1S1XA

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
553
structure length
545
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 137
structure length 545
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1xA05
2XO7A 1ITGA 5EU7A 4E1NA 3C95A 4B8AB 3CFPA 4CFAA 1N56A 3SPZA 2RF2A 1RT7B 2V0NA 3OYEA 4CEQA 1WNEA 1RTIA 1N6QA 1FKOA 4CGGA 3ITHB 2PY5A 4KO0A 3HP9A 2ZQBA 2KZZA 2A1SA 5HRRA 4RW8B 1J54A 3H5UA 1NK8A 1D8YA 4IRKA 1C0TB 1LW0A 4CEAA 4K8ZA 2IBKA 4J9LA 3D5MA 2XGPA 3H4DA 4J9SA 3VN5A 5FRMA 3LANA 1RDDA 1RT5A 5DGAA 4G3IA 4Q0BA 2YNFA 1KFSA 2HHXA 1LWCA 1QE1B 4ECUA 3VQEA 3TAFA 3NGYA 4TQRA 3DLBA 5KG1A 3KLIB 1R0AB 3K5MA 4FM1A 4YNQA 3V9SA 4TY8A 4J9MA 4I7FB 4JRQA 3GIKA 4WYWA 3OJUA 3PY8A 3CJ4A 1LAVA 4GMJB 1C1BA 4DL4A 1RTJB 4CJWA 5DQHA 3TAGA 3FQLA 5JUMA 5KFRA 2WOMB 2E9TA 1LWFB 4HUEA 1TKZA 4RW7A 1WNSA 2JEIA 3KK1A 1D1UA 5KFLA 2ETJA 3GIJA 3OHAA 3V9ZA 3M8PA 4TQSA 3ISND 4FJLA 5KT3A 1NHUA 1QTMA 4CHYA 5J2QB 3GV7B 4NYNA 1HQEA 4MK9A 4O4GB 3S3OA 3KD1E 4RW8A 2UUTA 4NCBA 1VSKA 3RWUA 3RB0A 3GILA 1SH3A 1QHTA 1T94A 1KHWA 4PA1A 4WE1B 4F4YA 4KKOB 4CHPA 2XI2A 4J9KA 4EO8A 4NLXA 4ECQA 4CESA 3HKWA 3MFHA 3VQAA 2VG7B 1S1UB 1BI4A 4KHNA 2WRMA 4M3UA 2G8VA 1NHVA 4OGCA 3PV8A 5KFTA 4OKKA 1VSMA 4DMNA 3N6NA 4I7FA 3C6TA 2Y1JA 1K6YA 3I5AA 4NLUA 4YP3A 4M3XA 4DF4A 4B9MA 2OZSA 1BQMB 4B9NA 3AO4A 1RTHA 1X1PA 4CF9A 1SKWA 2WOMA 1LWFA 1RDAA 4O5BA 1IM4A 1HJRA 3TVKA 5KG0A 4ICLB 4DTSA 1TL3B 5KFWA 1S9EA 3H40A 2KW4A 3O4QA 1RDBA 1ASWA 1FK9B 5DMRA 3RAXA 5KFNA 4FBUA 3I8DA 4FLTA 1JLEB 1QAJA 2BRLA 3O4NA 3L2QA 1VRTB 4O3OA 4ZPCA 4DL6A 2AGQA 4ZPDA 4BACA 4CIFA 4LQ9A 1S1VA 3OHBA 3CJ0A 4EBCA 2IOCA 4DSIA 2G8HA 3OJSA 3BREA 1C0UA 4CHOA 4MIBA 5SZTA 5F8LA 1JLCB 4CHNA 4H4OB 3V6KA 3HVRA 3LZJA 2VG7A 5D3GB 3IAYA 2ASJA 2AX0A 4DTOA 3LPUA 2AJQA 4LSLB 3OLBA 4F8RA 2QKKA 3HPOA 4ECYA 4PQUB 3VQBA 3HVTB 1J5OA 3SCXA 2OH2A 2G8IA 3DLRA 4QOZB 1NK4A 3SQ0A 2IAJB 2C2RA 3OS2A 1CXQA 4DTRA 1HYSA 3V4IB 3BR9A 3C6UB 5HBMB 4NLOA 4KAZA 3S3MA 2IM1A 1S49A 1CZ9A 1T05B 1QSYA 4MQ3A 1RCHA 4G1QA 3MTKA 3M9NB 4O3RA 3S9HA 3SI8A 3B6OA 1N4LA 3DDKA 3IS9B 4IH5A 4NLPA 5CYMB 3GIIA 4WFYA 2YHBA 2FLNA 5KT6A 5F8IA 4PUOA 4B3OA 4N5SA 3SV3A 1HMVB 3CFRA 2HMIA 1WLJA 3VQCA 4ECVA 1SH2A 1IKXB 1S1XB 3L2UA 1JLCA 3GQCA 4CEFA 4FZYA 4F4XA 5HROA 4IR9A 5HP1A 4MK8A 4BE1A 1X9MA 2BRKA 3G6VA 4FJIA 4ECZA 3HPGA 5HRPA 2OZMA 3MEDA 2AX1A 3H5SA 3FDSA 3HHKA 3BDPA 3V4IA 3G10A 4KTQA 2R7YA 2JEJA 5HBMA 4LH5A 4E7IA 1C1AA 3OYLA 4B9UA 2R8HA 2ASDA 3M9MB 2BDPA 4RW6B 3QINA 1KLNA 3KHRA 4XO0A 3IS9A 2GBZA 4Y2AA 3LWMA 5CYMA 3OVNA 3AA3A 3DOKA 1BL3A 4NYZA 1N48A 3NAHA 1XR5A 3KLGA 3KHLA 1EKEA 4W5NA 1NKBA 2X74A 3AVLA 3GV8B 2ZD1A 2IS3A 2VG5B 4RW4B 4DS5A 1JLQB 1IKXA 1ZBFA 3NMAA 3TARA 5KTQA 1S1XA 1UOCA 1S9FA 4W5OA 2OYQA 2HWHA 1IO2A 1CZBA 3DLGB 4DSKA 2G8WA 2KZMA 5JS2A 1K1QA 4M3ZA 1CSJA 1MU2A 3VQ7A 1W25A 4RNFA 4WZMA 4BWMA 2GC8A 1JLBA 1FKPB 3SUPA 3RR7A 3QESA 4NLGA 4WZQA 4BE2A 4EYIB 1U49A 3M9OB 2BQUA 3DM2A 5KFKA 1W0HA 2DFEA 3K57A 4O55A 2OA8A 1HNVA 3DRPA 3IG1B 5L1IA 2FJWA 2JEGA 1JXEA 4RW6A 3O3GA 2XRIA 1JLAB 4ECWA 4Z4EA 3KK2B 2DFFA 3CFOA 3HO1A 3OYFA 1TKTA 3LP1A 4O44A 2AGOA 2YNHB 4R8UB 3DRRB 4Q45A 3NH1A 1VSIA 1RAJA 1U47A 4FJ9A 3ZSXA 1NK9A 4HUGA 2XI3A 5KT5A 1D9FA 3DLEB 1ASVA 3ZSRA 4BDPA 3IRXB 2HWIA 4L8RB 4IH6A 2IJFA 2DTUA 4O3NA 3VQQA 1D9DA 4ZP9A 4C8LA 3SUQA 2FBVA 3TAQA 3OYMA 3KLHB 1FKPA 4IG3A 4IQXA 4KRFA 3LPTA 2JEFA 4QWCA 3LAKA 3QIOA 4JV0A 1RBUA 3KKRA 1ASUA 1YT3A 3EYZA 3KJVB 4FLUA 3QIPA 4F2SA 2D41A 4EP5A 3OYNA 3IG1A 3QEIA 3NH2A 1UAXA 3AVNA 4CGDA 3KD5E 2VWKA 2P5GA 3DLKB 3RAQA 5T14A 3KK3B 3AVAA 5DK5A 1XHZA 3RR8A 3LP2B 2R2TA 2EX3A 3HP6A 4Y2CA 3AVHA 1ZBIA 3KHHA 3DMJA 2PYJA 4R8UA 3DRRA 4ZTFA 1SV5B 3QO9B 3O3FA 4ELTA 4EP4A 4LY7A 4CECA 4AHTA 2IA6A 4KV8A 4O4RA 2RF2B 4B8CA 3NF7A 4O3PA 1RTIB 4Y3CA 3TABA 1VSHA 1IKVA 4CGIA 1N6QB 3NFAA 1FKOB 3EZ5A 3S3NA 5SWMA 4KO0B 5KI6A 1KTQA 2R8GA 4NRTA 3D0PA 5DQGA 3HJFA 3U3GA 3M8QA 4CE9A 3TI0A 1LW0B 1J9AA 4N47A 1KSPA 3ZT0A 3TAMB 3T3FA 2I5JB 5C25A 3KLHA 3QGGA 4B08A 4FK0A 3CVKA 1A5XA 3HT3A 4KE5A 1VSFA 1S9GA 1RT3B 3V9WA 4NCGA 1RT5B 5J2PA 1D0EA 2G8FA 4HHTA 5JXSA 4Q0BB 4CEBA 4Z4HA 1LWCB 4KHWA 5I42A 3MR5A 3NGIA 2ATQA 3I0SB 1HQUA 3QLHA 4TY8B 4W5RA 3KK3A 3N6LA 3BQ1A 3JSMB 2NUBA 4Q44A 3SNNA 4E19A 2IC3A 2C22A 4FJ5A 3HYFA 1WSHA 3TAEA 4DSJA 3KIOA 3KOAA 3QZ8A 2D0CA 4EZ9A 2D0AA 3QO9A 1S6QA 4WFXA 2D0BA 1TKZB 4RW7B 3KK1B 5KFEA 2RN2A 1UA1A 1U48A 5J2MA 3M8PB 4E7LA 5I3UA 2WK4A 1VSJA 4IBNA 3MEGA 1HQEB 3OS0A 2WCXA 3SV4A 1TK0A 4CCHA 2W9AA 5DLGA 2IM0A 3C94A 2BGGA 3PUFA 1ZBLA 3TAMA 2I5JA 3SJJA 2DFHA 3DYAA 1VRUA 3KHGA 2P5OA 2E9ZA 4URQU 1RT3A 4QCLA 4RNMA 4M94A 3K58A 4HCBA 4FJ7A 3RB6A 4YFUA 3SUNA 1HARA 3MR2A 3WNEA 1BI4B 2A1RA 3CM6A 3NGDA 1BIZA 2B5JB 4DLGA 4FW1A 3I0SA 4PY5A 4IKFA 3C6TB 3JSMA 3LZIA 3SPYA 3VQ4A 4I2PA 2D5RA 4OPJA 1XWLA 1GX5A 1S1WA 1U04A 1B9FA 3RTVA 5KFYA 5DG9A 4CIEA 3M8RA 2B43A 1RTHB 4FJ8A 4KHQA 1U09A 1KVBA 1KHVA 4E7KA 3H08A 3UIQA 5HLFA 1CXUA 3MR3A 1S9EB 1HPZB 3FSIA 1Z26A 3OYKA 5KFGA 5FDLB 3EZUA 4ED7A 3OL8A 2Z1JA 4DQRA 1C0MA 2AU0A 4YQWA 3NF8A 4KHMA 1TQLA 4I2QA 4OVLA 1T03A 4Q8EA 1S1VB 1N5YA 2WTFA 4IG0B 3NHGA 1C0UB 4R5PA 1JXLA 1TK5A 3EY1A 1Q9XA 4K4SA 5KFBA 3DLHA 5C42B 4URSA 2RPIA 1I39A 2J6SA 4R0EA 4AILC 2B5JA 3H4BA 2YNGA 1JXBA 1LV5A 4ID5B 3KNAA 4K4VA 1IH7A 4DQQA 4WFZA 4DFPA 4MK7A 3BSCA 1J5OB 5KGWA 3JYTA 3ICLA 4NCAA 3BGRB 2ZE2A 2W9BA 4XIUA 2I1RA 4DF8A 1HYSB 4QWAA 1RDCA 2D3UA 2CJQA 3NBPA 4H4MA 3L3VA 3EPGA 2YKMA 3NGZA 4CF0A 4E7HA 3SQ2A 3QEXA 1HPZA 1WSIA 3PVXA 4G1QB 4RNHA 1C2PA 4ZHRB 5FDLA 4DTJA 4KSEB 3HVWA 1NK6A 4OLBA 3PO4A 3MECB 3OYHA 3TANA 4CJUA 4CJVA 4IH7A 1RYSA 1O1WA 3DRSA 4M95A 5KFCA 5DQIA 4PUOB 3OL7A 4O0IA 4B3OB 4K4TA 3VQDA 4JRPA 3SFUA 1S97A 2HMIB 3SZ2A 4IG0A 1FXXA 4M3YA 4CJ4A 3PR5B 5L9XA 5C42A 2CKWA 3NAIA 1EP4A 5HROB 3PO5A 4KTZA 1NNDA 5HP1B 1Q9YA 4ID5A 5KFFA 2Z1HA 4N76A 4KB7A 4XPCA 4CEOA 5KRTA 3LP0A 4W5QA 2QKBA 3BGRA 3MEDB 3RBDA 2XCAA 4KHYA 4EYHB 4E0DA 5KGXA 2PZSA 4Z4CA 3MEEA 1SKSA 1ZTWA 2YHAA 4IRCA 2HNDA 3F9KA 4EZ6A 4ZHRA 3A2FA 4CJFA 2HVHA 5CZ2A 2F8SA 5EDWA 3MECA 4DEZA 1BHLA 2BANB 2GUIA 3OSPA 1JL1A 2IDOA 3DOKB 3N6MA 4ZVEA 1RT1A 3PW2A 4Z0UA 3K5NA 3L3UA 3IGVA 4DL2A 1ZETA 3KLGB 5KG3A 4XPEA 2W9CA 4JV2A 5L1KA 2EC0A 2ZD1B 1S1TB 3NCIA 3WNHA 4HKQA 4QPXA 1IG9A 4OGEA 4F4ZA 2C2EA 4GW6A 4DU1A 1RYRA 3AVFA 3QYYA 3NE6A 4HUFA 3V6HA 1MU2B 3CM5A 4K4ZA 1TVRA 4RNOA 1XR6A 3NDKA 1RBVA 1CLQA 3HXMA 1JLBB 1S6PA 4KHRA 1JL2A 3H2LA 4BDZA 3I5BA 3VQPA 3UDLA 4CJEA 3OYIA 4Z4FA 4ZP8A 2FBYA 3DM2B 2XHBA 4DWIA 3H59A 2ILZA 4AHUA 4KFBA 3TWHA 1UWBA 1HNVB 5F8GA 3QETA 3CJ3A 3DRPB 4FLZA 3QNOA 4Z4GA 2HHQA 4NLYA 1SL2A 2AWZA 4OKJA 3V1RA 5DLFA 1TK8A 1TKTB 2BANA 5KFJA 4E3SA 1YTAA 2F8TA 1ZBUA 3LP1B 4O44B 1NJZA 2YNIB 3I0RB 1RT6B 3AVBA 4CIGA 4LD0A 1NK5A 3T5HA 5F8NA 3L8BA 4CEEA 3QEWA 1S1TA 3AVMA 4Q8FA 4DSLA 2ZKUA 5KRSA 4QWDA 5DG7A 3CJ2A 4LSNA 3ZT2A 2YKNA 4IFVA 4DFMA 1KRPA 4GC7A 1BCMA 2G8KA 4OL8A 2XGQA 3TQ1A 3P83D 3HM9A 3MF5A 4NLWA 4NLRA 4Y34A 3HVAA 1K1SA 4KBIA 3GIMA 3OYDA 3EPIA 3AO1A 4IG3B 5KG2A 4CK3A 4AHSA 2HHUA 3Q8PB 1ZBHA 2F96A 1ZTTA 3VA0A 4EO6A 2ALZA 5KFUA 4DG1A 4HTUA 2B6AA 3H5YA 3MAQA 4DLEA 4C8OA 4ED2A 4X2BA 1RT4A 3V6JA 2RKIB 1VK0A 1JLFA 3E01A 3QIPB 4H54A 4FZXC 1G15A 3CIZA 3VQ5A 4ZPBA 4DL7A 1TKXB 1XR7A 3Q8RB 1OS5A 2WONA 3CG7A 4LH4A 2XY7A 5CYQA 4UQGA 5C24A 2KTQA 1BISA 4FBTA 4BWJA 4MIAA 5FRNA 3DMJB 2YNIA 1A5WA 3I0RA 4CGHA 1RT6A 5KG6A 1VSEA 5KFHA 3GV5B 4CFBA 4ED1A 4QAGA 4KV8B 3CJ5A 5KFXA 3NH0A 3ZSZA 3SFGA 4W5TA 4I9LA 2QV6A 1YVFA 1IKVB 2V4RA 2HHTA 4CJQA 4ZVGA 3G86A 1GX6A 4FS2A 3QEVA 2JC0A 4FCYA 4FJGA 1NK7A 1IKYA 3MXJA 3M8QB 4NRUA 1NKCA 1C1CA 3OYCA 3TR8A 1X9WA 3AO2A 5C25B 2OPQA 3ALYA 4AH9A 1EETB 1ZYQA 1LWEA 4O3QA 2IJNA 3OLAA 3VQ8A 1S9GB 2UVWA 4CJLA 4FLYA 4NCGB 2DY4A 3G6YA 3LDSA 5J2PB 4QW8A 3LWLA 2RKIA 4FLWA 1KVCA 5I42B 2HNYA 2ATLA 4C8NA 4WXWA 5KFQA 1TKXA 1HQUB 3QLHB 4ECXA 1JKHA 1EXQA 1B92A 3NF9A 3K2PA 2IC3B 3MXIA 1S5JA 5KFIA 1WAFA 4IDKB 4ECSA 2BQRA 4KHSA 5K14A 1S6QB 3PW0A 4J2AA 4ED0A 2E4LA 5J2MB 3HL8A 2B4JA 4JLHA 3AO3A 5I3UB 2XY5A 4IFYA 3MEGB 3UQSA 1NOYA 3DI6B 2OPPA 5F9NA 1TAUA 3ZSYA 1SL1A 3F73A 5KFZA 4CF8A 1SUQA 4ZTJA 2W8KA 2P1JA 2E6MA 3DYAB 1VRUB 2FJXA 1S10A 4CJ5A 1EETA 4IR1A 1BGXT 2EHGA 4NZ0A 4U7CA 3OY9A 3P5JA 4HCCA 4TXSA 1RBSA 1TV6B 5KG5A 3AO5A 4Y1CA 4KTWA 2R2SA 1DLOA 4C8MA 3VA3A 4RNNA 1QSLA 4JV1A 4I2PB 1S1WB 4Q43A 4IDKA 2Y1IA 3DOLA 4YR0A 1LW2A 2G8UA 4J2DA 1RT2A 1TL1A 3CDEA 3KMSA 5HLFB 3MFIA 4FJJA 4K50A 1XI1A 2HHVA 5KG4A 1SL0A 2HAIA 2PYLA 2ILYA 4FJXA 3MXMA 4J9NA 4CHZA 2AGPA 5KFSA 4CEZA 4IKAA 4FJMA 3DI6A 1L5UA 3NF6A 4ECRA 2X6SA 4TN2A 3M8SA 1WN7A 4I2QB 4ZVFA 4ZVHA 1XC9A 1T03B 1KLMB 1RTDB 4DTPA 3AVIA 4DU3A 1N5YB 3AVGA 5T7BA 4J2BA 1JLGA 2XWYA 4O3SA 1Q8IA 1QS4A 4R5PB 1HNIA 3H98A 4ZMMA 3V6DA 3CQ8A 3ZT1A 4HVJA 3V81A 1S0NA 3PW7A 1S4FA 4LQ3A 2HB5A 3U6FA 1BIUA 2W42A 4FZZA 3OS1A 3QIDA 2XY6A 3BQ0A 2YNGB 4CJTA 2OPRA 1TV6A 3OYGA 1NK0A 5KFAA 4H8KA 4DSFA 2XC9A 2IM2A 1GOBA 4E1MA 3GYNA 3V1OA 2HNZB 2VA2A 2BE2B 3RRHA 3JYTB 2FVCA 3RMBA 1Y97A 2FVPA 2W9BB 2ZE2B 5HRNA 1A5VA 2JLEA 4OLAA 1NJWA 3NBPB 4H4MB 4ECTA 2YKMB 2VG6A 1RBRA 1SH0A 4EBDA 2V9WA 4E89A 1KCFA 3O3HA 4RZRA 2FLLA 2C2DA 3PR4A 4WYLA 2HVIA 3ULDA 4FJNA 2FJVA 3RRGA 3KLVA 1T8EA 3DRSB 2V4QA 1RT7A 1RNHA 3CO9A 1KLMA 1RTDA 4DQIA 3BQ2A 3HPHA 4B9LA 3ITHA 4OJRA 4DSEA 2GIRA 4IOBA 4TLRA 3ZSOA 1UA0A 5JS1A 1C0TA 1EP4B 4CGJA 4DQSA 4K8XA 3ZT3A 4DL5A 5KFDA 4J9OA 4K4UA 4MH8A 4C8KA 3Q8SB 3OYBA 1TAQA 3VQ9A 5EWGA 1TKDA 1I6JA 1X9SA 3LP0B 2HNZA 2BE2A 2W7OA 3AVJA 3UPFA 1JX4A 4PWDB 2KFZA 3PZPA 1QE1A 3MEEB 3D28A 3OYAA 3KLIA 1R0AA 1Z4UA 4DU4A 2HNDB 4TSXA 1S48A 2P51A 4K4YA 4DTMA 3ISNC 2BR0A 2IM3A 1RTJA 4BE0A 4BDYA 4FVMA 3LAMA 2IMWP 4CFDA 4WXOA 5F8HA 5F8MA 3PX4A 4U6PA 2E6LA 4KPYA 4B9VA 1RT1B 4FM2A 3ZSWA 2W9CB 3RBEA 4CGFA 1HRHA 4YMEA 5J2QA 5KT2A 3PJXA 4DTXA 4KHUA 4O4GA 5L1LA 2JC1A 4NLQA 2WB4A 2UUWA 4AHVA 3PW4A 3IGNA 4F3OA 1U4BA 4KB1A 1JIHA 4TYBA 4WE1A 4FXDA 4KKOA 5FROA 3G6XA 4RG8A 1TVRB 1I3AA 4URGA 3PX0A 2FVQA 2VA3A 1S6PB 5CY4A 4ELUA 5F9LA 4I9QA 3RB4A 1DTQB 4PWDA 3QEPA 1S1UA 1QUVA 4QWBA 3T5JA 1T3NA 3HK2A 1GOAA 4KFBB 4HYKA 4FLVA 3UR0A 3RMAA 1UWBB 3PW5A 4CF2A 3SYZA 4M3WA 4QW9A 3L2RA 2VWJA 4YR3A 2FBTA 3AA4A 1LAWA 4ID1A 5EUHA 1S0MA 3V9UA 1VSLA 1BQMA 3KTQA 1L3TA 2FLPA 3CDWA 3G0ZA 4TY9A 4ICLA 1RBTA 1TL3A 4J9QA 1TGOA 1FK9A 2IGIA 4KREA 5EWEA 4CJ3A 1DTTB 3K59A 3OSNA 2R8JA 4CHQA 4RW9B 4FJHA 1JLEA 4LSNB 3PX6A 2YKNB 4IFVB 1VRTA 1J53A 3CYMA 4N56A 3T5LA 3QNNA 1B9DA 4KI4A 4ED6A 4Z4IA 3FFIB 2R8IA 3AVCA 1WSFA 3T1AA 4RUAA 5F8JA 3AA2A 3QERA 4H4OA 4RUCA 2R2UA 1DTQA 5D3GA 3MR6A 4IRDA 4DG1B 2B6AB 2XY8A 4ZP7A 3OYJA 4LSLA 1RT4B 1XHXA 2AQ4A 2X6NA 1JLFB 3E01B 4J9PA 2HHWA 4PQUA 3RMDA 3HVTA 5DG8A 2DPJA 2WONB 3ZSQA 3PJWA 2IAJA 3K5LA 1QAIA 4GC6A 4DTUA 3TAPA 5CYQB 2D3ZA 5C24B 3I5CA 2XCPA 3AA5X 3E51A 4Q5VA 3C6UA 2GIQA 1WAJA 1NKEA 3ZCMA 1WSJA 1BQNB 1T05A 3L2VA 4E7JA 5KFPA 1DTTA 1MMLA 4FYDA 3Q8QB 4RW9A 5J2NB 4ELVA 3V9XA 1GOCA 4DFJA 4CJPA 4J2EA 3QGHA 4NYFA 4OKEA 2J6TA 4RU9A 2ITGA 1IKWB 1QSSA 2F8EX 2DPIA 1IKYB 4B9TA 1HMVA 1C1CB 1YTUA 3V1QA 4JS4A 1QQCA 3FFIA 2OPQB 1TP7A 4OPKA 1LWEB 2D7SA 4M3RA 1HYVA 4M3TA 3IN5A 2RDJA 3WNGA 4CJSA 4CF1A 3NKYA 4MKAA 4YR2A 1WSGA 2HNYB 3SUOA 3KLFB 2X78A 2LSNA 1VSDA 2FBXA 5J1EB 2E9RX 1RDRA 4FW2A 1YVUA 1S0OA 5KFOA 1JKHB 4ED8A 1KFDA 2QE5A 2YV0X 2W7PA 3WNFA 4M45A 4K4WA 3CWJA 4NLTA 3AV9A 4ZP6A 5KT4A 5K14B 3NAEA 1BQNA 5KFMA 2BQ3A 3KLEB 3RMCA 4KB0A 1HYZA 3SI6A 3QZ7A 3THVA 3T5KA 4DL3A 4B9SA 2C28A 5J2NA 5KT7A 3CDUA 1D5AA 4IFYB 3BJYA 2KFNA 2OPSB 5KG7A 4JUZA 3QGIA 1IKWA 3H5XA 2OPPB 3ZT4A 4CERA 2W8LA 1SKRA 2UVUA 2J6UA 3OL6A 2VG5A 4RW4A 4TYAA 4F4KA 1SUQB 1JLQA 1U45A 3SQ4A 1Z25A 3NL0A 3VQSA 1NJXA 4CJRA 5DGBA 3DLGA 1F21A 2FC0A 3SQ1A 4QWEA 4AHRA 1RA7A 2Z1GA 1REVB 2Q3SA 3KLFA 4DQPA 5J1EA 1T7PA 4KAIA 3KMQA 2QK9A 2KQ2A 4F50A 3D45A 2QXFA 4NLDA 1DLOB 4FM0A 3PHEA 4ED3A 4FK2A 5L1JA 4DTNA 1C6VA 3DOLB 4AHCA 2O5DA 1NJYA 1LW2B 1L3VA 4FK4A 1RT2B 2RDIA 1TL1B 5EWFA 4JS5A 3KLEA 3VQ6A 3BSNA 1W9HA 4F4WA 1L3SA 4FLXA 1JLAA 1NOZA 3HSTB 4CJKA 3KK2A 2O4GA 2WHOA 4MKBA 4CEDA 2OPSA 2YNHA 3BSAA 2R2RA 4MFBB 1WSEA 3K5OA 4EEYA 5KFVA 4K4XA 3P1GA 3FQKA 4DFKA 5CZ1A 4NLSA 3DLEA 3FRZA 3L2WA 3LP3A 1JLGB 3T19A 4FJKA 1HNIB 3IRXA 4CK1A 2JGUA 3V6DB 4CK2A 4NLVA 5HRSA 3V81B 2ASLA 2HHSA 4N41A 1KVAA 2HW3A 1EX4A 3U3YA 1REVA 4EBEA 2R8KA 4FS1A 4F2RA 2FVRA 5C5JA 3LALA 5E41A 2OPRB 2UVVA 4M41A 4GVMA 1L3UA 3B6PA 4O0JA 2GV9A 2YNFB 3KKSA 4M42A 3KJVA 2UVRA 3BSOA 1RILA 4Y1DA 2O4IA 3RB3A 4DS4A 2FVSA 4KI6A 2VG6B 3DLKA 4ZPAA 4CFCA 3ZSVA 4F3TA 2Z1IA 1BCOA 1C1BB 3LP2A 1RA6A 4J9RA 3ASMA 1SV5A 4MFBA 3AVKA 3OL9A
chains in the Genus database with same CATH superfamily
4E1NA 2FC9A 4BR0A 3CFPA 1OVYA 5L9NA 1N56A 3SPZA 2RF2A 1HQ2A 2HAFA 2LECA 1WNEA 4CH0S 4LF7F 1FWKA 3ITHB 3HP9A 4LF6K 2ZQBA 3HHDA 4JEPA 1Q79A 3H5UA 2J5AA 5DO2A 1C0TB 3O3LA 1YJUA 3SSRA 3CCQN 3G71S 1S6OA 2VICA 2N4DA 4OHZA 1E6YA 4LF6J 2VFTA 5FPEA 4G3IA 1QE1B 2V7YA 3VQEA 3TAFA 2LEAA 2QN6B 2MPUA 3KLIB 2AIRB 3V9SA 2V4JB 4J9MA 4I7FB 3PY8A 4NL5A 1LAVA 1TELA 2FB0A 1VYAA 5DQHA 5JUMA 2MSTA 1Y5IB 2E9TA 3K8VA 1LWFB 1U24A 3IWLA 2ETJA 3VGUA 1IBMJ 2FD2A 3ENQA 1UVIA 4B1VA 3ISND 2ZUGA 4H0VB 4RX6A 1QTMA 3WIUA 4MAKA 1X5PA 3VVUA 4C11A 1GLCG 3D0GE 4KPCA 4O4GB 3S3OA 4HH1A 1BA1A 2UUTA 3R5AA 4NCBA 3RWUA 3NS7B 1UW4A 3GILA 2IVMA 3TA1A 5FLXU 1QHTA 2E88A 4LR7A 3FUYA 5KPZA 2QWQA 4WE1B 2CA9A 2BJ9A 2BMBA 3T1HK 3RU0A 2YH0A 2IBOA 1VLOA 2VPWB 4NI2A 4IDHA 3HKWA 3MFHA 1S1UB 1BI4A 4KHNA 4MKVA 1XJWB 3AD7C 3R5JB 2VF3A 2YXLA 2XYGB 4DMZA 3HHLD 3GFHA 5IZHA 4I7FA 4DU7A 3O5TB 4UZBA 2QM1A 3I5AA 4NLUA 2XWXA 4YP3A 4HTLA 2GFFA 4FF4A 3WXKA 1X1PA 1LWFA 4O5BA 4GNIA 3CCUS 3TVKA 1ZAWA 5KFWA 5M2UA 1FO1A 1FK9B 2XS2A 1K9MT 5KFNA 4GV6A 4KJIA 2NLXA 4KH6A 3FZ2A 3I96A 4F25A 2AYBA 3OQ2A 4WTYA 3R2CJ 2Q97A 4QR1A 4IOXA 4LMZA 1OH6A 4GKJK 3CJ0A 2I6WA 4PAAA 4JNEA 3HHLB 1PJ7A 3MM9B 1C0UA 4CHOA 5SZTA 4PPDA 4H4OB 2Y0BB 3CC7S 4I69A 5D3GB 2ASJA 4WBFA 5C7PA 3ZZOA 3U1NA 4LSLB 2OSQA 3A4TA 1HIYA 2QKKA 4BGAA 1MW7A 4LF4F 3MN7A 1EKRA 5CCLA 2GMJA 4WJBA 3BV8A 1LOUA 2YQ0A 1U1KA 2VQFJ 1NK4A 1YDLA 4B17A 4YORA 2HMPA 1VC6A 4C97A 4PKIA 3C6UB 1KAZA 4KAZA 3M2VA 1SC3B 2LLZA 5AXMA 3OFGA 4JK9A 1TFWA 3R1LA 4O3RA 2DPNA 3S9HA 1N4LA 4B3MK 1R0BG 3KHYA 5LSRA 4NLPA 1WC1A 5C0YA 3J81O 1PYSB 1EZZB 4FWQA 1FD8A 5T41A 2ZJRL 4X65F 2P9UA 2YHBA 1XMOF 3FGVA 2YWGA 4RCHA 2HMIA 4ECVA 4G1PA 3MM9A 1J2VA 4AQYK 1S1XB 4LR8A 3R9PA 4WFNL 2ZHBA 2YKPA 4JI5J 4IR9A 5HP1A 3BN4A 4JI4F 1QLNA 4KGVB 3M30B 1EAYC 1RHKB 1Y7PA 3Q2SC 4F02A 3KFWX 3FDSA 4DR7J 3MM8A 2JLGA 2JEJA 3O44A 1APSA 1KQGB 2FZKB 1FJGJ 3K7RA 2BDPA 3CCMS 4H0PA 1S57A 1KOOA 2V34A 2NLWA 4Y2AA 3AJ2A 2HQFA 3BF1A 5C12A 2XULA 1FVQA 2KXFA 1WC3A 3AARA 3KHLA 1GLBG 1NKBA 2QYGA 2X74A 3GV8B 4AD6A 4RW4B 3FNNA 1JLQB 3E9PA 5RUBA 4CZLA 1S1XA 3ZXWA 1ATRA 3VR1A 3BN7A 1UOCA 1VOMA 2OYQA 2HWHA 2DB1A 4DSKA 4BR4A 2DHSA 3W5XA 1WACA 3D0HE 3S8SA 2NZ4A 4R79A 1W25A 3M30A 4P7VA 3QESA 2GVDA 4NLGA 3CC4S 3MZIA 2XEXA 4OYIA 3M9OB 1QD1A 4DQ8A 3DM2A 1W0HA 2DFEA 2Q1NA 2ZH2A 4M5IA 4RKUC 3MPWA 3DRPA 4FXWA 4U7UK 4X4RA 1JXEA 7FD1A 5A8RB 2LA4A 1TUUA 3AA9A 4Z4EA 5HI7A 3KK2B 2UU9F 1Q81O 1TKTA 5BRFA 2M8HA 3LP1A 4MKYA 4Q45A 3NH1A 1VQKN 3O8WA 3G6ES 1QQOA 3TTFA 1GH8A 4OYOA 3OTCA 4USTA 1R8PA 2HSEB 3DLEB 5AJ3K 2N4CA 2B9EA 4L8RB 4DV7F 4O3NA 4Y65A 4K0KJ 3DWLA 4ZP9A 1S72N 3SUQA 5AQHA 1FNMA 2FBVA 4I6WA 1SS6A 3T9NA 3TZZA 1FTRA 3LPTA 3J7A1 4JV0A 1HHSA 1FJGF 5AQIA 3I87A 3KJVB 1Y00A 2QL5B 2W40A 4EP5A 2LMIA 3QEIA 5HQLA 4CGDA 3P49B 3CJ1A 3JS9A 1XHZA 4K42A 3RR8A 3LP2B 1DEJA 2EX3A 5E3QA 3DMJA 3ENWA 5DM7L 3D4JA 1XC3A 2PYJA 3E3XA 1X3MA 4XDCA 2W2OP 1SV5B 3O3FA 2MKYA 3J7YU 1U1LA 4JI6K 2VGNA 4O4RA 1DGKN 3NF7A 1H2UX 1RTIB 3A3NB 4OX9K 2VBXA 3TABA 4AF1A 4P2SA 1N6QB 1FKOB 4P9SA 4KO0B 5KI6A 1HNWJ 1KTQA 2R8GA 4FVUA 2GCFA 2O01C 3BGFA 3EKUA 1G3OA 3MWPA 5FLXY 4CE9A 1KSPA 3TAMB 2QO3A 4UQTA 2GEMA 2AA4A 4GKKK 5C25A 4F7VA 4BS2A 2HQ3A 4B08A 3W2VB 4FK0A 3CVKA 1A5XA 4KE5A 1VSFA 1S9GA 1RT3B 5G0RB 1RGIA 2NZTA 4LF2A 2G8FA 2NRRA 5JXSA 2LYVA 4Z4HA 4KHWA 2FY8A 1NH7A 3I0SB 1YIJS 3QLHA 2BX6A 1F60B 3BZQA 4TY8B 4AFFA 3BQ1A 4Q44A 3VAMA 3LDNA 2C22A 2OJ3A 2V8DA 4M5NA 2Y0SD 3EEQA 1GMVA 1NM2A 4A4JA 1WSHA 4DSJA 3TAEA 1VQ5N 4ES1A 5CA5A 1OYDA 3FR0A 1S6QA 2D0BA 1TKZB 3KK1B 1UA1A 4IOAQ 1O8BA 2ZH5A 3OXLA 1TYQB 1HQEB 4CI6A 2WCXA 1R31A 5ETQA 4OHWA 1PG5B 2MLXA 2FJEB 2CZ9A 4IEIA 3PUFA 2YWFA 4ZPTR 3TAMA 2V52B 1NDPA 2DFHA 3KHGA 2AMCB 2HHPA 5MAOA 4JI2F 3W2VA 2J9DA 1RT3A 4LSZB 3SQGB 4Z7YA 2KI2A 3K58A 4H0XB 1XERA 3MCOA 1FHTA 5BREA 4TNOA 4BRHA 2A1RA 2VPXB 2MQPA 1LFPA 4USHA 4N8OA 3R7SB 4DLGA 1BIZA 3BPSP 4FW1A 3I0SA 1I51B 3DGPB 2J9CA 2PD1A 3L7PA 1DZ5A 3C6TB 5LJ3Y 3LZIA 3SPYA 3P96A 4I2PA 4OPJA 1GX5A 1S1WA 1U0HB 5DG9A 2ZJQQ 3M8RA 5HN0A 1RTHB 2VH7A 4NZ6A 5A8WB 2KKHA 3P39A 4DR6K 1CXUA 1S9EB 1SJ1A 1HNWF 3FSIA 1VHXA 3W65A 2KXHA 2CNOB 3SIPB 1TYQA 4ED7A 2MZRA 4WCEQ 3OL8A 2Z1JA 3N5FA 4DQRA 4F0MA 1RAHB 3VOVA 2AU0A 4YQWA 1VQ7S 1TQLA 2DNMA 2AJ2A 4KH5A 1REGX 3HI9A 3CCLS 3AY0A 4QJVA 5F1XA 1F2HA 4DV5K 5CABA 2F40A 1PAUB 3NHGA 3M5RA 1NGAA 3D3BJ 2G0CA 4WK3A 3CE8A 4QYZJ 2I8EA 2BW7A 5LJVA 1I39A 2J6SA 4J37A 2LEPA 2GA7A 2E2NA 3H4BA 4JKEA 1W97L 4DR2F 2EK6A 1LV5A 3HKZD 2KT2A 4DQQA 4WFZA 5DZ7A 4CD3A 4X4UA 1J5OB 1CULA 1W2IA 2ZE2A 1U0HA 4WP9A 3GYXB 3BKFA 2GWKA 1U1RA 4QWAA 1HI1A 5CQGA 2MJNA 2Q6CA 1FWLA 2MY8A 1G99A 1RLCL 1AROP 3JAMO 1WBDA 4J90A 3QEXA 4BRPA 2O8CA 3NNCA 4G1QB 1IVZA 4ZHRB 2ZJPQ 1EQYA 2HBMA 2P2CB 4KSEB 4NXMK 2M0GB 2ZOMA 3PO4A 4X4TA 4ED5A 3TANA 4CJUA 4CJVA 1O1WA 2CJYB 3DRSA 3CCEN 5KFCA 1IBKJ 4XH1A 2C3OA 4K4TA 1E4GT 3VQDA 3SFUA 1S97A 3Q8UA 4M3YA 1N32F 4CJ4A 4NE9C 1FE4A 4DV0F 3DFEA 1EP4A 5HROB 3PO5A 2DGUA 1OIAA 4LBPA 3KJNB 4KB7A 5GMDA 3LP0A 4W5QA 1Y0HA 2E1YA 1G1XA 3TRGA 2XCAA 3LGMA 2PZSA 2R7WA 3X1LB 3MEEA 3NGRA 1SKSA 2ZZMA 1H72C 4ZS6A 4YDUA 4B3SJ 3PLAA 4M5LA 4EZ6A 4ZHRA 3A2FA 4CJFA 1AUDA 4C2MA 4S0MA 4RUBA 1NBWA 2F8SA 2PIIA 1BHLA 2GUIA 1FWPA 2WZ1A 1QDUB 3CC7N 3N6MA 1EIYB 2EWSA 4HDGA 2IVPA 1I5OB 2HK2A 3N28A 4XPEA 4RPFA 3C2PA 5L1KA 2R9LA 1UZHA 3PYGA 4DDFA 2ZD1B 4LFAK 2B0GA 4OYZA 2C1EB 1LQ9A 4W4MA 4CZGA 2C2EA 3AVFA 2GS8A 1RKJA 2P9KB 1YBAA 3K2YA 3NE6A 4AM7A 1DKGD 4RNOA 1XR6A 3NDKA 5GVQA 2OIHA 3MN6A 1WTFA 1WOQA 2GX8A 3H2LA 3I5BA 3VQPA 4X64F 1D9AA 3M6XA 5D4NA 3V2UC 4AHUA 2Z2ZA 3N0VA 4DV2F 1K73O 4K43A 2ZBCA 1HNVB 5ETPA 2W24A 4C3KA 3QETA 2K3IA 4FLZA 2RSQA 2BE7D 3GPAA 4HWIA 1SL2A 4OKJA 1V6HA 3SK3A 2VPYB 1IBKF 5DLFA 1TK8A 2JVRA 5KFJA 3FFKB 1JB0C 4E3SA 4GV3A 4UTGA 2EBEA 1RHQB 2YHYA 2UXCK 4CLFA 1KNZA 5F8NA 4CEEA 2XTJP 4DSLA 5KRSA 1VQ4S 2LP4A 4LF1A 4DR5F 2Z0GA 3AOAA 2E2PA 1S7IA 2ZBRA 3TQ1A 1SC4B 2W2PP 2P9KA 1WUUA 3MCMA 3AB4B 1X31C 4Y34A 1IWGA 3GIMA 3OYDA 5HVGA 1CJTB 3X3UA 3CCMN 2HHUA 1VQNS 3SSQA 2VB6A 2F96A 4PHTX 5GADI 1RWOB 3T6JA 5KFUA 2B6AA 5ETMA 4ED2A 5EOYA 3OVSA 2WC9A 3QIPB 2RDDA 2AZ3A 4DL7A 4L6V3 1OS5A 1YJVA 2CH6A 2B9WA 4CLYA 4A61A 2CXEA 1BISA 4FBTA 2CPYA 4MIAA 1AXQA 5FRNA 4I1TA 3VERA 2RS2A 2YVSA 4PG7A 5EN1A 3VEXA 5ADZA 4KT0C 4GY2B 4KV8B 1U6FA 3FCWA 3SCJE 1G4CA 3M4XA 3ZSZA 2IRUA 3FMWA 2AZ1A 2AD9A 2V51B 4CJQA 2RHQB 1FCAA 4XK8C 4CO5A 2A0FB 4FJGA 1SJQA 3DOMA 2JFKA 1H73A 3DHWC 4Y6IA 4FZVA 1KVIA 4CTAA 4DR4K 1CJTA 1EETB 1ZYQA 1LWEA 3OLAA 1OY6A 1DFDA 3BO3A 4NCGB 3G6YA 3LWLA 4ID8A 1KVCA 5I42B 4C8NA 5JVGQ 3NS5A 3G6EN 4B3TK 1VMBA 2IC3B 4ECSA 3CQYA 3CO0P 4IOCQ 3UN5A 3CMES 5GAGI 1BE4A 3AO3A 5I3UB 3R8EA 2HIQA 4LRCA 4C9DA 1NOYA 1RWMB 3DI6B 2XZDB 2UZAA 4U67L 1O0PA 1RAEB 3F73A 2P9IA 2OI2A 2H65B 3PCOB 2G0IA 1VRUB 2HG4A 2J7KA 4H5VA 1EETA 1DQAA 2HK3A 2ADCA 3P5JA 4LUBA 2QSWA 4CLPA 1N88A 3FGUA 4CZMA 1HW9A 4OLOA 1Z05A 3WQUA 2W41A 2MY7A 1TV6B 3AO5A 4Y1CA 1KD1O 2XMVA 5K8PA 4KTWA 1QSLA 4RNNA 1YI2S 2GAGC 1UPMB 2MGZA 4JV1A 3J81Y 3EKSA 3TJAA 2NXUA 2QA1A 4YR0A 1M90O 3THXB 2G8UA 3KUGA 3ZO7A 3A5LC 2E1CA 1EB0A 1TL1A 1GXUA 3VETA 1F9EB 3MFIA 2Q3PA 4ZVSB 4FWNA 1FDDA 2C3UA 1SC1B 1X5OA 5KG4A 3T9ZA 2HAIA 2PYLA 5AQLA 4FJXA 3O9QA 3PXGa 2HBKA 3C46A 3DI6A 3DXMB 2CPFA 2XBPA 5DM6L 3M8SA 3QWPA 2JLFA 2CDRB 3LDPA 1KLMB 3AVIA 3J7ZT 1LKZA 2XMUA 3R6LB 4O3SA 3CQ8A 3BKTA 3GSIA 4QBUA 1VR6A 4YOUA 3DU6A 4Y2IA 3QIDA 4DV6K 1TV6A 1WHVA 4H8KA 3AH6A 5AQUA 2IM2A 1GOBA 3RRHA 2BE2B 3IBCB 2JLEA 3LGHA 3POTA 2ASYA 3B4DA 4QS8A 4EK2A 4NXNK 2VG6A 1RBRA 1R3NA 3O9SA 1GTEA 4AE5A 2CADA 3MOJB 3VV2B 2C2DA 4CLWA 3WXMB 5LL6Z 2ZM6F 3DXMA 1X7VA 3KJQB 3KLVA 1TU0B 4ZK7M 1ZAVA 3GG0A 2V4QA 2Q31A 4DUZF 1RNHA 4JI3F 3F56A 1WG4A 1KLMA 4DQIA 3BQ2A 2QWLA 4B9LA 2N7YA 4DSEA 3LL3A 4LF5F 4KRWA 1NSQA 3D7SB 4ES2A 4C3MA 4FF1A 1R6VA 3F0NA 3M05A 3MAAA 3UE5A 4K4UA 4DX6A 3GJTB 4BRMA 3CQXA 1TKDA 3VQ9A 5EWGA 1I6JA 2XHWA 2BE2A 1ATSA 4O8KA 1TR0A 1D4XA 1JJ2R 2WBMA 1VQ7N 3G8QA 1R0AA 3A12A 4OYWA 2YWHA 5AXKA 2MKJA 4DPWA 5JMNA 1UJ6A 4P7TA 2CPZA 4FF3A 2P9SB 4BDYA 3LAMA 2IMWP 5DDRC 2JSXA 5F8MA 4BRQA 4BRKA 2E6LA 1VCTA 4LIRA 2EFQA 2QT7A 4MLHA 2BOAA 2V50A 3OTOJ 2UV8G 4K8RA 2Z57B 3ET6B 4UT4A 2VU5A 3NWRA 2E5LJ 4DOZA 2UUBJ 2WB4A 3AODA 4J7CA 1NJIO 1JWWA 3NCQA 4WIQA 4ETZA 4JYAJ 4KB1A 2G2YA 4IYQA 1BHNA 2W4DA 1GEHA 1TVRB 4URGA 4P6QA 2LU1A 1TL7B 1UAWA 4HHJA 5F9LA 2B8QA 3PIOL 2D9OA 4L74A 2QEXS 2WVDA 5LMUJ 2ZBQA 2BXJA 5CZXA 3RMAA 3HZGA 2O8EA 1SQFA 2K3KA 3SYZA 2VPZB 4M3WA 3J8AA 2WW4A 3UCGA 4ID1A 5AQYA 4J91A 2RIJA 3CB4A 1VSLA 1BQMA 5D78A 1GXTA 3O6WA 4NA3A 4XAKA 5A76A 5GAHU 3ULEB 4OI6A 4GO7X 3G0ZA 1IQZA 4I6MB 1I3OB 4NA2A 3WXLA 3DDNA 4J9QA 4YHHK 2DEIA 5EWEA 1N36J 4ZVRB 3VESA 2WFBA 2FHKA 1QUPA 2NRWA 5GMKa 4LSNB 2YKNB 4JV5K 2RQ4A 1J53A 3UWTA 1WHYA 3CYMA 3T1HF 3CJTA 2COLA 1VQOS 2V69A 4HR2A 2QXLA 5H9EK 1MWQA 2R8IA 3VF2A 1UJ5A 3AVCA 4DBQA 4H4KC 2MYFA 2XMKA 3QSIA 2MQOA 4YOWA 2JVOA 2R2UA 2OLWA 1BA0A 2KB2A 2Y3YA 3OYJA 2UUCJ 3CDAA 2VBWA 1WORA 4DUYJ 2EG1A 3HVTA 2DPJA 3QWUA 2IAJA 2HEKA 3K5LA 2V8VA 4GC6A 4DTUA 5CYQB 4DV1K 5C24B 3A8JA 1UPPA 2XCPA 1TL4A 3BUZB 1WTBA 3J7AP 2E5LF 2YPZA 1BQNB 4M5HA 4LFBJ 4OZJA 1KQSR 4FYDA 2MMYA 4ER8A 4ELVA 2E5HA 4NYFA 4GKJF 4IZ9A 1NUEA 4FKXA 3TSQA 3D1OA 4DZDA 2DPIA 1IKYB 2FZCB 1C1CB 4KGZB 2JRSA 4H4KA 2HSTA 4OPKA 4M3RA 4FWSA 3IN5A 5AQRA 5D8HB 1XEZA 3WNGA 3M6VA 3LM9A 4CJSA 4YR2A 3GB0A 1VS3A 5J1EB 3D1QA 1RDRA 4FW2A 4PYDA 5KFOA 2NREA 2W7PA 3QBXA 4ZOSA 4MTPA 3VGSA 4M45A 5J1NA 3CWJA 4NLTA 5A0YB 1VQ4N 3S41A 5KT4A 4ZP6A 4YY3K 1VFJA 5F41A 1KQKA 1BQNA 5LMNK 4B3MF 3PIPL 2GQ2A 1HYZA 2R7RA 1K8KB 4DV3K 3T5KA 2D0PA 4B9SA 2CQGA 3MCNA 4USVA 3CDUA 1VK3A 2XHCA 2R7VA 2OPSB 4BG9A 3PHTA 4CERA 2QC3A 1X0FA 3THYB 5IT9O 3Q8YA 3OL6A 2ADBA 2VG5A 4F4KA 2BEFA 1SUQB 2K8GA 2DYAA 1T11A 1Z25A 2UUCF 3T1YJ 1NGIA 1JCFA 3DLGA 4DUTA 2GWJA 4TVAB 4ZCIA 4DUYF 2VC1A 5K8NA 4O8UA 3M6WA 1RA7A 5TKYA 2BV3A 4P2XA 1REVB 3MD3A 2FLOA 2R7OA 4DQPA 5J1EA 4TLQA 3KG4A 3KMQA 2MKSA 4HH0A 4F50A 2XO6A 5IWAJ 4NLDA 3PEHA 3S7RA 1I94J 5HVFA 4DTNA 4LFBF 3BM7A 1T3OA 2OFGX 1SQKA 5A0YA 2GJ2A 4AHCA 2ALYB 1L3VA 1PO6A 3ZZTA 3CJ9A 2RDIA 5D4PA 3VQ6A 1W9HA 3CJ7A 1L3SA 4L72B 1GMWD 3UVJA 3H45C 3IP0A 2O4GA 1WI8A 1VJWA 5ETSA 4W98A 1FF2A 4OYBA 4CEDA 2OPSA 1PAEX 1VHIA 4BR2A 2IYIA 1CJVB 3C15A 4MFBB 2CQHA 4KBOA 5KFVA 2F5GA 4R25A 4K4XA 4CO3A 4A2BA 3P8BB 5H9FK 1NZAA 2K1RA 3DNCA 3EGVA 3FRZA 1JLGB 3T19A 1HNIB 1DAXA 2P9PB 2JGUA 3V6DB 3BGOP 5HRSA 1UTAA 5AQSA 2HW3A 3CJQA 1EARA 3U3YA 1REVA 4EBEA 2R8KA 2Q2RA 2FVRA 3UN3A 3W9HA 3L4IA 5E41A 2OPRB 1HWUA 3VTIA 2G1HA 2FJBB 4OV6A 1N33J 2LEBA 1OH5A 4GVMA 2KT5A 2YNFB 3KKSA 4CBWA 2E7VA 2UVRA 5AE2A 2CH5A 1ZOTA 4Y1DA 5IQQA 4KH1B 2FVSA 4NYPA 3DLKA 4EIAA 1BCOA 3KYLA 2C3PA 4A48A 1RA6A 4RWTA 1DY3A 1CJVA 4MFBA 4LT6A 1J5EK 3OL9A 3AVHA 4CH7A 4MDAA 5EU7A 1W26A 5D0RA 5AT1B 4CFAA 5AJ3F 1V9OA 1FI4A 1GNKA 3N4WA 1OO0B 2DNQA 2YBVA 1V3SA 4CGGA 2PY5A 1U1PA 2KZZA 3IKMA 4OZ0A 4RW8B 1YI2N 1M5KC 2MKKA 1YUWA 1LW0A 1D3WA 1I94F 4K8ZA 4J9LA 2F9DA 4E8UA 1FXLA 3H4DA 3IR6B 3I8BA 1FJEB 3TTCA 1LNQA 3MXHP 2YNFA 1J27A 3HI0A 3BO4A 4YN3B 3NGYA 3CCVS 3SXLA 2GO9A 4C48A 3DLJA 4C6AA 3K5MA 3THWB 3UDCA 4OLPA 3OJUA 5L38A 3QT6A 3P5BP 4AT1B 2PC6A 3FQLA 4ZVOB 1HFEL 2M5YA 2VV5A 4M7XA 5DJBA 1WNSA 5KFLA 4OX9F 3GIJA 3MMCB 2KHOA 4FJLA 1EWRA 4CHYA 2IA0A 2RU3A 2V5HG 3TJ9A 3GV7B 3CF5L 4V19J 4K25A 2HZAA 4RW8A 3MI7X 3RB0A 1SH3A 2ZWOA 4GKKF 4XEIA 4JHDA 5CHCB 1KHWA 1N33F 4PA1A 4F4YA 3CETA 4KKOB 4YB1P 2YQ3A 1BO5O 1O13A 4CHPA 2MZ1A 2PFFB 4EO8A 2W2MP 4CESA 4ATNA 5D15A 2P5VA 1VI7A 2HZVA 2JX2A 2WRMA 2G8VA 1X4FA 4UF4A 1VRQC 1Z1ZA 2D3OR 4BRDA 5HK4A 2OZSA 5AQTA 4B9NA 2C2KB 1ZS6A 1IM4A 2EKNA 3D2EB 3D6MB 3HHNB 4ICLB 1TL3B 1XNRJ 3MMCA 7FDRA 2KW4A 1RDBA 2D74B 1ASWA 5DMRA 4FNHA 3RAXA 2ZNYA 4DI6A 3FVYA 4IJNA 1FFWB 1XNQJ 1JLEB 3KDNA 2BRLA 3I32A 3NG8A 5GAGU 3L2QA 1VQ8N 4ZPCA 3AAPA 2KDOA 1RCOB 5E26A 4ZPDA 2HFZA 4YOEA 1S1VA 3OHBA 4EBCA 3MUTP 3OJSA 3BREA 5HJXA 4TKTA 1Q82O 5L46A 4P73A 3ILOA 2GZOA 3HVRA 3LZJA 4GVBB 2M52A 1OPIA 4ZCMA 2LDIA 2IFXA 1GLAG 4PQUB 2YKOA 3SCXA 4BC7A 2OH2A 3DLRA 3TSPA 4QOZB 2D9PA 3SQ0A 2C2RA 4HEA9 4QIFA 2FUG9 4DR3K 1CXQA 3DJCA 4M5GA 4DTRA 2DY1A 4DR6F 3BR9A 3TZWA 1M1KO 3JSRA 4WFAL 1T9VA 2KYZA 1T05B 2E2QA 2DJWA 3SCLE 2C3YA 4JBCA 3B6OA 3IS9B 5CYMB 3VALA 2MZQA 3NLCA 1CBKA 1S5ZA 4DV5F 2QEXN 1EKSA 4YOTA 5KT6A 5F8IA 3N01A 4B3OA 1HMVB 3ZC4A 1WLJA 2E2OA 1IKXB 3DCAA 3L2UA 4F4XA 4GVBA 2NSCA 3ADAC 4KHPJ 4BE1A 4AXIA 1XIQA 2XMTA 2PT0A 3CCTA 4ZCLA 4P71A 1GLDG 1OQ6A 5K8OA 1RCXB 3SDEA 2OZMA 2AX1A 3H5SA 3HHKA 4N8NA 1XNRF 3K0SA 3R1HA 1UFLA 5D6GA 4KTQA 2R7YA 4LH5A 2J9DE 1Y5NB 4YB6A 3OYLA 2ASDA 4X62J 2R4FA 3M32A 4F04B 1VQON 3THPA 3G9CA 3OR2A 2VQEK 2IYGA 3KZBA 4U9RA 1OH7A 1N0UA 3IS9A 5CYMA 3OVNA 3DOKA 1P90A 2EW9A 4IJAA 4FP9A 4NYZA 3WEEA 3NAHA 2D0OA 3KLGA 1E4FT 4PG4A 2NRHA 3NGTA 5A2QO 3JQKA 1IKXA 3NMAA 3TARA 1OWXA 5KTQA 4OZNA 2QGFB 1S9FA 4C4WA 1CZBA 2RU9A 2G8WA 5IXUA 2Q79A 5B0DA 1CSJA 3VQ7A 3DXKB 3DXBA 4A5AA 4RNFA 2HBQB 2FY1A 5HMXA 2GC8A 1JLBA 1MLAA 3RR7A 2ZZTA 3H42A 4Y28C 2J9EA 1HBNA 3R5BA 4O55A 4DCJB 2HS4A 2J0XA 3R27A 5L1IA 2FJWA 3Q22A 1XMQJ 4K7QA 4A8OA 2XRIA 2HFUA 1JLAB 3VGLA 3BR8A 3HO1A 3BO2A 3OYFA 1URRA 4O44A 4F26A 2FTRA 2YNHB 3PYEA 4LFAF 3N79A 4PXEA 1QZ5A 2QMXA 3ZSXA 5L8RC 4L3QA 2AV5A 3ZNJ1 1Q0NA 3QJLA 4BDPA 3SMZA 2Y8YA 3IRXB 1BU6O 5ADXH 5HOOA 4IH6A 2NUHA 2DHXA 1E3MA 3EE9A 1D9DA 1AT1B 4C8LA 3CCSS 4FWLA 1JMTA 4GVLA 1CEZA 3OYMA 3KLHB 4BRCA 3R5GA 4QS7A 1VQ9S 1H2VZ 4CRJA 3LAKA 2VC0A 3MMBA 3QIOA 4M5KA 4DPOA 5BN9A 3KUEA 4FLUA 3TP2A 3OYNA 2VWKA 2HS0A 5F0WA 3AVAA 3KK3B 5DK5A 1VHFA 3QRRA 2R2TA 2UXCF 4Y2CA 1RBAA 2EFPA 2PGCA 4LY7A 2RVJA 4CECA 3T41A 1T95A 3VGVA 1WEYA 1H0HB 5AQOA 5HVHA 2ZGZA 4Y3CA 3WX4A 1VSHA 1IKVA 4C1NK 4CGIA 3EZ5A 3EMTA 4A8WA 4Y0WA 1SJ3P 4DV4J 1TL5A 2AJ0A 1WD6A 1HNXJ 3U3GA 2HFVA 3TI0A 3UW1A 3AQPA 2RE1A 4OJGA 4N47A 2G2ZA 2DR5A 3P5TL 2I5JB 1FDAA 2FHJA 3KLHA 4DR1K 2WSFC 5A8KB 3W64A 3PSFA 1RT5B 4B3RK 1UVJA 5J2PA 1D0EA 2HHHJ 4FYVB 4HHTA 4Q0BB 3QRPA 2UXBJ 4CEBA 2ZH4A 1LWCB 1XMQF 1S99A 1RHMB 2OGUA 2OP5A 3LQVA 3NGIA 2ATQA 1HQUA 1U2VB 4JI0J 3KK3A 3N6LA 2ZHAA 3SNNA 2B7BB 4FJ5A 3HYFA 3NOGA 1VIXA 1C0GA 3WBZA 3QZ8A 4EZ9A 1N34J 2D0AA 4FWRA 4WFXA 4LIWA 4RW7B 3U7JA 2GHWA 3M8PB 4E7LA 2WK4A 4WPAA 1LOTB 5I3PA 3MEGA 2HBLA 5ELZA 1NAQA 2FJAB 3SV4A 5GAHP 1VQ6S 1V3RA 3W1YC 4ISEA 4DR4F 3C94A 4JK8A 2BGGA 3BZKA 3R8YA 5AQWA 4NZ7A 2I5JA 3SJJA 3DYAA 2P5OA 3JSYA 2E9ZA 1XMBA 4F36A 3BEXA 4URQU 2CGJA 4I67A 4FJ7A 3TA2A 5T7LB 4IQMA 3WNEA 3NMRA 4B3TF 3CM6A 4ZVTB 4PG8A 3PG9A 4IKFA 1U2VA 3FJ2A 2W4CA 3CJSA 3N5BA 3UCUP 3CD6S 4DCOB 1S6UA 3WC2A 5KFYA 3J7ZO 1L3KA 1HR0K 3RGIA 4FJ8A 5LOQA 3JTNA 3HZEA 1XQSC 5CCMA 1KVBA 1KHVA 1UKUA 2YX4A 3H08A 3CXCM 4ES3A 1QQMA 3AJ1A 3DHXA 4IO9Q 1HNXF 4OJHA 1YJ9S 2V63A 1BD6A 1AUSL 1IBLJ 4ZVQB 4I2QA 4OVLA 1T03A 2XSJA 4PKHA 1PBUA 4IG0B 2UXBF 1UEUA 4ZPVR 1TK5A 5AQXA 2KG0A 5KFBA 2A41A 3ID8A 2RPIA 5T7LA 5M1PA 3CUNA 5FPMA 1MA9B 2DNHA 2VODA 3A8IA 4AILC 1JXBA 2XMJA 1RHRB 2RQKA 1AFIA 2LCWA 4DFPA 2W25A 4NOHA 4NCAA 1F3FA 3HSGA 3P38A 2AJ1A 4J9VA 1HYSB 2D3UA 1OH8A 3NBPA 5IT9Y 3NGZA 2QYCA 3IXQA 4CF0A 3EICA 1RBOB 4ZDNA 3PVXA 3CCJN 2CQIA 4RNHA 1C2PA 3FC9A 4DTJA 1YJNS 4K5SA 3HVWA 2NYHA 4OLBA 2EG2A 4M5DB 4IH7A 1RYSA 2X1BA 2UUAK 4P75A 2ZH8A 2FSJA 3GJQB 4L75A 1WF0A 1OYEA 4O0IA 4PUOB 4U8VA 4JRPA 4WP8A 2VOPA 4IG0A 1X9JA 3PR5B 3PTWA 3GTYX 1NM1A 4USIA 1YZ6A 3NAIA 2X1AA 4DV6F 2O8DA 4KTZA 5ETRA 2CPEA 1WG1A 3T6BA 2IRXA 1S7HA 2CJ9A 8AT1B 4XPCA 2MLYA 4CEOA 2P9LA 5KRTA 3OBWA 3DLLL 1PC4A 3MEDB 1RKIA 2WBNA 4KHYA 4E0DA 4KR0B 1RACB 1FXDA 3K9KA 1NSPA 3L9ZA 1GT8A 2CVEA 2HGNA 5HJYA 4IRCA 2ASMA 2HNDA 3F9KA 4UY8O 2HVHA 4V19S 3E8OA 1KBRA 2PI4A 2K7JA 4WU3A 5EDWA 2QL7B 3M2RB 3FSYA 4M5DA 4ZVEA 1SJFA 1VQPS 3UCZP 4DL2A 4BQLA 3CDBA 1O5JA 1RWWB 2EC0A 3PRVA 3Q7BA 2KRRA 5B0FA 2MJUA 3MWTA 4HTUA 3WNHA 1NGHA 4H0YB 2F4VK 2CYYA 3QT5A 2QA4G 1Z6RA 1K73T 4QPXA 3HBTA 3HF5A 4DU1A 1VAZA 4ZLLA 4B1ZA 3MWBA 1MU2B 2VGMA 3TO8A 1ZZNA 4LFCK 5MLCV 1S6PA 4YB7A 3WIVA 4LF9J 4B1YB 4ZP8A 5DDPC 3VAIA 2O66A 3PACA 2WSCC 5F8GA 3NP5A 3C6AA 2XNQA 4CZFA 2E44A 3CJ3A 4Z4GA 3EWGA 2ATCB 2RNEA 2X3GA 4CP5A 3J7Z5 1HA1A 2FGOA 2NZCA 3M2RA 2PEBA 2YNIB 1RT6B 3AVBA 3ZZYA 4LD0A 3L4QA 3T5HA 3QEWA 1F9HA 2B4OA 3S01A 1N5TA 3FK4A 3RVCA 5DG7A 1R7IA 4IFVA 4DFMA 2G8KA 5M1KA 4KY3A 2CJKA 2XGQA 4IOAL 3P83D 2G13A 4JI8K 3UD3P 4NLRA 2C2NA 5CHIA 1UCNA 3UD4P 1K1SA 3AO1A 4IG3B 5KG2A 4CK3A 3Q8PB 3GOIA 4QIWD 1IR0A 4CLLA 3OHRA 3GIRA 4WKYA 3KXDA 4X2BA 1RT4A 3V6JA 2RKIB 2BJEA 3LGNA 3E01A 3CIZA 3VQ5A 1XR7A 5LSLA 3Q8RB 3W3DA 1BXNA 3CG7A 3LTOA 3W9IA 2M70A 4DPYA 4IFEA 2Z8QA 1NEEA 1MROB 2DY9A 4X4OA 2YNIA 1A5WA 1RT6A 5KG6A 1VSEA 1UJ4A 3GV5B 4JKCA 2C2MB 3NH0A 2QV6A 1YVFA 2P9NA 2HHTA 4ZVGA 1GX6A 4N77A 4FS2A 1YF5L 3D3CJ 4LF7K 3QEVA 4BRLA 1NK7A 1BG3A 2Z2LA 4MDBA 3M8QB 4NRUA 2DGSA 4LF8K 3SCIE 3TR8A 1NMDA 4FPAA 3GE1A 4WCEL 1CPZA 2EC2A 3VQ8A 2AW0A 2DHHA 5AE1A 5E5NA 3LDSA 4QW8A 3CJKA 2IRYA 2RKIA 3MAHA 4FLWA 1F0XA 2HNYA 3I55S 2XNRA 3T69A 3LM2A 1JKHA 2OKQA 3K2PA 1YZ7A 4B1UB 3MXIA 5KFIA 2UXDJ 4JI7J 2VD3A 2NRTA 5K14A 1FA0A 2DIVA 4J2AA 2E4LA 4A8YA 4A8MP 2CQ1A 2BKNA 5J2MB 3HL8A 1Y3JA 3MEKA 3KNGA 4IFYA 1WC4A 3VF4A 4KH0B 1VQ9N 1JXVA 2OPPA 4A5BA 1F5AA 4KQZA 5F9NA 1TAUA 4LVOP 2HPUA 1KD1T 1SL1A 4QIGA 4F67A 1ATNA 3A5OC 2ZJPL 2P1JA 1RLDA 2FJXA 4OV1A 5AZIB 3TR5A 2EHGA 5EHHA 2D4WA 3VWSA 1M90T 1HBOA 3MMAA 3BB5A 4PL8A 4X66K 3I56S 3JS6A 4R0JA 2M8DB 2KN4A 4CYUB 1ZM4A 3UE2A 2UYTA 1OPZA 5KG5A 1U2FA 2WVFA 5HL7Q 3KK7A 1DLOA 4YY3F 3ZTSA 5E3RA 5LMNF 3DOLA 4U96A 2BM1A 4DV3F 5JLHA 1RT2A 5BJRA 3KMSA 5HLFB 2BTFA 4FJJA 2HHVA 3VZIA 2W1BA 3KJFB 1U8SA 3RZAA 1HJOA 2CQ4A 1RZMA 5KFSA 2IVYA 5IM0A 3TQEA 4CT9A 4ERDA 1HPMA 2RRBA 1L5UA 5TKWA 1UETA 4ECRA 3VHQA 3IC1A 1WN7A 2V94A 5FD1A 1RTDB 1N5YB 2AJ4A 3AVGA 4L3KA 1QS4A 4R5PB 3ENBA 4DPXA 3PW7A 4NLBA 3D0IE 2HB5A 2ZUAA 2W42A 4CYUA 2AJFE 3BQ0A 2YNGB 4CJTA 1P9YA 1U2CA 5JJBA 4JKFA 1R6YA 3OYGA 2UXDF 4JI7F 5KFAA 1SJRA 1EHWA 1RK8A 3V1OA 1NXIA 3JYTB 2FVCA 1Y97A 4WQ5C 2W9BB 4C23A 1Q18A 1DBDA 4OLAA 1NJWA 1KQSM 2ZKTA 3C19A 1FFSB 1VQ6N 2RD5C 4H4MB 4ECTA 1IBMK 2YKMB 1FXRA 1NLKL 4DN9A 2L9WA 4EBDA 1XBWA 4JKAA 2FHMA 4LF4J 3O3HA 2GGPB 3HT0A 3PR4A 4WYLA 1JCGA 4PXCA 3ULDA 2VOOA 3QMQA 3M8WA 3TNVA 1QM9A 2FJVA 4WWSA 3TSUA 2C2ZB 4NO7A 1SIZA 2CGLA 5KOXA 1RTDA 5IT4A 1XMOK 3ITHA 3CGIA 2DNOA 2GIRA 2G9OA 2OTLS 4TLRA 3VEZA 2DKOB 1C0TA 3QFPA 2DK2A 1Q16B 3A1YG 3KG0A 5F0XA 4MO4A 4X65J 3ILLA 1PYOB 2XZWA 1XMOJ 1X9SA 3QSYB 4QS9A 2GMHA 4WQ5A 3ZZPA 3TVYA 2OEMA 3PZPA 4ISFA 1QE1A 1VISA 3KLIA 1ZPVA 2V4JA 1S48A 3ISNC 4JI4J 4BROA 1NJIT 2BR0A 1J5EF 3FZMA 1LK7A 5F3ZA 3EM1A 4WXOA 5F8HA 3J80O 5LXYA 4KPYA 1RT1B 2HLTA 3QFWA 3ZSWA 2MHEA 3CCRN 4YB5A 2W9CB 2QL9B 4CGFA 1HRHA 4O4GA 5L1LA 4NLQA 2J8AA 3HX9A 5BYQA 3ISZA 1BMQB 2RHKA 3IGNA 3LOUA 4BQZA 3WDOA 1JIHA 4WE1A 5FROA 3VF0B 2DH9A 3HHLC 2VQFK 3CI5A 2FVQA 2FQQB 2VA3A 1HD1A 1U0SA 2HGMA 3VVTA 3C65A 5CY4A 3MGJA 4ELUA 2VIHA 4I9QA 2VFUA 1YJNN 1S1UA 3T5JA 1PILA 2DGWA 4ANEA 4KFBB 1MWMA 1XTZA 4CZEA 2C2OB 3AXKA 1UWBB 1B0PA 2RRNA 3MMJA 1NU4A 3WHIA 1NHKL 5EUHA 2ZVIA 1VBKA 1S0MA 3V9UA 4OZLA 1L3TA 3IAM9 4RU2A 5CYJA 4NEZA 2ZH9A 5JVGL 2QLXA 4ZVPB 2P8IA 1TGOA 1FK9A 2IGIA 2CQCA 4CJ3A 5DDOC 5AXNA 3BGUA 2QLWA 1VQMS 2R8JA 4CJ7A 4FJHA 1WF2A 4JI5K 4AUKA 2UU9J 4IOCL 5IV3A 4PKGA 1U1OA 3T5LA 3QNNA 1N54B 2Y1LB 4ED6A 3HHLA 4Z4IA 3FFIB 1WSFA 4RUAA 1FJ7A 3AA2A 3QERA 2E7WA 2KYXA 4H4OA 4RUCA 3MUVP 2DNNA 4DR7K 4DZ6A 5D3GA 4DG1B 2PMHA 4XTTA 2GELA 4LSLA 2GO8A 2HBZB 2AQ4A 2FDNA 2MQ8A 1JLFB 1FJGK 2HHWA 1VQPN 2PA8D 4DV7J 2WONB 2H5JB 3PJWA 2GUPA 3ZSQA 3G4SS 2L9DA 2Z4PA 2FSKA 4K5RA 2JFDA 5BR9A 3H20A 3C6UA 1Z2ZA 1WSJA 3G2XA 3ZCMA 2APOA 5LL6d 1VQLS 2XMAA 3BF4A 3Q8QB 1DRZA 1Q78A 1JJ4A 4CLZA 4CJPA 3HSDA 2J6TA 5GIPA 8ATCB 1YITS 1IKWB 1QSSA 5ETVA 3MCSA 2JJ4D 4B9TA 2G2OA 1YTUA 1KXPA 4PG6A 1YJRA 3FFIA 2BA9A 2OPQB 1TP7A 3FBBA 2NUUG 2D7SA 1BDGA 2N3OA 2VKRA 1HYVA 4M3TA 4X84A 3B6BA 1NPRA 3IR7B 1XN9A 3NKYA 1HHTP 1B4SA 2CZ4A 6FDRA 1A6LA 2DR9A 4OZ1A 1SIWB 2LSNA 2E66A 2FBXA 2A1BA 3HD2A 4WQ4C 1E6VB 5K8MA 4ED8A 2QE5A 2YV0X 2RQCA 3WNFA 5D0HA 1Y3KA 2V2QA 4F0KA 1SBRA 3C14B 2KFYA 3NAEA 3NY0A 2QRRA 1TUGB 1WJ9A 2DR6A 3M8ZA 2DTJA 2BQ3A 2U1AA 2B3TB 3IR5B 3QZ7A 3U4LA 2VL1A 3BJYA 3AB2B 1IJFB 5KG7A 4JUZA 1PCAA 1IKWA 4QR0A 4OHYA 3UR3C 2UVUA 1VQYA 1ROFA 1WHWA 2DEJA 4K0KK 3C0BA 4ZLJA 5BYSA 4RW4A 4TYAA 1JLQA 1JNZB 3TEHB 2V9KA 4ZJQA 3NL0A 3VQSA 3G96A 1NGFA 1F21A 1HBMB 1FRXA 4M63C 3SQ1A 2O67A 2Z1GA 3BP8A 4NWBA 2CG4A 4U7UD 2E1MC 2QK9A 3KWIA 2IY5B 2KQ2A 2IIHA 4WQ4A 1BQXA 3PHEA 2BBEA 4FK2A 9RUBA 3I4HX 4JI2J 1C6VA 3FRYA 5C15A 1LW2B 3C14A 4FK4A 2VQEF 2VZ9A 2EXUA 4JS5A 3D68A 1MMNA 5A8RA 2BOPA 3QFUA 4F4WA 1X3NA 4FLXA 4TU8A 4KC5A 4NPOA 3KK2A 4BRIA 2HFNA 5CD4H 3NEKA 1HNWK 4C0BA 1HI8A 4BC2A 1WSEA 3K5OA 4EEYA 4P72A 1B64A 1EQMA 4G65A 3FQKA 5CZ1A 1F3VA 1CC7A 3DLEA 3WT0A 2JWKA 3AGKA 3LP3A 4FJKA 2Z58B 2MHNA 3TZYA 1HBMA 3V81B 4M63A 2WVBA 1EX4A 2QIFA 3U1MA 4GV9A 1U25A 4M7YA 4Z2XA 1TUWA 2BJ8A 3KJVA 2PN6A 2O4IA 3RB3A 2MZSA 5GAHI 2R7XA 4N7TA 1OMSA 3ZSVA 4F3TA 2Z1IA 4DR2J 1C1BB 2CQDA 3LP2A 1YXQA 3ZX0A 2O1PA 4J9RA 1O6XA 3AT1B 1SV5A 3OVBA 4B1XB 4Q2LA 1HWJA 3ZEUB 2HOEA 3U1LA 1RT7B 3EJMA 3OYEA 1RTIA 1N6QA 5G4DA 1FKOA 2AP6A 4KO0A 2A1SA 5HRRA 1J54A 2QW9A 1MWYA 3D6RA 3ZLJA 4WF9Q 2E5JA 2IBKA 3DRXA 1WKJA 3PIPQ 1H38A 3HOTA 2VDIA 3VN5A 4K2JA 5G0RA 2KU7A 1RDDA 1UEVA 2V2VA 1KQFB 3FEYB 1Z2LA 2RILA 5DGAA 4H5TA 4X4QA 4MYUA 3QQCD 1KFSA 2HHXA 1QTNB 1N32J 1PSDA 2W01A 2EFGA 4WK1A 3R6GB 4TQRA 2LXUA 5KG1A 3DKDA 4DV0J 2MKIA 4ANCA 3DU5A 2I7PA 4YNQA 4TY8A 1CJUB 5IOLA 3GIKA 4WYWA 1HNZJ 1ZBSA 4GMJB 1C1BA 4DL4A 1RTJB 5B09A 5KPRA 3ZX2A 4FWMA 3H7HB 5KFRA 1TKZA 3KK1A 1H74A 4RBUA 3ZETB 3OHAA 4X4SA 2F8HA 2RB7A 5KT3A 1S77D 1NHUA 3AAWB 4ILJA 5J2QB 3C7NB 4NYNA 1HQEA 2BJ7A 2QMUB 3G71N 1FX2A 3ENAA 2DNZA 4QYZK 2DNLA 1VSKA 2EKYA 2OD4A 1ZH5A 3CT9A 4DR1F 1T94A 3RBZA 1CZAN 4EUVA 3GCXP 3HJVA 1YBUA 4FN5A 2QI2A 4A8QA 5EGYA 3KWGA 3OVAA 4DN0A 3SQGA 4G9ZA 3NGSA 3MN5A 4J9KA 4ECQA 3D1HA 3W63A 2QWPA 1UZDA 2HQDA 3IMQJ 4ZPWR 4HLBA 4M3UA 2CAJA 4X4PA 2QMWA 4OGCA 3B82A 3PV8A 2VJUA 2ZHOA 4UOGA 2Q36A 3DGPA 4OKKA 1VSMA 1CJUA 3N6NA 3C6TA 3MM7B 3J81U 5B7WA 2Y1JA 1K6YA 4M3XA 4CLTA 3NNAA 3AO4A 1RTHA 2B4UA 4RBVA 4CO4A 2OTLN 1RDAA 5A8WA 4CNZA 4X64J 1IBKK 1DHMA 1H6KX 1S9EA 4YDUC 1Q82T 3D2FB 2GVZB 4DV2J 4BRAA 4FBUA 4A8XA 4FLTA 5FPNA 5I3QA 4DX7A 2YY3A 2PI5A 3O4NA 3CCWA 3Q7CA 1VRTB 4O3OA 2RMLA 3OW2R 2Y9HA 3W61A 4BACA 2J7WA 3I33A 2QJ3A 4CIFA 4LQ9A 3R7BB 5ETKA 2BUNA 2D69A 2DGXA 1W7AA 4J8FA 3CD5A 3FZLA 4PQAA 1JLCB 3V6KA 1M1KT 1CS4B 2M2BA 4JKHA 3IAYA 1SJ4P 3MPDA 3FEXB 2AX0A 3W2WB 3LPUA 2E20A 1HNZF 4DR5J 4F8RA 3CCUN 3W60A 5FLXO 4ECYA 4B3SK 3VQBA 1J5OA 3FSXA 2G8IA 1SQGA 4JP8A 3CPWR 3V4IB 3VGMA 4ILRA 5HBMB 4NLOA 1NGCA 1RI7A 1CJKB 1S49A 1AZSB 2CPHA 1QSYA 1CZ9A 3D2FA 4MQ3A 1RCHA 4G1QA 2N82B 1YJWS 1GTHA 2H51B 2EVZA 3DDKA 1SZ2A 3H90A 2HVDA 2CJAA 4WFYA 4GMKA 3GSDA 3PYDA 1IQTA 3SV3A 1ZM3A 1W7WA 3VQCA 2ZGYA 1PBAA 2KG1A 3ZZRA 1PJ5A 1JLCA 3GQCA 4CEFA 4P2FA 4FZYA 2WSEC 2B51A 5HROA 3Q23A 3W2WA 4BC9A 4BGBA 1HUXA 4MK8A 5SUHA 3J81j 3K89A 4FJIA 4ECZA 1QJHA 2NPFA 5H1SV 2HYIB 4ZIVA 2H54B 2DXEA 1Q8LA 4ILHA 1SI9A 3BDPA 1VQMN 2BKPA 3V4IA 2NR0A 5HBMA 2Z2YB 2DIUA 3TVZA 1CJKA 4E7IA 3GG4A 1Q8KA 3M9MB 4PWWA 2O8BB 2DNPA 1RQ0A 3GR0A 4FWKA 3QGPA 4HT5A 4HVZA 3JXOA 4OJ3A 2UUAF 4XO0A 3HM8A 1RE1B 2DT9A 2MXYA 3LWMA 3ZZ0A 4E98A 1V5VA 3EVWA 2I7NA 1BL3A 1N48A 2X51A 4OX6A 1XR5A 5C2DA 3GZ7A 2LQ5A 4JAXA 2ACMA 3H3OB 1HWIA 3AVLA 4CLUA 2ZD1A 4DS5A 3THTA 1ZBFA 4DHVA 3CXCR 4W5OA 3G4SN 1IO2A 1VQKS 3VAKA 3CJBA 3EX7B 3O80A 4M3ZA 1NGBA 4A57A 3OTDA 2R42A 3MDQA 1Q1KA 1CG2A 1FKPB 1VQLN 3Q86A 1KONA 4WZQA 1U49A 4EYIB 4BE2A 2WUSA 2ACYA 2BQUA 1X4GA 2XMWA 2QWRA 2QX0A 1S72S 1HNVA 1YITN 3IG1B 1YBTA 5AFUA 2JEGA 5ETTA 5AQPA 3O3GA 4K59A 4ZLNA 4ECWA 3K9JA 2DFFA 3CFOA 2VBYA 2HKEA 4AYBD 2XB2D 3GWCA 3C3LA 4OPAA 2KVIA 3JQMA 1RAJA 2F4VF 1V4SA 3HD1A 4HUGA 4FOIA 5KT5A 1D9FA 4NASA 2LFVA 2DCUB 1FFGB 3K5PA 3KKFA 3ZSRA 3EDQB 1FRIA 3CC4N 2POKA 2HWIA 2L3MA 2IJFA 2DTUA 1K8AT 2VHGA 2Y1RI 4OI0A 2A3ZA 2PO4A 3RSEB 3TAQA 1FKPA 3TOQA 3CC2S 2HRYA 2QLJB 2JEFA 4QWCA 4CO1A 3MUMP 3KKRA 2J0WA 4M8LA 3J80Y 1TUVA 1YT3A 1P1TA 3EYZA 3K8WA 1GLFO 5GINA 3QIPA 3O9UA 1HX1A 4F2SA 2D41A 3IG1A 3R9LA 3NH2A 3KD5E 4JOUA 2P5GA 5BXIA 5T14A 1HLUA 2YI1A 3TJ8A 2QWMA 1QY7A 2RHSB 3BBFA 1DT9A 5AZJB 5CR4A 2ZVSA 3G25A 4OO1J 1UP1A 3BPDA 4ZTFA 3L3CA 4EP4A 4AHTA 4YS2A 3GFZA 2IA6A 4KV8A 1MN9A 3NWGA 2RF2B 2AEFA 3LPEA 2V2KA 1HWKA 4HTIA 5AQMA 3WQPA 3S3NA 5SWMA 3P4IA 1MG7A 4JI8F 4NRTA 3D0PA 1IG8A 4UUXA 5DQGA 3ELHA 2YJEA 2YWKA 3F5TA 3HJFA 3RSEA 1J9AA 4CVNE 2ZM6J 3E66A 4CBXA 2A6AA 1RUSA 2DISA 3HT3A 4OHXA 4DUZJ 4JI3J 1E6YB 4NCGA 4NX9A 2FZGB 5A6WA 1F2GA 4AL5A 5I42A 4PZVA 4LF5J 1ESVA 3QPIA 4KGMA 1HBUB 4MO5A 5BR8J 1CC8A 2BJDA 1OKJA 2NUBA 2IC3A 2GJFA 2CIMA 4ENOA 2VUGA 3EVOA 4JN4A 2D0CA 1YRUA 2P9CA 5KFEA 2KM8B 2KM8C 2BH1A 2ZH6A 1WWHA 2X1FA 5I3UA 3VAJA 3IUCA 1VSJA 1YX2A 4C11B 3ENVA 3OS0A 1TK0A 3OA9A 3G82B 4CCHA 4LF8F 3W7BA 3K17A 1IR2A 1ITPA 1VRUA 2DRBA 1YIJN 4OQJA 4RNMA 2HZCA 4NI2B 4M94A 3QRQA 2H4YB 3JAMU 4A2AA 2WB1D 4YFUA 1BI4B 2NNWA 3UD5A 3IM9A 1S79A 1Q7YT 4PY5A 3EE8A 1HBUA 1WC6A 3PYFA 3VQ4A 3IRWP 2D5RA 1B9FA 3MX2A 4CIEA 2B43A 3TUIC 3THXA 3JXUA 1YAGA 1RDWX 3A8YA 1U09A 3IA0A 4OYMA 3UIQA 1GK8A 4JD2B 3OYKA 3FLCO 3EO3A 3ZTPA 3LPYA 5KFGA 3ETMA 3EZUA 1C0MA 3AY9A 3G82A 3GFYA 4C8YA 4KHMA 2GHVC 5AQVA 2I9SA 5AR0A 2W6LA 4U7BA 2KJVA 2D3O1 2YWWA 1YSJA 2K2PA 1FEHA 1GAOA 4O23A 2H3GX 4X66F 4PXDA 3OPKA 2DR8A 1C0UB 3PKMA 5JLFA 3E9OA 8RUCA 3EY1A 4NLCA 4K4SA 5C42B 3BF3A 3CCES 4JI1F 4R0EA 5BR8F 5KAKA 4ID5B 3KNAA 4K4VA 2DGVA 3HTVA 1UL3A 2C3MA 2KRBA 3T1HJ 4MK7A 4UZCA 4W92B 5IV4A 5KGWA 4QQBA 3ICLA 2I1RA 2XMMA 4DF8A 1V5IB 1R8HA 2FPHX 1R0CB 3RBXA 3M2VB 2ITMA 3OTOK 3GCWP 1Q95G 2Z30B 2OEJA 1WSIA 4JD2A 2GNKA 3CCZA 5KPTA 3CCLN 2BJ1A 3AD9C 2E5LK 2UUBK 1NK6A 3H1VX 1WUAA 3P45B 4OMFG 3EUNA 5E33A 1NGGA 4M95A 4JYAK 2P9UB 3IMXA 1Q86O 3KG1A 3OL7A 1O51A 4LF6F 4AM6A 1S3XA 2HMIB 3EGWB 3SZ2A 3QAUA 3CMAS 5AQFA 5HQ8A 3P6YC 1R8AA 3FKBA 2F7TA 5LMUK 2KVQE 5C42A 3F44A 2CKWA 1KVKA 1AW0A 4LVNP 2ZH7A 4UY8T 1KAYA 1NNDA 5HP1B 4I6YA 4GKJJ 4ID5A 5KFFA 4PABA 4N76A 1B7FA 2HQIA 1ICEB 4WFBQ 3SCKE 1IBMF 3A13A 5KGXA 2AYGA 4Z4CA 2QWOA 7AT1B 3MM8B 1ZTWA 2YHAA 3ZNUA 3JQJA 4OZ3A 1N36K 4HDHA 4B9QA 5EX3A 2P9SA 3AXMA 1MSWD 1RADB 3TW0A 2B4PA 1NBEB 2BANB 3OSPA 5JVHQ 1JL1A 2IDOA 4Z0UA 3PW2A 3L3UA 3IGVA 4PWUA 1ZETA 1AB8A 3A3OB 4JV2A 3MN9A 2B7CB 1H7XA 3ET6A 3NCIA 2V8HA 3M3ZA 4PG5A 2KHCA 1P9QC 4B3MJ 1IG9A 3IFEA 4GW6A 1WB9A 2ASPA 4C1NI 3ATVA 2UUCK 3QYYA 2O8FB 1WSRA 4K4ZA 4DUYK 1ZZFA 1TVRA 4ZITA 3HXMA 1TL7A 4AQYJ 4BDZA 2GVDB 4QU6A 1S22A 3UDLA 1YJWN 4CJEA 3CTRA 3OYIA 2IPOB 1U6ZA 1N8RT 2XHBA 3DM2B 2Q43A 4DWIA 2ILZA 3TWHA 4I68A 2Q0UA 2EEYA 3DRPB 4LFBK 1BY9A 4NLYA 3HZ6A 2XLJA 4OFZA 2AWZA 3V1RA 1D8ZA 3O2IA 2YQ1A 1TKTB 2BANA 2R3VA 3ULEA 2J0SD 3LP1B 3Q24A 4I6MA 4A59A 3IBWA 1NJZA 4P2MA 3I0RB 1X0PA 1NSAA 1X4EA 4DCPB 4CIGA 5L39A 3B8HA 1B0VA 3L8BA 1MWKA 3HHEA 2IJRA 1FVSA 3HSJA 2ZKUA 1YLXA 5BPLA 3CJ2A 3QATA 4FOEA 4LSNA 1EX8A 3ZT2A 2YKNA 4DX5A 1KRPA 2NQPA 4GC7A 2F65A 2FIUA 1WHXA 2H9ZA 2N7CA 2VQFF 3ENOA 2O8FA 5B0EA 2AP1A 3JB9k 4Z7CA 2XSFA 4AHSA 1VBXA 2YKQA 1ZBHA 3CULA 3VA0A 4EO6A 4FPIA 1X4BA 1U1QA 4DLEA 4NA1A 1VGYA 4IO1A 3GL1A 5CXTA 2BABA 3DAWA 4JKDA 2DCLA 3BY5A 1G15A 3CJCA 3SLCA 5GAEP 4LH4A 3A3PB 5CYQA 3MM5B 5C24A 3I9V9 3DMJB 3I0RA 4QU7A 3ZYYX 5F3TA 4CZIA 2P6TA 4CFBA 5AQKA 5K5MA 4ED1A 4QAGA 3CJ5A 4RO0A 3SFGA 4W5TA 4JI5F 3AQOA 4I9LA 3BBCA 3NXZA 3KDOA 1CLFA 3T1YK 3PRBA 1VQNN 3DLLQ 3G86A 4MLEA 4IXCA 2JC0A 1U26A 1IKYA 4AQYF 1TMJA 2A2DA 1NKCA 1C1CA 3OYCA 2R7UA 4IO9L 4DR7F 1X9WA 5C25B 3VAGA 4AH9A 5HATA 2NXJA 4O3QA 2IJNA 1QAYA 2B4VA 5IWAK 2GV1A 1S9GB 1T3VA 1I94K 1F1BB 1WOPA 4CJLA 4FLYA 5AJ3J 3QJJA 2ZZNA 2DY4A 1H2TZ 4GRSA