2ROTA 3QWYA 3LH5A 1VQ9T 3G6ET 2NUZA 1D09B 2DXTA 4CI0C 1NPRA 4FSSA 4A4EA 2XICA 4C5EA 3CC2A 3EG1A 1X01A 3CPWA 2V8IA 3CCMQ 3EFSA 3UATA 1QW1A 5IHNA 3OYJA 2PU9B 3I56T 1UE9A 2COZA 4ZTFA 1KK7A 4J8OA 2HCKA 2QEXQ 2M0YA 1RAGB 1Y07A 2RHYA 2QA4Q 2QQBA 2YRVA 2OAWA 2HAXA 1EX4A 1UJYA 5I2SA 1ZQ1A 2PVDB 4JJDA 4QVDA 2P0KA 2VKNA 4M77G 2EYQA 3OW2S 4FYWB 1NM7A 4RCBA 2NLUA 2M16A 5LL6S 2ENMA 1S72Q 1JO8A 4ORZA 2KQWA 3A8MB 4X1VA 3QPHA 2RA2A 4QT7A 3GOXA 2FRYA 1TUDA 1JJ2P 2GTJA 2D0NA 5KYUB 1O9SA 4Z8AA 2O9VA 1YJ9T 1V29B 5D6YA 2X4JA 3RKXA 4DBHA 1SSFA 2DTHA 2RJDA 2DD4A 1WGSA 2A08A 3VUBA 5FU7C 3G71T 1WIEA 2HKNA 1OI1A 2EAYA 2DYBA 1MV0B 4J9GA 2KRSA 4C0DC 4RG2A 4HKEA 4QVZA 2PZ1A 2MMPA 3CBPA 4M7AA 3CXCS 3A1PA 1UJ0A 2QYZA 1OQKA 4PJOB 5CK9A 4JZ3A 4FW1A 2DL3A 3H9NA 5GAOn 2DXCA 1WJSA 2KAFA 3UF4A 1RAFB 3CCEA 2KYMA 4PJJA 4C0ZA 1I07A 2NUPA 4BI8B 3X28B 3GIBA 5HK0A 1QCFA 3OYMA 2O31A 4DEYA 1Q81C 2ESWA 4C92E 5FLXE 2LZ6B 3A8LB 2OTLQ 1YIJQ 2D8HA 1D1BA 1FMKA 1VYUA 3U23A 1QQJA 1LVKA 4V2SA 3CCLQ 1RABB 3OA6A 1H92A 3VRZA 1YITT 2RD1A 3HFNA 3GF5A 3JCMf 1HSQA 5IXBA 3P8BB 2JMCA 2KYBA 3JB9F 4N4IA 2JZ2A 3CCST 1NZ9A 1S1NA 1Q95G 3E1SA 2ZPGB 1YN8A 3GLXA 1VQ8T 5IHIA 1XTDA 5GAMe 4LN2A 3PGGA 1G3TA 3VS1A 1KHIA 1K9MR 1VQ5Q 3JB9H 2DK3A 4M77A 4JS5A 1K8AU 1U3OA 2CSIA 2DL7A 4E7IA 4XTUA 1TUCA 2RHIA 4R56A 3CMAT 3CC2T 1OX8A 2CSQA 2EQMA 1RAHB 1U1TA 1QCNA 1WHHA 5CKEA 1NYGA 4RKUE 2P84A 1M90R 2A7YA 3S3OA 3MP1A 5KYYA 2DEQA 2L3QA 3EG3A 5IXFA 2BE7D 1ZA1B 2X4WA 2VWFA 2VUBA 2IG0A 5KCHA 1E6GA 2LTOA 4N4GA 4OVAA 2DYIA 1EFNA 3E9FA 3OW2A 1S72A 3JSCA 3O5ZA 4OMFB 1PM3A 2M02A 4PK4A 2AKKA 1K1ZA 2KGTA 2YLBA 2H3EB 3SD4A 3CCET 2D8JA 3EGXB 4FYYB 1LOJA 3EGXA 4OGCA 3M59A 1WXTA 5GANj 3MEWA 3CXCP 3OS0A 5HCKA 1YJWT 1MNDA 2BZXA 1Y7XA 3OY9A 5FRNA 5IHKA 1IGQA 3AT1B 1RAEB 3HPWA 3KUFA 4J7FA 1VQPT 5CQYA 3PE0A 2C0TA 3KFVA 2CUBA 4A4HA 2CZ1B 3CCMT 1K73U 1T0JA 1G3YA 1I5OB 3CMAQ 4OMQA 3EG2A 4LD6A 2HKQB 3H41A 5IT9E 2RHZA 1M4ZA 1UEBA 2L0AA 3REAB 4F04B 3CCQT 3EG9A 1TSFA 3PVLA 5CKBA 1NYFA 4J6YA 3CCSQ 4OB0B 2FEIA 3S3MA 2O9SA 3QJ6A 5KYUA 3ZFJA 5GANf 2QQRA 2DA9A 1SRMA 2EWNA 4M75E 2X4YA 4BE0A 4OF1A 2NUPB 2EQJA 2YUOA 3MP8A 2RK1A 2FPEA 1SRLA 2VXFA 3C94A 2E12A 4LUEA 2EGEA 5HY6A 1YI2T 1KQSS 1BI2A 4L5GA 2BZ8A 4GLKA 3HHTB 4EMHA 1KD1C 1YI2A 3QKJA 5GAN2 3JCMP 3JCMb 1U5SA 2G6FX 1TU0B 1VQMT 1NJIR 1RACB 1VUBA 5GJVB 4LDYA 1N9RA 4KUIA 1SHGA 2EW3A 4M7AC 3A5ZB 1W2BP 3JCMX 4BD3A 3TQ7P 2K9GA 5CO7A 1HYOA 1VQ9A 2MPXC 4C92G 1JRIA 4ZN3A 2CS7A 4C8QE 3QDFA 4HT8A 2DPPB 1YJNQ 2AIRB 4M78E 2M0OA 1TH7A 3CQTA 1FX7A 3LGFA 1JQQA 1IREB 2CZ7B 4RTZA 5HK3A 3NTKA 1PG5B 5FU6C 3OYKA 4PFPA 4XU2A 5DLOA 1X2KA 2CDTA 2QK0A 2E1HA 2RM4A 2K2MA 5GJWB 1ABOA 1Q86U 3CCQA 2RJEA 1KC8R 3EGDA 4LDXA 5J26A 1K8AR 2A37A 2I2LA 1PD1A 5ECAA 5KH6A 2K5LA 3FEOA 3P8DA 4QQGA 1JXOA 4K11A 1KQ2A 5J39A 2RQTA 5CCAA 4PKCC 4D8DA 4M78G 3LWHA 3CCVT 1WZOA 2Y4YA 4J9HA 5I2MA 2DEUA 3LX7A 2L3PA 2QA4T 1QVFS 2YWWA 3RBBB 1B34A 3P8HA 2K5IA 3RMSA 2RI2A 5CR2A 2HL5C 3OS1A 2XD0A 2KBTA 3FDRA 5LJ5d 2KMTA 2RK2A 3OSSC 2DX1A 3CMAA 4E7HA 2LVMA 4JJCA 2XI9A 3PNWC 1Q82R 5L8RE 2EYYA 2DL5A 3EG9B 1M2OA 2XDDA 1AHJB 1R0CB 5GAOr 5LJ3j 2EBPA 2FZCB 3S6WA 4WTOB 2SRCA 2JMAA 2HDAA 1K76A 2RMOA 3CCSA 2LCSA 1VQNT 2DIQA 1VIEA 2KXDA 4M75B 1I0CA 1LPLA 1W1FA 2QQSA 4C8QF 4ZNXA 2IPOB 1PD0A 3CPWP 1VQ4Q 2V1RA 4GBQA 2R5MA 1IO6A 1NLPC 3PVQA 2DFUA 3C12A 2CGHA 2CP0A 4M7DB 4F7UA 3QWXX 3BFMA 2V8KA 2NYSA 5M9OA 4BACA 3OS2A 2VYTA 3N5BB 2PUKB 2LJ0A 3M58A 2YDLA 2RQWA 3QBYA 2DJZA 1VQMQ 5LJ3d 1RUWA 3GP8A 4B9WA 3ME9A 2ZZDA 1T3SA 3CC4T 3CCRA 3JAME 2CYZB 4E2FB 2P0PA 1BK2A 3V8LA 2CP5A 5I22A 1U06A 1IGUA 3GPLA 2VV5A 2HNIA 4M7AF 3A8HB 2HQEA 1X27A 4M77D 2K7AA 1C6VX 3CXCA 1RL2A 3SDZA 1UTIA 3QYHB 3JCMg 2CP7A 2GF7A 5FRMA 2QTVA 2LQKA 4PJOF 4PJNA 1Z9ZA 4FL6A 4M75F 7AT1B 1VQ5A 3M0RA 3HKSA 2CP3A 4OP0A 4E7ZA 2EYZA 2BZYA 1UHFA 1IB8A 4XTVA 3OQ5A 5GAMf 5HKCA 3J81E 3DLLA 1G3WA 1OOTA 2KDSA 5D6WA 3BW1A 1OU9A 1BKBA 5GMKl 3BE3A 3OYIA 1TUGB 4M7DF 3RKYA 5KE3A 2YXYA 2QQ9A 3HTRA 5AYFA 1M1GA 2RQUA 4HT9A 5CAIA 1WNLA 4OMPA 1OPKA 1U8RA 2D1XA 2L3SA 1YITQ 2KE9A 1QP2A 2FG0A 4A4KA 2J06A 2KR3A 3MHXA 4RTTA 2DERA 2O01E 4RUGA 5GANg 2JNGA 2K57A 4KH1B 2OTLT 1E7OA 3A98A 3NMZC 1NG2A 2JUFA 1V76A 4M7AD 1BIBA 5CQXA 2LQNA 1GXIE 1KQSP 1XJWB 3CCVQ 1ZA2B 3HFOA 4NOYA 1N27A 3VUZA 1ZUYA 1M30A 4LUDA 1ZUUA 5LJ3h 2L2PA 2WSCE 2D0QB 3CBOA 2ZPHB 2RJFA 2OI3A 2EYWA 2RQVA 3M9QA 1X6OA 1RI0A 3RNJA 1VQ8A 5IN1A 3QG1A 1M1KR 1W2BA 3LW5E 3I55Q 3PIPA 3CCJA 2A3LA 2K2VA 2NUTA 3TCJA 2VC8A 1BB9A 1I8FA 1PNJA 1VQ4A 1RLPC 1IHVA 2GQVA 1BCOA 4MMLA 3I56A 1G3SA 3VS0A 1ZBJA 1MMAA 2MF2A 3UDCA 1VQ5T 2KRNA 1G2BA 4OB1B 5DM7R 3KXTA 1KC8C 2X3WD 2RNAA 5LJ5e 2F5KA 3META 4JUVA 4ZGEB 2K5FA 5GMKh 1KQ1A 4XTYA 4HVUA 4BI4A 3NHNA 1YIJA 2PNIA 1OX9A 3V8KA 4IUUA 4IUQA 2EIFA 1UGSB 2DVJA 2FPFA 2W0ZA 2R58A 2OAUA 1K0XA 2X3XD 1M9SA 2F5TX 2FO0A 3LGLA 5GAN4 4ZN1A 3RESA 3FJPA 5FW9A 2EQIA 1PRLC 4KGXB 2O88A 4C92A 4XAXB 3PTAA 1KD1R 2K6DA 3HP9A 1HK9A 1R77A 1WX6A 2DLPA 4X9DA 1UDLA 5GAOq 5GAN5 2P4TA 2XKOC 1Q86R 1M3CA 3NPFA 3QUIA 5DLQE 1D3BB 2JW4A 4JRPA 2O4XB 5EC7A 3CCQQ 3L2ZA 1JB0E 2FZKB 2AZSA 2KY9A 1NLOC 2CZ6B 2ZPBB 4M7DE 4AFQC 1VQKQ 8AT1B 1CKAA 1OU8A 4FW2A 3UA6A 3PT9A 2YLCA 1YITA 4D6WA 2LCCA 4M78A 3OYBA 1R8OB 3L42A 5GAN3 4II1A 3E9GA 1K9AA 3HRTA 1M8VA 5GAOp 1VQ6Q 2BKDN 4VUBA 3I55T 2FYKA 3JB9J 1VQNA 2VXEA 2CP6A 3FC3A 3AHUA 2F2VA 4L59A 1UG1A 4LXCA 2E41A 3CC4Q 4M7AE 1PC0A 6AT1B 1ACMB 1SF9A 4FT4A 2YRCA 4BY6C 2Y4XA 3OSVA 2PVGB 2DKGA 2XMFA 3QXEB 3WXMB 3DKMA 4C0GA 1ZBXA 4IIOA 4KGVB 3MJXA 2JJ9A 4Z02A 3L2WA 2HSPA 2KEAA 2DNUA 3JCMJ 4FCYA 1Y96B 3EH2A 1VQ4T 3MO8A 4A54A 3I56Q 4JJBA 1MMDA 3VS3A 1TG0A 2Y90A 4N0AC 2DTIA 2HBPA 2J05A 3GNFB 3FLGA 2WSFE 3ZBDA 3EH1A 3G6EQ 3RDVA 2X35A 3RIRA 1ZSGA 4RMOA 5A2QE 4BE2A 3QJYA 3QSUA 3M57A 3OB9A 2BUDA 1X2QA 1MHNA 4FU6A 4J7IA 2LX7A 3G71A 1PHTA 4ESRA 3CCLT 4O5VA 1GBQA 2PVOB 4J6XA 2XG8D 1G5VA 1VYVA 2E70A 1VIFA 2XHCA 2OX7A 2GTOA 1M2VB 1QCOA 2F69A 1ZSZB 2JS2A 4PFZA 3JCMh 4ZGJB 3RUXA 1PKSA 1Q86C 1SSHA 3JCMe 4Z89A 3ZL7C 1UECA 4C8QA 1TOVA 4FYXB 1JJ2A 1AZGB 4ZGDB 2E6ZA 1CSKA 1GFCA 1KQSA 3CBMA 4D8KA 2YUNA 4B9XA 3CC2Q 3OYFA 2MOXA 1KG1A 4RTVA 3SHWA 4DBRA 1TTHB 1M5Q1 4PLIA 2YSQA 5GANd 2BTTA 4X34A 2MYSA 3V7CA 2A0FB 3OYAA 3CC7Q 5GAOl 1UHCA 5FU7B 1QKWA 2CH4A 1QVFA 3UT1A 2VASA 4PJOG 2CT3A 2QA4A 3TREA 4M75G 4CC4B 2LNVA 1NPPA 2YUPA 3CD6Q 2H8HA 2EJGA 2P4RA 1P92A 3R6OA 2JN0A 1G8XA 4L6V5 5GAMd 4QKUA 4MZMA 2DL8A 1PCXA 4C92F 2HSEB 1VQNQ 2EKOA 2EGCA 9ATCB 1YJ9Q 2GNCA 4EIKA 1GFDA 2MWPA 2RN8A 1BYMA 2MIOA 3R6NA 2DIGA 3HRSA 4AMCA 2D6FA 4OB3B 4Q5WA 4C0FA 3OYCA 3VS2A 3JCMd 3QHSA 5FWCA 2DRMA 2LDMA 2KT1A 1AD5A 2YRDA 2MWOA 3SEMA 4BB7A 2JM9A 1S72T 4BY6B 2QXFA 1KC8U 4IKFA 1AWXA 2XDBA 2B8AA 1ZUKA 4EPCA 2GFAA 4PFOA 2EYXA 3I55A 1QWFA 1Y0MA 3JV3A 1VQ7A 2RHUA 2CZ0B 2DE0X 4E7LA 5AT1B 1N5ZA 5LJ3g 4O6JA 3CCJQ 3X26B 1NJIC 1YHQA 2FRWA 3LH0A 3QDRB 1M2VA 1UGQB 3FJ5A 2E6NA 5IH2A 1M90C 1GCPA 1JJ2S 1B34B 1XOVA 5LJ5f 2HZYA 1NBEB 1R0BG 1D0ZA 2D9TA 1AOJA 1VQLQ 1HXDA 2RJCA 3TSWA 3HRUA 3SWNB 4Y91A 2V8JA 1Q81U 4LD9K 3VS7A 4IIMA 4DBQA 3S3NA 3FRNA 1W6XA 2EPDA 4N0AA 1H641 3VS4A 1MUZA 1I4K1 3MP6A 2FL7A 3DB3A 2ZGWA 3V7RA 1SPKA 2JOYA 5A0LA 3QO3A 3UPUA 4FSXA 4J9EA 1X6BA 1IRXA 4MMKA 1VQPQ 4TVRA 3CCLA 2LCLA 1QVPA 5I21A 2HMAA 2HL3A 2QGFB 2E10A 5KYNA 1YJWQ 3G4SQ 2W10A 2I0NA 5GAOm 2X51A 3Q1JA 1HD3A 1MGQA 2DILA 3A8GB 2CH4W 4GLMA 4UC4A 3OYLA 3DLMA 1H3HA 4M7DD 5LJ5g 4EMGA 2KK4A 3CMET 2DMOA 4FM4B 2R57A 4OMMA 2SEMA 3J7AF 1FYNA 1Y57A 2DXBA 2RI3A 2RQRA 4PJOC 4M75D 1MMNA 1ZX6A 3HL8A 4OMNA 4F7UF 2JTFA 1BBZA 3OYDA 3NTHA 3EGUA 3MPUB 3JB9I 3OYHA 2EVRA 2JVVA 2X9HA 2AT1B 2JXBA 4DA4A 4RG8A 4OGEA 3M54A 4LNPA 4M77E 3CCUT 1QKXA 2E3HA 2M1HA 4PLLA 2LT1A 4AFUC 1H3ZA 3THKA 4LDUA 2QGGA 2QTXA 3T9NA 1YWOA 1GRIA 4E6RA 2IIMA 4KBMB 2QAZA 5EG2A 2YT6A 1FMVA 1QLYA 4RTUA 4HA8A 4R55A 3RMQA 4JLIA 3QYGB 3MEAA 3I5SA 2KXCA 4KRTA 3SWNA 3M0TA 4M77F 3CCJT 3OBWA 3L2QA 3M56A 3EGDB 4M75C 3VYGA 1N6AA 3PFSA 1KHCA 4DOWA 1DJ7B 1WFWA 4BI3A 2OTJT 2QG9B 2AKLA 1K0SA 2E5QA 4HVVA 2G3RA 2RI5A 4M78F 1BCMA 1C0MA 1TXQA 2KROA 2K3XA 2FVUA 4WF2A 5CKFA 1VQLA 4YTLA 1M27C 1JU5C 2HD0A 2RPNA 1WJQA 4XQ3A 1QMCA 4ANJA 2E65A 4HXJA 3A8OB 3LYIA 4FYVB 3X24B 1VQOA 4HCBA 3J80E 1JBMA 2BIVA 1YCSB 1K73R 2B86A 1QVGS 8ATCB 5A0DA 2LJ1A 1X6GA 2LNHB 3G71Q 4RTYA 1OZ3A 1X43A 4MDXA 3NGPA 1N8RC 1M8MA 3CCUQ 3WVEB 3H0FA 5I11A 2JTMA 1ARKA 2KNBB 1VA7A 3FB9A 1YJWA 1Y96A 1MNEA 1C1AA 2CUDA 4DQ2A 3CC7T 5D6XA 2RHXA 1I5LA 5FROA 2MI6A 1NJIU 3OBYA 1MMGA 4WCIA 3NTIA 2EGAA 2RF0A 4IURA
chains in the Genus database with same CATH topology
2FPEA 1GCQA 1SRLA 2F2VA 1OPLA 1UG1A 2O2OA 4LUEA 2EGEA 2AZVA 1BU1A 2F2XA 2K79A 1SEMA 2BZ8A 1UUEA 1T0HA 1WYXA 1B07A 1U5SA 2G6FX 2C0IA 2XMFA 4JPBW 5GJVB 4IIOA 2MCNA 1SHGA 1M3AA 2EW3A 1AZEA 2HSPA 2KEAA 2DNUA 3TSZA 2K9GA 4F14A 3H0IA 4JJBA 4A63B 2DF6A 4OMLA 3VS3A 1TG0A 4J9IA 2J05A 1YNZA 2J6KA 4JZ4A 2FPDA 1ZSGA 3CQTA 1AWOA 1JQQA 4R0KA 4RTZA 2KRMA 1QWEA 4HCKA 2DRKA 1JEGA 1X2KA 2CDTA 1OEBA 4OMOA 1X2QA 2LX7A 1PHTA 4ESRA 2K2MA 5GJWB 1ABOA 1A0NB 1GBQA 1YWPA 4AG1C 1VYVA 2A37A 2QDLA 5ECAA 2DBKA 1H8KA 2GTOA 1K4US 1X69A 2JS2A 1JXOA 4F16A 4K11A 2J7IA 2CT4A 2RQTA 4D8DA 3TVTA 4CC3A 2YUQA 1UGVA 4J9HA 1PKSA 2PTKA 1SSHA 4Z89A 1PWTA 2L3PA 3ZL7C 1UECA 1AWJA 1VYTA 3RBBB 1I1JA 1AZGB 4F17A 1WXBA 1GBRA 1CSKA 1GFCA 3VRYA 4J9CA 2KBTA 2LMJA 4D8KA 2YUNA 1RI9A 4LE9A 1JXMA 2MOXA 2LJ3A 4RTWA 4RTVA 3SHWA 2DX1A 1PKTA 4JJCA 2YSQA 2BTTA 4AFSC 1SHFA 2EYYA 2DBMA 2DL5A 2GGRA 1UHCA 1NEGA 3EHRA 4DEXA 1QKWA 2CH4A 1B3QA 1CKBA 2EBPA 4AG2C 2SRCA 2CT3A 2ED1A 3M0QA 2JMAA 2HDAA 1K76A 2RMOA 4CC7A 4CC4B 2LCSA 1E6HA 2AK5A 2YUPA 2H8HA 2ROTA 3QWYA 3LH5A 2KXDA 1I0CA 2NUZA 2P4RA 1W1FA 4FSSA 4ZNXA 1ABQA 2HBWA 2DL8A 3EG1A 3I35A 2V1RA 2EGCA 5IHNA 3UATA 4J9FA 1UE9A 2GNCA 4GBQA 1IO6A 1NLPC 3PVQA 4EIKA 1GFDA 2HCKA 2RN8A 2MIOA 3QWXX 2M0YA 3R6NA 3VS2A 2OAWA 5FWCA 2DRMA 1GL5A 3C0CA 2LJ0A 1KFZA 2DM1A 1UJYA 2KT1A 1AD5A 4Y92A 2YDLA 4JJDA 2RQWA 3SEMA 2VKNA 2JM9A 1J3TA 2F2WA 2GQIA 1RUWA 1AWXA 1NM7A 1ZUKA 1T3SA 2ENMA 2EYXA 1JO8A 2EKHA 1WI7A 4ORZA 1QWFA 1Y0MA 3JV3A 1MV3A 4X1VA 3I9QA 1BK2A 1GCQC 2DE0X 5I22A 1U06A 4QT7A 2CREA 2FRYA 1TUDA 1N5ZA 2M51A 2GTJA 1X27A 2D0NA 2K7AA 2ABLA 2FRWA 4Z8AA 3FJ5A 5IH2A 2O9VA 1GCPA 1UTIA 1XOVA 1Z9ZA 4J9DA 4J9BA 2JS0A 1WA7A 1KSWA 1AOJA 3M0RA 3TSWA 2EYZA 1AWWA 2BZYA 3VS7A 2ED0A 1UHFA 4IIMA 1W6XA 2A08A 2EPDA 5FWBA 1LCKA 3VS4A 1MUZA 1OOTA 2LP5A 1WIEA 2JM8A 2DYBA 1SPKA 1MV0B 4J9GA 2KRSA 4J9EA 1X6BA 2PZ1A 2RQUA 1UJ0A 3VS5A 4OMPA 1OPKA 1AVZC 3GBQA 4JZ3A 2D1XA 2L3SA 2DL3A 2KE9A 2GBQA 3UF4A 2W10A 2I0NA 2FG0A 2J06A 2KYMA 1HD3A 2KR3A 4RTTA 3H0HA 1I07A 4RUGA 2DILA 3ULRB 2CH4W 4GLMA 1E7OA 1WLPB 3A98A 3NMZC 1NG2A 1H3HA 4CC2A 1WXUA 3VS6A 1QCFA 2DMOA 2O31A 4DEYA 2ESWA 2V1QA 2K3BA 2LQNA 2LZ6B 4OMMA 2SEMA 2D8HA 1FMKA 1VYUA 3U23A 1FYNA 1Y57A 1ZUYA 3UA7A 1M30A 4LUDA 1H92A 1ZUUA 3VRZA 2L2PA 2RQRA 1HSQA 5IXBA 1KIKA 2OI3A 2EYWA 1ZX6A 2JMCA 1YP5A 2KYBA 2RQVA 4OMNA 2DL4A 1BBZA 2DJQA 4Z88A 3RNJA 3EGUA 1S1NA 2EVRA 1YN8A 1Z9QA 2JXBA 3M0UA 5IHIA 3M0PA 1ZLMA 4LNPA 4M4ZA 1QKXA 4LN2A 3VS1A 1BB9A 1U3OA 1PNJA 2CSIA 2DL7A 4RTXA 1TUCA 1RLPC 4AFUC 3THKA 1PRMC 3VS0A 2CSQA 2LQWA 1ZBJA 2VVKA 1YWOA 1GRIA 4E6RA 2KRNA 1G2BA 2IIMA 2X3WD 1HJDA 2RNAA 1NYGA 2YT6A 1QLYA 3REBB 2C0OA 4RTUA 2E5KA 3I5RA 4HVUA 3NHNA 2L3QA 2PNIA 3EG3A 5IXFA 3I5SA 2KXCA 1NEBA 2VWFA 4KRTA 3M0TA 5L23A 1E6GA 2DVJA 2FPFA 2W0ZA 1K0XA 2X3XD 1EFNA 2ECZA 1KJWA 2FO0A 3O5ZA 2AKKA 3EG0A 1M3BA 1OV3A 2KT8A 1K1ZA 1WFWA 2JTEA 2KGTA 2A28A 5FW9A 2J6OA 2EQIA 1PRLC 2AKLA 2O88A 2D8JA 1K0SA 4HVVA 2K6DA 1WXTA 4AFZC 2JT4A 2KROA 5HCKA 1UFFA 2BZXA 2J6FA 5IHKA 1WX6A 1M27C 2DLPA 1UDLA 1JU5C 2A36A 2RPNA 3PE0A 2C0TA 3EHQA 3KFVA 4HXJA 2NWMA 1RLQC 2CUBA 1M3CA 3NPFA 3M0SA 1T0JA 1YCSB 2B86A 4HVWA 2LJ1A 1X6GA 2JW4A 2LNHB 4OMQA 2HEQA 4RTYA 3EG2A 5EC7A 1WDXA 1X43A 3NGPA 1M8MA 3H41A 1AEYA 2AZSA 1NLOC 3H0FA 4AFQC 5I11A 2L0AA 3REAB 1ARKA 2KNBB 1T3LA 1CKAA 3PVLA 1VA7A 3UA6A 1NYFA 2FEIA 1V1CA 1G83A 2CUDA 2O9SA 1K9AA 2OJ2A 2DA9A 2ROLA 1SRMA 3IQLA 2YUOA 4WCIA 1W70A 2EGAA 2RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPE A;  1GCQ A;  1SRL A;  2F2V A;  1OPL A;  1UG1 A;  2O2O A;  4LUE A;  2EGE A;  2AZV A;  1BU1 A;  2F2X A;  2K79 A;  1SEM A;  2BZ8 A;  1UUE A;  1T0H A;  1WYX A;  1B07 A;  1U5S A;  2G6F X;  2C0I A;  2XMF A;  4JPB W;  5GJV B;  4IIO A;  2MCN A;  1SHG A;  1M3A A;  2EW3 A;  1AZE A;  2HSP A;  2KEA A;  2DNU A;  3TSZ A;  2K9G A;  4F14 A;  3H0I A;  4JJB A;  4A63 B;  2DF6 A;  4OML A;  3VS3 A;  1TG0 A;  4J9I A;  2J05 A;  1YNZ A;  2J6K A;  4JZ4 A;  2FPD A;  1ZSG A;  3CQT A;  1AWO A;  1JQQ A;  4R0K A;  4RTZ A;  2KRM A;  1QWE A;  4HCK A;  2DRK A;  1JEG A;  1X2K A;  2CDT A;  1OEB A;  4OMO A;  1X2Q A;  2LX7 A;  1PHT A;  4ESR A;  2K2M A;  5GJW B;  1ABO A;  1A0N B;  1GBQ A;  1YWP A;  4AG1 C;  1VYV A;  2A37 A;  2QDL A;  5ECA A;  2DBK A;  1H8K A;  2GTO A;  1K4U S;  1X69 A;  2JS2 A;  1JXO A;  4F16 A;  4K11 A;  2J7I A;  2CT4 A;  2RQT A;  4D8D A;  3TVT A;  4CC3 A;  2YUQ A;  1UGV A;  4J9H A;  1PKS A;  2PTK A;  1SSH A;  4Z89 A;  1PWT A;  2L3P A;  3ZL7 C;  1UEC A;  1AWJ A;  1VYT A;  3RBB B;  1I1J A;  1AZG B;  4F17 A;  1WXB A;  1GBR A;  1CSK A;  1GFC A;  3VRY A;  4J9C A;  2KBT A;  2LMJ A;  4D8K A;  2YUN A;  1RI9 A;  4LE9 A;  1JXM A;  2MOX A;  2LJ3 A;  4RTW A;  4RTV A;  3SHW A;  2DX1 A;  1PKT A;  4JJC A;  2YSQ A;  2BTT A;  4AFS C;  1SHF A;  2EYY A;  2DBM A;  2DL5 A;  2GGR A;  1UHC A;  1NEG A;  3EHR A;  4DEX A;  1QKW A;  2CH4 A;  1B3Q A;  1CKB A;  2EBP A;  4AG2 C;  2SRC A;  2CT3 A;  2ED1 A;  3M0Q A;  2JMA A;  2HDA A;  1K76 A;  2RMO A;  4CC7 A;  4CC4 B;  2LCS A;  1E6H A;  2AK5 A;  2YUP A;  2H8H A;  2ROT A;  3QWY A;  3LH5 A;  2KXD A;  1I0C A;  2NUZ A;  2P4R A;  1W1F A;  4FSS A;  4ZNX A;  1ABQ A;  2HBW A;  2DL8 A;  3EG1 A;  3I35 A;  2V1R A;  2EGC A;  5IHN A;  3UAT A;  4J9F A;  1UE9 A;  2GNC A;  4GBQ A;  1IO6 A;  1NLP C;  3PVQ A;  4EIK A;  1GFD A;  2HCK A;  2RN8 A;  2MIO A;  3QWX X;  2M0Y A;  3R6N A;  3VS2 A;  2OAW A;  5FWC A;  2DRM A;  1GL5 A;  3C0C A;  2LJ0 A;  1KFZ A;  2DM1 A;  1UJY A;  2KT1 A;  1AD5 A;  4Y92 A;  2YDL A;  4JJD A;  2RQW A;  3SEM A;  2VKN A;  2JM9 A;  1J3T A;  2F2W A;  2GQI A;  1RUW A;  1AWX A;  1NM7 A;  1ZUK A;  1T3S A;  2ENM A;  2EYX A;  1JO8 A;  2EKH A;  1WI7 A;  4ORZ A;  1QWF A;  1Y0M A;  3JV3 A;  1MV3 A;  4X1V A;  3I9Q A;  1BK2 A;  1GCQ C;  2DE0 X;  5I22 A;  1U06 A;  4QT7 A;  2CRE A;  2FRY A;  1TUD A;  1N5Z A;  2M51 A;  2GTJ A;  1X27 A;  2D0N A;  2K7A A;  2ABL A;  2FRW A;  4Z8A A;  3FJ5 A;  5IH2 A;  2O9V A;  1GCP A;  1UTI A;  1XOV A;  1Z9Z A;  4J9D A;  4J9B A;  2JS0 A;  1WA7 A;  1KSW A;  1AOJ A;  3M0R A;  3TSW A;  2EYZ A;  1AWW A;  2BZY A;  3VS7 A;  2ED0 A;  1UHF A;  4IIM A;  1W6X A;  2A08 A;  2EPD A;  5FWB A;  1LCK A;  3VS4 A;  1MUZ A;  1OOT A;  2LP5 A;  1WIE A;  2JM8 A;  2DYB A;  1SPK A;  1MV0 B;  4J9G A;  2KRS A;  4J9E A;  1X6B A;  2PZ1 A;  2RQU A;  1UJ0 A;  3VS5 A;  4OMP A;  1OPK A;  1AVZ C;  3GBQ A;  4JZ3 A;  2D1X A;  2L3S A;  2DL3 A;  2KE9 A;  2GBQ A;  3UF4 A;  2W10 A;  2I0N A;  2FG0 A;  2J06 A;  2KYM A;  1HD3 A;  2KR3 A;  4RTT A;  3H0H A;  1I07 A;  4RUG A;  2DIL A;  3ULR B;  2CH4 W;  4GLM A;  1E7O A;  1WLP B;  3A98 A;  3NMZ C;  1NG2 A;  1H3H A;  4CC2 A;  1WXU A;  3VS6 A;  1QCF A;  2DMO A;  2O31 A;  4DEY A;  2ESW A;  2V1Q A;  2K3B A;  2LQN A;  2LZ6 B;  4OMM A;  2SEM A;  2D8H A;  1FMK A;  1VYU A;  3U23 A;  1FYN A;  1Y57 A;  1ZUY A;  3UA7 A;  1M30 A;  4LUD A;  1H92 A;  1ZUU A;  3VRZ A;  2L2P A;  2RQR A;  1HSQ A;  5IXB A;  1KIK A;  2OI3 A;  2EYW A;  1ZX6 A;  2JMC A;  1YP5 A;  2KYB A;  2RQV A;  4OMN A;  2DL4 A;  1BBZ A;  2DJQ A;  4Z88 A;  3RNJ A;  3EGU A;  1S1N A;  2EVR A;  1YN8 A;  1Z9Q A;  2JXB A;  3M0U A;  5IHI A;  3M0P A;  1ZLM A;  4LNP A;  4M4Z A;  1QKX A;  4LN2 A;  3VS1 A;  1BB9 A;  1U3O A;  1PNJ A;  2CSI A;  2DL7 A;  4RTX A;  1TUC A;  1RLP C;  4AFU C;  3THK A;  1PRM C;  3VS0 A;  2CSQ A;  2LQW A;  1ZBJ A;  2VVK A;  1YWO A;  1GRI A;  4E6R A;  2KRN A;  1G2B A;  2IIM A;  2X3W D;  1HJD A;  2RNA A;  1NYG A;  2YT6 A;  1QLY A;  3REB B;  2C0O A;  4RTU A;  2E5K A;  3I5R A;  4HVU A;  3NHN A;  2L3Q A;  2PNI A;  3EG3 A;  5IXF A;  3I5S A;  2KXC A;  1NEB A;  2VWF A;  4KRT A;  3M0T A;  5L23 A;  1E6G A;  2DVJ A;  2FPF A;  2W0Z A;  1K0X A;  2X3X D;  1EFN A;  2ECZ A;  1KJW A;  2FO0 A;  3O5Z A;  2AKK A;  3EG0 A;  1M3B A;  1OV3 A;  2KT8 A;  1K1Z A;  1WFW A;  2JTE A;  2KGT A;  2A28 A;  5FW9 A;  2J6O A;  2EQI A;  1PRL C;  2AKL A;  2O88 A;  2D8J A;  1K0S A;  4HVV A;  2K6D A;  1WXT A;  4AFZ C;  2JT4 A;  2KRO A;  5HCK A;  1UFF A;  2BZX A;  2J6F A;  5IHK A;  1WX6 A;  1M27 C;  2DLP A;  1UDL A;  1JU5 C;  2A36 A;  2RPN A;  3PE0 A;  2C0T A;  3EHQ A;  3KFV A;  4HXJ A;  2NWM A;  1RLQ C;  2CUB A;  1M3C A;  3NPF A;  3M0S A;  1T0J A;  1YCS B;  2B86 A;  4HVW A;  2LJ1 A;  1X6G A;  2JW4 A;  2LNH B;  4OMQ A;  2HEQ A;  4RTY A;  3EG2 A;  5EC7 A;  1WDX A;  1X43 A;  3NGP A;  1M8M A;  3H41 A;  1AEY A;  2AZS A;  1NLO C;  3H0F A;  4AFQ C;  5I11 A;  2L0A A;  3REA B;  1ARK A;  2KNB B;  1T3L A;  1CKA A;  3PVL A;  1VA7 A;  3UA6 A;  1NYF A;  2FEI A;  1V1C A;  1G83 A;  2CUD A;  2O9S A;  1K9A A;  2OJ2 A;  2DA9 A;  2ROL A;  1SRM A;  3IQL A;  2YUO A;  4WCI A;  1W70 A;  2EGA A;  2RF0 A; 
#chains in the Genus database with same CATH topology
 3JB9 D;  1GCQ A;  1Q7Y U;  2R5A A;  1YCY A;  2DTO A;  4F7U B;  2O2O A;  2AZV A;  1BU1 A;  1SEM A;  2FZG B;  1UUE A;  4XTZ A;  1D3B A;  1T0H A;  1B07 A;  1RAD B;  3JCM W;  2DVE A;  2DZC A;  2C0I A;  4JPB W;  2BE9 B;  3G4S T;  3E2U A;  4M75 A;  5FU6 B;  1VQ7 T;  4ELZ C;  1D0X A;  2LT4 A;  2Z0W A;  2WAC A;  1FWZ A;  3TSZ A;  2CKK A;  5GAM g;  2XDP A;  3H0I A;  4A63 B;  2DF6 A;  1YBY A;  4EDU A;  4M7D A;  5GMK j;  3URG A;  4J9I A;  2RH2 A;  1W4S A;  5GMK m;  3V8J A;  4XTW A;  1YNZ A;  4RCC A;  5GMK e;  1YJ9 A;  3X20 B;  4JS4 A;  3CCR T;  4OB2 B;  2DZ9 A;  2V26 A;  2DRK A;  2XK0 A;  3OMC A;  1D1A A;  4FIB A;  1OEB A;  4OMO A;  1BI0 A;  2DET A;  3JCM V;  2ZPE B;  4BDY A;  1YWP A;  4ZTJ A;  2QAS A;  1VQ7 Q;  4KT0 E;  1QVG P;  1Q81 R;  1N8R R;  1H8K A;  1RAI B;  1X69 A;  2OTJ A;  2CT4 A;  3TVT A;  5GAN 7;  4CC3 A;  2YUQ A;  1VQO T;  1PSE A;  3M55 A;  4C5G A;  4E7K A;  1AWJ A;  1VYT A;  4NL2 A;  2E4H A;  1I1J A;  3CME Q;  4F17 A;  1Q7Y R;  1YFN A;  4C0D B;  3G6E A;  2RB6 A;  2LMJ A;  4KUL A;  1VQO Q;  1M1K U;  1RI9 A;  4LE9 A;  4IUP A;  4RTW A;  1SKU B;  4M7D G;  3BY7 A;  2IVW A;  2DBM A;  3VYH B;  1TS9 A;  1UGP B;  1WHG A;  3MEV A;  3PMT A;  1B3Q A;  4XK8 E;  2ED1 A;  2C06 A;  4KH0 B;  4CC7 A;  3G7Z A;  2ZPF B;  1WQ7 A;  1ZSZ A;  1Y71 A;  3L1A A;  5GMK i;  2GFU A;  3CCU A;  3G4S A;  3RKW A;  1WJR A;  4DBF A;  1ABQ A;  2HBW A;  3OYE A;  4EMK A;  2ZCF B;  3I35 A;  4M7A G;  4LDW A;  4J9F A;  4PJM A;  1BIA A;  4X9C A;  5GAM j;  3CPW S;  2KI7 A;  3FIF A;  3BDU A;  3V7S A;  2KVQ G;  4E7J A;  3C4S A;  4J5Y A;  1GL5 A;  1OUL A;  3C0C A;  2L3R A;  4DOV A;  1KFZ A;  2DM1 A;  4Y92 A;  3OMG A;  1J3T A;  4PJO D;  1EIF A;  2F2W A;  2GQI A;  3CC7 A;  5KYX B;  3H6Z A;  5KYW A;  2VB6 A;  5CKD A;  1WHK A;  2EKH A;  1WI7 A;  4JJN K;  2LX9 A;  1N8R U;  3M4G A;  1MV3 A;  3I9Q A;  1GCQ C;  2CRE A;  2ZAE A;  3CD6 A;  3CCE Q;  1OYX A;  2M51 A;  4BDZ A;  3WVD B;  1D0Y A;  1K73 C;  2ABL A;  3ASK A;  5GAN e;  4QVC A;  2L8D A;  4Y28 E;  4C92 B;  4F7U G;  1O75 A;  3JRZ A;  2VGN A;  4J9D A;  4J9B A;  5LJ5 h;  2JS0 A;  1WA7 A;  1KSW A;  4GY5 A;  4A53 A;  4EMK C;  1AWW A;  4N4H A;  2ED0 A;  1VOM A;  5KYY B;  4FT2 A;  5FWB A;  4JDS A;  3HSB A;  1LCK A;  2LP5 A;  3MEU A;  2P0Q A;  2JM8 A;  3CD6 T;  3TU4 K;  4J83 A;  3CCV A;  2LRQ A;  2HQX A;  4MDW A;  4E47 A;  4IUV A;  1SG5 A;  3NFC A;  3VS5 A;  3OS5 A;  2PUO B;  2RO0 A;  1AVZ C;  3RER A;  3GBQ A;  5D7U A;  2FB7 A;  2GBQ A;  4A4G A;  2X4X A;  3H0H A;  3ULR B;  3CCM A;  3E19 A;  5KCO A;  1K9M C;  3G1J A;  1WLP B;  3LWI A;  4PNO A;  4CC2 A;  1WXU A;  3VS6 A;  1Q82 U;  2QEX A;  2V1Q A;  2K3B A;  3M53 A;  3H8Z A;  4HCZ A;  3X25 B;  2CP2 A;  4PJL A;  3UA7 A;  2F1L A;  1VQ6 T;  3BDL A;  2XID A;  3L2R A;  4C8Q D;  3SWN C;  4AT1 B;  1KIK A;  1YP5 A;  2DL4 A;  3OYY A;  4XTX A;  2DJQ A;  4Z88 A;  2KSS A;  5CVI A;  1TWB A;  4BUG A;  1Z9Q A;  3LLR A;  3M0U A;  3M0P A;  1ZLM A;  4M4Z A;  1AT1 B;  5KYW B;  1VQM A;  1FMW A;  1WHJ A;  2DD5 A;  1IXD A;  4JRI A;  3CCR Q;  4RTX A;  3CC4 A;  4QW2 A;  4EMK B;  1PRM C;  3EAE A;  2LQW A;  1M1K C;  2VVK A;  4XU1 A;  3VKI A;  1HJD A;  3CPF A;  3O8V A;  4M7D C;  3REB B;  2C0O A;  4C8Q G;  2E5K A;  2MK5 A;  4J6W A;  3EFR A;  4MZT A;  4C5I A;  1NEB A;  1I81 A;  4QQ6 A;  1IZ6 A;  5L23 A;  2EQK A;  3CEY A;  4C5H A;  2DAQ A;  1B7T A;  3OW2 P;  1OZ2 A;  2EJF A;  2ECZ A;  1KJW A;  3L2V A;  3EG0 A;  1M3B A;  4NL3 A;  3L2U A;  1N9S A;  1OV3 A;  2KT8 A;  4JRK A;  3ZEH A;  2JTE A;  2QQA A;  2A28 A;  2J6O A;  5IAY A;  4QQD A;  1W2B S;  3KBG A;  1K9M U;  4M77 B;  2OTL A;  4AFZ C;  2LC4 A;  1VQK A;  2JT4 A;  1LJO A;  1UFF A;  2EFI A;  2ZPI B;  2J6F A;  3SB2 A;  4KUD K;  2A36 A;  2ATC B;  2VGM A;  3EHQ A;  2NWM A;  1RLQ C;  1VQ6 A;  3M0S A;  2WSE E;  1YJN T;  3JCM c;  2M9U A;  3GNG A;  4HVW A;  4M78 C;  2HEQ A;  1WDX A;  4M77 C;  2K3Y A;  1AEY A;  2QDY B;  4HCC A;  2DO3 A;  1T3L A;  1PSF A;  3JCM Q;  1BI1 A;  2EJ9 A;  3RR6 A;  3EFO B;  3EFO A;  4NS5 A;  1M1F A;  1XQH A;  5DY9 A;  1V1C A;  1G83 A;  4C8Q B;  4LDV A;  5LJ3 e;  3UWN A;  1VQ8 Q;  1QP3 A;  2OJ2 A;  2ROL A;  3C95 A;  4M78 B;  1YJN A;  3IQL A;  3CME A;  3MCA B;  1W70 A;  2L5Q A;  3I5R A;  2L89 A;  3OYN A;  2OTJ Q;  5C0M A;  1OPL A;  1YIJ T;  1IHW A;  4ELY C;  5J3B A;  3QZ5 B;  4M78 D;  2F2X A;  2K79 A;  1UB4 A;  2MAM A;  1LNX A;  1U1S A;  1NE8 A;  5LJ3 f;  4C92 C;  1WYX A;  2AHJ B;  1BI3 A;  4XU3 A;  3M5A A;  1D1C A;  4A4F A;  2MCN A;  2PQW A;  1M3A A;  2XU8 A;  4M7A B;  1KD1 U;  1AZE A;  2H3J A;  5GAN 8;  2LQ8 A;  3VU3 C;  2COY A;  1WPY A;  4F14 A;  3D7S B;  1Q82 C;  2E64 A;  4OML A;  4E7S A;  4KGZ B;  5GAM h;  1YHQ T;  3F70 A;  1FXX A;  2DXU A;  2NUT B;  4CRI A;  1RAA B;  1EZZ B;  2J6K A;  1ZSZ C;  4JZ4 A;  2FPD A;  3INZ A;  5CIU A;  4C92 D;  3QII A;  1Q7Y C;  1AWO A;  4R0K A;  3SFM A;  1WQW A;  3MKD A;  2KRM A;  1QWE A;  4HCK A;  4F7U E;  4IUT A;  4B6M A;  1JEG A;  1QVF P;  3VV0 A;  1XNI A;  3JB9 G;  2EQU A;  1A0N B;  2GCX A;  1YHQ Q;  1QVG A;  2HQH A;  3PIO A;  1M90 U;  4AG1 C;  4JRQ A;  2QDL A;  3TEE A;  4MZP A;  2DBK A;  3ER0 A;  2YHT A;  1X75 C;  4PJO A;  3PMI A;  1UGR B;  4PL6 A;  5KYX A;  5GAN h;  1K4U S;  4C8Q C;  4F16 A;  4ATO A;  2J7I A;  4PJO E;  5GAN 6;  1UGV A;  2PTK A;  1PWT A;  5LJ5 j;  1YI2 Q;  1K8A C;  2K4Y A;  4JLG A;  1WXB A;  2E3I A;  1F1B B;  1GBR A;  3VRY A;  5C6S A;  4J9C A;  3VJP A;  2QEX T;  3DB4 A;  1JXM A;  2LJ3 A;  3M4Y A;  1VQP A;  1PKT A;  5KE2 A;  4AFS C;  1ZHI A;  4P5N A;  1SHF A;  2FHD A;  2GGR A;  2COW A;  2O4X A;  3QZ9 B;  1NEG A;  3EHR A;  4DEX A;  5A0G A;  3OYG A;  1CKB A;  1VQK T;  4AG2 C;  4XU0 A;  5CKH A;  1VQ9 Q;  4ME7 A;  3M0Q A;  1WHM A;  2QI2 A;  1E6H A;  1WHL A;  2AK5 A;  1VQL T;  4BE1 A;  2ROT A;  3QWY A;  3LH5 A;  1VQ9 T;  3G6E T;  2NUZ A;  1D09 B;  2DXT A;  4CI0 C;  1NPR A;  4FSS A;  4A4E A;  2XIC A;  4C5E A;  3CC2 A;  3EG1 A;  1X01 A;  3CPW A;  2V8I A;  3CCM Q;  3EFS A;  3UAT A;  1QW1 A;  5IHN A;  3OYJ A;  2PU9 B;  3I56 T;  1UE9 A;  2COZ A;  4ZTF A;  1KK7 A;  4J8O A;  2HCK A;  2QEX Q;  2M0Y A;  1RAG B;  1Y07 A;  2RHY A;  2QA4 Q;  2QQB A;  2YRV A;  2OAW A;  2HAX A;  1EX4 A;  1UJY A;  5I2S A;  1ZQ1 A;  2PVD B;  4JJD A;  4QVD A;  2P0K A;  2VKN A;  4M77 G;  2EYQ A;  3OW2 S;  4FYW B;  1NM7 A;  4RCB A;  2NLU A;  2M16 A;  5LL6 S;  2ENM A;  1S72 Q;  1JO8 A;  4ORZ A;  2KQW A;  3A8M B;  4X1V A;  3QPH A;  2RA2 A;  4QT7 A;  3GOX A;  2FRY A;  1TUD A;  1JJ2 P;  2GTJ A;  2D0N A;  5KYU B;  1O9S A;  4Z8A A;  2O9V A;  1YJ9 T;  1V29 B;  5D6Y A;  2X4J A;  3RKX A;  4DBH A;  1SSF A;  2DTH A;  2RJD A;  2DD4 A;  1WGS A;  2A08 A;  3VUB A;  5FU7 C;  3G71 T;  1WIE A;  2HKN A;  1OI1 A;  2EAY A;  2DYB A;  1MV0 B;  4J9G A;  2KRS A;  4C0D C;  4RG2 A;  4HKE A;  4QVZ A;  2PZ1 A;  2MMP A;  3CBP A;  4M7A A;  3CXC S;  3A1P A;  1UJ0 A;  2QYZ A;  1OQK A;  4PJO B;  5CK9 A;  4JZ3 A;  4FW1 A;  2DL3 A;  3H9N A;  5GAO n;  2DXC A;  1WJS A;  2KAF A;  3UF4 A;  1RAF B;  3CCE A;  2KYM A;  4PJJ A;  4C0Z A;  1I07 A;  2NUP A;  4BI8 B;  3X28 B;  3GIB A;  5HK0 A;  1QCF A;  3OYM A;  2O31 A;  4DEY A;  1Q81 C;  2ESW A;  4C92 E;  5FLX E;  2LZ6 B;  3A8L B;  2OTL Q;  1YIJ Q;  2D8H A;  1D1B A;  1FMK A;  1VYU A;  3U23 A;  1QQJ A;  1LVK A;  4V2S A;  3CCL Q;  1RAB B;  3OA6 A;  1H92 A;  3VRZ A;  1YIT T;  2RD1 A;  3HFN A;  3GF5 A;  3JCM f;  1HSQ A;  5IXB A;  3P8B B;  2JMC A;  2KYB A;  3JB9 F;  4N4I A;  2JZ2 A;  3CCS T;  1NZ9 A;  1S1N A;  1Q95 G;  3E1S A;  2ZPG B;  1YN8 A;  3GLX A;  1VQ8 T;  5IHI A;  1XTD A;  5GAM e;  4LN2 A;  3PGG A;  1G3T A;  3VS1 A;  1KHI A;  1K9M R;  1VQ5 Q;  3JB9 H;  2DK3 A;  4M77 A;  4JS5 A;  1K8A U;  1U3O A;  2CSI A;  2DL7 A;  4E7I A;  4XTU A;  1TUC A;  2RHI A;  4R56 A;  3CMA T;  3CC2 T;  1OX8 A;  2CSQ A;  2EQM A;  1RAH B;  1U1T A;  1QCN A;  1WHH A;  5CKE A;  1NYG A;  4RKU E;  2P84 A;  1M90 R;  2A7Y A;  3S3O A;  3MP1 A;  5KYY A;  2DEQ A;  2L3Q A;  3EG3 A;  5IXF A;  2BE7 D;  1ZA1 B;  2X4W A;  2VWF A;  2VUB A;  2IG0 A;  5KCH A;  1E6G A;  2LTO A;  4N4G A;  4OVA A;  2DYI A;  1EFN A;  3E9F A;  3OW2 A;  1S72 A;  3JSC A;  3O5Z A;  4OMF B;  1PM3 A;  2M02 A;  4PK4 A;  2AKK A;  1K1Z A;  2KGT A;  2YLB A;  2H3E B;  3SD4 A;  3CCE T;  2D8J A;  3EGX B;  4FYY B;  1LOJ A;  3EGX A;  4OGC A;  3M59 A;  1WXT A;  5GAN j;  3MEW A;  3CXC P;  3OS0 A;  5HCK A;  1YJW T;  1MND A;  2BZX A;  1Y7X A;  3OY9 A;  5FRN A;  5IHK A;  1IGQ A;  3AT1 B;  1RAE B;  3HPW A;  3KUF A;  4J7F A;  1VQP T;  5CQY A;  3PE0 A;  2C0T A;  3KFV A;  2CUB A;  4A4H A;  2CZ1 B;  3CCM T;  1K73 U;  1T0J A;  1G3Y A;  1I5O B;  3CMA Q;  4OMQ A;  3EG2 A;  4LD6 A;  2HKQ B;  3H41 A;  5IT9 E;  2RHZ A;  1M4Z A;  1UEB A;  2L0A A;  3REA B;  4F04 B;  3CCQ T;  3EG9 A;  1TSF A;  3PVL A;  5CKB A;  1NYF A;  4J6Y A;  3CCS Q;  4OB0 B;  2FEI A;  3S3M A;  2O9S A;  3QJ6 A;  5KYU A;  3ZFJ A;  5GAN f;  2QQR A;  2DA9 A;  1SRM A;  2EWN A;  4M75 E;  2X4Y A;  4BE0 A;  4OF1 A;  2NUP B;  2EQJ A;  2YUO A;  3MP8 A;  2RK1 A;  2FPE A;  1SRL A;  2VXF A;  3C94 A;  2E12 A;  4LUE A;  2EGE A;  5HY6 A;  1YI2 T;  1KQS S;  1BI2 A;  4L5G A;  2BZ8 A;  4GLK A;  3HHT B;  4EMH A;  1KD1 C;  1YI2 A;  3QKJ A;  5GAN 2;  3JCM P;  3JCM b;  1U5S A;  2G6F X;  1TU0 B;  1VQM T;  1NJI R;  1RAC B;  1VUB A;  5GJV B;  4LDY A;  1N9R A;  4KUI A;  1SHG A;  2EW3 A;  4M7A C;  3A5Z B;  1W2B P;  3JCM X;  4BD3 A;  3TQ7 P;  2K9G A;  5CO7 A;  1HYO A;  1VQ9 A;  2MPX C;  4C92 G;  1JRI A;  4ZN3 A;  2CS7 A;  4C8Q E;  3QDF A;  4HT8 A;  2DPP B;  1YJN Q;  2AIR B;  4M78 E;  2M0O A;  1TH7 A;  3CQT A;  1FX7 A;  3LGF A;  1JQQ A;  1IRE B;  2CZ7 B;  4RTZ A;  5HK3 A;  3NTK A;  1PG5 B;  5FU6 C;  3OYK A;  4PFP A;  4XU2 A;  5DLO A;  1X2K A;  2CDT A;  2QK0 A;  2E1H A;  2RM4 A;  2K2M A;  5GJW B;  1ABO A;  1Q86 U;  3CCQ A;  2RJE A;  1KC8 R;  3EGD A;  4LDX A;  5J26 A;  1K8A R;  2A37 A;  2I2L A;  1PD1 A;  5ECA A;  5KH6 A;  2K5L A;  3FEO A;  3P8D A;  4QQG A;  1JXO A;  4K11 A;  1KQ2 A;  5J39 A;  2RQT A;  5CCA A;  4PKC C;  4D8D A;  4M78 G;  3LWH A;  3CCV T;  1WZO A;  2Y4Y A;  4J9H A;  5I2M A;  2DEU A;  3LX7 A;  2L3P A;  2QA4 T;  1QVF S;  2YWW A;  3RBB B;  1B34 A;  3P8H A;  2K5I A;  3RMS A;  2RI2 A;  5CR2 A;  2HL5 C;  3OS1 A;  2XD0 A;  2KBT A;  3FDR A;  5LJ5 d;  2KMT A;  2RK2 A;  3OSS C;  2DX1 A;  3CMA A;  4E7H A;  2LVM A;  4JJC A;  2XI9 A;  3PNW C;  1Q82 R;  5L8R E;  2EYY A;  2DL5 A;  3EG9 B;  1M2O A;  2XDD A;  1AHJ B;  1R0C B;  5GAO r;  5LJ3 j;  2EBP A;  2FZC B;  3S6W A;  4WTO B;  2SRC A;  2JMA A;  2HDA A;  1K76 A;  2RMO A;  3CCS A;  2LCS A;  1VQN T;  2DIQ A;  1VIE A;  2KXD A;  4M75 B;  1I0C A;  1LPL A;  1W1F A;  2QQS A;  4C8Q F;  4ZNX A;  2IPO B;  1PD0 A;  3CPW P;  1VQ4 Q;  2V1R A;  4GBQ A;  2R5M A;  1IO6 A;  1NLP C;  3PVQ A;  2DFU A;  3C12 A;  2CGH A;  2CP0 A;  4M7D B;  4F7U A;  3QWX X;  3BFM A;  2V8K A;  2NYS A;  5M9O A;  4BAC A;  3OS2 A;  2VYT A;  3N5B B;  2PUK B;  2LJ0 A;  3M58 A;  2YDL A;  2RQW A;  3QBY A;  2DJZ A;  1VQM Q;  5LJ3 d;  1RUW A;  3GP8 A;  4B9W A;  3ME9 A;  2ZZD A;  1T3S A;  3CC4 T;  3CCR A;  3JAM E;  2CYZ B;  4E2F B;  2P0P A;  1BK2 A;  3V8L A;  2CP5 A;  5I22 A;  1U06 A;  1IGU A;  3GPL A;  2VV5 A;  2HNI A;  4M7A F;  3A8H B;  2HQE A;  1X27 A;  4M77 D;  2K7A A;  1C6V X;  3CXC A;  1RL2 A;  3SDZ A;  1UTI A;  3QYH B;  3JCM g;  2CP7 A;  2GF7 A;  5FRM A;  2QTV A;  2LQK A;  4PJO F;  4PJN A;  1Z9Z A;  4FL6 A;  4M75 F;  7AT1 B;  1VQ5 A;  3M0R A;  3HKS A;  2CP3 A;  4OP0 A;  4E7Z A;  2EYZ A;  2BZY A;  1UHF A;  1IB8 A;  4XTV A;  3OQ5 A;  5GAM f;  5HKC A;  3J81 E;  3DLL A;  1G3W A;  1OOT A;  2KDS A;  5D6W A;  3BW1 A;  1OU9 A;  1BKB A;  5GMK l;  3BE3 A;  3OYI A;  1TUG B;  4M7D F;  3RKY A;  5KE3 A;  2YXY A;  2QQ9 A;  3HTR A;  5AYF A;  1M1G A;  2RQU A;  4HT9 A;  5CAI A;  1WNL A;  4OMP A;  1OPK A;  1U8R A;  2D1X A;  2L3S A;  1YIT Q;  2KE9 A;  1QP2 A;  2FG0 A;  4A4K A;  2J06 A;  2KR3 A;  3MHX A;  4RTT A;  2DER A;  2O01 E;  4RUG A;  5GAN g;  2JNG A;  2K57 A;  4KH1 B;  2OTL T;  1E7O A;  3A98 A;  3NMZ C;  1NG2 A;  2JUF A;  1V76 A;  4M7A D;  1BIB A;  5CQX A;  2LQN A;  1GXI E;  1KQS P;  1XJW B;  3CCV Q;  1ZA2 B;  3HFO A;  4NOY A;  1N27 A;  3VUZ A;  1ZUY A;  1M30 A;  4LUD A;  1ZUU A;  5LJ3 h;  2L2P A;  2WSC E;  2D0Q B;  3CBO A;  2ZPH B;  2RJF A;  2OI3 A;  2EYW A;  2RQV A;  3M9Q A;  1X6O A;  1RI0 A;  3RNJ A;  1VQ8 A;  5IN1 A;  3QG1 A;  1M1K R;  1W2B A;  3LW5 E;  3I55 Q;  3PIP A;  3CCJ A;  2A3L A;  2K2V A;  2NUT A;  3TCJ A;  2VC8 A;  1BB9 A;  1I8F A;  1PNJ A;  1VQ4 A;  1RLP C;  1IHV A;  2GQV A;  1BCO A;  4MML A;  3I56 A;  1G3S A;  3VS0 A;  1ZBJ A;  1MMA A;  2MF2 A;  3UDC A;  1VQ5 T;  2KRN A;  1G2B A;  4OB1 B;  5DM7 R;  3KXT A;  1KC8 C;  2X3W D;  2RNA A;  5LJ5 e;  2F5K A;  3MET A;  4JUV A;  4ZGE B;  2K5F A;  5GMK h;  1KQ1 A;  4XTY A;  4HVU A;  4BI4 A;  3NHN A;  1YIJ A;  2PNI A;  1OX9 A;  3V8K A;  4IUU A;  4IUQ A;  2EIF A;  1UGS B;  2DVJ A;  2FPF A;  2W0Z A;  2R58 A;  2OAU A;  1K0X A;  2X3X D;  1M9S A;  2F5T X;  2FO0 A;  3LGL A;  5GAN 4;  4ZN1 A;  3RES A;  3FJP A;  5FW9 A;  2EQI A;  1PRL C;  4KGX B;  2O88 A;  4C92 A;  4XAX B;  3PTA A;  1KD1 R;  2K6D A;  3HP9 A;  1HK9 A;  1R77 A;  1WX6 A;  2DLP A;  4X9D A;  1UDL A;  5GAO q;  5GAN 5;  2P4T A;  2XKO C;  1Q86 R;  1M3C A;  3NPF A;  3QUI A;  5DLQ E;  1D3B B;  2JW4 A;  4JRP A;  2O4X B;  5EC7 A;  3CCQ Q;  3L2Z A;  1JB0 E;  2FZK B;  2AZS A;  2KY9 A;  1NLO C;  2CZ6 B;  2ZPB B;  4M7D E;  4AFQ C;  1VQK Q;  8AT1 B;  1CKA A;  1OU8 A;  4FW2 A;  3UA6 A;  3PT9 A;  2YLC A;  1YIT A;  4D6W A;  2LCC A;  4M78 A;  3OYB A;  1R8O B;  3L42 A;  5GAN 3;  4II1 A;  3E9G A;  1K9A A;  3HRT A;  1M8V A;  5GAO p;  1VQ6 Q;  2BKD N;  4VUB A;  3I55 T;  2FYK A;  3JB9 J;  1VQN A;  2VXE A;  2CP6 A;  3FC3 A;  3AHU A;  2F2V A;  4L59 A;  1UG1 A;  4LXC A;  2E41 A;  3CC4 Q;  4M7A E;  1PC0 A;  6AT1 B;  1ACM B;  1SF9 A;  4FT4 A;  2YRC A;  4BY6 C;  2Y4X A;  3OSV A;  2PVG B;  2DKG A;  2XMF A;  3QXE B;  3WXM B;  3DKM A;  4C0G A;  1ZBX A;  4IIO A;  4KGV B;  3MJX A;  2JJ9 A;  4Z02 A;  3L2W A;  2HSP A;  2KEA A;  2DNU A;  3JCM J;  4FCY A;  1Y96 B;  3EH2 A;  1VQ4 T;  3MO8 A;  4A54 A;  3I56 Q;  4JJB A;  1MMD A;  3VS3 A;  1TG0 A;  2Y90 A;  4N0A C;  2DTI A;  2HBP A;  2J05 A;  3GNF B;  3FLG A;  2WSF E;  3ZBD A;  3EH1 A;  3G6E Q;  3RDV A;  2X35 A;  3RIR A;  1ZSG A;  4RMO A;  5A2Q E;  4BE2 A;  3QJY A;  3QSU A;  3M57 A;  3OB9 A;  2BUD A;  1X2Q A;  1MHN A;  4FU6 A;  4J7I A;  2LX7 A;  3G71 A;  1PHT A;  4ESR A;  3CCL T;  4O5V A;  1GBQ A;  2PVO B;  4J6X A;  2XG8 D;  1G5V A;  1VYV A;  2E70 A;  1VIF A;  2XHC A;  2OX7 A;  2GTO A;  1M2V B;  1QCO A;  2F69 A;  1ZSZ B;  2JS2 A;  4PFZ A;  3JCM h;  4ZGJ B;  3RUX A;  1PKS A;  1Q86 C;  1SSH A;  3JCM e;  4Z89 A;  3ZL7 C;  1UEC A;  4C8Q A;  1TOV A;  4FYX B;  1JJ2 A;  1AZG B;  4ZGD B;  2E6Z A;  1CSK A;  1GFC A;  1KQS A;  3CBM A;  4D8K A;  2YUN A;  4B9X A;  3CC2 Q;  3OYF A;  2MOX A;  1KG1 A;  4RTV A;  3SHW A;  4DBR A;  1TTH B;  1M5Q 1;  4PLI A;  2YSQ A;  5GAN d;  2BTT A;  4X34 A;  2MYS A;  3V7C A;  2A0F B;  3OYA A;  3CC7 Q;  5GAO l;  1UHC A;  5FU7 B;  1QKW A;  2CH4 A;  1QVF A;  3UT1 A;  2VAS A;  4PJO G;  2CT3 A;  2QA4 A;  3TRE A;  4M75 G;  4CC4 B;  2LNV A;  1NPP A;  2YUP A;  3CD6 Q;  2H8H A;  2EJG A;  2P4R A;  1P92 A;  3R6O A;  2JN0 A;  1G8X A;  4L6V 5;  5GAM d;  4QKU A;  4MZM A;  2DL8 A;  1PCX A;  4C92 F;  2HSE B;  1VQN Q;  2EKO A;  2EGC A;  9ATC B;  1YJ9 Q;  2GNC A;  4EIK A;  1GFD A;  2MWP A;  2RN8 A;  1BYM A;  2MIO A;  3R6N A;  2DIG A;  3HRS A;  4AMC A;  2D6F A;  4OB3 B;  4Q5W A;  4C0F A;  3OYC A;  3VS2 A;  3JCM d;  3QHS A;  5FWC A;  2DRM A;  2LDM A;  2KT1 A;  1AD5 A;  2YRD A;  2MWO A;  3SEM A;  4BB7 A;  2JM9 A;  1S72 T;  4BY6 B;  2QXF A;  1KC8 U;  4IKF A;  1AWX A;  2XDB A;  2B8A A;  1ZUK A;  4EPC A;  2GFA A;  4PFO A;  2EYX A;  3I55 A;  1QWF A;  1Y0M A;  3JV3 A;  1VQ7 A;  2RHU A;  2CZ0 B;  2DE0 X;  4E7L A;  5AT1 B;  1N5Z A;  5LJ3 g;  4O6J A;  3CCJ Q;  3X26 B;  1NJI C;  1YHQ A;  2FRW A;  3LH0 A;  3QDR B;  1M2V A;  1UGQ B;  3FJ5 A;  2E6N A;  5IH2 A;  1M90 C;  1GCP A;  1JJ2 S;  1B34 B;  1XOV A;  5LJ5 f;  2HZY A;  1NBE B;  1R0B G;  1D0Z A;  2D9T A;  1AOJ A;  1VQL Q;  1HXD A;  2RJC A;  3TSW A;  3HRU A;  3SWN B;  4Y91 A;  2V8J A;  1Q81 U;  4LD9 K;  3VS7 A;  4IIM A;  4DBQ A;  3S3N A;  3FRN A;  1W6X A;  2EPD A;  4N0A A;  1H64 1;  3VS4 A;  1MUZ A;  1I4K 1;  3MP6 A;  2FL7 A;  3DB3 A;  2ZGW A;  3V7R A;  1SPK A;  2JOY A;  5A0L A;  3QO3 A;  3UPU A;  4FSX A;  4J9E A;  1X6B A;  1IRX A;  4MMK A;  1VQP Q;  4TVR A;  3CCL A;  2LCL A;  1QVP A;  5I21 A;  2HMA A;  2HL3 A;  2QGF B;  2E10 A;  5KYN A;  1YJW Q;  3G4S Q;  2W10 A;  2I0N A;  5GAO m;  2X51 A;  3Q1J A;  1HD3 A;  1MGQ A;  2DIL A;  3A8G B;  2CH4 W;  4GLM A;  4UC4 A;  3OYL A;  3DLM A;  1H3H A;  4M7D D;  5LJ5 g;  4EMG A;  2KK4 A;  3CME T;  2DMO A;  4FM4 B;  2R57 A;  4OMM A;  2SEM A;  3J7A F;  1FYN A;  1Y57 A;  2DXB A;  2RI3 A;  2RQR A;  4PJO C;  4M75 D;  1MMN A;  1ZX6 A;  3HL8 A;  4OMN A;  4F7U F;  2JTF A;  1BBZ A;  3OYD A;  3NTH A;  3EGU A;  3MPU B;  3JB9 I;  3OYH A;  2EVR A;  2JVV A;  2X9H A;  2AT1 B;  2JXB A;  4DA4 A;  4RG8 A;  4OGE A;  3M54 A;  4LNP A;  4M77 E;  3CCU T;  1QKX A;  2E3H A;  2M1H A;  4PLL A;  2LT1 A;  4AFU C;  1H3Z A;  3THK A;  4LDU A;  2QGG A;  2QTX A;  3T9N A;  1YWO A;  1GRI A;  4E6R A;  2IIM A;  4KBM B;  2QAZ A;  5EG2 A;  2YT6 A;  1FMV A;  1QLY A;  4RTU A;  4HA8 A;  4R55 A;  3RMQ A;  4JLI A;  3QYG B;  3MEA A;  3I5S A;  2KXC A;  4KRT A;  3SWN A;  3M0T A;  4M77 F;  3CCJ T;  3OBW A;  3L2Q A;  3M56 A;  3EGD B;  4M75 C;  3VYG A;  1N6A A;  3PFS A;  1KHC A;  4DOW A;  1DJ7 B;  1WFW A;  4BI3 A;  2OTJ T;  2QG9 B;  2AKL A;  1K0S A;  2E5Q A;  4HVV A;  2G3R A;  2RI5 A;  4M78 F;  1BCM A;  1C0M A;  1TXQ A;  2KRO A;  2K3X A;  2FVU A;  4WF2 A;  5CKF A;  1VQL A;  4YTL A;  1M27 C;  1JU5 C;  2HD0 A;  2RPN A;  1WJQ A;  4XQ3 A;  1QMC A;  4ANJ A;  2E65 A;  4HXJ A;  3A8O B;  3LYI A;  4FYV B;  3X24 B;  1VQO A;  4HCB A;  3J80 E;  1JBM A;  2BIV A;  1YCS B;  1K73 R;  2B86 A;  1QVG S;  8ATC B;  5A0D A;  2LJ1 A;  1X6G A;  2LNH B;  3G71 Q;  4RTY A;  1OZ3 A;  1X43 A;  4MDX A;  3NGP A;  1N8R C;  1M8M A;  3CCU Q;  3WVE B;  3H0F A;  5I11 A;  2JTM A;  1ARK A;  2KNB B;  1VA7 A;  3FB9 A;  1YJW A;  1Y96 A;  1MNE A;  1C1A A;  2CUD A;  4DQ2 A;  3CC7 T;  5D6X A;  2RHX A;  1I5L A;  5FRO A;  2MI6 A;  1NJI U;  3OBY A;  1MMG A;  4WCI A;  3NTI A;  2EGA A;  2RF0 A;  4IUR A; 
#chains in the Genus database with same CATH homology
 2FPE A;  1GCQ A;  1SRL A;  2F2V A;  1OPL A;  1UG1 A;  2O2O A;  4LUE A;  2EGE A;  2AZV A;  1BU1 A;  2F2X A;  2K79 A;  1SEM A;  2BZ8 A;  1UUE A;  1T0H A;  1WYX A;  1B07 A;  1U5S A;  2G6F X;  2C0I A;  2XMF A;  4JPB W;  5GJV B;  4IIO A;  2MCN A;  1SHG A;  1M3A A;  2EW3 A;  1AZE A;  2HSP A;  2KEA A;  2DNU A;  3TSZ A;  2K9G A;  4F14 A;  3H0I A;  4JJB A;  4A63 B;  2DF6 A;  4OML A;  3VS3 A;  1TG0 A;  4J9I A;  2J05 A;  1YNZ A;  2J6K A;  4JZ4 A;  2FPD A;  1ZSG A;  3CQT A;  1AWO A;  1JQQ A;  4R0K A;  4RTZ A;  2KRM A;  1QWE A;  4HCK A;  2DRK A;  1JEG A;  1X2K A;  2CDT A;  1OEB A;  4OMO A;  1X2Q A;  2LX7 A;  1PHT A;  4ESR A;  2K2M A;  5GJW B;  1ABO A;  1A0N B;  1GBQ A;  1YWP A;  4AG1 C;  1VYV A;  2A37 A;  2QDL A;  5ECA A;  2DBK A;  1H8K A;  2GTO A;  1K4U S;  1X69 A;  2JS2 A;  1JXO A;  4F16 A;  4K11 A;  2J7I A;  2CT4 A;  2RQT A;  4D8D A;  3TVT A;  4CC3 A;  2YUQ A;  1UGV A;  4J9H A;  1PKS A;  2PTK A;  1SSH A;  4Z89 A;  1PWT A;  2L3P A;  3ZL7 C;  1UEC A;  1AWJ A;  1VYT A;  3RBB B;  1I1J A;  1AZG B;  4F17 A;  1WXB A;  1GBR A;  1CSK A;  1GFC A;  3VRY A;  4J9C A;  2KBT A;  2LMJ A;  4D8K A;  2YUN A;  1RI9 A;  4LE9 A;  1JXM A;  2MOX A;  2LJ3 A;  4RTW A;  4RTV A;  3SHW A;  2DX1 A;  1PKT A;  4JJC A;  2YSQ A;  2BTT A;  4AFS C;  1SHF A;  2EYY A;  2DBM A;  2DL5 A;  2GGR A;  1UHC A;  1NEG A;  3EHR A;  4DEX A;  1QKW A;  2CH4 A;  1B3Q A;  1CKB A;  2EBP A;  4AG2 C;  2SRC A;  2CT3 A;  2ED1 A;  3M0Q A;  2JMA A;  2HDA A;  1K76 A;  2RMO A;  4CC7 A;  4CC4 B;  2LCS A;  1E6H A;  2AK5 A;  2YUP A;  2H8H A;  2ROT A;  3QWY A;  3LH5 A;  2KXD A;  1I0C A;  2NUZ A;  2P4R A;  1W1F A;  4FSS A;  4ZNX A;  1ABQ A;  2HBW A;  2DL8 A;  3EG1 A;  3I35 A;  2V1R A;  2EGC A;  5IHN A;  3UAT A;  4J9F A;  1UE9 A;  2GNC A;  4GBQ A;  1IO6 A;  1NLP C;  3PVQ A;  4EIK A;  1GFD A;  2HCK A;  2RN8 A;  2MIO A;  3QWX X;  2M0Y A;  3R6N A;  3VS2 A;  2OAW A;  5FWC A;  2DRM A;  1GL5 A;  3C0C A;  2LJ0 A;  1KFZ A;  2DM1 A;  1UJY A;  2KT1 A;  1AD5 A;  4Y92 A;  2YDL A;  4JJD A;  2RQW A;  3SEM A;  2VKN A;  2JM9 A;  1J3T A;  2F2W A;  2GQI A;  1RUW A;  1AWX A;  1NM7 A;  1ZUK A;  1T3S A;  2ENM A;  2EYX A;  1JO8 A;  2EKH A;  1WI7 A;  4ORZ A;  1QWF A;  1Y0M A;  3JV3 A;  1MV3 A;  4X1V A;  3I9Q A;  1BK2 A;  1GCQ C;  2DE0 X;  5I22 A;  1U06 A;  4QT7 A;  2CRE A;  2FRY A;  1TUD A;  1N5Z A;  2M51 A;  2GTJ A;  1X27 A;  2D0N A;  2K7A A;  2ABL A;  2FRW A;  4Z8A A;  3FJ5 A;  5IH2 A;  2O9V A;  1GCP A;  1UTI A;  1XOV A;  1Z9Z A;  4J9D A;  4J9B A;  2JS0 A;  1WA7 A;  1KSW A;  1AOJ A;  3M0R A;  3TSW A;  2EYZ A;  1AWW A;  2BZY A;  3VS7 A;  2ED0 A;  1UHF A;  4IIM A;  1W6X A;  2A08 A;  2EPD A;  5FWB A;  1LCK A;  3VS4 A;  1MUZ A;  1OOT A;  2LP5 A;  1WIE A;  2JM8 A;  2DYB A;  1SPK A;  1MV0 B;  4J9G A;  2KRS A;  4J9E A;  1X6B A;  2PZ1 A;  2RQU A;  1UJ0 A;  3VS5 A;  4OMP A;  1OPK A;  1AVZ C;  3GBQ A;  4JZ3 A;  2D1X A;  2L3S A;  2DL3 A;  2KE9 A;  2GBQ A;  3UF4 A;  2W10 A;  2I0N A;  2FG0 A;  2J06 A;  2KYM A;  1HD3 A;  2KR3 A;  4RTT A;  3H0H A;  1I07 A;  4RUG A;  2DIL A;  3ULR B;  2CH4 W;  4GLM A;  1E7O A;  1WLP B;  3A98 A;  3NMZ C;  1NG2 A;  1H3H A;  4CC2 A;  1WXU A;  3VS6 A;  1QCF A;  2DMO A;  2O31 A;  4DEY A;  2ESW A;  2V1Q A;  2K3B A;  2LQN A;  2LZ6 B;  4OMM A;  2SEM A;  2D8H A;  1FMK A;  1VYU A;  3U23 A;  1FYN A;  1Y57 A;  1ZUY A;  3UA7 A;  1M30 A;  4LUD A;  1H92 A;  1ZUU A;  3VRZ A;  2L2P A;  2RQR A;  1HSQ A;  5IXB A;  1KIK A;  2OI3 A;  2EYW A;  1ZX6 A;  2JMC A;  1YP5 A;  2KYB A;  2RQV A;  4OMN A;  2DL4 A;  1BBZ A;  2DJQ A;  4Z88 A;  3RNJ A;  3EGU A;  1S1N A;  2EVR A;  1YN8 A;  1Z9Q A;  2JXB A;  3M0U A;  5IHI A;  3M0P A;  1ZLM A;  4LNP A;  4M4Z A;  1QKX A;  4LN2 A;  3VS1 A;  1BB9 A;  1U3O A;  1PNJ A;  2CSI A;  2DL7 A;  4RTX A;  1TUC A;  1RLP C;  4AFU C;  3THK A;  1PRM C;  3VS0 A;  2CSQ A;  2LQW A;  1ZBJ A;  2VVK A;  1YWO A;  1GRI A;  4E6R A;  2KRN A;  1G2B A;  2IIM A;  2X3W D;  1HJD A;  2RNA A;  1NYG A;  2YT6 A;  1QLY A;  3REB B;  2C0O A;  4RTU A;  2E5K A;  3I5R A;  4HVU A;  3NHN A;  2L3Q A;  2PNI A;  3EG3 A;  5IXF A;  3I5S A;  2KXC A;  1NEB A;  2VWF A;  4KRT A;  3M0T A;  5L23 A;  1E6G A;  2DVJ A;  2FPF A;  2W0Z A;  1K0X A;  2X3X D;  1EFN A;  2ECZ A;  1KJW A;  2FO0 A;  3O5Z A;  2AKK A;  3EG0 A;  1M3B A;  1OV3 A;  2KT8 A;  1K1Z A;  1WFW A;  2JTE A;  2KGT A;  2A28 A;  5FW9 A;  2J6O A;  2EQI A;  1PRL C;  2AKL A;  2O88 A;  2D8J A;  1K0S A;  4HVV A;  2K6D A;  1WXT A;  4AFZ C;  2JT4 A;  2KRO A;  5HCK A;  1UFF A;  2BZX A;  2J6F A;  5IHK A;  1WX6 A;  1M27 C;  2DLP A;  1UDL A;  1JU5 C;  2A36 A;  2RPN A;  3PE0 A;  2C0T A;  3EHQ A;  3KFV A;  4HXJ A;  2NWM A;  1RLQ C;  2CUB A;  1M3C A;  3NPF A;  3M0S A;  1T0J A;  1YCS B;  2B86 A;  4HVW A;  2LJ1 A;  1X6G A;  2JW4 A;  2LNH B;  4OMQ A;  2HEQ A;  4RTY A;  3EG2 A;  5EC7 A;  1WDX A;  1X43 A;  3NGP A;  1M8M A;  3H41 A;  1AEY A;  2AZS A;  1NLO C;  3H0F A;  4AFQ C;  5I11 A;  2L0A A;  3REA B;  1ARK A;  2KNB B;  1T3L A;  1CKA A;  3PVL A;  1VA7 A;  3UA6 A;  1NYF A;  2FEI A;  1V1C A;  1G83 A;  2CUD A;  2O9S A;  1K9A A;  2OJ2 A;  2DA9 A;  2ROL A;  1SRM A;  3IQL A;  2YUO A;  4WCI A;  1W70 A;  2EGA A;  2RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...