1S1TB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
437
structure length
416
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 111
structure length 416
sequence length 437
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1tB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1tB04
1RT1B 1LWEB 4EEYA 5KT7A 1HPZA 1J5OB 4ED6A 3BREA 1C0UB 4DEZA 3MECB 1VRTB 1TL1B 4HKQA 4URGA 1QE1A 1N48A 3LALA 2AGOA 4K4UA 3PHEA 5J1EB 3KLIB 5KFLA 4JV2A 3HVAA 3DRSB 2ALZA 5KFTA 2BQUA 1XR5A 2JC0A 3MFIA 4K4ZA 5KFUA 5J2QB 1EETB 3RBDA 1TKTB 4ID5B 2FLLA 2IAJA 4TXSA 4O3SA 3DLGB 3N6LA 5L9XA 5F8HA 5F8GA 1RT2A 1LWCB 2ZE2B 2CJQA 2ILYA 1FKPB 3ISND 2FVSA 2E9TA 4ZHRA 5F8MA 2XI3A 3H2LA 4NLVA 5HBMA 2WONB 3KK1B 5KFEA 3HVTB 1JXLA 1IKWA 1N56A 3HVWA 2FVCA 3M8PB 1HYSA 3PW4A 4H54A 3RB4A 4KO0A 1DTTB 1RTIB 4ZP6A 5I3UA 3KHGA 2HNYB 5KG1A 3ICLA 1S97A 4O3RA 1BQMB 3H98A 4NLUA 3DRRA 3G86A 5DLGA 3QIPB 3N6MA 2HMIB 1T03A 1S6QA 1FK9A 3RB0A 4EO8A 2BRLA 1JLAA 1S1XA 3UQSA 1RYSA 1HNVB 3QLHB 4ECZA 1SV5A 3IN5A 5KFJA 4RNMA 4FBUA 1ZTWA 4ED3A 3QIDA 4QWBA 5HP1B 3G6YA 3KHHA 3IS9B 2OPPB 2RDJA 2B5JB 2BE2B 3QZ7A 5J2MB 4K4YA 5KT2A 3OL7A 1C0UA 1UWBA 5JUMA 4ED7A 4NCGA 2WTFA 2D3UA 1JX4A 1KLMB 2QV6A 2J6TA 4Y2AA 2DPJA 3IRXA 2JEIA 4NLTA 4I7FA 4RW4B 1REVA 1EETA 5DQIA 5KG6A 4IRCA 4H4MA 3Q8SB 1RT6A 2IC3A 2YNGA 5KG7A 4LQ3A 4IR1A 3PR5B 2RF2A 3DMJB 3JYTB 2CKWA 2VG6A 1DTQA 1S1TB 2V0NA 4TLRA 3PW0A 5CYQA 3CDEA 3H5XA 4H4OB 1N6QB 3SFGA 2HAIA 4EBDA 2YNHA 3DYAB 1S1UB 5KFZA 4IR9A 1MMLA 1TKXA 3H5UA 4PQUA 3M8PA 1HYSB 4R5PA 4KE5A 1N5YB 5L1LA 5KFHA 1HNIB 1JLBA 2GC8A 4NZ0A 4WFXA 2V4QA 1YVFA 3QIPA 4JV1A 2C28A 4IG3B 1RA7A 2BR0A 1ZTTA 4IOBA 4F4YA 1MU2B 4IFVB 3V81A 1W25A 1RA6A 3DOLA 4RW8A 2AX1A 2VG5B 4KKOB 3RBEA 5HLFB 4O44B 1C1BA 1RTDB 4YMEA 3PR4A 3MEGA 2YNFB 4M94A 4NLDA 3EPGA 4LQ9A 4J9QA 4Q45A 4FS1A 2D41A 4ZVFA 5C42B 1KHWA 5C24A 4TYBA 2UVRA 3DLEA 3C6TA 3NBPB 1R0AA 2OPPA 4TQSA 4I2PB 2ATLA 2YKMB 4ECRA 2OPQA 1EP4A 4G1QA 5J2PB 5D3GB 2D3ZA 4TY8B 2UVUA 3NMAA 2IJNA 5KFIA 2D7SA 3LANA 5KFXA 1U09A 1UWBB 2R8GA 3LP1B 2ZD1A 2BQRA 3LP0A 2W8LA 1JKHA 4O3PA 3E01A 4WXWA 4DL3A 1TL3B 1RT7B 5FDLB 1KLMA 1I6JA 2UUWA 3Q8RB 4EBCA 4I2QB 4IDKB 2I5JA 1JLCB 4ZMMA 3Q8PB 3DLKB 3TAMA 3GIIA 5DLFA 4MKAA 3MEEA 4J9OA 4DL6A 2YKNB 5J1EA 2RKIA 1S1WB 2HNYA 4ZVEA 3KLFB 3D28A 1TV6A 3KK2A 4RNHA 2XC9A 2W9CA 3LAMA 3KLGA 3QO9B 4TN2A 2R8IA 4EYIB 5DGAA 3KNAA 3DRRB 1TKZB 2FVRA 4NLOA 2YNIA 3QYYA 3T19A 4Y3CA 3LP2B 1JLAB 1S1XB 3H5SA 3I5AA 1D0EA 1HQEA 1BQNB 1RTJA 3QGHA 5C5JA 2W9BB 1S9GA 3BSNA 1LWCA 2ZE2A 2XCPA 1WNEA 1RTHA 3V4IA 4ZHRB 3RAQA 4B3OA 3HVTA 1DLOB 4J9LA 2W8KA 2I1RA 4EBEA 4IH7A 5KFYA 2B6AB 4HYKA 3D5MA 2O5DA 2BANB 4MH8A 4IG0A 4ZPCA 3RB3A 4YP3A 4O4RA 4URQU 4OL8A 3MR2A 3I5CA 3OL8A 2E9RX 3CJ3A 4IH5A 2ZKUA 1GX5A 3GILA 3C6UA 4JV0A 1C0TB 4MKBA 1S6PB 1VRUB 5C24B 1T05A 2IA6A 1REVB 1RAJA 1VRTA 3CJ0A 3NAIA 4DL7A 2QE5A 1RT4A 1RDRA 1JLEB 4KFBB 3DRPB 3DDKA 4IRDA 2RF2B 5KFFA 4PWDB 2ZD1B 3RB6A 1DTQB 1C2PA 2XI2A 1S1VB 4WYLA 3M9MB 2WK4A 1LW2B 4IH6A 2IM3A 4Q8EA 2B5JA 2BE2A 2V4RA 2I5JB 3JSMB 1KHVA 4ED2A 5F8IA 4Q0BA 1TL1A 3CJ2A 4MK8A 4RUAA 3DOKB 3QLHA 4KHRA 3I0SB 4QW8A 5F8NA 2AQ4A 4MK7A 3RAXA 3MR6A 1RT1A 3UR0A 5KT3A 4RW6B 5HROA 3Q8QB 3KK1A 4LSNA 3CVKA 1XR7A 3IS9A 4QW9A 3MECA 2OH2A 4O3NA 1FKOB 4KV8A 4DG1B 4RW7A 5EWFA 3PZPA 2GIRA 4IFYB 4ZVGA 1SH0A 4TQRA 3TQ1A 4RW9B 3CDWA 2VG7B 1S9GB 4NLSA 5HLFA 1NHUA 2HNZA 3GIMA 4WYWA 5KG4A 2VA3A 3V4IB 3ITHA 3LAKA 2XWYA 4Q8FA 2R8HA 4G3IA 2FJVA 2IMWP 1CSJA 4XPEA 2IAJB 2WRMA 2AGQA 3CWJA 3PW5A 4PQUB 3KJVB 3FFIA 4KB7A 1QE1B 3MFHA 3NKYA 4TY8A 4NLRA 4ED0A 2WCXA 5F9NA 1HMVB 3KLVA 1ZETA 3OLAA 2WONA 3E01B 3EPIA 1IKXB 3DI6B 2GIQA 1IKVA 4WFYA 5J2QA 5FDLA 3DM2B 4PUOA 2W7OA 1N6QA 4NLWA 3MEDA 3C6UB 4WE1A 2FVPA 3UDLA 4YQWA 2WOMB 4TY9A 2XCAA 4NLXA 5J2MA 3M9NB 3T5HA 1GX6A 1IKYA 4RU9A 3H59A 4NLYA 1RT4B 5CYMB 4O4GB 1S4FA 2HNDA 5C25B 5F8JA 4X2BA 1FKPA 2JEFA 1S1WA 3QGIA 4F50A 1HPZB 5KFAA 4K4XA 3KK3B 1LW2A 3NAHA 2WHOA 5DG9A 1R0AB 4QPXA 4ICLB 5KFVA 4QWAA 2IBKA 3EZUA 5L1IA 5J2NA 5J2PA 1JLQA 2R8JA 1JLFA 3BGRA 3LP2A 3V6DA 5KFCA 3MR3A 2C22A 1LW0B 4IRKA 3GIJA 1HQUA 1RTJB 3V6JA 3T1AA 3CJ4A 4NCGB 4ECTA 4NLQA 3SI8A 4ECVA 5KFMA 4QWDA 4DL2A 2J6SA 5DG8A 2IM0A 4IKAA 2EC0A 3KLEA 3KLHA 1FK9B 4ECWA 3OSPA 4TYAA 1TKXB 4MIBA 3IG1B 5EUHA 2FVQA 5KFSA 4MFBA 4WZQA 1T94A 4NYZA 3N6NA 3KMQA 1TL3A 3QO9A 4R8UA 4I2QA 1RYRA 2E9ZA 3CO9A 1DTTA 1RTIA 1SH2A 4O3QA 4NRTA 4ZPAA 3DLGA 1BQNA 1S9EA 1SUQB 4R5PB 1D1UA 1S1TA 2OPSA 4WFZA 3OHBA 2W9BA 2BQ3A 2RKIB 5F9LA 5F8LA 2F8EX 3G6VA 1JLGA 1TVRB 2HWHA 1QUVA 3HKWA 2FLNA 2V9WA 1TKZA 4URSA 2YNGB 1SV5B 1RT5B 5K14B 1QAJA 4O3OA 4FBTA 3DMJA 3JYTA 3DRSA 5DG7A 4RW8B 4WXOA 1C1CA 4O4GA 3I0RA 1NNDA 4MIAA 4J9RA 4KAIA 3UPFA 4YR3A 1TKTA 3GV8B 1TP7A 1OS5A 1T03B 3BSAA 1S6PA 2UVVA 4MK9A 3FSIA 2HWIA 5KFGA 4LSLA 2OPQB 4G1QB 4J9PA 3H4DA 3DRPA 2IM2A 4O44A 4PWDA 1LWEA 1N4LA 1LWFA 2VG7A 4RNOA 4K4SA 1J5OA 2OPRA 4GC7A 4M95A 3MF5A 4QWEA 2YKMA 1RT3A 4KO0B 2RDIA 1VRUA 2YNIB 3DLKA 3M9OB 3DOLB 5HP1A 2YKNA 3H40A 4MFBB 1C1BB 5CYQB 1JIHA 1HMVA 4NLPA 1S0OA 4K4TA 2R2UA 5KT6A 4J9KA 1S10A 1S1VA 2HMIA 4ID5A 2W9CB 3OHAA 1NHVA 3BJYA 3DYAA 4J9NA 2IC3B 5T14A 2JC1A 3NL0A 1RT2B 4Y2CA 3GIKA 1S0MA 1N5YA 4IQXA 4Q0BB 4ED8A 2AX0A 3LP1A 1QAIA 1S48A 2VG6B 3IRXB 2R2SA 1XR6A 4JUZA 4RW4A 4XO0A 4NLGA 4ECSA 4KSEB 1TVRA 4IDKA 5KG5A 4J9MA 3KK3A 1S1UA 3OL9A 3BR9A 3T5KA 5JXSA 3T5LA 1MU2A 3V81B 3KJVA 3HHKA 5EWGA 1RT5A 5K14A 5KFOA 1JLFB 3BGRB 3V6DB 3IGNA 3PVXA 3KLFA 5DQHA 3GV7B 1HQUB 5DGBA 5KFWA 4EYHB 4DL4A 3I0RB 5KFKA 5C42A 4F4XA 4QWCA 5KFNA 4YR0A 1S49A 1RT6B 2W7PA 1C0TA 5EWEA 1IM4A 4IG3A 1K1SA 1K1QA 3CIZA 5KFPA 3T5JA 4WZMA 3KLIA 4IFVA 3FFIB 4RZRA 3BQ0A 5KT5A 2DPIA 2FJWA 3KHRA 4ECYA 1RTHB 3MR5A 3QZ8A 3FQLA 2W9AA 5HROB 3G6XA 1LWFB 2R8KA 2YNHB 1IKVB 4RNFA 2OPRB 1DLOA 2AWZA 2FLPA 4R8UB 4I2PA 3MEDB 1FKOA 1HNVA 2JLEA 1RT3B 2B6AA 4WE1B 5KG3A 4Q43A 1JLQB 4U7CA 2AGPA 1S9FA 5I42A 4J9SA 1LW0A 4ZP8A 2YNFA 3MEGB 3IGVA 3TVKA 5HBMB 5KFBA 5KFDA 2UVWA 2OPSB 3H5YA 4I7FB 3KHLA 2HNZB 2ASJA 1IKWB 1RT7A 3M8QB 2IM1A 3BQ2A 4ECQA 2R2TA 3MTKA 4RUCA 5KT4A 3JSMA 5I3UB 2ILZA 4F4WA 3V6KA 4ICLA 4KV8B 4DG1A 3FQKA 2FJXA 3OLBA 3MEEB 4FS2A 1JKHB 1T3NA 3I5BA 4IFYA 1BQMA 2UUTA 2WB4A 3FRZA 3BSOA 5L1JA 4H4OA 1SH3A 4ZP7A 4RW6A 1C1CB 2R2RA 3CDUA 1IKXA 3DI6A 2AU0A 5KFRA 3C6TB 4RNNA 4PUOB 4H4MB 4YR2A 2C2DA 5D3GA 1S0NA 3KLEB 3KLHB 4ZVHA 3H4BA 4U6PA 3GQCA 1Z4UA 1IKYB 3NGDA 3DOKA 4ZPBA 2JEJA 1S9EB 1SUQA 2B43A 5KG0A 2HNDB 3V6HA 2C2EA 4ECUA 4F4ZA 4B3OB 3FDSA 5L1KA 4GC6A 3KOAA 3PW2A 4XPCA 3QGGA 4K50A 3VQSA 3GV5B 5EDWA 1HARA 4R0EA 2JEGA 1JLBB 4RW9A 5KG2A 4IG0B 3BQ1A 5C25A 3PW7A 4ZP9A 3KLGB 2IJFA 3GYNA 3DLEB 3NBPA 3ITHB 3DM2A 1JLGB 3ISNC 5DQGA 1EP4B 2BRKA 2VA2A 2WOMA 3PJXA 1T05B 3E51A 4K4VA 1TQLA 1HQEB 2BANA 5J2NB 2ASLA 2VG5A 4KKOA 3PJWA 4KBIA 3OL6A 1RTDA 5KFQA 5I42B 4Y34A 3OSNA 2XGPA 4ED1A 4ECXA 3KMSA 4LSNB 1S6QB 1JLCA 4NRUA 3M8QA 3CJ5A 4Q44A 3TAMB 4RW7B 1JLEA 4KFBA 2XGQA 3BSCA 4EO6A 2C2RA 1HNIA 4KHMA 4DL5A 4LSLB 3LP0B 1TV6B 3IG1A 5CYMA 3KK2B 4ZPDA 3SFUA 3I0SA 4K4WA 2J6UA 2ASDA
chains in the Genus database with same CATH superfamily
4YY3J 4GKJF 3ZZYA 3IBFB 4EEYA 2DGSA 2DGVA 3A1YG 2J8AA 1GK8A 2XYHB 2V50A 3I9V9 4I6WA 3BREA 1EQ0A 4ANDA 3FJ2A 1KRPA 2XLJA 4QIGA 3DLHA 1Z2LA 1OPZA 4ZCKA 4DV5J 5J1EB 4OJHA 3KLIB 1UFWA 3KTQA 4JV2A 2Y1IA 3N9UC 3DHXA 4CZCA 1U1MA 1VQ5S 2JC0A 2CQDA 2KJVA 5J2QB 4YDDB 2MQOA 3Q2TC 2UXCJ 2E1AA 4G65A 5A8KB 4JI4F 4WKRA 2XMKA 3DLGB 2BW7A 2DXFA 2HQGA 3KWMA 3N6LA 5F8HA 1D8YA 4P7TA 4X84A 2F1FA 2BYCA 3L95X 1FKPB 2BJ9A 3CD7A 1HBMA 3P6YC 3DOMB 5HN0A 1ZZFA 4ZITA 3WZ0A 3J81j 1U1PA 2UP1A 3IA0A 4NASA 1SVDA 4WK3A 1QVFR 1KQGB 1T9VA 2IYIA 2FVCA 4D3HA 1PBAA 3M8PB 2CZ4A 2H3EB 2LCWA 4WK1A 1JJ2R 1TL5A 2YH0A 1S5ZA 5I3UA 1ZAXA 2AJ2A 4ANEA 3PYFA 1U2FA 2DIVA 4OHYA 1LOUA 4NEYA 3BB5A 5E2QA 4JI0F 2GJFA 4O3RA 8ATCB 3NNHA 4Q7AA 2GZOA 3D2WA 2WB1D 4ZVSB 3QIPB 4NXMF 5IZHA 1XERA 3AD8C 4KPCA 1XIQA 4OZ0A 3RB0A 4RU2A 1AUDA 3TA2A 1JLAA 3OXFA 2R42A 3PIOQ 1RYSA 1HNVB 3ULHA 4ECZA 1Q5YA 2J9DA 2OP5A 3M1VB 5E3PA 2FYXA 2RUSA 4AE5A 3ZZ0A 1PO6A 4DR6J 4IO1A 3QIDA 4KGVB 1L5UA 3SV4A 1WEXA 3LF0A 3PKYA 2EXUA 1Y3JA 3BPSP 4NXNJ 1TFWA 2B5JB 2BE2B 4ANCA 2RDDA 2FZGB 3G87A 2QA2A 2HBYB 1RBOB 1MN9A 5KT2A 2PFFB 3R7NB 3VAIA 4GKJJ 3CULA 3ADAC 2Z56B 1WELA 1G6BA 3R8YA 2XMAA 4HDHA 3IP0A 1KLMB 3QQCD 4UOFA 2DPJA 1UKUA 4NLTA 4I7FA 3KDOA 4OYOA 2YWWA 4RW4B 4PG6A 1RK8A 4BC7A 1EETA 2MEWA 4EMDA 5DQIA 1S72S 4H4MA 4IRCA 5A8KA 1IN0A 2OFHX 3G82A 4IR1A 2AYMA 3KJFB 3DMJB 3JYTB 4LR7A 1KFSA 1RP5A 3JTOA 4IOAQ 3T1YF 1NKBA 3D6TB 2MZJA 4CDIA 4DPUA 2XMVA 1VQSA 2JVOA 5E0OA 2Y8WA 2DGXA 3GFXA 2FY1A 4B3TF 1FHTA 1HNZJ 4EBDA 5K8MA 2XY6A 2BDPA 1S1UB 2DITA 5ETSA 5AE2A 4R5PA 2DHSA 4KE5A 2WBMA 2J5AA 1KTVA 1LFWA 1QLNA 3SQOP 4ILMA 3FMBA 1VHIA 3OTBA 2MZRA 3OBIA 3TEHB 3MD1A 3QIPA 1VLOA 1FDBA 2NUHA 4JV1A 2BR0A 4DCJB 3MHYA 5CYJA 4F4YA 1MU2B 4IFVB 3W3SA 1SJRA 3DOLA 3IWXA 2JHEA 1QAYA 2JFKA 3RBEA 5L9NA 4O44B 4YMEA 2ZH1A 3OJUA 3MEGA 3EPGA 3OVSA 4J9QA 4Q45A 2XY7A 2V2KA 2YPZA 5C42B 5FJ4A 5C24A 4HHJA 3DLEA 2RILA 2ATLA 1NK7A 5HQMA 4TQSA 1YG0A 4LF8F 3ZZZA 4ECRA 1EP4A 4UQTA 4I0WA 3HHLC 4FPIA 2D7SA 5KFXA 1FNXH 1AT1B 2I2YA 1UWBB 4LF4J 4ED5A 3LP0A 2W8LA 1HIYA 1NKEA 2DNPA 1FRIA 3E01A 2Y3YA 3Q8VA 1Y5LB 4O3PA 3WDOA 2VV5A 4DL3A 1TL3B 3U1MA 4E0DA 2XZWA 2FPHX 3BO2A 1N34F 1X4BA 2AJ1A 2CPDA 3FEZA 2QL5B 4EGLA 4OX7A 2CFXA 4LVNP 3DLKB 3BKFA 3GIIA 5DLFA 4I6AA 5J1EA 2RKIA 3LGNA 1S1WB 4ZVEA 1SKWA 3W5YA 1KR4A 1M0SA 2PE8A 1ACMB 1FRLA 2KI2A 2CVIA 2LEPA 3FEYB 4G1IA 4LUBA 3KLGA 3QO9B 1MWZA 3MDFA 4TN2A 3AB4B 1XMOF 3KNAA 4UQGA 3KKFA 4NLOA 3RYLA 2QA1A 3T19A 4Y3CA 2H48B 2VB6A 3W9HA 3J81U 3L4BC 2LQBA 3H5SA 4G1PA 4P52A 1D0EA 4JYAJ 3BH6B 3QGHA 1B64A 1YGYA 2XCPA 4DV3J 2UV8G 2XYGB 3ET6B 2RHSB 2Y1JA 1TK0A 3GJRB 3J7ZT 3VVTA 3D1QA 3HVTA 3UR3C 1U1LA 1NDKA 4PYDA 4UOHA 2RRBA 2QGFB 1NHKL 4N7TA 2YX4A 2QFIA 1AROP 4KC5A 1YBUA 2FB0A 3M6XA 3QRPA 3A3OB 3MPVA 1WHXA 3AJ1A 4O4RA 2E9RX 3DU5A 3OL8A 2VPZB 3CJ3A 4IH5A 2A10A 2P9EA 2AJFE 1M1HA 3AHPA 1RLDA 4A8YA 2R7QA 1SKSA 1SBRA 4J9VA 3NS5A 2FIUA 1VRUB 5C24B 4C0OC 4F26A 2F9JA 5MAOA 2VOOA 2QE5A 4NXNF 3IM8A 1QY7A 3DCAA 4K59A 2QSWA 4M5IA 2MMYA 1WJ9A 3OT9A 4QIWD 2PI4A 3KJNB 1L3VA 1HI0P 2XB2D 3IAS9 2V8GA 4F8RA 2EKYA 2ZZTA 1MG7A 4WYLA 4Y65A 3M9MB 2WK4A 2LU2A 3C14A 1H2UX 3MM6A 1WOPA 4IH6A 1GMWA 3QAUA 5CD4A 2ZH5A 1PILA 4CM0A 3CUNA 4DR2F 1NJWA 3MAQA 2V4RA 2KT5A 3JSMB 2F4FA 2RJZA 1JK9B 2YKPA 3TWZA 2OHDA 3CJ2A 3ZZPA 1WEYA 2HYIB 4AQYF 3DOKB 5IWAF 1SKRA 1T7PA 1T3OA 1SJ3P 1V9OA 4CTAA 4QW8A 3SV3A 2FUG9 4HH0A 5KT3A 4DXLA 4UZBA 4KGKA 5D0GA 1Z1ZA 4ELVA 3HHNB 2GQ2A 2G0JA 1B3TA 4B9NA 3MECA 5B0FA 3NGUA 1PC4A 1FKOB 2BOPA 4LR9A 2OH2A 5EX0A 4RW7A 3PZPA 2BJ7A 3GLJA 4KR0B 3NMRA 3BM7A 5DDPC 3PFOA 5JVHQ 1DRZA 4NLSA 2E5LF 5DZ7A 3G71S 2J9DE 4WYWA 1G3OA 4ES1A 1Y4ZB 3ZZOA 2XWYA 3MPWA 3R2DJ 2VZ9A 4PG8A 3T3FA 3OPKA 2IAJB 2CDRB 1XTZA 3CWJA 3PW5A 3KJVB 2V8VA 1WKKA 2E7VA 4PWWA 3WIUA 3HSZA 3JS9A 3K5MA 2R7SA 3CPWR 2EW9A 3KLVA 2MLYA 1NZ8A 4OI4A 1HNXJ 4DQQA 2HHUA 3EPIA 3DI6B 2F9DA 3U1NA 5T7LA 5FDLA 1YHQS 1I94F 4N5SA 3C6UB 3BV8A 1CQNA 4TY9A 3S6EA 4NLXA 2NUUG 1X60A 2OAUA 1HL6A 4DF4A 5CYMB 1F1BB 3A8JA 1FX2A 3U02A 2BJ1A 5C25B 3VAMA 3TVYA 4XIUA 4HI2A 4PABA 4M5DA 2NS1B 4ER8A 2QTWA 3L7OA 4FXDA 5DETA 3KK3B 4C8LA 2QC3A 1ZPWX 4I64A 4ICLB 3A8KA 4OX8A 3EZUA 5J2PA 3NOCA 3IMQJ 4X4SA 1QD1A 3BGRA 3LP2A 3V6DA 4P7VA 5KFCA 2C22A 4NCAA 2HFVA 3F73A 3GIJA 2ZBRA 4ZIVA 4NCGB 4DN0A 2A2CA 4NLQA 5CCLA 4ECVA 5KFMA 2J6SA 1TUVA 5DG8A 1NH7A 1VQNS 4RLEA 3ENWA 4QR1A 1ZM9A 4WBFA 5C2GA 1T9WA 5U47A 2VFVA 1XK8A 1Q8LA 1TR0A 2QLXA 3OR1B 5EUHA 1M5OC 4TKTA 3X3UA 5FLXY 2ZZNA 3FBCA 1T94A 4WZQA 1KSPA 2JFDA 3N6NA 3KMQA 1EAYC 3CJKA 1FWPA 4F4KA 3MGJA 3TR5A 3QO9A 5D4NA 3VAJA 2X1GA 4CM2A 4YB1P 1URNA 3OFFA 2Z2YB 1RYRA 2FHMA 2J9EA 1SI9A 1RTIA 2R7OA 4CO1A 2YWGA 3I31A 1MROB 1BQNA 2CPHA 4R5PB 3OTDA 1S1TA 2OPSA 4NXMJ 2ZITA 2BQ3A 5F9LA 5CD4H 1WC0A 2PMZD 1JLGA 1XNQJ 4DR6F 4X4NA 2HWHA 2YKAA 1CC8A 5ETLA 1WG5A 3M4XA 1YJ9S 1TKZA 2NXEA 2V9WA 3MCOA 1QAJA 2E5GA 3DNCA 4KRWA 1SQEA 2CIMA 4B9VA 4B3MJ 4FBTA 4LF9J 1MWYA 1D9DA 4TU8A 4RW8B 1DQ8A 2V5HG 1R89A 3MTJA 4KT0C 4Y2MA 4I67A 1UW9A 1JXEA 2KXFA 2N4DA 3T9NA 3UPFA 3CCES 2UUCF 2DIUA 2NSBA 1RTZA 3QSYB 1T03B 2E1RA 1N5TA 4FPRA 1S6PA 2UVVA 3A8EA 3L09A 2JOQA 4OMFG 4W92B 1B7FA 2HWIA 4LSLA 4EWTA 1A9NB 2IHR1 4Y00A 2D74B 3N5FA 1N88A 5A2QY 4FYYB 2QEXS 3TUZC 1LWFA 4KGXB 1JJ4A 3K5OA 3R5CA 1BUXA 1GXTA 2BZ2A 2KT3A 5E3CA 4YHHF 2ZJQQ 4GC7A 2KZMA 4FF4A 2YKMA 4OYMA 5CQGA 1G4CA 3NGRA 3HULA 2YNIB 2EK1A 3HDSA 4PKDB 2XLIA 1W2IA 4HL9A 2MTLA 5AXMA 3SYZA 5DJBA 1WHYA 3GJSB 4L75A 1JJHA 7FDRA 1G1XA 5HP1A 2JL9A 2MY7A 5A8WB 1JIHA 3HHLA 1HMVA 2Y0SD 2GAHC 1N36J 2ZNYA 2EFOA 1TAQA 3GU0A 3HVRA 4ID5A 3LQVA 4JI7J 1X9SA 3BJYA 3DYAA 4J9NA 1UVLA 7FD1A 1NSAA 1PG5B 5H9EJ 2IC3B 2R7XA 3LTOA 1RT2B 3BKUA 4Y2CA 5IM0A 3SSSA 3GIKA 1RWMB 1N5YA 1G2EA 4Q0BB 1UZHA 1FJ7A 3LP1A 3UWTA 4M5LA 4CO5A 2VG6B 2DGUA 3CJSA 4DR7J 2R2SA 2N7CA 3VVUA 4P2MA 4ZJOA 2DT9A 3FKBA 3GFHA 3RRKA 1CJKA 4YS2A 4ECSA 1UW4A 3UCGA 1YJVA 3K59A 4KSEB 4P6QA 5KG5A 2CYYA 3PACA 2XULA 4J9MA 3BR9A 3T5KA 2ZBPA 3RRGA 4DU7A 3KJVA 3BO4A 4N8NA 4ILLA 3ZTQA 4FXVA 3THPA 3P3DA 3MM7A 3KLFA 2H4YB 5C42A 4ILRA 3EGVA 4QWCA 5KFNA 5GAHI 3UDEA 5EWEA 1IM4A 4CH7A 4E98A 4DV4J 3IFEA 1U1OA 1RWKB 3KLIA 5E33A 3IM9A 2VONA 4WIIA 2I6WA 2GAGC 3MM5B 3VAHA 4ECYA 1WSVA 5C2CA 1X0FA 2RB7A 1ZZNA 4UUWA 4KJIA 2B4VA 2J7UA 3BH7B 5ETRA 3C66A 3CTRA 3QT6A 2KM8B 4R8UB 1N0VC 4LFBJ 3MEDB 1FKOA 1A6LA 2B6AA 2YY3A 3BYRA 4OX9F 1JLQB 3HZEA 1F3FA 4Q43A 2KKHA 4U7CA 4YFUA 1NU4A 2AGPA 2DR7A 1TFYA 5KFBA 1N5SA 2ASJA 3HD2A 3D0IE 2HLTA 3BQ2A 5G4DA 4OHZA 5HANA 4AL5A 2OMOA 4RUCA 1QSYA 5KT4A 2CQHA 5I3UB 2V2QA 3MPDA 3V6KA 4WTOB 2GFFA 3FQKA 4YY3F 3HX9A 1T3NA 3R7BB 4HH1A 1JKHB 1TL7A 1T8EA 4IFYA 3P5TL 1FRKA 2WB4A 1J27A 3BSOA 2CUYA 1P1LA 2DGWA 4ZP7A 3HPOA 1C1CB 4LSZB 5BR8J 2AU0A 3CC7S 4ZLPA 3CW2C 4DR4F 1OWXA 4DV5F 1X9WA 3HCXA 1VQ9S 4YR2A 3J7A1 2RMLA 3R5GA 2C2DA 3Q83A 4ZVHA 4NYPA 3E8OA 2EG2A 1RHMB 4PWUA 3BR8A 3NGDA 1IVZA 3EVMA 2KHDA 1CJVA 3SXLA 5ETPA 1FRHA 4ECUA 4DV6J 3MCSA 4B3OB 2HZCA 3FDSA 3QRRA 5J1PA 1CJUA 1WDTA 1M5VC 5IWAJ 3KOAA 4YUDA 2RT3A 4X66J 2VASA 3MURP 1NDLA 5DM7Q 1GTHA 3K89A 1YJNS 1FWKA 3D1OA 4O0NA 4LREA 4FKXA 3NOGA 4R0EA 2UZAA 1JLBB 1OQ6A 3ZTOA 5KG2A 3U7JA 2Y1LB 1PC5A 3KLGB 2BACA 3GYNA 3NBPA 3ITHB 2LECA 4C97A 4U96A 2VA2A 2BRKA 3OFHA 3EDQB 3JTPA 4DI6A 2G13A 1NLKL 2HAFA 2BANA 4DFMA 1PBUA 2UUBJ 3PJWA 4KBIA 2B3TB 1H73A 2XZTB 3T9ZA 1Y7PA 5KFQA 5I42B 1NK5A 3JXOA 5K8NA 4OX9J 1N52B 1VBKA 2I38A 4JI3F 3IAM9 4U7UD 1JLCA 2ZWOA 2CA9A 4LFAJ 3M8QA 3B8HA 2DVIA 4LFCJ 1VR6A 2K3IA 2AEMA 4RW7B 4ES2A 5AE3A 2ROEA 2QMXA 1Y5IB 2BUNA 2YVSA 2PA3A 4CIOA 4DL5A 1TV6B 3KK2B 1PYSB 3AOAA 3ILIA 3OR1A 4C8MA 8RUCA 2XY5A 1I94J 1YBAA 1M5KC 2ZHOA 1NSPA 2VF3A 3L3CA 1RT1B 1U6FA 3TUIC 3BKTA 3CF5Q 5KT7A 2KM8C 3RZAA 3R5AA 1KQKA 1J5OB 3OFEA 4L72B 2AJ0A 2AW0A 3TX0A 4F04B 4LMZA 4P73A 1LK5A 2DNZA 5E3AA 5SUHA 5K8PA 1QE1A 1N48A 1Q7LB 3BBBA 2FTRA 2MQNA 3HVAA 3TX8A 4LF5J 3MZIA 2BQUA 4OIXA 1PKUA 3MFIA 3GONA 2RQCA 1EETB 1TKTB 4OYIA 3GWCA 3FCHA 4AL7A 3T1YJ 2WVCA 3KJQB 1FJGF 3WIVA 3VZIA 2FLLA 1WKLA 4TXSA 4O3SA 3I4PA 5K5MA 2F7VA 1BWVA 5F8GA 2CJXB 2CJQA 1OSCA 5DS7A 4CLPA 4QJVA 4BC9A 1M5SA 2PMHA 3ISND 2FVSA 2QN6B 3CCWA 4ZHRA 2E1MC 2XI3A 3H2LA 1P6TA 3UN5A 3BN4A 2WONB 4D3GA 3FBFA 3QNWB 4M5HA 1N56A 3PO5A 4NX9A 4DLGA 4OI0A 4K4VA 1FDAA 4OV1A 2ROGA 4GVBA 3AOCA 2BA9A 2LYVA 4DBQA 3RB4A 2EWHA 1WF2A 2WW8A 4CCHA 4ZCMA 3ICLA 4OYPA 1RWUA 3HP6A 3GSIA 4DFKA 2DY9A 5GAGI 3H98A 3AODA 4X4QA 3G86A 1DHMA 2LQ9A 2HMIB 4A8SA 3DC2A 2JZ5A 1FK9A 2LLZA 2MQLA 4FXWA 4NOHA 2BRLA 2P6TA 3W66A 4B9MA 3C46A 2A6OA 4FVCA 2HK3A 3QLHB 2LQ8A 1SV5A 3FRYA 4RO0A 4MT1A 5B0EA 3VGSA 4A8MP 4J91A 4LFAF 2H5IB 4RNMA 1ZS6A 4RJVA 4ED3A 2VQEJ 4JI5J 3M2VA 3G6YA 2Q3PA 2V2ZA 2VJUA 1WI6A 2EEYA 1R0CB 2SXLA 3GG0A 3TP2A 2RDJA 4F0KA 3W61A 3QZ7A 3OL7A 1RAHB 1UFLA 1UWBA 2HQFA 2D69A 2W24A 4G6VB 3JAMU 1U49A 1VOMA 1EHWA 4K5SA 3UFCX 4DUYJ 3PYDA 2PC6A 3NRBA 3Q22A 2JEIA 2FJEB 3DN9A 1XC9A 4B3MF 4QR0A 1FJEB 4BDPA 1KVJA 2NXCA 1ROFA 1CPZA 3ONQA 4DZ6A 2GHPA 2B51A 2DNOA 1RT6A 2KRRA 2OEMA 2XHCA 3GJQB 4HT5A 4USHA 2DISA 4PG5A 1SJ1A 4DSKA 4R0JA 2UUCJ 1ZYQA 2CQ2A 1YWXA 2CKWA 2D9PA 1DTQA 3QJPA 4I6YA 1CJVB 1KQSR 1OSDA 5CYQA 1B0VA 1Q4RA 1S12A 4H4OB 1RBAA 2QO3A 3SFGA 1XBWA 1FERA 2G0IA 3GFYA 2V63A 3PYGA 3QWUA 3UW1A 3M6WA 3E2EA 4OHWA 1PAUB 5KFZA 3J7YI 1MMLA 1TKXA 2W7OA 1NJYA 1L3UA 1IBLF 2FHJA 2RAQA 5F0WA 4CLWA 2ZH2A 4B3TJ 1DBDA 1U0HB 5IFMA 4CH1A 5L1LA 3RW7A 1HNIB 1JLBA 4NZ0A 3D7SB 4P71A 2MXYA 2KH9A 2BKPA 1Q82T 2J0SD 4FKYA 2V4QA 1UPMB 4K8RA 2CPFA 1N8RT 1YLXA 2HW3A 3ILJA 2DGQA 1VIXA 3GCXP 3NLCA 3ZC4A 4QU6A 5AT1B 1PJ6A 2DH7A 2NPFA 3MAHA 2C28A 1KC8T 4IG3B 2C3YA 3V81A 1W25A 2MSSA 1RA6A 1WDDA 2VG5B 4KKOB 1E6YB 3AOBA 1EX8A 1SC3B 1RKJA 1KDNA 3VALA 1C1BA 4RPFA 3TJ8A 2NXNA 3ZFVA 4X62J 3IWLA 4NLDA 3PR4A 1VQMS 3J80U 2K8GA 4FS1A 1RHKB 2Z0GA 4LBIA 4UF4A 3M2VB 4ZVFA 3OL9A 4XTTA 1R27B 4ES3A 4C2MA 2OPPA 2VFUA 2XNRA 2HHQA 2K3KA 1LNQA 4TY8B 2DNGA 3HZGA 3QT7A 2ZM6J 1VQPS 4FYVB 5KFIA 3LANA 2K1RB 3Q23A 1U09A 5FIIA 5LXYA 2ZVIA 5E7OB 2V67A 1JKHA 1TL7B 1GFWB 1H98A 4TU9A 1RGVA 4WXWA 2HBRB 3NGKA 1I6JA 5FDLB 1F6TA 4I2QB 1CJTB 2R3VA 3ZTPA 4DUYF 2L08A 1U48A 1OYDA 3DLJA 4YDXA 4ZMMA 3D67A 4C8NA 1NSKL 2POKA 3F44A 5HATA 3G96A 2OIHA 1H72C 4B9UA 3TAMA 2EI5A 4R25A 2LQJA 2YKNB 3J7Z5 3KLFB 1X5OA 3D28A 5E5NA 2XC9A 2GNKA 5GAGU 2DK2A 3IBCB 1VLYA 2ASYA 4OZLA 3QMQA 1NRKA 2R8IA 2CPZA 1VQ7S 4GO5X 1VIOA 3DRRB 4K2JA 1HWUA 4QIVA 1P8GA 1UAWA 3ZNUA 4CLYA 1ZM3A 4DL0C 3CJQA 4DPYA 2YNIA 1DQAA 4LBHA 1K47A 1KP6A 3M32B 4N47A 1JNRB 1WUUA 2W9BB 2Q1LA 2V69A 1URRA 3K8WA 3DFEA 5A8WA 2PEBA 3H7HB 4ZHRB 3OJSA 1FFSB 1WC3A 2D9OA 5A6PA 4KH1B 3PEHA 2HVDA 1SXLA 4DV3F 1AFJA 4J9LA 1EIYB 2O1PA 2F5GA 3KUHA 5J1NA 3HT3A 2GGPB 4IH7A 5KFYA 2B6AB 2V34A 5GAEU 3UD3P 4F3MA 1TUWA 3MPYA 5I3PA 3D5MA 2O5DA 2BANB 4MH8A 4IG0A 1Y5NB 2RE1A 1B70B 4CWBA 5GADI 3MM9B 1RAAB 3RB3A 2J76E 2ZKUA 1GX5A 1HBMB 4CO2A 3GILA 4K7QA 5LSLA 3I9ZA 3C6UA 4DV2J 4AXJA 1C0TB 3DDIA 1RE1B 1REVB 1SC6A 1RAJA 5CABA 3CJ0A 3NAIA 5ETKA 2AYBA 1RDRA 4AL6A 1FDNA 1HHQA 3DRPB 1VMBA 1X5PA 3DDKA 4Q2MA 4C0HA 2RF2B 2OSQA 4U8VA 3PRBA 5KFFA 3H25A 1N32J 1QUPA 3RW6A 2MSTA 3BO3A 2W2QP 1F60B 5K8OA 4U67Q 2B5JA 2BE2A 2A18A 2DO4A 2F3JA 2R9LA 3WC0A 2I5JB 3SZ2A 2HS3A 2OKQA 2AJQA 3KG1A 2PSZA 3Q89A 2Q43A 3CCJS 3BGLA 2KJWA 5F8NA 3O6QA 5K20B 3VAGA 3UR0A 4RW6B 5HROA 1MW7A 2LKZA 4CNYA 2O3DA 4LSNA 2PFDA 3CVKA 2M5YA 4WFNQ 4QW9A 3BS9A 4GKKJ 1BC6A 5BYRA 1JB0C 3K17A 4KV8A 1GXUA 4O3NA 4DUTA 5EWFA 1O0PA 1SIZA 4ZVGA 4YN3B 1SH0A 1PYOB 4PXCA 3TJ9A 4IO9Q 1HR0J 5BYQA 1F2GA 1NHUA 4ZIWA 2HNZA 4KTQA 2MLXA 5L8RC 4EFAC 3BDEA 4OI3A 2NYHA 2R8HA 4Q8FA 2DNRA 1UWAA 3MI7X 2FJVA 4HDGA 5D15A 5H9FJ 2H54B 3UVJB 2E5LJ 1CG2A 3VWSA 4CYUB 1HW8A 2LDYA 3FFIA 2BE9B 5BYSA 2Z30B 2CZVC 1N0UA 4NLRA 4ED0A 1I1GA 3P96A 5DDQC 5F9NA 1HMVB 1ZETA 2O01C 3SCJE 3OLAA 2E29A 3V2UC 2HHXA 2W2OP 1W7WA 1IKVA 4M5MA 2V4JA 1M90T 1KKHA 3DM2B 4PUOA 1V3RA 1N6QA 1NZAA 4NLWA 4WE1A 2BJEA 4HTIA 2FVPA 2IVYA 3UDLA 2G9OA 2MJUA 2XCAA 3RR7A 5J2MA 4OX6A 1HBUA 2OTJS 4KHPJ 1IKYA 3BZQA 2OFGX 4RWWA 3SQGB 4DR1J 4N41A 1S4FA 1YIJS 3HO1A 1WHVA 3B54A 2NXUA 1NJZA 3T6JA 2JEFA 2OO4A 1WC4A 4AD6A 2VBZA 2FZKB 3QGIA 4P75A 1FJGJ 1YJRA 1KLNA 2HRTA 5AXLA 1LW2A 3A8IA 3KXDA 5IXUA 1N5VA 4M63A 5DG9A 5KFVA 2ERRA 4DV6F 4ZVPB 2R8JA 4CI0B 3FEXB 4X66F 3PO4A 2GHWA 2YQ0A 2H5EA 4DX8H 3SI8A 4ECTA 2HQDA 1IBMF 4QWDA 3FUYA 5GADU 3FBBA 4CLKA 3R1LA 1LKZA 2EC0A 3KLHA 1RHJB 3W2WA 1TMMA 3ILLA 4TYAA 3G8QA 1TKXB 1K0TA 4B02A 4P72A 4C8ZA 2HHWA 3IG1B 1FKAF 1FD8A 3IRWP 1XQIA 4Y2KA 4KGZB 1WF0A 2HPUA 4DCPB 4B3RJ 2PO4A 5G0RB 2C1EB 2R4FA 4ZVTB 1WEZA 1HFEL 2ZDPA 4R8UA 1NK0A 2E5IA 3O3LA 2APOA 1SH2A 3H2VE 1UMJA 5ETVA 4JI3J 3HT0A 4TNOA 5GAHU 4H4KA 2Z8QA 3NGSA 1S9EA 3HF5A 3OHBA 4JP8A 2RS2A 2RKIB 2IVFB 2F8EX 4FNHA 4LRAA 1SB6A 1SC4B 3QSIA 4DU8A 5M2PA 3G6VA 3OVBA 2R7TA 1TVRB 2X1BA 2YQ3A 2YWEA 4F2RA 2VQEF 3UD4P 2L3MA 3DLBA 1SV5B 1DURA 2IPOB 4DSJA 2YX7A 2HFNA 1XNRF 2DNHA 3D0HE 4QBUA 1B0TA 3PX0A 1BMQB 5DG7A 1ZBTA 2RNEA 3CJRA 3CMAS 1RWVB 3RU0A 3I0RA 2K7JA 4OFZA 2P5VA 4MIAA 2BOAA 1U02A 1JMTA 1H7XA 1U26A 3C8YA 4KAIA 2HGMA 2MDAA 1TKTA 2W2MP 4FF2A 1TP7A 1OS5A 2CWKA 1KN6A 2LU1A 2HHVA 5RUBA 1FWLA 2GV1A 4RX6A 4ZOSA 3KNGA 3M2RA 3DRPA 4DWIA 4O44A 3VHQA 2ZUAA 5D0HA 4C6AA 2G1DA 1U1QA 4NWBA 3CCTA 3CJTA 2MGZA 2MKSA 2K06A 2VG7A 5SZTA 1DFDA 2C3MA 4C0BA 5DM6Q 2ZHBA 2VDIA 1VRUA 2IRUA 3L9ZA 4GO7X 3TZWA 1ZM4A 4YHHJ 5DDOC 2KZZA 3DLKA 2WAQD 3I55S 2KDOA 4LVOP 4BWMA 2YKNA 1X31C 2DO0A 2LXUA 4MFBB 3DRYA 1KOOA 3RGIA 2VDHA 1OQ3A 2QSFA 3TZYA 1TK8A 1NKCA 1S1VA 2HMIA 1UL3A 4JI0J 2DRBA 4X4OA 3C3LA 2Z2LA 1RWNB 1TELA 2QG9B 1P1TA 2B56A 4M5NA 4AFFA 2JC1A 2WW4A 5T14A 2VJVA 2Y8YA 4A8XA 4DLEA 1S0MA 4IQXA 1H3DA 2DTJA 1S48A 2EFQA 4P2SA 3AT1B 1XMQF 3I56S 4Y28C 2QYCA 3EICA 2DGOA 2F8HA 3HD1A 3HFKA 1HW9A 4OQJA 3W7BA 1VQYA 1AXQA 2B8PA 3N4WA 1VQ8S 2GIFA 5D4PA 1TVRA 1S76D 4U7UK 2Q6BA 2B9WA 3A13A 1IM6A 3UE2A 2MKKA 1MU2A 3T5LA 1VYAA 5IQ6A 5EWGA 2KYZA 2BEFA 2VU5A 3IGNA 2M4MA 2L9DA 1HQUB 2LA4A 5KFWA 2ZM6F 4EYHB 2WSFC 3IR5B 3I0RB 5KFKA 1Y9OA 3DLLQ 3GIMA 2FC9A 4UOGA 1EARA 2YH1A 4YR0A 3DRXA 1X4GA 1VHFA 1WC6A 1RT6B 3BPDA 1C0TA 2NLWA 2C2OB 2CDQA 3CIZA 4BWJA 4DPXA 5HMXA 3T6BA 5KFPA 3ENAA 3T5JA 3CMES 4B9LA 4NA3A 4IQMA 4USVA 3AY0A 3BBFA 4HACB 4O23A 2HIYA 1KQFB 1RTHB 5LT5A 2XBPA 3QZ8A 1NPRA 3FQLA 5HROB 3D54A 3N01A 5HK4A 3RAMA 3G6XA 1WKJA 4USMA 4PPDA 2QIFA 2QLBB 1VK3A 4RNFA 2OPRB 1DLOA 1E6VA 2VFRA 3D6HB 3K5NA 3FGVA 4O0IA 3HHEA 2JLEA 4DF8A 3MUTP 1HNWF 1FESA 1WC5A 1J5EJ 5I42A 3TYTA 5ADZA 1K0VA 2YNFA 1KVKA 1IBLJ 2HEKA 1RISA 2ZVSA 2UVWA 1B99A 2KTQA 4I7FB 2HNZB 4B17A 1RT7A 1SQFA 3M8QB 2RQKA 3NNAA 4ECQA 2J0WA 5HSPA 4CO0A 2KVQE 2XMUA 5I4MA 3UVJA 5HL7Q 3DGPB 4MYUA 3N5BA 2F4VJ 4ICLA 2VPWB 1TUGB 3D4JA 4KV8B 1H6KX 2MQMA 5EGYA 3JQJA 3HHDA 2H1YA 4C3MA 4DV1F 2UUTA 1OY8A 3R1HA 3ET6A 4DQPA 4DQSA 4L73A 5L1JA 5KTQA 1MMDA 4CRJA 2DNNA 3CDUA 4L6V3 3SSRA 1WTBA 4JI8J 1QSSA 2CJAA 3C6TB 4PUOB 4WJBA 3VQTA 2FQQB 3PX6A 4LF5F 3A12A 3M1VA 4U6PA 1FXRA 3HFVA 3S8SA 1Z4UA 1Q95G 1IKYB 2GS8A 2W1BA 2YKOA 3GCWP 2HHSA 1X5TA 1XWLA 2B43A 2YX1A 5DO2A 5KG0A 2C2EA 1IBKJ 1VI7A 3LH2S 1DARA 3FC9A 4DS4A 3VGVA 5L1KA 1UVIA 1LK7A 4XPCA 5ETMA 2WVFA 1HI8A 3G2XA 4N77A 3VQSA 2UXBJ 1HARA 3IBWA 3W1YC 2JEGA 2C2MB 3SQGA 4RW9A 1FF2A 4JI6J 1P9QC 1RAFB 3JSBA 4DR5J 3CE8A 2G2OA 5C25A 1ZH5A 2KU7A 2C3UA 2E44A 1IBCB 3ENVA 1YTYA 3A3PB 3M05A 2ZOMA 4PR6A 3WQPA 5DQGA 1EP4B 3EWGA 3KG4A 4PPZA 4EZ9A 1T05B 1FVSA 2CPJA 2RH3A 3M32A 2IFXA 3E51A 4C3LA 1QDUB 3ZZRA 3EUNA 3D68A 4KIAA 1OJ4A 1R6YA 4ZK7M 5B09A 2AZ1A 1P27B 4XDDA 3OL6A 2B4UA 4Y34A 3UD5A 1WG4A 4ED1A 2HVIA 2CAJA 1R7IA 4QYRA 3KMSA 2W4DA 4LSNB 1IWGA 2QLJB 2VFSA 1WF1A 3GR1A 4OJ3A 5CZVA 4C3KA 4DN9A 2GMJA 4X64J 4Q44A 1YITS 1I3OB 2HQCA 2VQFJ 1VQKS 4EO6A 3RBXA 1HNIA 3O1LA 4KHMA 4DCOB 4LSLB 3IG1A 2ZWPA 4K4WA 4K5RA 4OZNA 3W60A 4CTAB 2J6UA 1FE0A 3PY8A 3CDAA 1LWEB 4X4TA 1HPZA 3RR8A 4ED6A 1X5SA 1ICEB 3TI0A 2DEJA 3MECB 1VRTB 1TL1B 4HKQA 2DHXA 4DEZA 4MIWA 3LALA 2OMLA 4A8WA 3VAKA 4K4UA 2XZDB 4U8YA 5HVHA 4HLBA 1MROA 3DRSB 2KT2A 2ALZA 5KFTA 3W9IA 1FD2A 1QM9A 1KFDA 2MKIA 5LSRA 4K4ZA 2BJ8A 2NR0A 4ERDA 4FP9A 2M8HA 4WP9A 3SSQA 1AB8A 2M9KA 2R7RA 1H7WA 1Q8BA 1VFJA 4LR8A 3OD2A 4PG4A 5L9XA 3AA8A 1ELOA 1YJ7A 1LWCB 2ZE2B 4QZVB 3CC2S 4E8UA 3UCUP 2VD3A 3W64A 4IYQA 2XMWA 3MM7B 3RUBL 5F8MA 2RU9A 4NLVA 5HBMA 4ED7A 3R6LB 3EXCX 1NK6A 2DXEA 3F56A 1WI8A 2CRLA 2CQBA 2B9EA 4HT7A 1CJKB 2DNMA 4JI6F 3PW4A 4LIWA 1DTTB 4Y6IA 4ZP6A 2FGCA 5KG1A 9RUBA 2ZUGA 4DUZJ 2GW8A 4OYXA 2ZJPQ 4ZN1A 1BQMB 3H0PA 4NLUA 3DRRA 2YTCA 5EN1A 3BF4A 1OIAA 4BS2A 3KG0A 2IA0A 1V5IB 3M8ZA 4EO8A 3C19A 4K0KF 2ZEJA 4P10A 5ETNA 3W9JA 4CLSA 4ZLLA 4OLOA 3J7YU 3RTVA 2Y1RI 3PCOB 4FBUA 4LJMA 5F3TA 3QJJA 1CC7A 2X3DA 3UN3A 2P2CB 3I82A 3P4UB 3PTWA 5HP1B 1UTAA 2HQ3A 4QWBA 4M5GA 3ZZTA 3KHHA 3GR0A 5E3QA 1REGX 3IS9B 2A2DA 4PYAA 4C98A 2OPPB 2W25A 3G8SA 5J2MB 4M1KA 5D6GA 1C0UA 5ITHA 3Q2SC 1RABB 5JUMA 5IT0A 2J7KA 2VPXB 4CT8A 5HVFA 2D3UA 1M5HA 2BXJA 3VR1A 3MAAA 1R8PA 2QV6A 2WVDA 2ZBCA 4Y2AA 5LMUJ 1XNRJ 4KHPF 1X4CA 3QATA 2AMCB 2U2FA 4WTYA 3CJKB 4P2FA 4C11A 5L39A 4A8KA 4OJGA 3ZTRA 1REVA 3HI9A 1FJCA 5KG7A 4LQ3A 3HJVA 1B7YB 1FNOA 1JXVA 1WG1A 2RUGA 2RF2A 3IR6B 3PR5B 2J7WA 4JI2F 2N82B 1VQLS 1S1TB 1YJUA 1YRUA 4GVLA 2V0NA 4TLRA 4PAAA 4WP8A 1F0XA 4DPOA 3H5XA 2ZHAA 3AXKA 5D77A 1CQMA 4TLQA 4DPTA 5FLXU 4PXEA 1RUSA 1PYTA 4TU7A 4PQUA 1HYSB 2YBVA 1RHRB 4YB5A 3M7VA 1SQGA 2IY5B 4L74A 3CD0A 3JQMA 2HG4A 2XNQA 2GC8A 5KFHA 3OUYB 1D9FA 4WFXA 3B82A 2MGZB 1L3KA 1UEUA 4B9SA 1RACB 1RA7A 2C2ZB 1ZTTA 2IMOA 1J2VA 4IOBA 3IR7B 1QSLA 4WFBQ 3MM8A 4QYZK 3OQ2A 1RAIB 2YNFB 4M94A 3DXBA 3NY0A 4DV4F 3CT9A 2V8HA 3LPYA 3ILOA 1R43A 4NE9C 4ZPTR 1X7VA 2W2PP 4CLUA 3NBPB 3C6TA 1R0AA 3RRHA 4I2PB 2FDNA 2YKMB 1K73T 2JDJA 1ZA2B 1SJ4P 2UVUA 3NMAA 2IJNA 4RBVA 1N32F 3EM1A 5ETTA 1W2BR 4I1TA 3LP1B 2ZD1A 2BQRA 2HHHJ 3S7RA 4OHVA 2PT0A 4CLLA 5D4LA 3P49B 3BDPA 4YB7A 4USIA 3N0VA 4EBCA 3TANA 1W26A 2I5JA 2UUBF 5LM7E 1RXOB 1RAGB 1NMEB 1F5AA 3Q8PB 2ZH9A 1N34J 3AB2B 4MKAA 3MEEA 2DRAA 5IM0B 2IDLA 2QL7B 3MUMP 2FD2A 2HNYA 4NEZA 3ELHA 3TZXA 1BD6A 1APSA 1U47A 3GYGA 3OVAA 3LAMA 2HVEA 4PEOA 4Z37A 6FDRA 3NXZA 4EYIB 2W2NP 4WKYA 3PG9A 1SJFA 1DAXA 1TKZB 2ZDOA 1J5EF 1HR0F 1NBEB 1EZZB 2ZOGA 2AF6A 2C42A 3LP2B 3IXQA 4I56A 2H65B 4J90A 1S1XB 3I5AA 4YB6A 1HQEA 2FJAB 5HMWA 1TU0B 1S9GA 2AEJA 1WNEA 1VC6A 1N33F 1VC5A 4EI2A 4U95A 4B3OA 3O8WA 1NDPA 2QMUB 3CEDA 3W2WB 2FHJD 4IOCQ 4W98A 2GJIA 4EBEA 2KG1A 4MYTA 1UEKA 2RRAA 2CADA 2A1BA 3CDBA 1VQ4S 1NB2A 3OTCA 3AD9C 4ZPCA 4CT9A 4FF1A 2DJWA 2J8SA 3US5A 2PDAA 3MR2A 2DD8S 4URQU 1UA1A 1O6XA 3CC4S 4ELTA 4LF2A 4LIRA 3HM9A 3Q24A 2GX8A 2JH3A 3M2UB 4MKBA 4OZJA 2DRDA 4TVAB 2BM1A 5IQQA 3WX4A 1IBKF 1VRTA 1CS4B 2ZH6A 3BYPA 1HHSA 3UO0A 3QT8A 3FCVA 1YDLA 1ZAWA 2W7AA 4KGMA 4P9SA 1NK9A 2ZOFA 2GO8A 4PWDB 3DXSX 2ZD1B 4NA2A 3RB6A 1C2PA 4CO3A 2RU3A 5HAOA 5LSOA 4DV0F 1LW2B 2KRBA 2KYXA 2ADBA 3KUEA 4ZS6A 5JJBA 2ZJRQ 1BY9A 4NYOA 1A0OB 5D78A 5B0CA 5A2QU 2Z4PA 3ZZUA 2CJ9A 4ED2A 5F8IA 1IBMJ 1ZM2A 2I0XA 4CLTA 4F2SA 2VKZG 1DQ9A 2EPIA 3I0SB 4HI1A 4KHRA 1O5JA 2AQ4A 3RAXA 4I68A 3BN7A 4FNIA 5GMDA 1RT1A 1UEVA 3TA0A 3Q8QB 1OY6A 3H20A 5LL6d 4BLGA 3HMJG 5LJ3Y 3MR7A 3ETOA 1VBYA 4DSLA 1Q8KA 1CULA 1KONA 2D3OR 5ETOA 3I4HX 1OPIA 4TQRA 3CDWA 3I6PA 4M5KA 3QJLA 1S9GB 2XMJA 5HLFA 1OYEA 2IIHA 3OXGA 2HGNA 2CNLB 5GVQA 3R5DA 3V4IB 5KG4A 3ITHA 2ADCA 1I51B 2ATCB 4G3IA 1VS3A 2E5HA 2IMWP 4XPEA 5GAEI 3EDRB 2AGQA 1UCNA 4PXDA 1FO1A 4X64F 2IRXA 2WCXA 2B4OA 3LPEA 2CPYA 5M2RA 3H42A 1HHTP 1U24A 2WSCC 3E01B 2GIQA 4QR2A 2NYIA 5J2QA 2I8EA 5BXIA 3MEDA 4X65F 1BE4A 4YQWA 2WOMB 4A46A 3T5HA 2M8DB 2ZBQA 1GX6A 3GYXB 1CBKA 5A8RA 4ZJLA 3H59A 1IR0A 4RU9A 1CS4A 1WTFA 4FYDA 3Q8UA 3LWLA 2XO6A 5F8JA 1AA1B 4DQRA 4X2BA 4LF7J 1FKPA 1VRQC 1S1WA 3HKZD 4UTGA 4ZA1A 2P9GA 2P8IA 2CQIA 1HPZB 3PYEA 1NPKA 4K4XA 4C11B 3NAHA 2GHVC 2WHOA 1R0AB 3M8YA 2IBKA 2AKWB 2MQ8A 1HKAA 5L1IA 5J2NA 4EZ6A 3C15A 4FN5A 4JOUA 4RUBA 3EZOA 3QAEA 3MR3A 4AUKA 1LW0B 1PCAA 2OD6A 4QYZJ 3V6JA 1RTJB 2DR6A 3NS6A 3PJ9A 3T1AA 3CJ4A 1U45A 2QA4G 1UA0A 1X8DA 4DSIA 3K7RA 2AD9A 4DL2A 4F02A 3JAMY 2IM0A 1Z2ZA 3EYZA 3KLEA 4ECWA 4MTPA 3OSPA 1LXNA 1RCOB 3BGFA 3TNVA 2LDIA 1BHNA 2OELA 2PGCA 2MZ1A 4MFBA 4B08A 1FTCA 3EMTA 2JVRA 4NYZA 5CZXA 2B9XA 5HVGA 4C8KA 2CPXA 3PHTA 1FXLA 3PRDA 3J81Y 3TARA 3GPAA 1TL3A 1HBNB 1XMBA 1K9MT 2W4PA 1KS2A 1OY9A 4I2QA 1CJTA 2ZC4A 3AA9A 1Q53A 4MMOA 3PXGa 3SCIE 2PN6A 3K5LA 4JI1F 4O3QA 2E9ZA 4NRTA 4ZPAA 4J9UE 3CIMA 4ELUA 3DLGA 2ROPA 4FYXB 2W9BA 1SUQB 4WFZA 1TL4A 5IS2A 4RBUA 2M70A 2YWFA 4DMZA 1X9MA 1Y00A 2ACYA 1QTNB 2BABA 2IBOA 3AQPA 5F8LA 3FSYA 3OUYA 2EFGA 2VQFF 5F0UA 2DNKA 4CP5A 1GH8A 2AYEA 3HKWA 2H9ZA 3QPIA 4DR3F 2YNGB 1RT5B 4O3OA 2N3OA 2VH7A 1S99A 3DMJA 3JYTA 4LRDA 5HJYA 3DRSA 4WXOA 1C1CA 1QAXA 1CEZA 4DV7F 1VDHA 3M30B 1OMSA 2ZZMA 1NNDA 5DZ6A 1YX2A 1AYEA 3MOZA 4XDCA 2GCFA 1C4AA 1Y0HA 4YR3A 3GV8B 1EJ7L 2DNLA 2R7VA 4OLPA 4LF7F 4MK9A 4Y0FA 3Q0AA 3FSIA 3D3CJ 2V2VA 5KFGA 3OTOF 2M0GB 3D6FB 4WU2A 2IM2A 3U1LA 3MAAB 1UFKA 2XQCA 1RJJA 5HMZA 4ZLNA 4RNOA 1LV5A 4K4SA 2PA8D 3VTIA 2ZH7A 2OPRA 1E6VB 2LMIA 4M95A 2L9WA 1HD0A 3MF5A 4GRSA 4WP3A 5AXNA 2RDIA 3AAWB 3CD5A 3EGWB 2HGLA 1F5CA 2XYPB 5LMNF 1Y11A 3M9OB 4ETZA 2OEKA 3H40A 1XEZA 5CYQB 4NLPA 4HHUA 1YJWS 1FT8A 3UDVA 2R2UA 3R5JB 1U4BA 1KD1T 3OHAA 4DV1J 3DGPA 5DDRC 4ETXA 2FZCB 1H74A 3LOUA 5B0DA 1EKSA 4I69A 2E1PA 4V19X 4H4KC 4ED8A 2AX0A 1QAIA 1YI2S 3IRXB 1U2CA 2XSJB 1YK9A 4MJKA 3DDNA 4HTJA 4RL1A 4W90B 4RW4A 1ULRA 5CA5A 2MHNA 2CG4A 4C4WA 1DJ0A 1KBRA 2PD1A 3QFWA 2RSQA 1S4EA 4IDKA 2RQMA 3MMCA 7AT1B 1S1UA 1HBOB 1MNEA 3SIPB 4ZKAA 1CVJA 2NZ4A 3V81B 1U0SA 2FGOA 2F40A 1IJFB 2QLFB 1RT5A 2F65A 2XS7A 1JLFB 2EBEA 3BBCA 4OZ3A 3PVXA 4A48A 5IT4A 5DGBA 4E2FB 3GV7B 3M30A 2AT1B 2W01A 4AT1B 2AYGA 3CD6S 3Q8YA 2HHHF 1TMJA 1S49A 5LMUF 2RIJA 3PKMA 2FY8A 4AXIA 4DR5F 1H0HB 4IG3A 1K1SA 1K1QA 2CPEA 2ALYB 3VGTA 4V1Ak 4IFVA 1BWEA 2QFJA 4L3KA 4UW2A 4F4AA 4ED4A 2IYGA 2DPIA 1U2RA 3PNIA 5HQLA 2X1FA 2O67A 3WHIA 2OSRA 3MR5A 3CB4A 1EQMA 2DHHA 3OTOJ 2OLWA 4ZLJA 1QVGR 2P9CA 2R8KA 2EK6A 1IKVB 2AWZA 3E3XA 2FLPA 1V6HA 2GVDB 2OEJA 4USTA 1HNVA 3LGHA 3TEGA 2GMHA 2DNQA 4F3OA 1Q1KA 5CHCB 1SL1A 2MQQA 3EX7B 4ALZA 2HFOA 3MEKA 1B0PA 1IQZA 1LW0A 1GT8A 2LQ5A 1IR1A 1FA0A 3IGVA 3TVKA 5A6WA 4X4PA 5KFDA 4LFBF 3H5YA 3K0JA 4PG7A 3CCVS 2JJ4D 2Z2MA 2CVEA 4NMLA 1WD6A 2DHAA 2V94A 2R2TA 3MTKA 2CQPA 1FX4A 3JSMA 2ILZA 3J80Y 1SL2A 4LRCA 5LXRA 1HNXF 4OI2A 3B4DA 3W5ZA 3CCLS 2FJXA 3MCNA 1F3VA 1T11A 1RQ0A 2HWTA 2HZAA 2RQ4A 3OLBA 5B0AA 1BQMA 1LEOA 4HHHA 1JNZB 1BXNA 4UUXA 5FD1A 4H4OA 1SH3A 1SJQA 2HS4A 2MYFA 5CAAA 2HSEB 3MUVP 1IKXA 3LGMA 2COLA 2GJ2A 3C14B 3MM6B 3UCZP 4ENOA 4X62F 4QIFA 5THWA 2VC1A 1S0NA 3KLHB 3H4BA 3GQCA 3FCWA 3MMCB 2KXNB 2QYGA 2V68A 1WORA 4HR2A 3MXHP 4CYUA 4RR5A 2JEJA 4L3NA 1S9EB 4WPAA 2RVJA 5AJ3J 2HNDB 2LEBA 1R31A 3VAFA 2AIRB 4KY3A 2VHGA 3S1TA 4F4ZA 1SCJB 1FRMA 1RB0A 4GC6A 3NWRA 1U6ZA 3P45B 3PW2A 1SC1B 4V19J 3QGGA 4DV0J 3I32A 4LT6A 1HQ2A 1WOOA 3PRVA 1MMNA 5EDWA 3KUGA 1F5BA 1F9HA 5A8RB 4IG0B 1NK8A 1T95A 2DCUB 5D0RA 3PW7A 3AXMA 2IJFA 3NGTA 5HJXA 2UXBF 3DLEB 1HWKA 1RAOA 4OZ1A 1JLGB 1R8CA 2NCKL 1S59A 1Y10A 3CGIA 3PJXA 2LA6A 1N54B 2B9YA 4C7QA 2XMMA 2V8PA 3V4MA 1HQEB 2ASLA 3L7UA 1V3SA 2CNNB 1TZ0A 1WHWA 3G4SS 1RTDA 3OSNA 3N79A 2XGPA 3IWNC 4K0KJ 4CQ1A 2EC2A 1TK5A 2J9CA 3ZNJ1 3V5RA 3HSGA 3EE3A 4NRUA 4JB8B 6AT1B 3A3NB 3CJ5A 2UV8A 4JBCA 2NREA 1JLEA 4KFBA 2MZSA 4DSFA 2C2RA 3HLUA 4RBTA 2H5JB 1SIWB 4ZPDA 1AUSL 4LFCF 2O66A 3D3BJ 2XM3A 2ASDA 3NS7B 3FMWA 2CJBA 3FSXA 1UVNA 1VJQA 1GQEA 3RJMB 2XS2A 2IDEA 2MHEA 1T9UA 3LUYA 3QFHA 1C0UB 5H9FK 3JB9k 1D3WA 4URGA 3EGNA 1RLCL 3LA0A 1U8WA 3PHEA 1Y3KA 2HHTA 4X4RA 1U1NA 5KFLA 1QJHA 4LRFA 2W4CA 3MMAA 1M1GA 2HRYA 2ZNZA 1XR5A 2DGTA 2HLUA 1Q8IA 2ACMA 2QRRA 2V4JB 3OFGA 4WWSA 5KFUA 2MB0B 3RBDA 3T41A 2DR8A 3VZHA 1V3ZA 4ID5B 4EK2A 4JI2J 5HO4A 3M8RA 1FEEA 2IAJA 1T02A 2JSXA 3TA1A 4CH0S 3K58A 2XMTA 4HVZA 4K2XA 4NA1A 1FVQA 1RT2A 5E3RA 3R5BA 3MM9A 4MAKA 1VBXA 2ILYA 1YRXA 5AXKA 2E9TA 2UUAJ 2GQQA 3PX4A 1KTQA 2H4WB 3HSDA 5LJ5Y 3KK1B 5KFEA 3UDCA 2MQPA 3HVTB 1YZ7A 1NJXA 1JXLA 4WF9Q 1IKWA 2BJ3A 3HVWA 3EZ5A 1HYSA 4H54A 1VC0A 4KO0A 2CNOB 4MKYA 1RTIB 3C15B 1N36F 4A8FA 4BBYA 3KHGA 2HNYB 1B4SA 3ISZA 3ZXWA 2MZQA 2ZC3A 4IUFA 2MLZA 3OXLA 1NAQA 1S97A 1HA1A 4L76A 4JI1J 4Y2IA 2NZCA 1S77D 2KL8A 2KN4A 3N6MA 3SCKE 5DLGA 3SDEB 1T03A 1S6QA 3P5BP 3CMQA 2RS8A 1S1XA 1YJTA 3UQSA 1RSCA 3IN5A 5KFJA 3TUPA 4X4UA 4AYBD 4LF1A 1ZTWA 2AV5A 2CXEA 1SKUB 1MLAA 3MM5A 3NG8A 4ZVOB 3PIPQ 1MSWD 4ZCIA 5L38A 4WU3A 2X51A 3T1HJ 3PV8A 3C2PA 1K44A 2IJRA 4N76A 2XS5A 1S6UA 4K4YA 1C4CA 1NCLA 1HBOA 2L9NA 3PM9A 2CQ3A 3WBZA 5HMYA 1U1RA 3AQOA 2HBQB 1JWWA 2HVZA 2M7SA 4NCGA 2QLWA 3GB0A 4X65J 2WTFA 3GZ7A 1WOSA 3VCDA 1Q5VA 2J6TA 3JQKA 3R7SB 3IRXA 2XSJA 4DFPA 1NUEA 3AJDA 2DYAA 2HZVA 1S7HA 2EG1A 2XG8A 3SEOA 5KG6A 4DDFA 3Q8SB 4DV7J 4NCBA 2KHCA 2IC3A 1D09B 1R6VA 2YNGA 4Z7YA 2V9KA 1U6BA 3MOJB 2UXCF 2NQPA 4KYZA 3P8BB 1HNZF 4JI4J 2VG6A 2H51B 3GIRA 2AHOB 3DHWC 1VCTA 3PW0A 3CSKA 1FCAA 3OR2B 1BGXT 3CDEA 1UVJA 1RU1A 2HFZA 1N6QB 3DOMA 2HAIA 1DY3A 1F9EB 4EUVA 1T9TA 2L41A 2YNHA 1AW0A 2D3O1 3DYAB 2HFSA 4OZ5A 5E41A 5H9EK 3H5UA 2JLGA 3WC2A 1N5QA 2A6MA 2GVDA 3M8PA 2DH9A 4J37A 3MMBA 2VBWA 2QT7A 2HHPA 1N5YB 1T9XA 3GSDA 4UY85 2VBXA 4A8QA 4YOEA 2CQ4A 3O5TB 4C8YA 1YVFA 1AZSA 1EB0A 2N4CA 1X4HA 4QCLA 2M3DA 1NM2A 1R8AA 1CJUB 3MMJA 3TAQA 4OV6A 1CULB 3DU6A 1UP1A 4DR4J 4RW8A 2CPIA 2AX1A 5HLFB 3OTEA 1IXKA 1RTDB 3ZO7A 4DFJA 4DJBA 3HJFA 4LQ9A 4DZDA 2ZKTA 2D41A 2RHQB 1KHWA 1JJCB 2N7YA 4TYBA 3RG6A 2EKNA 5EHHA 2XTJP 2MKYA 2OJ3A 2UVRA 4LF4F 1R8HA 1X4DA 2HIQA 2CQGA 3CXCR 2OPQA 4G1QA 5D3GB 5J2PB 1GMWD 2D3ZA 3BEGB 4P2XA 5B08A 4F0HA 1FRJA 2X3GA 1A7GE 3H8YA 2R7WA 1V5VA 2R8GA 4JV5J 3THTA 4B3SJ 1U25A 3W2VA 4OI6A 3UN2A 2F63A 2HRUA 3TVZA 2KFZA 1GTEA 2P6SA 4DX7A 1BQXA 1RT7B 5IC6B 1KLMA 2DEIA 2UUWA 8AT1B 3Q8RB 3D0GE 5IV3A 3EGZA 4IDKB 2XEXA 1JLCB 3B78A 3DGVA 2HBZB 2NPIA 2L48A 1LXJA 4I4BA 4XK8C 2EFNA 3EVOA 1KVIA 1HWJA 1YBTA 4EU0A 3GFZA 1T9YA 4J9OA 2XHWA 3M8WA 4DL6A 1PSDA 2KVIA 2XO7A 1VISA 3G8TA 4ZVQB 1TV6A 3KK2A 1HWLA 4RNHA 4C48A 4J7CA 2VFTA 1YQHA 4PXBA 2W9CA 5DGAA 3GE9A 1AFIA 1RAEB 2C2NA 1Q78A 3UI3A 2UU9J 2FVRA 2E7XA 4RUHA 4WIQA 3QYYA 2EFVA 2E1CA 3X1LB 1RI7A 2Z57B 2DCLA 1JLAB 2CNKB 1WC1A 5C5JA 5MLCV 3BSNA 1BQNB 1RTJA 3MMBB 5M2UA 1LFPA 4ZN3A 2AGOA 1LWCA 2ZE2A 1I5OB 1RTHA 3V4IA 2YWKA 5GMEA 1PGZA 3RAQA 1GMVA 1R0BG 3O44A 1GNKA 2NXJA 1DLOB 4ATNA 2W8KA 2I1RA 1U8SA 1S6OA 1Q86T 3HXMA 3M2RB 3NWGA 2KFYA 3JTNA 2BVZA 1OO0B 3GP9A 3QWPA 2BBEA 4OJ1A 4HYKA 2G4BA 1RWXB 4HACA 2AZ3A 3ZTSA 4YP3A 4OL8A 3MCMA 3A4TA 3I5CA 1TAUA 2R7UA 5IT9Y 1FDDA 2JWNA 5D8HB 4JV0A 2XSFA 1S6PB 1T05A 3N28A 2IA6A 4XAKA 1YSJA 3GJTB 4PCQA 4DL7A 4DV2F 1RT4A 1FRXA 1KEKA 1JLEB 4KFBB 4FS2A 4IRDA 3EJMA 1YRTA 5BJRA 4NI2B 4DR2J 4LF8J 1XJWB 3NP5A 2FHOB 1DTQB 1X4FA 2XI2A 1S1VB 2KG0A 1NDCA 2VUGA 3D66A 1NEEA 2BX6A 2D1CA 4AQYJ 2BMBA 3R27A 4LBPA 2IM3A 3PDNA 1FE4A 2BE7D 2BKNA 4Q8EA 2PIIA 1RBLA 3AH6A 1KHVA 4LF6F 2E5JA 4Q0BA 1TL1A 1O8BA 4MK8A 4RUAA 1VBZA 4KPYA 3QRQA 3QLHA 3D9BA 3I96A 1U0HA 4MK7A 3MR6A 2M88A 3CCUS 2FJBB 2VC0A 3TQEA 2E66A 3KK1A 1FTRA 3MPUB 1TKDA 4S0MA 2F8MA 1XR7A 3IS9A 1RHQB 4CO4A 2QMWA 1VQOS 1JX4A 5KOWA 1D9AA 2PEHA 4DG1B 1WACA 2BM0A 2FC8A 3W5XA 3W63A 2GIRA 4OYAA 4IFYB 1RADB 3FBEA 4RW9B 3TQ1A 2MKCA 2UU9F 3HK2A 5A0YA 4GKKF 4KH0B 2VG7B 2LXIA 2X7IA 2XLKA 3H90A 1LQ9A 2VA3A 4ZPWR 3LAKA 3CCSS 2CZ9A 5EX3A 4DQIA 2VPYB 1IUJA 2DBBA 1FI4A 4ZCLA 1WWHA 1CSJA 4UY8T 1ITPA 2WRMA 1WSRA 3K8VA 3SCLE 2OTLS 4PQUB 4KB7A 5GMKa 4ZJQA 1QE1B 3MFHA 3NKYA 4TY8A 4JI5F 3R97A 1RZMA 2OD4A 1PJ5A 4NMXA 4B9TA 4PQAA 2F4VF 3EXYA 3KYLA 2WONA 4FDFA 3BGOP 1IKXB 2ZH8A 4DR3J 4WFYA 4FVMA 4DR1F 1RWWB 2HS0A 2OGUA 1GMUA 3IO1A 4LRBA 4A4JA 5A76A 4NZ7A 3B4MA 4QU7A 3M9NB 2K7KA 2K2PA 4ZPVR 4JI8F 2ZBIA 2B4PA 2B0GA 4NLYA 1RT4B 2MZTA 5IOLA 4O4GB 1KWMA 1HLWA 2HNDA 2VKRA 4F25A 1Q0NA 2GQCA 2V6AA 4ZVUB 4OYWA 3OW2R 2G2ZA 4DOZA 3TUJC 4Z7CA 4F50A 2V8DA 4PRFA 2B7CB 2JX2A 1FNMA 1P9YA 2OUGA 5KFAA 1D8ZA 2WVBA 3NEKA 4OYZA 5AJ3F 4CLFA 2CQ0A 4QPXA 2C2KB 4QWAA 3PEJA 4F67A 3FK4A 2G2YA 2DB1A 1JLQA 1ZPVA 2RRNA 3AFGA 1JLFA 1H38A 2N3LA 3JSRA 4IRKA 4ITSA 2YWHA 1HQUA 3FNNA 1JQGA 2YQ1A 2CJYB 4P74A 4J5OA 2QX0A 4UOCA 1R3NA 4ZVRB 2Z58B 1UJ4A 3VF0B 3W65A 3NNCA 5LMNJ 2QZ8A 3HHLD 4IKAA 4F7VA 5F3ZA 1IJEB 2VIHA 1L3TA 4C8OA 2VODA 1FK9B 1GAOA 3FZBA 3PFEA 4YEAA 6FD1A 4B3RF 4MIBA 1RWPB 2GGPA 1T0TV 2HQIA 3D6MB 4OZ2A 2FVQA 2HKEA 5D0EA 3S01A 2EVZA 5KFSA 3W62A 4UT4A 5I3QA 2VBYA 3GTYX 1M1KT 2DXDA 1IWAA 2BJDA 1DZ5A 5ETQA 4ZDNA 1ZA1B 4QQBA 1PJ7A 5K9FA 2A0FB 2LVWA 4Z2XA 3C16A 4QOTA 1AZSB 2DY1A 4QPTA 2DR5A 3HFZB 3NCRA 5HQ8A 2ZH4A 3CO9A 2QA4S 3H2UB 1DTTA 5HI7A 3AD7C 2UXDF 2Q66A 2DR9A 5B7WA 2JNJA 3T1HF 1D1UA 5AE1A 1YZ6A 3R9LA 1U1KA 3LO3A 3R3TA 1UZDA 4OI1A 3IC1A 2JRSA 2VOPA 1RCXB 4MKVA 2FLOA 5KOXA 1VJWA 5T7LB 4WFAQ 1QUVA 2YPYA 2FLNA 1U7LA 4URSA 2I9SA 2VICA 2U1AA 3GMGA 3HSJA 5K14B 2DKOB 2GVZB 1NJIT 3R2CJ 2LFVA 1MN7A 2OI2A 4C9DA 4DSEA 4O4GA 1UETA 2MKJA 5JMNA 4IR9A 2Y9HA 1H2TZ 1UJ5A 1TTHB 4M5DB 4F0MA 4J9RA 2G1HA 5L46A 3M8SA 3BSAA 2Z2ZA 3M2UA 1F9FA 2HK2A 1NO8A 2YKQA 4J9PA 2OPQB 4G1QB 2HVHA 1UPPA 3UNYA 3J7AN 3H4DA 3U27A 4PWDA 1LWEA 1N4LA 4M5JA 3W2VB 2IRYA 3OV7A 3NCPA 1J5OA 3K2YA 4N8OA 4PZVA 4USWA 5IT9U 3DKDA 4DX5A 4QWEA 5F41A 2CJKA 1RT3A 2UUAF 4KO0B 4A47A 2MJNA 2J0QD 1S79A 2PI5A 3TAPA 3DOLB 4JI7F 2PMWA 3POTA 1C1BB 2MY8A 3TZZA 1K8AT 3W8GA 3MWBA 1S0OA 1VGYA 3M6VA 4K4TA 5KT6A 4J9KA 1S10A 3AJ2A 4F3QA 3SDEA 3CCRS 3QGPA 2WSEC 2W9CB 1NHVA 5JVGQ 3KDNA 1HI1A 4DUZF 1NH8A 3GG1A 1ZAVA 2RD5C 5T41A 4DR7F 1YKWA 4F36A 2KFNA 3KFWX 3NL0A 3CCMS 1HBUB 3LWMA 3LW5C 3UNGC 4FYWB 4HEA9 1HWIA 5KAKA 3TJAA 1UVMA 2UXDJ 1Q81T 1Q16B 1XR6A 4USJC 1XN9A 1MWQA 4JUZA 4XO0A 3TO8A 4FZVA 3QBCA 4NLGA 3VV2B 1S57A 4N56A 5H1SV 2BV3A 1F2HA 2IVMA 1LWXA 2CQ1A 4GVBB 1BLUA 1XMQJ 4B3SF 3KK3A 1FEHA 2M52A 4USKA 2Y0BB 3I87A 5JXSA 2JLFA 9ATCB 1XNQF 2EBGA 3HHKA 4DHVA 1VQ6S 1KNZA 5K14A 2GVZA 1H2VZ 5KFOA 3BGRB 3V6DB 1VK8A 4NI2A 3L7PA 4BCAA 2VL1A 5DQHA 4DL4A 2WBRA 3FVYA 2KO1A 4F4XA 4LF9F 2WZ1A 3MD3A 4DS5A 3CO0P 3R6GB 2W7PA 4OHXA 5CH7B 2GA7A 1RWOB 4WZMA 2GMLA 3FFIB 4RZRA 3BQ0A 5KT5A 3Q86A 2HURA 3MMAB 1NXIA 1X4EA 2NSCA 3NCQA 4DX6A 2FJWA 5B0BA 3KHRA 3K57A 3TOQA 2W9AA 4JYAF 1LWFB 1RKIA 2MPUA 2WVEA 5G0RA 2YNHB 1NB7A 1HNWJ 1KOHA 4CLZA 1S7IA 1ZOTA 4I2PA 2DH8A 2XWXA 4WE1B 3SBMA 5KG3A 3QT5A 1RT3B 2ZH3A 1XMOJ 1L3SA 2M2BA 1S9FA 1RU2A 4J9SA 4ZP8A 3MEGB 2CG8A 3RBZA 5HBMB 1X4AA 2AP6A 5CXTA 2OPSB 1UJ6A 3KHLA 2ABYA 1IKWB 3HHLB 4CNZA 1SL0A 2IM1A 3FZ2A 4WCEQ 3VGUA 1PIEA 4FF3A 3JSYA 2KB2A 4W4MA 3G9CA 1NSQA 2DNYA 4F4WA 3ETMA 2K1RA 4NPOA 2QL9B 1UVKA 4DG1A 5BR8F 3MEEB 2DHGA 3I5BA 1Q79A 2LEAA 3F0NA 2GO9A 3FRZA 2C3OA 1S0VA 2BKOA 3SMZA 4RW6A 5A0YB 4U9RA 2R2RA 3D1HA 4Q5VA 3DI6A 1M5PC 1IQTA 2AJ4A 5KFRA 3F41A 1G7CB 5B0GA 4RNNA 4H4MB 1RHUB 3THVA 1PAEX 5C7PA 3TW0A 5D4OA 5D3GA 1NPPA 3KLEB 1O51A 2FHKA 2LXFA 3G82B 3DOKA 2QJ3A 3CNQP 4ZPBA 1SUQA 2Q6CA 3V6HA 4GMKA 2EFPA 4OYBA 4BHQA 3CJ8A 3EVWA 3CCZA 4Q2LA 4NL5A 5DRKA 4JV5F 2A3JA 4UZCA 2Q79A 1HBNA 1QTMA 2AEFA 4K50A 3MM8B 3GV5B 1CLFA 2B8QA 2BW2A 3M6UA 2CQCA 2C3PA 4M8LA 4NZ6A 3BQ1A 1GEHA 1SPBP 3B6BA 2FJDB 4ZP9A 4LF6J 2CWXA 4USUA 5IC4B 3DM2A 4QIEA 1Q7YT 2MKHA 3ISNC 1X0PA 2WOMA 2YXLA 4DPWA 2E7WA 1IR2A 3W8PA 1TQLA 3BGUA 5J2NB 2VG5A 4KKOA 1E6YA 3ENQA 3O2IA 1FXDA 1R8BA 2J0XA 2LP4A 3OR2A 4KQZA 4RKUC 5IV4A 1HD1A 3G6ES 2G0CA 4A8OA 2HFUA 1FFWB 4ECXA 1S6QB 3C16B 4ID8A 1N33J 1GXLA 1EKRA 2B7BB 3TAMB 5CCMA 3K5PA 2X1AA 3TRGA 2KXHA 2XGQA 3BSCA 3CCQS 4RWXA 1FFGB 3LP0B 5CYMA 3SFUA 5LOQA 3I0SA 4X4VA 1NK4A 3POTB 2ZFHA 3WX8A
chains in the Genus database with same CATH topology
4GKJF 3ZZYA 4EEYA 2DGSA 2DGVA 3A1YG 2J8AA 3I9V9 4I6WA 4OI6A 3BREA 3FJ2A 1KRPA 2XLJA 4QIGA 3DLHA 1Z2LA 1OPZA 4ZCKA 5J1EB 4OJHA 3KLIB 1UFWA 3KTQA 4JV2A 2Y1IA 3N9UC 3DHXA 4CZCA 1U1MA 1VQ5S 2JC0A 2CQDA 2KJVA 5J2QB 4YDDB 2MQOA 3Q2TC 2E1AA 5A8KB 4JI4F 4WKRA 2XMKA 3DLGB 3N6LA 3KWMA 5F8HA 1D8YA 4P7TA 4X84A 2F1FA 2BYCA 3L95X 1FKPB 3CD7A 1HBMA 3P6YC 5HN0A 1ZZFA 1U1PA 3WZ0A 2UP1A 3IA0A 4WK3A 1QVFR 1KQGB 2IYIA 2FVCA 4D3HA 1JJ2R 3M8PB 2CZ4A 4WK1A 2LCWA 1TL5A 2YH0A 5I3UA 1ZAXA 1U2FA 2DIVA 4OHYA 1LOUA 5E2QA 3BB5A 4JI0F 4O3RA 3NNHA 4Q7AA 3D2WA 2WB1D 3QIPB 5IZHA 1XERA 3RB0A 4OZ0A 1AUDA 4RU2A 3TA2A 1JLAA 3OXFA 3PIOQ 1RYSA 1HNVB 3ULHA 4ECZA 2J9DA 3M1VB 2OP5A 5E3PA 3ZZ0A 1PO6A 4AE5A 4IO1A 3QIDA 1L5UA 3SV4A 1WEXA 3LF0A 3PKYA 1Y3JA 1TFWA 2B5JB 2BE2B 2PFFB 2QA2A 5KT2A 3VAIA 3CULA 1WELA 1G6BA 4HDHA 1KLMB 2DPJA 1UKUA 4NLTA 4I7FA 4BC7A 4RW4B 4PG6A 1RK8A 1S72S 1EETA 5DQIA 4IRCA 4H4MA 5A8KA 1IN0A 2OFHX 4IR1A 2AYMA 3DMJB 3JYTB 1KFSA 1RP5A 3JTOA 3T1YF 1NKBA 2MZJA 2XMVA 1VQSA 2JVOA 5E0OA 2DGXA 3GFXA 2FY1A 4B3TF 1FHTA 4EBDA 5K8MA 2XY6A 2BDPA 1S1UB 2DITA 5AE2A 4R5PA 2DHSA 4KE5A 2WBMA 2J5AA 1KTVA 1LFWA 1QLNA 4ILMA 3FMBA 3OTBA 2MZRA 3OBIA 3MD1A 3QIPA 1FDBA 2NUHA 4JV1A 2BR0A 3MHYA 5CYJA 4F4YA 1MU2B 4IFVB 3W3SA 1SJRA 3DOLA 3IWXA 2JHEA 1QAYA 2JFKA 3RBEA 5L9NA 4O44B 4YMEA 3OJUA 3MEGA 3EPGA 3OVSA 4J9QA 4Q45A 2XY7A 2V2KA 5C42B 5FJ4A 5C24A 4HHJA 3DLEA 2RILA 2ATLA 1NK7A 4TQSA 4LF8F 1YG0A 3ZZZA 4ECRA 1EP4A 4UQTA 4I0WA 3HHLC 2D7SA 5KFXA 1FNXH 2I2YA 1UWBB 4ED5A 3LP0A 2W8LA 1NKEA 1M90T 2DNPA 1FRIA 3E01A 4O3PA 1Y5LB 3WDOA 2VV5A 4DL3A 1TL3B 3U1MA 4E0DA 2XZWA 2FPHX 3BO2A 1N34F 1X4BA 2AJ1A 2CPDA 3FEZA 4EGLA 4OX7A 2CFXA 4LVNP 3DLKB 3GIIA 5DLFA 4I6AA 5J1EA 2RKIA 3LGNA 1S1WB 4ZVEA 1SKWA 2PE8A 1KR4A 1M0SA 2KI2A 2LEPA 1FRLA 2CVIA 3FEYB 4G1IA 4LUBA 3KLGA 3QO9B 1MWZA 3MDFA 4TN2A 3AB4B 1XMOF 3KNAA 4UQGA