1S1XA

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
553
structure length
545
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 137
structure length 545
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1xA05
4O44B 4F50A 2GC8A 5CYMB 3O3FA 3IS9A 3V9WA 4IG3B 1D5AA 4MK9A 5JS2A 4PQUA 3NAHA 3DLHA 1JLFA 3PX4A 1W9HA 4IQXA 1MU2B 3CFRA 5DQHA 1RDAA 4KFBB 5KFSA 3NGYA 1YT3A 4DTRA 1DTTB 1D0EA 4CIFA 4B9NA 3KHRA 3KMSA 3DLBA 1TKXB 2HVIA 4GVMA 3G6XA 5KT5A 2BGGA 4DTNA 4EZ6A 3BSAA 1N6QB 2DFFA 4G1QA 3T5LA 3RMBA 4KTZA 4XO0A 1QSSA 3HYFA 4DTUA 4M3TA 2YKNB 2WB4A 2R7YA 1S9GB 4E3SA 4DG1B 3JSMA 2FLNA 5JS1A 5F8LA 4H4MA 3KHHA 4IG0A 3FRZA 4DMNA 4O3OA 3V9ZA 2HB5A 1J9AA 2OPRB 1VK0A 2AU0A 4KI6A 2WRMA 2EX3A 3DLKA 3K58A 4ICLB 3DLGB 3LANA 3EYZA 5DLFA 4FW2A 3NKYA 2JEIA 1KTQA 1BI4B 1RT2B 3PX6A 5KRSA 2G8IA 2XGPA 5KTQA 1TK5A 2OYQA 3LP0A 2C2DA 4Y1DA 3KTQA 4CJPA 4CJVA 2F8SA 3SI8A 3AA4A 1KCFA 5KFMA 4Z0UA 1I3AA 1ASWA 1IKYA 4IG3A 2YV0X 1NK0A 1SUQB 3S3MA 4FYDA 3QYYA 2FC0A 3MXJA 1BISA 3PX0A 4KHYA 3C95A 1Q9YA 5DLGA 4DU3A 1B9DA 3KLEA 5J2PB 2IC3B 2HHUA 3TAGA 4DFJA 3FSIA 4CJSA 2NUBA 4QWBA 4NLTA 3K57A 4Y2AA 1WAJA 5KT4A 1JLGB 3FQKA 4KHSA 1C2PA 3PHEA 2O4GA 4IBNA 5KI6A 3SYZA 3AVHA 4OGCA 4RUCA 4ID5B 2HNZA 3PV8A 1HYVA 3LP3A 2XCPA 2IJNA 2ITGA 4CJRA 5C24A 1J5OA 3V1RA 3RWUA 3UPFA 3BGRB 1S9GA 3ZSXA 2JLEA 1T03B 1LWEA 2IAJB 4DG1A 3AVGA 4Y2CA 2D0BA 4EEYA 2WCXA 4ED1A 2UVUA 1RYRA 2E6MA 4E7KA 4CGGA 2WOMB 4CFCA 1C1CB 4ICLA 2G8UA 3PR4A 4NLYA 4EP4A 2FBTA 1HNVA 2RDIA 3K5OA 4FJMA 3VQQA 3OYGA 3ZT2A 5FDLA 4DS5A 3U6FA 4N47A 2DFEA 3DM2A 2P5GA 1XWLA 2D41A 5DGBA 4CF1A 3LPTA 2P51A 4BE1A 1K1QA 3V6KA 4CK2A 4H54A 5KFLA 4QWAA 5E41A 3RMCA 4DSJA 1NJWA 2AJQA 4CJKA 3DRSB 3LAMA 1KLMB 1VSHA 3KLIB 3MF5A 2XCAA 1VRUA 3RB0A 2P5OA 2EHGA 3P1GA 4KSEB 4BE2A 3OY9A 3QGGA 5J2PA 3OYHA 2IC3A 4CGHA 2G8WA 1RDCA 4N5SA 3QEWA 4CJTA 3LZJA 4OKKA 4HYKA 2X6SA 4CF9A 2RF2B 4MK8A 1UAXA 4M42A 1BHLA 1D9FA 1T8EA 1TKZA 5I3UA 2XY8A 1N56A 3KK3B 1NKBA 5EDWA 1UOCA 4ECRA 2IAJA 1BQMB 2PYLA 2DPIA 1RT3A 4FVMA 4AHCA 1SKWA 3MFHA 5J2MB 5T14A 3PO5A 3M8PB 4AILC 4KV8A 1KHVA 1XHZA 2QV6A 1T7PA 1TV6A 2OZSA 4FM0A 3QGIA 4K4WA 3L3UA 2WHOA 4DWIA 2RN2A 4ELTA 3UIQA 4IRCA 4AHSA 4ZVFA 1HQUB 4BDYA 2C2EA 1X9MA 5F8NA 1HNIB 2VA2A 3AVLA 3CDWA 3OL6A 2ILZA 4M95A 1VSDA 1O1WA 2E9ZA 1NNDA 4FK2A 1QE1B 3M8RA 2QKKA 3BSCA 4RW7A 3LP2B 4EZ9A 3KLIA 3MEDB 1JLBA 4CHQA 3LDSA 1RT6B 3MR6A 1S1TA 4J9OA 4FW1A 3VQ4A 4HUGA 1C1BB 4ZVHA 4DQRA 5I42B 3LP1B 2IDOA 3QEXA 5C25B 3NAEA 1IG9A 3TAMA 3QIPA 3Q8PB 4WFXA 2W9AA 2D3UA 4HKQA 1XR6A 4NZ0A 2E9TA 4R5PB 4RNHA 2J6SA 2YNHB 2XI3A 4ELVA 4AHRA 2ZD1B 3AVMA 4ELUA 1NHUA 1BCMA 3I8DA 3T19A 3SPZA 3OYJA 4WYWA 3KK3A 1LV5A 4YNQA 4O4RA 3L2RA 4KHMA 5DK5A 5L1LA 4RU9A 4ZMMA 4B9LA 1S9FA 3VQDA 5DG9A 3H4BA 3NH1A 3GV8B 4QWCA 3AVIA 3QZ7A 3OHAA 4CJEA 4NLOA 4QCLA 1S1UA 1LWFB 1S6PB 5F8MA 4WE1A 3NFAA 4IFVB 4HUEA 5KGXA 1S1XB 4O3RA 1RT5B 4Q43A 5F8HA 4ZP7A 3DLEB 2YHBA 2KZZA 1RT7B 5HRPA 5KFFA 3PJWA 4IKFA 5K14B 5JUMA 4QAGA 1HQUA 1RA7A 1HNIA 3SV3A 4MH8A 4K4YA 1JKHB 2E9RX 1WNSA 4DEZA 4TY8B 4MK7A 2VG7A 2YNIA 3DOLA 1BIUA 2HVHA 4EYIB 3KK1B 3K5LA 5KFGA 4IOBA 3A2FA 4NCGB 4NRUA 3F9KA 2W9BB 3OYKA 1KSPA 1JX4A 4MKAA 1FKOB 3MXIA 2HHSA 5CZ2A 1RT6A 4CJQA 3PVXA 1S6QB 3NF6A 1BGXT 3MR3A 1ZBLA 3GQCA 4LQ3A 4DU4A 5C25A 1RT1B 2DY4A 3P5JA 3I5BA 4LQ9A 4OVLA 4J9MA 3VA3A 1IKXB 3AVBA 4R5PA 3QINA 2YNHA 4RNMA 3V9XA 5J2QA 5KFAA 2R2UA 4ID1A 2WTFA 1T05B 4QWEA 3SFUA 4F2SA 2A1RA 4DL4A 3N6LA 2BANA 2Z1GA 4NLRA 1VSKA 1WSFA 4DS4A 4M3YA 3RBDA 1DTQB 2D0AA 2KTQA 1C1AA 4CJWA 4CFAA 1ZBIA 4FM1A 5KFTA 1RT4B 2VG6A 1LW0B 3SQ4A 3L2QA 1S6PA 2FVQA 3V9UA 4IFVA 1WLJA 1G15A 3WNGA 1TKTB 1RT5A 1HARA 2Y1IA 4J9NA 3L2UA 3LALA 1RTJB 1RT7A 1S1VB 5K14A 1XR7A 3M9OB 3ICLA 3OSPA 1JIHA 3OL7A 2XHBA 3QETA 4PWDA 2HAIA 1RILA 4DTXA 2AGQA 3OHBA 1CSJA 1K1SA 3KK1A 1JL2A 2FVSA 4NCGA 1YTUA 1S10A 4LD0A 5KFVA 4QW9A 2DPJA 3AVCA 4CF2A 3CO9A 3OS0A 4ZTFA 1S6QA 1UA1A 3HVWA 4DTMA 1U48A 1IM4A 2HNYB 4B3OA 1RT1A 5KFCA 4W5TA 4E7LA 3T5KA 3KLHB 3UR0A 4FS1A 4DL2A 5KFWA 3JYTB 3QNNA 4FJNA 4FLZA 4IR1A 1T05A 4F4KA 3D45A 3Q8RB 2R8HA 4ZTJA 1LW2B 4E89A 3OYDA 3BSNA 2F96A 3BREA 2KQ2A 2DTUA 4XPEA 1S9EA 4I2PA 3MECA 1Z25A 1I6JA 5HP1B 1JLEB 5KFPA 4EO6A 3FQLA 4DLGA 4RNNA 4B9UA 1RT4A 2R2SA 1WSGA 2XRIA 4MKBA 1HJRA 1HQEB 4UQGA 4YR0A 2FBXA 1EP4A 4M3XA 3MEGB 4CGFA 3VQ9A 4NYFA 4RW8B 3IRXB 5KFXA 4HCCA 3C6TB 3V4IB 1N5YA 1C0UA 3HPHA 1RTJA 3PW5A 1UWBB 2EC0A 4PUOB 3OJUA 4ZPDA 4QOZB 4EO8A 3NGZA 3IN5A 3VN5A 4FJKA 2OPSA 4OL8A 5KFYA 5EWGA 4RW6B 1DLOB 1RA6A 4I9LA 3SCXA 4CEFA 4ED6A 3DLRA 4K4XA 2PYJA 3CDEA 2GV9A 4CEAA 4CEBA 3NF9A 1JXBA 3AO3A 1NOZA 4CIEA 2HNYA 3K5NA 5SWMA 2XY5A 3QGHA 4KAZA 3KLHA 3O3GA 4XIUA 3T3FA 3HVTA 3L3VA 3JYTA 1RBVA 2FLPA 2RKIA 3VQPA 4NLSA 4DSIA 2I5JB 3DI6B 3IG1B 4RNFA 3QEIA 4O44A 1LW2A 1ZBUA 4FLVA 3EPIA 3T1AA 5CYMA 4TLRA 2X74A 3MAQA 4CJUA 4CF0A 4OJRA 4I9QA 1Y97A 4NYNA 3CM6A 3HKWA 1RBRA 1JLEA 3NGDA 2IGIA 2FJVA 1C0MA 3KKSA 2HHVA 4E1MA 4YP3A 3TANA 4CJFA 1HQEA 3NDKA 1MU2A 3ZSYA 2QE5A 4NLQA 1JXEA 4KFBA 4DFMA 3ZSRA 4RW8A 3HP9A 4GC7A 1DTTA 3HJFA 3TWHA 2GIRA 3NMAA 4RUAA 4GC6A 4CGDA 1TKXA 4CERA 2HNDB 1UWBA 2AX0A 4PUOA 4DF8A 3RB6A 4JUZA 2WK4A 3SQ0A 3HT3A 4NLDA 3HL8A 3KD5E 4FJ9A 1N6QA 4KB7A 2AQ4A 2AWZA 4N56A 1QSYA 4RW6A 3L2VA 4WXOA 2BE2B 4B8CA 3FFIB 2JC0A 4DL6A 1HYZA 3B6PA 2YKNA 1JLAB 4DQSA 4FJXA 4FJ8A 4ECSA 1TL3B 1N4LA 2HHWA 2R8IA 5SZTA 4NRTA 3WNHA 4KB1A 2OPRA 3C6UB 3G10A 1S5JA 1RBTA 4KBIA 1CZBA 3RMAA 4QPXA 4TYBA 4MIAA 3CJ0A 3KLGB 3DLGA 2ILYA 3ZSQA 1MMLA 3MEEB 4O3QA 4URGA 3OYFA 4KHUA 4DSFA 3DRRB 4C8NA 1KRPA 1BI4A 1RT2A 3BR9A 4OKEA 2D3ZA 5HRNA 4GMJB 1WNEA 4FBTA 4K8ZA 3RRHA 2I5JA 4F4WA 3IG1A 1QSLA 4CEOA 4O4GB 4O0JA 3OYLA 2G8KA 1N48A 3VQSA 2XC9A 1X1PA 3QO9B 2AX1A 1WSIA 5KFBA 4R8UB 2GBZA 2AGPA 1SUQA 4LH4A 4FCYA 3CG7A 3DMJB 3OLAA 4F8RA 1J54A 3G6VA 1X9SA 4M41A 3MFIA 3CJ2A 5C5JA 1EETB 1SL0A 3OYAA 1W25A 1S1WB 1JL1A 2YHAA 4CJLA 3E51A 4CJ4A 4B08A 2XI2A 4M45A 4ZHRB 2IBKA 1FKPB 4YMEA 3QZ8A 2HNDA 3LAKA 2ALZA 2VWJA 4M3RA 4ZPAA 4NCAA 1D1UA 1S97A 1JLGA 3AVNA 3ISNC 2JC1A 1CXQA 3LWLA 4AH9A 1KVAA 4F4XA 4ID5A 3PUFA 5F8IA 1CLQA 1KVCA 3BGRA 2X6NA 3AV9A 4OPJA 1T03A 1KFDA 4BDPA 3I0SB 2QKBA 2HHQA 4N76A 4Q45A 1TL3A 4FLYA 2QK9A 4IH7A 1KLNA 3VQ6A 4TY9A 3I0RB 4ECVA 1B9FA 3NBPB 5EWEA 1SL2A 1R0AB 1U49A 3VQ7A 2JGUA 4Z4GA 4WFZA 1RBSA 2WOMA 3Q8QB 1C1CA 4IKAA 2ASLA 3I5CA 3NHGA 5J2NB 3KLGA 5KFQA 4KHWA 2GIQA 4M3ZA 2JEJA 3DRRA 4CF8A 3PR5B 4FJ7A 1XR5A 3DOKB 5JXSA 3KKRA 2BQ3A 1NK5A 3F73A 1EKEA 2XWYA 3QLHB 2G8HA 1TP7A 3IAYA 1VSLA 3RB3A 2BR0A 5KG3A 3DRSA 4R8UA 1KLMA 2E6LA 4CJ3A 3HPGA 5KT7A 3HO1A 3CM5A 2A1SA 2ATLA 3OYIA 4CEZA 3H98A 4Q44A 5KFNA 1S1WA 3UQSA 1NKEA 4OKJA 2ASDA 1SKRA 2RF2A 2HMIB 1JXLA 3HXMA 2G8FA 4KO0B 4LSLB 3ULDA 4DQIA 5HLFB 2BQUA 1BIZA 3UDLA 2ZE2B 3FDSA 1QTMA 4O5BA 1EXQA 4BACA 3PZPA 4Y34A 3AA5X 2R8JA 5HRRA 3VQ8A 3V81B 1S0NA 3I0SA 3K59A 1BQMA 5CYQB 4HUFA 2OPPB 3RRGA 2FBYA 3CFPA 3NF7A 3V9SA 5DMRA 3VQBA 4J9SA 5J2MA 3M8PA 1NHVA 1R0AA 2Y1JA 4W5RA 4TQSA 3ZCMA 5L9XA 1A5XA 3NH0A 4ECXA 2W7PA 1QS4A 2YKMB 4E7IA 5KFRA 3HVRA 3E01B 3OVNA 3EZ5A 1FK9B 1RTDB 2XY7A 2VA3A 3PO4A 4PA1A 5DQGA 4DSLA 2VG5B 3KJVB 1CZ9A 3GIMA 1J53A 3OL8A 3H08A 3H40A 2KZMA 4IDKB 5KFOA 4LSNB 4CFBA 1QAIA 5KG5A 1QE1A 1VSIA 1TAQA 3LP2A 1RTIB 3MEDA 3L2WA 3HM9A 4CHZA 4DFKA 4FK0A 4TSXA 3M8QB 2FVPA 3ZSOA 1HPZB 2ZQBA 1C1BA 5C42B 2V0NA 4ED2A 3H5SA 1ASUA 5I42A 3LP1A 2B4JA 4RW9B 4FZXC 4FXDA 4ZVGA 4CESA 1ZBHA 4DTPA 2R8KA 5F9NA 2G8VA 4KO0A 4LSLA 1RTHB 5HLFA 2ZD1A 5KFHA 1TVRB 1VRTB 3CIZA 2FJXA 3EZUA 5KG6A 3TABA 4KHNA 2V4QA 1Q8IA 4FJGA 4L8RB 5HBMB 1U45A 2OPPA 4CHPA 5CY4A 3DYAB 3SUNA 1JLQB 3DRPB 5HROB 2B5JB 4K4SA 2CKWA 4ECQA 4NYZA 2RDJA 3AVKA 2JEFA 3SPYA 1ZYQA 1LWFA 1TAUA 2BRKA 3AO1A 4TXSA 4J2DA 2YKMA 3TI0A 5KT3A 5F8JA 1S1XA 3TAQA 3TQ1A 3NH2A 3KNAA 3DLEA 3VQ5A 1L3UA 4PQUB 1GOBA 4YR2A 4ZPBA 1JKHA 4BE0A 4TY8A 1C6VA 4IDKA 3G6YA 4LSNA 2X78A 1ZETA 4J2AA 2LSNA 2BDPA 4FJIA 1SH2A 2W9BA 4I2QB 4NLXA 2P1JA 4K4TA 5FROA 1FKOA 3GIKA 4Y1CA 3VA0A 3TAFA 4QWDA 3M8QA 1HPZA 4EBEA 1U04A 3KLFB 1NK9A 3EY1A 1NJXA 1XI1A 4CFDA 3ZT1A 3SI6A 4NLGA 3HHKA 1Q9XA 4C8OA 4B9MA 1IKXA 2BQRA 4DTOA 5KG4A 1REVB 3JSMB 1T94A 3S3OA 1GX6A 3KLVA 3LWMA 4CGJA 4IG0B 2OH2A 3WNEA 3PW4A 5KFUA 4JV1A 1TVRA 5FRMA 5D3GB 3SJJA 4NLVA 1WSEA 3QESA 2RPIA 1VRTA 4DL3A 4Z4HA 3DLKB 2ETJA 3QEVA 2FVCA 3PJXA 3AVAA 1DTQA 4DF4A 2FBVA 3D0PA 4X2BA 3HSTB 4URSA 2OA8A 3DYAA 5HROA 2B5JA 4Y3CA 5T7BA 5KFJA 3RAQA 1ZTWA 4E0DA 3VQEA 1LW0A 1L3SA 4F3TA 4CIGA 5KG1A 4JV2A 3ZT3A 3IGVA 4FJHA 1GOCA 1NJYA 3H59A 1S4FA 1TKTA 4NCBA 4Z4FA 1IKYB 3OLBA 4FLUA 1S1VA 2HHTA 4NLWA 3MR5A 4DQPA 3QIDA 3PW7A 3RBEA 2W8LA 3OS1A 4OLBA 5L1JA 4BWJA 4Q8FA 4J9RA 4HTUA 3MXMA 4GW6A 2OPQB 3KLEB 3BSOA 1RDBA 4ED0A 3SUOA 3IGNA 3QEPA 4ECYA 3SUQA 4I2QA 3O4NA 1ZTTA 2VWKA 1BCOA 4FJLA 4WYLA 1YTAA 3OYNA 3QNOA 1WSHA 3ZSZA 5EUHA 2HNZB 3KLFA 2Q3SA 3ZT4A 4ECUA 4WFYA 3GIJA 3T5HA 5C24B 1J5OB 2C2RA 2KW4A 1SH3A 1LWEB 4DL5A 1REVA 3BDPA 3OS2A 4N41A 1KVBA 4OLAA 5KFIA 4AHUA 2IJFA 1NK7A 5D3GA 2W42A 1A5WA 4TN2A 1LAWA 3NGIA 4H4OB 2IMWP 3LPUA 3ZT0A 3O3HA 1TK0A 1TGOA 2HHXA 1RYSA 3TR8A 3N6MA 1HNVB 4O0IA 2R8GA 5FDLB 4Q0BB 2C28A 5HP1A 3QIOA 3DM2B 2D7SA 4NLPA 1S48A 2W7OA 3V1QA 1HMVB 3CDUA 4KTWA 3K5MA 4K8XA 4QW8A 3HP6A 3MEGA 3CQ8A 2OZMA 3RR8A 4CK1A 3NAIA 1SKSA 1SL1A 3IRXA 3C6TA 3V4IA 2Z1HA 4K4VA 3G86A 4Z4EA 1VRUB 3GV7B 4OPKA 3RR7A 2D5RA 4CGIA 2XGQA 2O5DA 4F4YA 3TARA 1D8YA 4ECTA 2OPQA 1DLOA 3NE6A 2W9CB 2R2TA 4JRPA 3NCIA 2GUIA 4J2BA 1X9WA 4EBCA 1QHTA 1RNHA 4AHVA 4NLUA 3CJ4A 1BQNB 1K6YA 1TKZB 2UUTA 2FJWA 3KOAA 1F21A 1A5VA 1ZBFA 4CK3A 2FLLA 5I3UB 1KHWA 2IM3A 4K4ZA 3TAEA 3RB4A 1EX4A 2ASJA 3S3NA 3ASMA 2Z1JA 2YNFB 3VQCA 3QERA 1RT3B 3P83D 2JEGA 4EP5A 4DFPA 3KMQA 4B8AB 3BJYA 3DI6A 1SV5B 4H4OA 1VSJA 1JLCB 3U3YA 4KV8B 2PZSA 1TV6B 3U3GA 4B9SA 1IKVB 3V6DB 4B9VA 3AO2A 2Z1IA 4Q0BA 2WONB 4CJ5A 3NL0A 1HMVA 1U4BA 3OYCA 5DGAA 3M9NB 2R2RA 3Q8SB 4CHNA 2KFZA 3OJSA 3DDKA 5EWFA 3V6HA 4TYAA 1YVUA 2E4LA 4MIBA 3ZSWA 4CHOA 4RW7B 3V6JA 3SV4A 4J9LA 1JLBB 1QAJA 2IM0A 3BQ1A 1IKWB 3KD1E 4B9TA 4MFBB 1S1TB 1U09A 5HRSA 4FLTA 2BE2A 3FFIA 4I7FB 2W9CA 2UVRA 3TAMB 3QIPB 4EYHB 3V1OA 1JLAA 1HRHA 4ED8A 4AHTA 5KG2A 4RG8A 3CJ5A 1S0MA 1TQLA 2V9WA 3OL9A 5J1EB 1BQNA 2F8EX 3N6NA 3C6UA 3SUPA 2KFNA 4WXWA 4BDZA 3MEEA 3CWJA 5KRTA 2XY6A 2IOCA 3ZSVA 3ISND 4FLXA 1RDRA 2YNFA 4YR3A 4Z4CA 2B6AB 3PW2A 1UA0A 1SH0A 4W5OA 4DLEA 2AGOA 4IH5A 4FM2A 2ZKUA 1SV5A 5EU7A 3H5YA 1JLCA 1S1UB 4O4GA 4F3OA 4M3UA 1LWCB 2I1RA 4WE1B 2BRLA 4O55A 4M3WA 5KT2A 1C0TB 1IKVA 3QO9A 3V6DA 5DQIA 4K4UA 4HHTA 4DSKA 4IRKA 5DG8A 1ASVA 2WONA 5L1KA 2F8TA 2FVRA 2IS3A 3AO5A 3PY8A 3DMJA 4ZP9A 2XO7A 4W5QA 2ATQA 1Z26A 4FLWA 4E7JA 1EETA 3BQ0A 4Q8EA 1QQCA 4E7HA 4WZMA 4KHRA 1TL1B 2V4RA 3KHGA 2VG7B 4IFYB 4ZHRA 2YNIB 3K2PA 3DOLB 1FKPA 3GYNA 4CECA 3GIIA 2D0CA 4FZZA 3H5XA 3C94A 4DQQA 1IKWA 4O3SA 4WZQA 4CCHA 4XPCA 1L3TA 4ECZA 3BQ2A 1XHXA 3D28A 4CEDA 4MFBA 3I5AA 3CFOA 4J9QA 1RCHA 2DFHA 4I7FA 3MR2A 4O3NA 1CXUA 3H5UA 3OYMA 3OSNA 1D9DA 3SNNA 1VSFA 4U6PA 4TQRA 3HPOA 5J2QB 3GV5B 2UVWA 5J1EA 1T3NA 5KGWA 3I0RA 1U47A 3NBPA 2YNGB 3SQ2A 4FZYA 1RDDA 2BANB 1L3VA 1S49A 4J9PA 5J2NA 3KK2B 5KG7A 4R0EA 1BL3A 1VSEA 4E19A 4ZP8A 2O4IA 3DOKA 4EBDA 2B6AA 4KKOB 1NKCA 3CJ3A 4JLHA 2VG6B 3OYBA 1OS5A 4BWMA 1LWCA 4KRFA 4H8KA 3QLHA 2PY5A 1C0TA 4DU1A 4U7CA 1GX5A 4RNOA 1WN7A 5KFZA 3H4DA 4DSEA 2CJQA 4DTJA 5FRNA 4KREA 1ITGA 3CYMA 4HCBA 4ZPCA 4ZVEA 4RW4B 3CVKA 1NK6A 1TL1A 3ITHB 4PWDB 2B43A 2IM1A 4CE9A 4IFYA 1TK8A 3SQ1A 3O4QA 4JRQA 3RAXA 3NF8A 2J6UA 4C8MA 4O3PA 3PW0A 2HMIA 4DTSA 4OGEA 4F4ZA 4HVJA 4DL7A 5CZ1A 1IH7A 4URQU 3AA3A 2ZE2A 1HYSB 3SZ2A 3RTVA 3AO4A 5KG0A 4J9KA 4B3OB 4ECWA 4IH6A 3H2LA 4YQWA 5F9LA 3TAPA 2QXFA 5KFDA 3B6OA 4FBUA 3V81A 3MTKA 2UVVA 5CYQA 4Z4IA 4ED7A 3AVFA 1KFSA 3OYEA 2C22A 4KHQA 2YNGA 1IO2A 1NK8A 1RAJA 4IR9A 1L5UA 1TKDA 4M94A 3EPGA 3KK2A 4ED3A 2HW3A 4G3IA 3D5MA 1S9EB 3IS9B 4I2PB 4FS2A 3SFGA 4Q5VA 1Z4UA 4ZP6A 3MECB 3E01A 1LAVA 1FK9A 3HVAA 4JV0A 2UUWA 1RTDA 4KKOA 1GOAA 2J6TA 3THVA 1NOYA 1JLFB 3M9MB 1NK4A 2VG5A 1EP4B 3KJVA 1YVFA 1FXXA 4C8KA 3KHLA 3AVJA 3WNFA 1VSMA 4KAIA 1N5YB 4FJJA 3KIOA 3S9HA 1C0UB 4IRDA 1RTIA 2IM2A 1WAFA 1W0HA 3M8SA 4W5NA 4RW4A 4YFUA 2OPSB 5KFEA 2IA6A 4PY5A 4E1NA 4G1QB 3ITHA 1QUVA 5C42A 4CHYA 4KE5A 4KPYA 4C8LA 5L1IA 4RW9A 1NJZA 3G0ZA 3TVKA 3T5JA 3GILA 1S0OA 4KI4A 2W8KA 3AA2A 4JS4A 3VQAA 4LY7A 4H4MB 2HWIA 4MQ3A 4FK4A 1RTHA 4CEQA 4LH5A 4RZRA 1HYSA 1XC9A 4F2RA 4K50A 4FJ5A 1RBUA 4KTQA 2HWHA 3HVTB 4JS5A 5HBMA 5F8GA 2RKIB 1WSJA 5KFKA 3HK2A 3ALYA 3L8BA 1JLQA 3DRPA 3LZIA 3LP0B 5KT6A 4KB0A 1I39A 4J2EA 1B92A 5DG7A 3RMDA 4CEEA
chains in the Genus database with same CATH superfamily
2P8IA 4O44B 4JHDA 2GC8A 5BR8K 3O3FA 1KVIA 3ENHA 1KTVA 2C2NA 1D5AA 5JS2A 5LT5A 4AQYF 2P9PB 4F0HA 3NAHA 3IAM9 1JLFA 3PX4A 1W9HA 4IQXA 5DQHA 1UPMB 4WPAA 6FDRA 3FMBA 4U67L 3EO3A 1NO8A 4FYXB 1NBWA 4G65A 2Q1LA 2AEMA 4YOWA 4RBTA 1Q79A 4GVMA 3CCUS 4JNEA 1R0CB 4JBCA 3MCAB 4TU8A 3MPDA 4H5NA 4KH6A 3BSAA 1N6QB 4ZCKA 4G1QA 2F9TA 5EOYA 2ZDOA 3T5LA 3LH2S 1BXNA 3Q7CA 5FPNA 3OFGA 2LQ5A 1HKGA 4M3TA 5M2UA 5DM7Q 3FRYA 4V19X 2R7YA 4E3SA 3PJ9A 2MJNA 4DV3J 2RHKA 2FC8A 1SKUB 2COLA 3FUYA 3JSMA 4WJBA 5JS1A 5D0RA 1F60B 4IG0A 4L3NA 4LF4F 3FRZA 2I7PA 4O3OA 2HB5A 2KN4A 1J9AA 3LM9A 3QSIA 2NREA 4WCEQ 3G96A 2DRAA 4KI6A 2WRMA 1HIYA 3TEHB 5BRHA 2BE7D 3EYZA 4OHYA 2E66A 4CRJA 3NKYA 2JEIA 4Y0WA 3OFFA 1HWKA 2J0WA 1ESVA 5LJ3Y 2QEXS 1M1GA 2JRSA 5A2QY 2QSWA 1UPPA 4FN5A 3W63A 3UFCX 3THYA 3AA4A 1H2TZ 1KCFA 4AD6A 3GWCA 1ASWA 4IG3A 5LSRA 3WX4A 3S3MA 2FC0A 1RHKB 4IOAQ 1D4XA 1WHVA 5EX3A 4KHYA 3C95A 2XMVA 3TTDA 4DU3A 2EBGA 3KVGA 2ZEJA 1MW7A 3O2IA 4D3GA 2MQNA 3J81j 3FSIA 3OFHA 4DR6F 2KXFA 2XBPA 5KT4A 5BPNA 1C2PA 2G0JA 4LF9F 2HNZA 2QA4G 4KIAA 5HOOA 2XCPA 1VQ5S 5CHIA 1BUPA 1J5OA 3V1RA 3CPEA 3UPFA 2F4VK 2HZVA 3T7ZA 3P4IA 3S01A 1C4CA 2GMLA 1YDLA 3ET6B 2BACA 5T7LA 4OZ3A 2UVUA 3OTEA 4FWQA 3M6WA 1OH6A 4CGGA 4QIGA 2UXBJ 3WIVA 3M1VA 4EP4A 2XMUA 2RDIA 1Q82O 3VQQA 2YJFA 3BEXA 5K20B 3ZEUA 4N47A 2BJ3A 2CWXA 3WQTA 4BVOA 4OQJA 4PG5A 1VJWA 4BE1A 3VF6A 4NYOA 4QWAA 3WXKA 3RMCA 2CQIA 3W9IA 2E1AA 1NJWA 2AJQA 5B0AA 1KLMB 1LOTB 5IC6B 2JSXA 1HNZF 2XCAA 2EFQA 2XTJP 3P38A 2UUAK 2NXNA 2EHGA 3P1GA 1RK8A 4C0HA 4DUZK 3QGGA 1DZ5A 4LRDA 2G8WA 2YWFA 1RDCA 4A8XA 4N5SA 3QEWA 2V7ZA 4CJTA 2LP4A 3ULHA 4CF9A 5J1PA 2ZH4A 4M42A 1BHLA 1T8EA 2MZ1A 4OFZA 1TKZA 3ZC4A 4YDUC 4CVNE 2GVDB 5I3UA 4MT1A 3T9NA 4X64K 3NNAA 1NKBA 2QMXA 4DR5J 1VQ8N 1HNXF 3OTDA 3IR6B 5DO2A 4XH4A 4FDFA 1FXDA 1LOUA 2A18A 2V9KA 3MFHA 3MK6A 3G6EN 3PO5A 1FJ7A 4C2MA 3SDEB 5D4PA 3IR5B 1T7PA 2JL9A 2WSEC 3AT1B 3A5NC 4K4WA 1OWXA 2BJEA 4DCHA 3J7YP 4HI2A 4ELTA 3BH7B 3MMCA 2ZH2A 4BC5A 3R3TA 4DL0C 2VA2A 3AVLA 4FXVA 2PEHA 4WK1A 1LFWA 3NGRA 3A8IA 3FCWA 3PTWA 4M95A 1N0UA 2HVEA 2V69A 4LF4J 4RW7A 1VQPN 3GFZA 2P9SB 3GFXA 4USTA 4CZMA 2V8DA 2P9LB 2MZQA 1IQZA 5H9FJ 2WVCA 2V34A 2CYYA 3VQ4A 3DFEA 2DIUA 5I42B 1X3MA 3TAMA 2W9AA 2D3UA 3MUVP 4R5PB 2JH3A 4RNHA 1YG0A 1RWWB 2E5JA 4BRKA 3CCWA 3MX2A 1PG5B 4WU3A 4XK8C 3AVMA 3JSYA 2EEYA 1SQFA 3QSYB 1NHUA 1BCMA 3SPZA 3QT6A 1NGEA 1LV5A 2C3UA 1RWNB 2HURA 2XG8A 3FGVA 4DJBA 5JVHQ 4YNQA 3K0SA 4O4RA 3KUHA 4RU9A 4B3SK 4PKDB 5DG9A 3MCSA 2WVBA 3AVIA 2J9DE 3OHAA 3MMBA 1S6PB 5F8MA 2WUSA 1XIQA 3NFAA 2ZNZA 2NS1B 4O3RA 1BY9A 4Q43A 4C23A 4DPTA 1UJ5A 2KZZA 1N33K 1M1HA 1UVNA 2N82B 4LF9J 2EPIA 4QAGA 1HQUA 1SAZA 3D68A 4H0PA 3G82B 1F2GA 3S41A 1Q1KA 4DEZA 2VQEF 2C2OB 2VG7A 1M5OC 3DOLA 1BIUA 1WEXA 1VS3A 2VC1A 4NRUA 1JX4A 1WC6A 1F5CA 1SJFA 1ZA1B 3NF6A 3RU0A 4V19S 4HT7A 5AQTA 3MR3A 2V51B 1Q8KA 2CWKA 2R7QA 4DU4A 4FL9A 4KPCA 4LQ9A 3WDOA 4OVLA 1VBKA 1V6HA 4J9MA 4CZGA 3HRGA 3QINA 1KOHA 3T41A 5KFAA 2R2UA 4DX8H 4ID1A 2VZ9A 4F2SA 5FPMA 3K89A 1N0VC 2CPJA 1OVQA 1G6BA 2Z1GA 4NLRA 1VSKA 2H5JB 4CO5A 3MUMP 1UWAA 1HNZJ 2BKNA 3JQMA 2D0AA 3VZHA 1C1AA 3FBBA 3QMQA 5AQQA 4FM1A 3OW2R 5ETLA 1SQGA 1HBMA 3L2QA 1EWQA 3CXCM 1K8AO 2RRAA 4OPHA 5TKWA 1IXKA 4PWUA 3DDNA 1A9NB 1VI7A 1W26A 4PQAA 2LFVA 2RQ4A 5KPTA 2DVIA 1S1VB 3IWNC 1XR7A 3M9OB 4IOCL 2O8DA 3MN9A 5F3TA 1N8RO 1JIHA 1EIYB 2FXUA 3M2RB 4ZITA 4MO4A 2AGQA 1HNXJ 1K1SA 3PFEA 3KK1A 1JB0C 3D6MB 1AFJA 1JL2A 5E33A 1ROFA 1YTUA 2J9DA 1X7VA 3WBZA 5KFVA 4QW9A 2DHSA 4CLPA 4CF2A 4ZTFA 1VQNS 1IM4A 4DR2F 5KFCA 4FWMA 1YJNS 4UOCA 1TYQA 1RHUB 2J7WA 1FWKA 3ID6A 4FJNA 4JI0F 3M32A 3J7AP 1VQ4S 3W2VA 1ZM9A 3D45A 2FSJA 2UV8G 2ZH1A 1NCLA 3ENBA 2E44A 2VHGA 1LW2B 4HH1A 1N88A 3H2UB 2Y1RI 4C11B 4I2PA 1XERA 3MECA 1I6JA 3AY9A 4DI6A 2DNYA 1JLEB 1WHXA 2GZOA 3BGLA 4CYUA 4WIIA 2WZ1A 4MKBA 3EKSA 4YR0A 1VC0A 2R7TA 1HWIA 1T0TV 3EJMA 4JI1J 1ZBTA 5KFXA 1WOQA 3W8PA 1R27B 2IDLA 4U7UK 1VQLS 1RTJA 3BYPA 1OSDA 3Q23A 1FD2A 2EC0A 2CADA 4CQ1A 4I6WA 3U1LA 4QOZB 1XQSC 5E3QA 1TUGB 5KFYA 5HK4A 1NH8A 4RW6B 3EGVA 4CO0A 3M30A 1DRZA 4CEFA 4JI4F 3HMJG 3HT0A 5AE3A 5IZHA 1GAOA 4M63A 4FOIA 2VFSA 2IJRA 3NF9A 4LFAF 4ER8A 2DEIA 3CCVS 2U2FA 5SWMA 1ELOA 1JMTA 3MX5A 2WBRA 2RKIA 4J7CA 3KFWX 2BJ9A 2DNHA 2VQEJ 2HGNA 1WF0A 1ZBUA 4H5RA 4FLVA 3T1AA 5CYMA 4TLRA 5HANA 3MAQA 2EWHA 4I9QA 4DV5K 2DB1A 3CM6A 3HKWA 4JN4A 3KKSA 2KXHA 2GX9A 3NCRA 1U2CA 3QJLA 4GV9A 4BRPA 1QVFR 2NLWA 1HQEA 2VBXA 1NPPA 2QE5A 4NLQA 3EL2A 3OPKA 5M2RA 2DNZA 3ZSRA 4GC7A 1DTTA 1MN9A 3NMAA 4KR0B 1EAYC 1TKXA 2BJ8A 4NLBA 2WK4A 3T6JA 3KD5E 1RADB 4B3TK 3CQXA 2GQ2A 3VGKA 3FEZA 1QSYA 4WXOA 3PEJA 2J4RA 2JC0A 1FDDA 4YOEA 1MWKA 2NSCA 5A8KB 4DQSA 1EZZB 4FJ8A 3CHWA 1TL3B 4YB1P 3FEXB 3CJKB 4NRTA 3WNHA 3WT0A 4KB1A 4YB5A 4RTFD 2EFNA 4Q7AA 4XDDA 3VTIA 5C12A 1NDCA 1WWHA 3BS9A 5EVZA 2ILYA 4ZLLA 4O3QA 2HRUA 3DRRB 4C8NA 1K8AT 4HDGA 1KRPA 1BI4A 1RT2A 1NDLA 1F9FA 3VPZA 3VGVA 5HRNA 3DXSX 4P2SA 1WNEA 3RRHA 2QJ3A 4DR4F 2I5JA 1K0TA 3OYLA 1FEEA 3DDIA 2XC9A 2PFUA 3AQPA 1U2VA 2E7WA 5KFBA 1BOTO 2QWPA 1N8RT 2AGPA 4OZ5A 1SUQA 3CG7A 4F8RA 2BJ1A 2J0QD 3LGMA 3UN2A 3G6VA 1K8KA 1X9SA 1JQGA 2QMWA 2UUCK 1E3MA 4DR2J 2NZ4A 5C5JA 3OYAA 3MAAA 3W66A 3FBFA 2YHAA 3MCNA 4ZHRB 2A10A 2FGCA 8AT1B 1IBKF 3A5OC 2HNDA 2ALZA 1KEKA 2E7XA 3THTA 3B8AX 3CCMN 1JLGA 3AVNA 1CXQA 4F4XA 3IBWA 4ID5A 1X4FA 3PUFA 5F8IA 2W2NP 3PRDA 2DPNA 2XZTB 2BOAA 2X6NA 4OPJA 1T03A 2HEKA 2EFVA 2QKBA 4N76A 2BJDA 4F9OA 3M8YA 3I87A 2OUGA 1SQEA 3I0RB 3RRKA 3O8WA 1EB0A 1FHTA 3V4MA 2QW9A 1R0AB 2QX0A 2W40A 2JGUA 4KH1B 2WOMA 1C1CA 4IKAA 2ASLA 5J2NB 2CFXA 4KHWA 4DR1F 3TYTA 5E3CA 1URNA 3PR5B 3DOKB 2BQ3A 1TTHB 1NK5A 4DUYK 3SCKE 3CCRN 2XWYA 4QYZJ 3QRQA 5AZJA 1OJ4A 1TP7A 1XN9A 2AZ3A 4CLKA 4PAAA 4JI4J 1VSLA 3Q2TC 5AE1A 2DR7A 4LRAA 2DO4A 3QWUA 4ZK7M 3DOMA 5KT7A 3OBYA 2ZZMA 2CQBA 4JK9A 1WSVA 4CEZA 1T9YA 2HFVA 4Q44A 1S1WA 3UQSA 3ULEB 5L39A 3BGFA 4ETXA 1VYAA 3G4SS 3LW5C 4I6AA 1RE1B 4O8UA 1CJTB 4FP9A 2HMIB 3HXMA 1JXLA 2ATCB 2ZH6A 2G8FA 4LSLB 3THXB 5HLFB 4OV6A 2U1AA 4O5BA 1EXQA 4Y34A 2KYZA 4NXNJ 4JI3J 1H2VZ 4CTAA 2OEKA 1GLDG 4TVAB 3K59A 1BQMA 3RRGA 3CCZA 3NF7A 2RE1A 3H1QA 3R7SB 3M6GA 3VQBA 2W01A 1FRLA 1U25A 4MJKA 1OY9A 2FZCB 3M8PA 4I6YA 4TQSA 3GCWP 2R7WA 2FPHX 4F3MA 3GU0A 1QS4A 5A8RB 4GKKF 2ZH5A 2YKMB 3HOTA 2ZH3A 3HVRA 2IIHA 4ZLNA 1CJVB 1K73T 3LDQA 2VA3A 1TFYA 1NU4A 4PA1A 1CZ9A 3IUCA 3GIMA 3OL8A 4JP8A 2KZMA 3W5YA 5KFOA 3CJ7A 5GMKa 2M52A 4CFBA 1QAIA 3F2KA 4PCQA 1QE1A 1U26A 1VSIA 2QLXA 2ZJQQ 4IEIA 3LP2A 3U7JA 1IV0A 3VAFA 2FJDB 2FJAB 4JI7K 5ETOA 2FZGB 4DFKA 5RUBA 4QZVB 3HHLC 5C42B 2V0NA 4X4QA 2B4JA 2AYEA 2ASMA 4RW9B 2RHQB 1AZSA 4FXDA 4QYRA 1YJRA 4DR4J 2ZD1A 1HKBA 1WSRA 1VRTB 3CIZA 2F8MA 4BLGA 1I94F 1PILA 1Q8IA 4KH5A 4WP8A 4L8RB 5HBMB 1U45A 2OPPA 3CJTA 3JS9A 5AQLA 1CQMA 3DRPB 5HROB 4K4SA 3E3XA 4BC7A 4K0KF 1VR6A 2RDJA 4Y0FA 1ZYQA 4KQZA 2BRKA 1IBKJ 3AO1A 4TXSA 2J9CA 5KT3A 2RE2A 1RAAB 5D77A 3LQVA 1U8SA 5E0OA 2E5LK 3CMES 4R79A 1L3UA 3P6YC 2ZJPL 3D2FB 1UVJA 4NZ6A 2M9KA 4USWA 4BE0A 1MWQA 2K7JA 4TY8A 2LSNA 3H42A 3ATVA 4RWWA 2W9BA 4E2FB 4NLXA 2GGPA 3FFKB 3CCTA 4C0OC 3M8QA 1U04A 5AQXA 1NK9A 4DR1J 3WEEA 3CCSS 3UKRA 5AQPA 4NLGA 1IKXA 3BKFA 3CC7S 4L6V3 1T94A 3S3OA 1GX6A 4CGJA 1U1MA 2OH2A 3TR5A 3SJJA 2MKHA 2H5IB 1WSEA 4DL3A 4Z4HA 3DLKB 5IC4B 2OAUA 2DGVA 1DTQA 4C3MA 3SMPA 2X1AA 2CAJA 4HHJA 2D0PA 4URSA 4N8NA 1ZTWA 5LM7E 3TVYA 4ZPVR 5IT9U 3JQJA 1L3SA 4F3TA 4JV2A 3AXMA 4AL5A 4EWTA 1GOCA 3EE8A 5F41A 3Q8VA 3CERA 4NE9C 3H59A 4C4WA 2ZHOA 2DEJA 2IVMA 4NCBA 4ALZA 4OZ0A 2N7CA 3FCHA 1Q7LB 1SPBP 3NGUA 1M5KC 1EX8A 3RBEA 1XMQK 1KDNA 4OLBA 5HVFA 4Q8FA 4XEIA 4FVUA 1ZOTA 3BSOA 2EG2A 1RDBA 3US5A 2G9OA 4ECYA 3SUQA 4I2QA 4CLZA 4X66K 3SAFA 2NRVA 1BCOA 2VASA 3QNOA 1VQPS 2KT5A 3KLFA 4PG6A 2N7YA 3PLAA 4OJ1A 5BRDA 2DGTA 1XEZA 2DHGA 2QLFB 1AUSL 1SH3A 2VB6A 3S1TA 4DL5A 1UZHA 3OS2A 4N41A 1KVBA 4M5LA 4ZCMA 3MM9B 4OYXA 2NQPA 3W2WB 2RAQA 4BQZA 3VEXA 1A5WA 3O1BA 2VQFF 2DK2A 3CF5L 4C3LA 2IMWP 2MHNA 3O3HA 2CPXA 1TGOA 1H7XA 3GG4A 1VQYA 1HNVB 1YJTA 3MM5B 3QIOA 3DM2B 2D7SA 1KOOA 3A8YA 2BOPA 1AFIA 1CJKB 3V1QA 3NNHA 2WVDA 3MEGA 3TQEA 1VLYA 2X1BA 1NGAA 1OPZA 3IRXA 1ICEB 4DV1K 2JZ5A 4DHYA 2VD3A 1VRUB 2ADBA 1VAZA 2QWRA 4OPKA 2R4FA 1S76D 1KAYA 2DIVA 1I94J 4BR9A 4I64A 2A40A 4GY2B 2RS8A 3DNCA 2ZNYA 3NE6A 4JRPA 5BPMA 2DJWA 3NCIA 1X9WA 4EBCA 2C3YA 2LEBA 2O8BA 1RWVB 5AXLA 1T3VA 3ZO7A 3CJ4A 2FJWA 2XS2A 3KOAA 1KN6A 3SCJE 2JWNA 2IM3A 4K4ZA 1QD1A 3RB4A 3G87A 4AQYK 4N7TA 1EX4A 3D1QA 3S3NA 3A0IX 3W7BA 3UKUA 1YKWA 3VQCA 1IBLF 3P83D 3QFHA 5GMDA 2JEGA 2IPOB 4B8AB 3BJYA 4FNIA 3MN7A 3DI6A 3NGKA 4F26A 1JLCB 1TV6B 2CRLA 4B9SA 4ZS6A 2ZH8A 1IKVB 1SI9A 1PGZA 2VKRA 4BBYA 4LVOP 4Q0BA 2IDEA 1R59O 3GR1A 4AM7A 2CGKA 4DOZA 3H20A 2EKNA 4M5DA 1VLOA 2MGZB 3OYCA 2R2RA 1UCNA 2KFZA 3V6HA 1YVUA 2B9XA 1HWLA 4Z37A 4IO8A 3WQPA 2QFIA 3SV4A 5C2FA 6AT1B 4J9LA 3KD1E 4B9TA 4MFBB 1S1TB 4OX9F 1YBUA 5HRSA 2BE2A 2E7VA 4I7FB 3V1OA 1F1BB 1HRHA 3R3LA 4RG8A 1TQLA 3VTHA 1BQNA 1VC6A 3BZCA 3N6NA 1UFKA 2F7TA 4JYAK 1YZ7A 2AEFA 3O5TB 3M2UB 4WXWA 5HVGA 3MEEA 3EEQA 3E9LA 2H4YB 1N5VA 1TR0A 1RDRA 1E6YA 3CGIA 3VAGA 2B6AB 3PW2A 3SXLA 5FLXU 4GVBA 2ZKUA 3H5YA 3R6GB 3VAMA 4O55A 1C0TB 4HHTA 2ZBQA 4DR6K 2BMBA 5K9FA 3D6RA 1ASVA 4NZ7A 3MN5A 3MM8A 3UNGC 3RG6A 3EDRB 3PY8A 1V5VA 3N01A 3DMJA 1MA9B 4W5QA 2C2ZB 2DNPA 3AFGA 2DITA 3N4PA 1QQCA 3DJCA 4PABA 4CD3A 2YNIB 2JVRA 2I0XA 3OV7A 2LQ8A 3LF0A 3GYNA 1WG4A 4DN0A 1HBUA 2C2KB 2D0CA 3FZFA 3Q8UA 1W7AA 1IKWA 3B4MA 3JTNA 4WZQA 3J81Y 4CI0B 4CEDA 4X65J 2CIMA 4ZVSB 4B1YB 5AJ3J 4H0TB 3A8KA 4PG4A 1FE0A 4O3NA 1CXUA 3D7EO 4IWVA 3OSNA 1D9DA 3OYMA 2HSEB 4CJ7A 4Y65A 1WORA 5J2QB 2UVWA 2YX7A 1T3NA 3M8ZA 3JSBA 1CQNA 2YNGB 4MLEA 2A0FB 2XSJA 5LJVA 4Y2MA 1EO1A 4ES2A 3VEZA 3HTVA 4R0EA 5ETSA 2CQ1A 4JB8B 2O8FB 2O4IA 5B0EA 1XNQK 4QS8A 1FESA 1OS5A 1LWCA 3TUIC 4YS2A 4DU1A 3PDNA 2VIHA 4CBXA 4YY3K 5KFZA 3H4DA 3CETA 3MN6A 2H54B 4DSEA 2VJUA 3M6XA 2FJEB 3R7BB 4OV1A 1T9WA 1TL5A 3EICA 2A42A 4ZVEA 1GXUA 2J9EA 4RW4B 4EU0A 2MJUA 1NK6A 2YQ0A 1TL1A 2B43A 1RLCL 5EX0A 5BR8F 4LBHA 3RAXA 4P2FA 1IBLJ 1T6CA 5D0HA 5AQUA 4FWOA 4HVJA 3ZX2A 2IYGA 2FUG9 2ZE2A 3DGPA 3C0BA 4B3OB 5AXNA 1XMOJ 2GX8A 4YQWA 2LVWA 2QXFA 4WCEL 4FBUA 2MSSA 2UVVA 2RQCA 5CYQA 4QIEA 1B70B 4DHVA 3OYEA 2LQJA 1R89A 1Y9OA 2DNKA 3R9PA 5E5NA 2IA0A 3TTFA 1NK8A 5GAEP 3KDOA 5HMZA 3DAWA 4JHDB 1NXIA 3K7RA 3EPGA 3KK2A 5KPZA 3D5MA 2QIFA 3SFGA 1Z4UA 2RUSA 3E01A 2W7AA 5C2GA 3DU5A 1FXLA 2XWXA 3FMWA 4OX9J 1JLFB 3POTA 1NK4A 2VG5A 1EP4B 3KJVA 1YVFA 3ZTOA 1X0FA 5I4MA 3J80U 4KAIA 4DR3F 1N5YB 5IT0A 2BEFA 4FJJA 2Z2ZA 3S9HA 3WX8A 4IRDA 5CD4A 2IM2A 2LXUA 5BXIA 5ADXA 4W5NA 4YFUA 1YXQA 3CCJS 1T9UA 4G1QB 2D3OR 2FTRA 2EW9A 4WF9Q 5GIOA 3CJQA 1YGYA 1YTYA 2WW8A 4RUHA 3TVKA 5CA5A 3AA2A 1IJJA 2G2OA 2HWIA 2AJ2A 1WELA 4CEQA 1HYSA 4BGAA 1O13A 3VVTA 5BYQA 4K42A 5IWAJ 4JS5A 5F8GA 3JAMY 4OZ1A 1Z2LA 3HK2A 3J7YI 4KB0A 1I39A 3MHYA 4F0MA 3QQCD 1WC5A 2PC6A 1ZAWA 3THYB 3SQGB 2FDNA 1H74A 3IS9A 2LQ9A 4IG3B 3F0NA 1T3OA 3DLHA 4QQBA 3TSPA 2XZWA 4YHHJ 4DZ6A 2AJFE 2OANA 3IO1A 1R8BA 4DTRA 4S0MA 4BG8A 4B9NA 3KHRA 3KMSA 5BJRA 3CQYA 2YQ1A 3DLBA 2HVIA 3G6XA 2BW7A 2ERRA 5KT5A 3D6HB 2BGGA 1X4HA 3OXFA 4EZ6A 2UXDJ 2XM3A 1NLVA 3GE1A 4OHZA 1NHKL 2HYIB 1LXNA 2YKNB 2WB4A 4CZEA 3BH6B 3A3OB 1KNZA 5B0BA 2XLIA 2GJIA 1J6ZA 2HHHK 2NUHA 1HR0F 3GJQB 1HI0P 2UUAF 2OPRB 5T7LB 3FC9A 2NRXA 3W8GA 4ZKAA 2MKJA 4A57A 3M1VB 3DLGB 3J81U 3ZYYX 1HI8A 5L9NA 1NBEB 2NZCA 3VR1A 3Q0AA 1EKSA 2F3JA 3TZYA 2XGPA 3NOCA 5ETTA 3LP0A 2C2DA 3AXKA 3EUNA 1N32K 4U7UD 4M5JA 4USHA 4NA2A 5BR8J 4CJVA 2F8SA 4X4PA 3TZXA 3VAIA 1F3FA 5ETQA 3SI8A 5KFMA 4X64F 2Z2MA 1Y5LB 1IKYA 3TJ9A 1H72C 3MXJA 5G0RA 3OTBA 2RD5C 4C9DA 2HFUA 3K8VA 2RT3A 3SEOA 3R5BA 2JVOA 4OI3A 3KLEA 1VMBA 3O44A 4JI0K 4CJSA 5HVHA 4QWBA 2R3VA 2HBKA 1O8BA 3N4WA 1IWAA 2E88A 3W61A 4USKA 4OGCA 3PV8A 2QL7B 1HYVA 3Q83A 2IJNA 2ITGA 4CJRA 3RWUA 3BGRB 3ZSXA 2WSCC 4DG1A 3AVGA 1J5EF 4NI2A 3G2XA 3KZBA 3TZZA 5JVHL 4EUVA 3W65A 4OZNA 4ED1A 5CD4H 1RYRA 2G2YA 2WFBA 3JTOA 1KQGB 3PR4A 3AD8C 3UD4P 2FBTA 3K5OA 4LRBA 4ES1A 4DQ8A 5FDLA 1I5OB 4DS5A 4I67A 3D2EB 2CJBA 3MMCB 2ZUGA 3V6KA 4CK2A 1CG2A 5E41A 2N4CA 4CJKA 4BCAA 2P9EA 2Z57B 1VGYA 2CZVC 4L75A 3DXMA 3RB0A 1T44A 1Q7YO 2BTFA 4B3SF 4LFAK 2ZUAA 4CH1A 1SC4B 2E1MC 5J2PA 1JCFA 3OYHA 4YOVA 2HLUA 2IC3A 1IQTA 2LEPA 2NXCA 1TZ0A 3LZJA 3OTOK 4TLQA 2R7VA 4MK8A 5E26A 1UVIA 4DV4K 1ZS6A 2DGQA 1N33F 1D9FA 1HLUA 3HZGA 4XAKA 4FF2A 3VENA 2XY8A 1N56A 4JKHA 2F4VJ 2ZFHA 5EDWA 4ECRA 2IAJA 1D3WA 3AAQA 1RT3A 4FVMA 1J27A 5J2MB 3GP9A 2FHOB 3MMBB 5MLCQ 1GXTA 4OLPA 3AJ2A 3BUZB 3UD5A 1K47A 4FM0A 1RSCA 3QGIA 3QWPA 4LF5F 2D74B 2WHOA 2CPYA 2QYGA 4X4NA 1P9YA 3F44A 1HQUB 4YORA 1X9MA 4C48A 5F8NA 1S99A 3CDWA 4CNZA 2L9DA 3DLLQ 3FJ2A 2VODA 1VQMN 1NNDA 4FK2A 2QKKA 2OI2A 3BSCA 3KLIA 5DDRC 3MEDB 2B9YA 2UUAJ 4P74A 1JLBA 4CHQA 3PG9A 3AD9C 1HJOA 2X3GA 4DUZJ 3LDSA 2XNQA 2E29A 2HF4A 4J9OA 1R8HA 1BQXA 4DQRA 3RBXA 2IDOA 3LP1B 3QEXA 1HW8A 3VGUA 4WFXA 1TUVA 1HKCA 4NZ0A 1C4AA 2BE9B 3TOQA 3L7PA 2XI3A 3P39A 4ELUA 1G2EA 2HVZA 4PHTX 4X64J 3OYJA 4WYWA 3KK3A 1HNWF 2KRBA 5L1LA 4ZMMA 2E2QA 1S9FA 1J2VA 2L3MA 1QVGM 5D15A 4QWCA 4CJEA 1WUAA 1S1UA 4WE1A 3ZX0A 2CPFA 4QBUA 4OI0A 3DLEB 2YHBA 4HH0A 5HRPA 3A8EA 5KFFA 3A12A 3W5XA 5K8PA 1TL7A 1KQFB 2HVHA 1QY7A 2A41A 3KK1B 3EZWA 3EDQB 5KFGA 5M1KA 3H1VX 4M7YA 4NL5A 2EC2A 3MURP 4PG8A 3IM9A 1RTZA 4BR4A 1RAGB 1FKOB 4BR5A 3MXIA 3H46O 5CZ2A 1RT6A 3E9PA 4PYAA 3MPWA 3GQCA 2LQBA 4K8RA 3I5BA 4HI1A 1TYQB 1IBCB 2HBQB 4RNMA 3V9XA 2K3IA 3M32B 3P8BB 4DR7F 2WTFA 1X4BA 1V4TA 1VQ7N 4QWEA 4X62F 2BZ2A 4DL4A 2QC3A 2ZM6F 1NGCA 1ZAVA 4DCPB 3BN7A 4USVA 2ASYA 4KY3A 4M8LA 2KTQA 4HTJA 2M7SA 4B3SJ 4JI5F 4CYUB 2QA4S 2MDAA 3NLCA 4IEEA 1S77D 3TA1A 1Z6RA 1H7WA 1Q7YT 4RJVA 3C7NA 4OJGA 1TKTB 1RT5A 3CSKA 1HARA 1G99A 2QTDA 2Y1IA 1H0HB 1N33J 1RTJB 3ILLA 1RT7A 2PAVA 3LGNA 2B56A 4PWWA 2W2PP 1HBNA 5F1XA 3OSPA 2CUYA 2XHBA 3GG1A 4PWDA 2O1PA 2W24A 3OHBA 2CNLB 2GEMA 4NWBA 2FVSA 3CDAA 4JOUA 2DXDA 1RWOB 1WKLA 4BRQA 5U47A 1VOMA 1U6BA 1MWMA 3HX9A 1U48A 2CNKB 4W5TA 3UR0A 1FTRA 1S57A 3M2VA 2FHKA 4FLZA 4IJAA 1KVKA 5L46A 2K8GA 3O9RA 4ENOA 5A2QO 3FSYA 3PM9A 1U02A 1RB0A 2ZBPA 4LFBK 4RBVA 1WUUA 4ZTJA 2F96A 3D3BJ 3VWSA 3BREA 2KQ2A 4XPEA 1S9EA 4JI6F 3I55S 2WVFA 5HP1B 3PCOB 2VKZG 4EO6A 1KQSR 3OR1A 4RNNA 1M90O 1RT4A 4BRHA 5HL7Q 3MMVA 1HJRA 1HQEB 2M70A 4UQGA 5H1SV 3W9HA 3RVCA 1VK8A 4CH0S 4NYFA 4HHHA 3O9QA 3V4IB 1C0UA 1U0HA 3HPHA 3CCQS 2MZJA 2YPZA 3PW5A 3EE9A 5EX5A 2D1KA 3OJUA 4EO8A 5JVGQ 4B1ZA 2HBZB 4I6MA 2CQDA 4OL8A 1DLOB 1SJ3P 2P9IB 2Q66A 1RA6A 3VALA 1NM2A 2A6AA 2QN6B 3FBCA 1Y7PA 4K0KK 1NZAA 3CDEA 5IV3A 4CEAA 3T1HK 3AO3A 1NOZA 2UUCF 1VBYA 4CIEA 3ZTRA 2HNYA 2BKOA 1TMMA 3HSCA 4OYMA 5DZ7A 3FZMA 3O3GA 2NYHA 4XIUA 3DHXA 3JYTA 4I56A 2FLPA 2EFGA 5HMYA 3KNGA 1PBAA 3C2PA 2RB7A 3VMFB 2I5JB 3AJ1A 4RNFA 4O44A 4IJNA 3G8SA 1FDNA 4OJHA 2M2BA 4CF0A 1FNMA 3IWLA 3MM7B 4NYNA 1RHJB 3ILJA 4F25A 2HHVA 5ETPA 2P9PA 4YP3A 1K8KB 5IQ6A 2EG1A 1MDUB 4DV7K 4ZJOA 4RBUA 4DFMA 2ZVSA 3HP9A 3U4LA 2GIRA 4UF4A 4FPBA 4CGDA 4CERA 2B8QA 3O3LA 2HNDB 4C8ZA 5HQMA 1UWBA 3T1YK 2AX0A 4H0YB 2FQQB 2VDIA 4NLDA 4P2MA 1UAWA 5AQJA 4H03B 1N6QA 1U6FA 4KB7A 2MQPA 1G1XA 2P6SA 2AWZA 2G2ZA 3VAHA 3L2VA 4B8CA 2Q1NA 1HYZA 2DRDA 1JLAB 1CBKA 2CQHA 1Q95G 3ZZOA 2UP1A 3BGUA 4UZBA 4ECSA 3WHIA 2PFFB 4P9SA 2ZWPA 3C6UB 3OXLA 3MOZA 4A8MP 1X4CA 4MIAA 2LDIA 1FRMA 4PKGA 4DV6F 2J76E 2BW2A 4KHUA 1N5SA 1RWXB 3BR9A 5A6PA 2D3ZA 3NNCA 4K8ZA 3L6QA 2QLWA 1W2BM 4F4WA 1QSLA 1OPIA 5AZJB 2VOOA 1YJ9S 1X1PA 3UDEA 4A8QA 3VEVA 4DV5J 2GBZA 3QT5A 1QZ6A 5LMUK 3M7VA 4FWSA 3DOMB 5JMVA 2IRXA 1NM1A 1S6OA 3CJ2A 4U67Q 2ZJQL 2BUNA 1SL0A 1W25A 3UR3C 1S1WB 4NMXA 1JL1A 4A2AA 1SQKA 1U1NA 1RQ0A 1ZPVA 3E51A 4BRFA 3MGJA 4DXLA 1FKPB 1EKRA 4YMEA 1Y3JA 1RISA 4M3RA 4IUFA 4F7VA 5K8MA 4F36A 5GAHP 2VQFK 4B3TJ 2FJBB 2Q3PA 3LPEA 3LWLA 4AH9A 2DBBA 5C10A 2Q2RA 3GCXP 3ZX3A 1CLQA 3D1OA 4LJMA 2IYIA 1OO0B 4CTAB 2NPIA 5HN0A 1PAEX 4Q45A 2HF3A 4DKWA 1KLNA 2QTWA 2ZBCA 1B9FA 2GVZB 3ET6A 3NBPB 1DFDA 4E1JA 3UN3A 4X4UA 4WFZA 1KC8O 3Q8QB 3TUJC 3RSEA 3KLGA 1DBDA 1M90T 1SS6A 2JEJA 4PEOA 1V5IB 4B3RK 4FJ7A 4FF1A 2VFRA 5JXSA 4X4OA 1HLWA 1DQ8A 4AL6A 1GLFO 2A1BA 2W2MP 2AW0A 3QLHB 2G8HA 4ILLA 1KD1T 2QFJA 3IAYA 4PPZA 2E1YA 1KLMA 3AOBA 2YWHA 3RAMA 3TJ8A 1KKHA 3PIOQ 2UUCJ 1PC5A 3CM5A 1DKGD 4O23A 3ILIA 1IVZA 3TUPA 3HOSA 1WI6A 2E5GA 5D78A 2M3DA 1YI2S 1NJIT 2BBEA 2E5LF 3ULDA 4DQIA 2LYVA 1QTMA 2V4JA 2R8JA 2XMKA 3NGTA 2G0CA 3EZOA 3V81B 2DT9A 3I0SA 4DCOB 5LL6d 1I1GA 4HUFA 2OPPB 4OYBA 2R7UA 2B4PA 4KHPK 3QFPA 2QL9B 3ENQA 2O8EB 2Y1JA 3H90A 3SDEA 2AT1B 4RPFA 1YRXA 3NH0A 2GMHA 5KFRA 3TJAA 2YKAA 2IY5B 3OVNA 2IVOA 3GOIA 3L7OA 3PO4A 1ITPA 3TZWA 4DSLA 3FR0A 4DUYJ 5BN9A 4CLTA 1RWKB 3DRYA 3H25A 3H08A 3H40A 4WFAQ 5A8WA 2CJ9A 3CJCA 1FJGK 4UT4A 5IV4A 2G0IA 1RTIB 2A6MA 2W4CA 3MZIA 4OZJA 3EM1A 2LECA 2GGPB 2VF3A 2VOPA 2N3LA 3HM9A 4WQ5C 3VGTA 2P9LA 4FPRA 2VFUA 3M8QB 2BM1A 4BQLA 4B1VA 2GIFA 3WEEB 3CD7A 1PYOB 3UKRB 5I42A 1BWVA 1E6VB 1FEHA 1HA1A 1FF2A 2CPIA 2B9WA 4DTPA 3MPVA 4KO0A 4OO1J 1RTHB 3HSJA 5KFHA 1UMJA 2FY8A 2HQ3A 4ISFA 1XMQF 3EZUA 2KFYA 4DB3A 3DKDA 3I9V9 2V4QA 4BRMA 4FJGA 2P2CB 1R8CA 3W62A 5CY4A 1S5ZA 1JLQB 4X66F 2O67A 2CKWA 2ZITA 1TAUA 3MD3A 2GWKA 3JTPA 3TI0A 1H73A 5DETA 4NASA 2Q0RA 5M2PA 3VQ5A 2NLXA 4PQUB 2VUGA 4M5GA 4KGMA 1Y00A 3G82A 3JB9k 1RHMB 3K8WA 4IDKA 3AB4B 2X78A 4J2AA 1GLJO 2BDPA 4FJIA 4QR1A 3RUBL 4I2QB 4LR9A 1XQIA 2Q0UA 4JI7J 5FROA 4CBUA 4I69A 3GIKA 2V50A 3TEGA 1KAZA 4YOYA 5M1QA 3TAFA 1Z2ZA 1HPZA 4OYWA 5A0YA 2ALYB 3KLFB 3EY1A 1NJXA 4CZLA 4B9MA 4LRCA 5KG4A 1X8DA 4IYQA 1KC8T 1HBOB 2RRNA 3WNEA 1H6KX 1QQMA 4JV1A 4P7TA 3QESA 1IUJA 1ZZFA 3QEVA 4ZCLA 5HMXA 2AP1A 3AVAA 4DF4A 3PIPL 2FBVA 1ILYA 4BRDA 3DYAA 3F56A 4BR7A 5KFJA 3RAQA 2IHR1 4E0DA 3GYXB 4RX6A 4QS9A 2XLKA 2C3MA 1E4GT 4J37A 4H0XB 2P9KB 4Z4FA 4HEA9 5DZ6A 2E5LJ 3OLBA 3HM8A 4NO7A 1S1VA 1O6XA 3MR5A 4KGKA 3WC0A 2OHDA 4BRNA 2HK3A 2O01C 4WIQA 4BWJA 3UE2A 1QM9A 3GYGA 3M2RA 3QDKA 1FXRA 5CZVA 2P9CA 3J8AA 1FCAA 1V4SA 3O4NA 2O8BB 1ZTTA 2CQ0A 1VQMS 2QYCA 1Q86O 3OYNA 3TX0A 3ZZPA 1B3TA 3ZSZA 5FPEA 5EUHA 3LDPA 1U1KA 3ZT4A 5C24B 4M63C 2KW4A 2I9SA 1MROA 1LWEB 1CS4A 1REVA 2V2VA 1FJEB 5KFIA 4AHUA 1TUUA 1NK7A 5C15A 4L3KA 4DR3K 4W98A 2PD1A 3LPUA 3ZT0A 1RYSA 3EE3A 1F6TA 4C11A 2R7OA 4Q0BB 2C28A 4OHWA 5GAGP 1S48A 4BR0A 4DZDA 2E1PA 3VVUA 4BS2A 2FLOA 4KTWA 4M5DB 4DPUA 3K5MA 4K8XA 4FKXA 2VJVA 2HMPA 4EK2A 4JYAF 3VGSA 3AGRA 1SKSA 2B51A 3I4HX 4IOCQ 1Y10A 3G86A 3GV7B 1F2HA 1N36F 3RR7A 2D5RA 1XMQJ 3E9OA 3Q8YA 2E1RA 3C16B 2CXEA 3HHEA 3VF0B 2V6AA 1XNRK 4ISEA 2OPQA 1U1RA 1H98A 1MMDA 1OMSA 5LXRA 2AJ1A 4EFHA 2CZ4A 4ZVRB 4X66J 2XYHB 3CC2N 1ZH5A 2MY7A 5JICA 5B7WA 1BQNB 4K5SA 1NEEA 2YI1A 1A5VA 1WOPA 4JK7A 5AXMA 2QA2A 1ZBFA 5AQOA 1KHWA 2HIYA 5GAEI 2B4VA 1FFGB 4XH5A 2ASJA 3LO3A 3ASMA 2Z1JA 1M0SA 4P52A 2D3O1 4GVBB 2UXCK 1O0PA 3U3YA 5K8NA 4KV8B 3ATUA 3GPAA 3HI0A 3A5LC 4B9VA 5IXUA 3T69A 3GJSB 4EMDA 1OSCA 3IMXA 4DU7A 1GK8A 3HULA 4JI2F 3CIMA 1HMVA 2ZWHA 2V2QA 2IVFB 2OO4A 3GB0A 3QFWA 5EWFA 3CJSA 4TYAA 3MDFA 2VWBA 1BWEA 2E4LA 3ZSWA 4DV1J 1VHIA 1HBUB 4LUBA 2FIUA 4K7QA 1HR0K 4A5AA 2IM0A 1IKWB 3T9ZA 1YHQS 1XNQF 4PXBA 2HVDA 2DR8A 5JJBA 2M0GB 1BU6O 5AQIA 3VHQA 1NRKA 3QIPB 2DNLA 4ED8A 1U6ZA 2J5AA 1T11A 5B0GA 4YY3F 5KG2A 4EI2A 1CJUB 3CJ5A 4QR2A 3TA0A 4YDDB 3KDNA 5D8HB 3AARA 3G71S 1NSPA 3R2CJ 2XSJB 2IIRA 4AQYJ 1QJHA 4ZIVA 5KRTA 2XY6A 4M5IA 3ZSVA 3ISND 4I68A 5LJWA 4FLXA 4YR3A 4Z4CA 3CD6S 2W2OP 1UA0A 2X1FA 1YF5L 2XNRA 1SV5A 5EU7A 1BC6A 4M3UA 1LWCB 1U1PA 2I1RA 2E8AA 2BRLA 4B9QA 2A3JA 4DSKA 4K4UA 2R42A 3CCUN 1P9QC 1PSDA 1R8PA 1RGVA 5L1KA 5ADZA 2HFOA 2IS3A 4ZP9A 4XTTA 2ZJRQ 1Z26A 4FLWA 4USMA 2YX6A 4FPAA 4KHRA 1TL1B 4CW7B 4ZHRA 4LREA 2LA4A 5DRKA 1J5EK 5HI7A 4A62A 4CECA 1PKUA 3NOGA 4KBOA 4DDFA 3AJDA 3HHLB 3ETOA 2C2MB 4DQQA 1LCUA 2B9EA 1QQNA 3BQ2A 4L3QA 2I38A 2B8PA 1AA1B 3CFOA 3DGPB 4B1UB 3GZ7A 2NRTA 1Y0HA 2XS7A 4A47A 2Q6CA 4CNYA 4HL9A 2QEXN 4U6PA 4QR0A 3BYRA 3CPWM 3PFOA 2QT7A 3HSDA 3WXJA 5KGWA 3I0RA 2PI4A 4JYAJ 5CCLA 4K2XA 3SQ2A 2BANB 1WC0A 1S49A 4GKJK 4J9PA 5J2NA 2IVPA 3KK2B 2VL1A 3PXGa 3CMAS 2QA1A 3UB5A 1VSEA 2L48A 3Q89A 3DOKA 2J0XA 1NPRA 4LMZA 4HTLA 4JLHA 2VG6B 1GH8A 3OYBA 1CULB 3ENVA 1NGFA 4H8KA 1TU0B 2PY5A 1X4DA 1DGKN 4DR6J 1F0XA 4RNOA 3L7UA 2F1FA 4HCBA 2PFDA 1VQ5N 1YIJS 3SSSA 3GMGA 1NZ8A 2BXJA 3ULEA 2IVNA 4TU9A 4CE9A 3S6EA 4BHQA 1JK9B 3O4QA 1YLXA 4WQ5A 3AY0A 3NF8A 2J6UA 3NRBA 3NS6A 3FZHA 4AM6A 4WFNQ 2HMIA 4OGEA 4F4ZA 4DL7A 4XDCA 5ETRA 2ABYA 1YZ6A 3AA3A 1HYSB 3SZ2A 2QWLA 1FJCA 1FRJA 2X7IA 4LF5K 2ZC4A 4ECWA 5F9LA 3TAPA 2YWWA 3B6OA 5F0WA 3X3UA 1AUDA 4GO5X 1VQKN 1Q82T 1RAJA 3ID8A 1FWLA 3IR7B 1L5UA 1RDUA 3M05A 4G3IA 1U1OA 3IS9B 2UU9K 4ZP6A 4WP3A 1G4CA 1CJVA 5E3PA 3GE9A 4JV0A 2UUWA 1Q5YA 3THVA 3N79A 2HHHF 2J7KA 4C8KA 3KHLA 3AVJA 1GLAG 3NS5A 3WNFA 4RO0A 4YY3J 4LF6F 2DGUA 2YHXA 3KIOA 4I0WA 4RWXA 4JI8F 3CCLS 1Y11A 2WVEA 1CZAN 3MCPA 2G1HA 2QGFB 3D66A 2OPSB 5KFEA 3J7A1 3ITHA 1P1LA 1N32F 1HNWK 1GMWA 5C42A 4CHYA 3QFUA 1YJUA 3MWBA 3Q24A 4C8LA 3UCUP 1NJZA 4RW9A 2CQ4A 2YCHA 3T5JA 3BPDA 1NSAA 4JS4A 3UO0A 4WKRA 2DY9A 1OH8A 2OCEA 4UQTA 4MQ3A 1YBAA 2MKIA 1U7LA 4LH5A 4RZRA 2YXLA 1F9HA 2DR6A 4K50A 2GJ2A 3GSDA 1RBUA 1U1LA 2HWHA 3HVTB 4A8FA 5HBMA 2O8CB 4B02A 1IBMF 2CDRB 3DRPA 3LP0B 5HJYA 1VIOA 1CC8A 3ETMA 1TFWA 3OS0A 3CT9A 4LF8K 4KH0B 1YJ7A 4F50A 2YH1A 2ASPA 2QRRA 3BEGB 1FO1A 2YWGA 2KVIA 2JWLA 4WQ4C 1RU1A 3D6FB 1MU2B 2KKHA 4UY85 2HPUA 1RDAA 4KFBB 2EKYA 4PZVA 5KFSA 4DUTA 2UUBK 3NGYA 5IQQA 1DEJA 1D0EA 4DR7K 1MLAA 4M5MA 2OTLS 2QXLA 4X62K 4DTNA 2ZM6K 1WF2A 5F3ZA 2KH9A 1JCGA 4KTZA 1D9AA 4CLFA 4XO0A 4BREA 1QSSA 4DTUA 3OTCA 1RAIB 5LJ5Y 4JI5K 4HVZA 4DG1B 2MY8A 4NI2B 5F8LA 1QHAA 3KHHA 2L9WA 2YBVA 1VK0A 2AU0A 3DLKA 3K58A 2RJZA 3QMLA 1VQ6S 1RBOB 2J8SA 1FD8A 5DLFA 4FW2A 1KTQA 1SXLA 3PX6A 5KRSA 3OTOF 2VFTA 2OYQA 4NA1A 4DV4F 3KTQA 2Y1LB 3AD7C 1NNEA 5AQSA 3R5AA 1S6UA 3M3ZA 1I3AA 3HF5A 4LF7K 3DLLL 1NK0A 2YV0X 4FYDA 3QYYA 2RIJA 3PKMA 5BYSA 4H0OA 1BISA 2LDYA 2MLXA 5HO4A 2OD4A 3PX0A 2P9UB 1Q81O 2EK1A 3UE5A 1ATRA 1NUEA 1B9DA 5J2PB 2LMIA 2IC3B 3CJBA 2VONA 4DFJA 2NUBA 4BRLA 2B7BB 2O66A 2YTCA 3K57A 4NB4A 4Y2AA 2LU2A 2GA7A 3PHEA 2WAQD 1M5PC 4IBNA 4NXMK 3E8OA 2KXNB 1T95A 3KG4A 3AGKA 2OMLA 1GLBG 4JI6K 5B09A 3QT8A 1S9GA 2FD2A 3MCMA 1VBZA 1H3DA 2IAJB 3THPA 1KWMA 5DDQC 2D0BA 2HHHJ 3HFZB 5AQMA 2WCXA 4BRAA 3W2WA 5LSLA 3MDQA 2KHCA 2WSFC 1S3XA 3H8YA 4F04B 1WG5A 4E7KA 3U8XA 3KK7A 4ICLA 4CFCA 4ZA1A 1HNVA 4FJMA 3KJNB 3OYGA 4KGXB 3U6FA 2Y9HA 2DFEA 4GV6A 3MM5A 3DM2A 5DGBA 1N32J 4CF1A 3BO3A 1K1QA 5KFLA 1NH7A 2HS3A 3D67A 3DRSB 3LAMA 2JJ4D 5EHHA 1VSHA 3KLIB 1VRUA 4KSEB 1YJNN 1R3NA 4CGHA 3NS7B 4JI0J 3UNYA 2L41A 1VQ4N 5B0FA 4PPDA 4HYKA 3A5MC 2RF2B 5D6GA 3TU5A 5CR4A 3CXCR 1PAUB 2GQQA 2QSFA 2ACYA 3KK3B 2R7RA 3P96A 4FKYA 5IT9Y 9RUBA 3F9MA 4WFBQ 2Y0SD 4F3QA 2EWSA 2DPIA 4Y00A 1D09B 4AXIA 1KHVA 4ZLPA 2QV6A 1XHZA 1TV6A 1ATSA 1VQLN 3ISZA 3L3UA 3HI9A 1HQ2A 4JAXA 1HWJA 3UIQA 4A8WA 1TUYA 4ZVFA 3KJFB 5FIIA 3CI5A 4YDXA 3PYDA 2YHYA 1U2FA 2ILZA 5D0GA 1AROP 2VPYB 3N28A 1TL7B 4CO2A 3P31A 4DN9A 3C65A 1VSDA 4LBPA 3WIUA 3OR2A 3M8RA 4EZ9A 4B1XB 4LFAJ 1R0BG 2XULA 5IOLA 1RT6B 3Q22A 1S1TA 2XMTA 4ZOSA 4FW1A 1C1BB 4DV6K 4H5WA 3NAEA 1FDAA 3OTOJ 3Q8PB 3L4IA 1QTNB 1NGGA 4HKQA 2JLFA 3WXLA 2H3EB 4DV4J 3R5JB 3EWGA 4AHRA 3K0JA 2F8HA 4RU2A 5CXTA 2PDAA 5CH7B 1XC3A 2IRYA 1LFPA 5CABA 4OZ2A 4FSVA 4B9LA 4DV3F 1M5VC 2YX4A 3GV8B 2M88A 3QZ7A 3ZXWA 1LWFB 1ZM3A 3NVMA 4HUEA 4AF1A 1Q81T 5HL7L 3VGLA 1S1XB 1RT5B 3EGZA 3LUYA 2NPFA 5F8HA 4A59A 4P2XA 1LK5A 2M8DB 2JNJA 5C2CA 1RT7B 2WB1D 1RA7A 2JDJA 1HBNB 1HNIA 3SV3A 4K4YA 3P49B 4I1TA 1JKHB 2E5HA 2E9RX 5HJXA 4LFBF 4GVEA 1FI4A 3W3DA 2YNIA 1UFWA 5JVGL 4EYIB 1RJJA 2NSBA 3A3NB 4IOBA 3F9KA 1KSPA 3UVJB 3SJHA 3OUYB 3B78A 4P7VA 1OQ3A 2HHSA 1Q4RA 4U7BA 3L3CA 5CHCB 2QL5B 1ZBLA 3FBEA 2JOQA 5C25A 2DY4A 1JNRB 2CPZA 1WJ9A 3AVBA 5IWAK 3JAMO 2GO9A 2YNHA 5J2QA 2J8AA 3C15B 5AZIA 5IM0B 2AJ0A 1Q78A 2A1RA 3CD5A 2LU1A 2X51A 3N6LA 3LM2A 3SCLE 2I6WA 2GAGC 4W4MA 4DS4A 1RGIA 4M3YA 4BC4A 3RBDA 3R5GA 2O8FA 1EARA 2K1RB 5M1FA 1TUWA 4CFAA 3OR1B 2ASOA 2MQ8A 1RT4B 1LW0B 3SQ4A 2W4PA 4CM0A 4L76A 4FWRA 3T1HF 4CT8A 3V9UA 4IFVA 3R1XA 2QLJB 1G15A 4MIWA 3WNGA 3QATA 3SBGA 1T02A 1U0HB 2PBDA 3LALA 4OIXA 2UXBF 3LDLA 3L2UA 2DRBA 4ZJQA 3TA2A 5K14A 3LTOA 4G6VB 5GAHI 2MPUA 1RUSA 3BO2A 3ZZRA 2FHMA 2DTJA 3QETA 3DGVA 4LR7A 1XMBA 3H7HB 4JKFA 2E1ZA 3CO0P 4NCGA 4MDAA 1S10A 3D6TB 2DPJA 2VICA 1OY8A 1U8WA 2YWKA 4YOXA 1S6QA 3D0IE 1SJRA 3HVWA 2MSTA 3NG8A 1QZ5A 2HNYB 1YAGA 3PKYA 4PL7A 4DV7F 2BM0A 3DRXA 4B3OA 1RT1A 3IBCB 4E7LA 3TVZA 1V3ZA 4FS1A 5FLXY 3CC4N 2DNNA 3JYTB 1X31C 3GG0A 5B0DA 4W90B 1AW0A 4IR1A 1T05A 3T1YF 1FKAF 1RAEB 4F4KA 2F7VA 4BGBA 1D8ZA 1BWFO 2R8HA 3CJ8A 3BSNA 2DTUA 1H1VA 5H9EK 1OYDA 3H3OB 4FZVA 4YN3B 5ETMA 4F4AA 2Z2YB 5KFPA 2P5VA 4DR5F 4AUKA 3FQLA 1VQ8S 4DLGA 2VBWA 2DNRA 1BA0A 1WSGA 2XRIA 2AV5A 4DPWA 3ZETA 1EP4A 1NGHA 4M3XA 2OEMA 2QG9B 3EN9A 3VQ9A 3TSQA 3G4SN 2F5GA 3G6ES 4WQ4A 2CVEA 3MOJB 4HCCA 3C6TB 1N5YA 2Q31A 2L9NA 4FF4A 1NMDA 4R0JA 3C46A 2RUGA 1UWBB 5HQ8A 4CD1A 3NGZA 3VN5A 2GTDA 4MAKA 3TP2A 1RP5A 3AQOA 5EWGA 4Y2KA 3VF4A 5GADU 2MKKA 3QNWB 4DBQA 4Y28C 2W2QP 3SCXA 4ED6A 3DHWC 4K4XA 2PYJA 3SSRA 2GV9A 1WOOA 5LMUF 2K06A 4CEBA 4GKKJ 3QBWA 1JXBA 1MMNA 5LMNK 3K5NA 3MAHA 2XY5A 3QGHA 4KAZA 3KLHA 3I31A 2HBYB 3MWTA 5T41A 1RBVA 2PA3A 2DKOB 1EJ7L 3G25A 4LFBJ 3EVWA 4M5HA 2ZZTA 4P75A 1QAYA 4JV5K 3OD2A 3W9JA 3R6LB 1X3NA 1OQ6A 3IWXA 3K9KA 3SQGA 4CJUA 3UWTA 4OJRA 1OIAA 1X0PA 1Y97A 2B4OA 1OH5A 1RBRA 2C1EB 3NGDA 2FJVA 1C0MA 4I4BA 2KYXA 3TANA 4ANEA 3NDKA 2KJVA 1FRHA 1JXEA 3PIOL 3VQTA 4RW8A 1SJ1A 3HJFA 4GC6A 2DR5A 2BUPA 2W25A 4GMKA 3E2EA 4PUOA 4DF8A 3SQ0A 4B3RF 3HL8A 4FWNA 3OW2M 1ZBSA 2AQ4A 4N56A 2PI5A 3RBZA 4JEPA 2NXEA 3FFIB 2AYGA 2YKNA 3ZTQA 1PCAA 2CG8A 1S72N 1VQON 2GUPA 4K0KJ 2LKZA 2NXJA 1N4LA 3T1HJ 1WOSA 2OPRA 3G10A 2MQMA 1GMUA 1S5JA 1CZBA 3RGIA 3RSEB 3CJ0A 3NVKA 3KLGB 2H48B 3DLGA 3D4JA 2H9ZA 3CMEN 1F5AA 2DHAA 2LXIA 4URGA 2A2DA 3OYFA 4EGLA 4JKGB 4L74A 3J80Y 2BABA 4U8YA 3D7SB 2KB2A 4X4SA 1NMNA 3IG1A 1BO5O 4O4GB 3I6PA 4O0JA 1VQKS 2G8KA 3BBCA 1N48A 3MMAB 3VQSA 1Q53A 3QO9B 2ZDPA 3J7AN 4QIVA 4KC5A 4LH4A 4WFAL 4FCYA 4QU7A 3J7ZO 1X60A 4KHPF 4DV7J 1FX2A 1EETB 3CCSN 4ZPTR 4H4KA 4CJLA 1VIXA 4B08A 2XI2A 2W6LA 4BR2A 3CC7N 2IBKA 2CQ3A 3IKMA 3T1YJ 1GXLA 2VWJA 4NA3A 3MMJA 1D1UA 1S97A 1DQAA 3N0VA 4M5NA 5ETNA 3FVYA 5E84A 2V4JB 4OPAA 2P9NA 2G1DA 2E2NA 3BGRA 3AV9A 2D4WA 4BDPA 3I0SB 3VCDA 2HHQA 2IRUA 2XZDB 1FJGF 2CH6A 1R6YA 4ECVA 2KG1A 3LL3A 5EWEA 1JNZB 2JFDA 1U49A 4A8OA 3VQ7A 4USIA 3SIPB 5KFQA 2GIQA 4M3ZA 2L08A 2YVSA 5F0UA 1JJHA 1N36K 4YUDA 2D9OA 2CGLA 3R27A 1JJ4A 4N8OA 3D2EA 3KKRA 4J91A 4K41A 1RFQA 5AQGA 3F73A 3HLUA 1EKEA 5KQ8A 2FGOA 1RAHB 3MM6A 2MKCA 5A8WB 4R8UA 1WDTA 4C7QA 5SUHA 5LMUJ 2QWQA 1DT9A 3HPGA 2AEJA 2A1SA 3P4UB 3B6BA 3O9SA 3OYIA 1DQ9A 4UUWA 3F41A 5KFNA 1NKEA 3DXKA 2ASDA 2V67A 4OYPA 1B99A 3C3LA 3B4DA 4JI1F 2KG0A 5BRFA 2VQFJ 3TWZA 3CJ1A 1V3SA 4KO0B 2RU9A 1QVFM 4OLOA 5JLFA 1BIZA 3UDLA 3CMQA 4CLUA 3OBIA 1N34K 3AA5X 1PJ6A 1UFLA 2DR9A 4LIWA 1SCJB 2HRTA 3D9BA 3HHNB 4JI2K 2DGSA 3VZIA 2FBYA 5G4DA 3V9SA 3HCXA 5GAGI 5J2MA 1NHVA 4KRWA 3VETA 4W5RA 3ZCMA 3R2DJ 4ECXA 2W7PA 1HPMA 3S7RA 4UY8O 1N52B 3FCVA 4E7IA 4B3RJ 2NNWA 5AQVA 3EZ5A 2Z56B 1FK9B 1RTDB 1BUXA 1S7IA 5DQGA 4C0BA 3KWIA 4GV3A 5AQZA 1WHWA 4OI2A 4IDKB 3RYLA 2CPHA 3THWB 3IRWP 5A2QU 4B1WB 1JCEA 4USUA 1TAQA 3R5DA 3MEDA 1PO6A 2YKQA 4H5TA 2KM8C 4TSXA 2NCKL 1HPZB 4FYYB 1UJ4A 5A0YB 3BN4A 2ZQBA 3ZTPA 1CEZA 1MN7A 3O08A 4KT0C 3H5SA 1ASUA 2PSZA 3LP1A 5D4OA 3M4XA 2GO8A 4CESA 4RCHA 1RCXB 1ZBHA 2D9PA 3L4QA 5DM7L 2DD8S 2HZAA 3ZFVA 2G8VA 3I82A 4J9UE 1RXOB 2HAFA 4KYZA 3CB4A 3O9TA 3KUEA 3PNIA 3BV8A 4KHNA 1TMJA 1RWUA 4OYOA 4KHPJ 1F9EB 3HD2A 2ZH9A 2W6KA 3DYAB 3SUNA 1NGBA 2CPEA 2W4DA 4JD2B 1JJCB 1EHWA 3KUGA 4FO0A 1W7WA 4A61A 2XHCA 2JEFA 2XMMA 4Q2LA 4A5BA 2IFXA 3J7ZT 4O8KA 4ILJA 1GQEA 3TQ1A 3VOVA 2DHHA 3