1S1XA

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
553
structure length
545
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 137
structure length 545
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1xA05
1VSKA 3V4IA 5JUMA 2Z1IA 4EZ9A 3NGYA 2ALZA 4CJLA 4ED3A 4O3NA 2FVPA 4J9NA 2D0CA 5KG3A 3PVXA 4TN2A 3N6LA 2HHUA 3RMDA 3KLHB 4ED7A 4NLSA 4R0EA 1N4LA 4KPYA 4LQ3A 1JL2A 2HHVA 1UWBA 3KK2B 3KLEB 2QK9A 3GIKA 3K5NA 3NH1A 4HCCA 2NUBA 1QSYA 4TXSA 1RYRA 2G8FA 2BDPA 1S0OA 4FLXA 3KLIA 3G6XA 2XC9A 2JEJA 2VG5A 1HYSB 3S3NA 4OKKA 3P1GA 2IJFA 1WAFA 3ITHB 2RDIA 2XY8A 3IGVA 2J6SA 4CGDA 4DF8A 1L3TA 2FJVA 4K4SA 3KK3A 1L3SA 3TQ1A 3NBPA 4NLXA 4M94A 1W9HA 1IKYB 1J54A 4M3XA 1BQNA 4NLQA 2B6AA 2DFHA 3LPTA 4Q0BB 2JEFA 5CYQB 1KFDA 3G86A 4IQXA 4DSJA 2HNDB 2FLLA 4ZVEA 3LZJA 5T14A 3UDLA 3HVRA 3SUNA 4MQ3A 3Q8QB 2EC0A 4FJGA 2P1JA 2HHTA 2RPIA 5J1EB 5KG4A 3CDEA 3CJ5A 4FJNA 3NFAA 3RR7A 1JKHB 3QIPB 1TVRA 2V4QA 4HYKA 4FW1A 5KFZA 3HHKA 5E41A 3DLKB 4LH5A 2I1RA 4EP5A 3NH2A 4BDZA 1IKWB 1ZBFA 3OVNA 3BSOA 3OLAA 4O44A 2R8IA 5KT7A 4AH9A 4WZQA 2QV6A 3N6MA 4CF8A 3K5OA 1VRUB 1NNDA 3PR4A 5L1IA 3VQQA 2ASJA 2BGGA 4FJKA 1JLAB 5J1EA 3OY9A 5FDLA 5DMRA 4KHSA 5HROB 3UIQA 2G8HA 1VSJA 1EXQA 3TABA 1IKXA 3AVMA 5F8HA 1J5OA 4KFBB 1TV6A 4M3RA 3D28A 1JLFB 4CJ4A 1RT7A 3PX0A 4PUOB 2HNYB 1N6QA 5FRNA 2W7OA 3KOAA 4DQQA 1S1TA 4DSKA 2GIQA 4HUGA 3KK1A 2OPSA 3M8SA 2BRKA 4CIFA 4URQU 3ZSVA 4DG1A 3T3FA 3QEXA 4J9OA 1N48A 2XO7A 3LP3A 5D3GB 4K4WA 1X9WA 4K4TA 4CHZA 4DF4A 3NDKA 5KFVA 2W42A 2BRLA 4W5OA 3GV7B 2C2EA 2FBYA 2AU0A 4EEYA 4EYHB 1S1VB 1SV5A 3SFUA 2RF2B 5C25B 5F8JA 2YKMB 1TP7A 4RW4B 3IAYA 2F8EX 2BQRA 3QNNA 3T19A 3DYAA 2G8VA 4E7JA 5KG1A 4AHRA 4RW8B 2W9BA 1S1UB 4O4GA 1S9FA 3RRGA 3AVJA 3ZSRA 3ZCMA 4Y1DA 4M41A 4HUEA 5F8NA 3QIOA 4MKBA 5C5JA 2P51A 3K59A 1EETA 4DL2A 1GOCA 4B8CA 4O3PA 3I0SB 5SWMA 4Z4GA 5C25A 3ZSOA 3NCIA 3OYHA 2R8KA 1BCMA 4DLEA 1U4BA 1S9EB 1OS5A 1B9FA 3DRPB 3Q8SB 4ZVGA 4CIGA 1S1UA 4FJ9A 2VG6B 3P5JA 1MU2B 1JLGB 2B5JB 5I3UB 2IAJB 5KRSA 1TL1A 4GC7A 2ETJA 5FROA 4TYBA 1GX6A 1C1CA 3EY1A 1BI4A 3E51A 2X78A 2D5RA 2XWYA 4N56A 3LP0A 2JC0A 3VQSA 4DFJA 4ZPDA 3ZT2A 4FW2A 1C1AA 1CXUA 1NJXA 5KFKA 2D3ZA 4CK1A 5DLFA 3MEEB 4IR9A 2X6SA 4JRQA 3UQSA 2VG6A 4BACA 1KHVA 4MKAA 4RW6B 2IAJA 1NOZA 4O3RA 2Q3SA 2UVWA 4DQRA 3OS2A 4IRKA 4PWDB 1A5XA 4B9NA 4HHTA 3OL8A 1S0MA 3G0ZA 5KG6A 4KO0B 3RMAA 3T5HA 5KT6A 3AVBA 4OLAA 4J9LA 1ITGA 3BR9A 4C8NA 1D8YA 2AGQA 2G8UA 4DL3A 4ECRA 2XI2A 1Z4UA 5JXSA 2EHGA 3MF5A 1RT4A 4KV8B 3H98A 3V6DB 2VWKA 3PHEA 1S9GA 3BQ1A 1ZETA 3V1OA 2D7SA 2R7YA 1KLNA 4DSIA 4W5RA 4DU3A 1S49A 2RDJA 4OLBA 5EUHA 1Y97A 1SH3A 2VG7A 2RKIA 4DL6A 4DTMA 1T03B 2HHWA 4CJ5A 3CO9A 1K6YA 3CJ3A 3O3FA 1VSLA 1L3UA 4FJIA 1UA1A 2HHXA 3RB4A 1TK8A 3DLGA 1BQMA 3ISND 4ZVFA 5I42A 2ATLA 2Y1JA 2UUWA 2OPPB 3QERA 1HMVA 3DRRA 3VQEA 4WE1B 1D9FA 2HMIB 3HKWA 4ZHRA 4FYDA 1IM4A 3ISNC 4QWCA 4DSEA 1B9DA 1ZTTA 1RT3A 3VA3A 4MK8A 1TKTB 3MECB 2BE2A 5CY4A 2KFNA 3OYEA 2IC3B 4TQSA 1KVAA 1X9SA 1S6PB 4IDKA 4ZP9A 4CEEA 3K58A 3FDSA 4KB0A 3VN5A 3K5LA 4JUZA 3LP2A 5KFJA 2F96A 3BQ2A 2IM1A 3HJFA 4CJFA 1JLBB 4FJ7A 5F8GA 4Y2CA 3T5JA 3L2UA 4UQGA 1RBUA 4KAZA 1VRTB 2WONB 4WFXA 3D45A 4Q8EA 4E7HA 3RMCA 1QSLA 2YNGA 4FM2A 2IC3A 3KIOA 3VQ9A 4WFZA 4B8AB 1K1SA 4R8UA 2HW3A 4QWBA 4FZYA 1TKZA 3SI8A 1EX4A 2WB4A 2JGUA 1L3VA 3CQ8A 2X74A 2W9CA 4ZTJA 2ILYA 2KTQA 1HQUB 3QO9A 4IG0B 4RW9A 5HRNA 4CHNA 4Z4FA 5T7BA 2LSNA 3DRSA 3HVTA 1JX4A 1RBSA 1T3NA 3IGNA 3O3HA 3H5UA 2ASLA 2IS3A 1MMLA 2C2DA 3SFGA 4GW6A 2IBKA 3MR2A 4ICLB 3SV4A 3MEGA 1UOCA 1XC9A 4NYZA 5KFSA 3F73A 1HPZA 4Y3CA 2CKWA 2VWJA 3CFPA 4ID5B 1VSFA 3NF6A 4M3WA 3VQBA 2X6NA 5DG8A 4IH7A 3QNOA 4DU4A 3KD5E 2BANA 5KG0A 2DPIA 1RT6A 1RTDB 5L1JA 2R2RA 1S48A 3RBEA 4ELTA 4R5PA 2YNHB 3KD1E 3TAMA 3MXJA 3V4IB 2UVUA 4CJUA 3PJWA 4ED6A 4JLHA 3V1QA 4CHPA 5DLGA 3KMSA 2D41A 2AX0A 1YT3A 1HYVA 2FLNA 5L1KA 1GOBA 5C42A 2D0BA 4BDPA 2QKKA 3LWLA 2FC0A 3CDWA 3PW7A 1I6JA 4NZ0A 4CGGA 1FK9A 4F4KA 4K4ZA 2XY5A 4AHVA 3L3VA 4YR3A 3C95A 4DFMA 4IH6A 5KTQA 3V6KA 1RCHA 1KVCA 2HWHA 4ECVA 1UWBB 3AVHA 4KTQA 4FLVA 4KRFA 4M3UA 4E1NA 1TL3A 5HBMA 4QWAA 3DMJA 1FKOA 4Z0UA 3C6TA 4J9KA 4Z4HA 1YTUA 3OL7A 3VA0A 5EWEA 4K4YA 3KLIB 4MK9A 4K4UA 4CFCA 1LAWA 3FFIA 2VG5B 3VQ6A 1X1PA 5F8LA 4NLVA 2E9RX 3LWMA 3CJ4A 1RNHA 4FBTA 4B9TA 4H4OA 4KTWA 1VSMA 4ED8A 4J2AA 2V0NA 1QE1A 4XO0A 3KK3B 4RG8A 3NBPB 4RUCA 3ZSYA 1SH0A 2YHAA 4DQIA 3QGGA 4CJRA 1BQNB 2A1SA 1RT5A 1U48A 2G8IA 3NGDA 2B6AB 3T1AA 4HTUA 3DLHA 1WAJA 3H5SA 3MXIA 3AO2A 5HP1A 3DLRA 4LQ9A 1TK0A 4ECQA 4DL4A 1S1XA 3OSNA 3ZT4A 4CJKA 4W5NA 4ECWA 4I2QA 4DLGA 1C0UA 2J6TA 3V81A 4FJJA 2O5DA 4DTNA 4N76A 4EP4A 1TVRB 4DL7A 4KI6A 4DSFA 3TARA 2FVSA 2E4LA 4MFBA 4O44B 4J2BA 3MEDA 2E9TA 1RBVA 1HJRA 3CYMA 4FS2A 1TKXA 2FVRA 3DM2A 4E1MA 4Q5VA 2ZD1A 2QXFA 1REVA 1I39A 4JS5A 4ZP6A 4C8LA 5KFMA 3EZUA 3MTKA 1NK6A 4ECXA 2R8GA 3NH0A 5HRPA 5FDLB 3MR6A 3BDPA 3LZIA 4CF2A 5J2MA 1IKXB 1C6VA 1J5OB 1W25A 4MH8A 4OKEA 1TAUA 1TV6B 3WNGA 3UPFA 1RT7B 5CYMA 5C24B 1JLQA 1N6QB 3CFOA 1S1TB 1ZYQA 1B92A 3PW0A 4CJSA 4F4WA 3KK1B 2OPSB 3SQ0A 1YVFA 2XY6A 4B3OA 4LSLA 3KHRA 4ECUA 4CF9A 4DG1B 4YFUA 1UA0A 4JV0A 4KBIA 1YVUA 3K2PA 3HVAA 1DTQA 1C1BA 1WNEA 1S6QA 4KKOA 4NCBA 5CZ2A 1WSEA 2OPRA 2XCAA 4F2SA 3LALA 4URGA 3OYJA 2IM3A 4MIAA 4CJQA 1IH7A 5C24A 4YP3A 4EYIB 2ZKUA 3KKRA 4FLUA 5KFEA 2FLPA 1S4FA 4J9QA 4CGJA 4IFVB 2AQ4A 4QW9A 3G6VA 3K57A 1SV5B 1WSIA 4DWIA 4NRTA 4KTZA 1SUQA 4O3QA 5KFOA 2FJWA 4O5BA 3JYTA 3QEIA 3DYAB 4DTUA 4FXDA 4CJPA 1S0NA 4KHNA 3L2VA 1ZBLA 4ZTFA 2W9BB 3HO1A 1XHZA 4O4GB 1S1WA 4CECA 1FKPA 4NCGA 4IH5A 4WXOA 1XR5A 5F8IA 4ECYA 4J9MA 3AVAA 1SKSA 1KRPA 4J2DA 1D0EA 4IFVA 1EETB 2YV0X 4CK2A 4DTRA 3SUPA 1Z26A 4BE1A 4MIBA 4NYFA 2CJQA 2JEIA 3NKYA 3M9MB 1WLJA 2WOMA 3TWHA 2DTUA 3OYLA 1C0TA 5KT2A 4NLDA 2ILZA 5J2NA 1BIZA 1TL1B 3DI6A 4AILC 3CJ0A 1N56A 3OYFA 1ZBUA 2R8HA 3DOKA 4KB1A 3MFHA 4TLRA 1C1CB 3LAKA 1BI4B 3ZSQA 3LP0B 3B6PA 4WFYA 5KI6A 5EWFA 1KLMA 1J53A 2Y1IA 4AHTA 4KI4A 2C2RA 3SUQA 4I9QA 4G3IA 4C8KA 4E0DA 1NKEA 4OJRA 4YNQA 1TQLA 2IA6A 4FLTA 3F9KA 1F21A 4E89A 4RNOA 4FJMA 3AVGA 3H5YA 3L8BA 5KG7A 1WSGA 3PW2A 1RTHA 4KHWA 4EBCA 4C8OA 4RNFA 2HB5A 1RT4B 1XR6A 3VQ7A 4TY8A 1NK8A 3AVCA 2ZE2A 1JLCA 1LAVA 1GX5A 4XPEA 5HLFA 3TAEA 1HQEA 4QWDA 1S9GB 3RB6A 3LAMA 3I8DA 3HPGA 4DTSA 2HNZA 3WNEA 5KFGA 3BSNA 5JS1A 3TAGA 1HNVB 3UR0A 4B9UA 1RT2A 3AVFA 3DOLB 3M8RA 3KNAA 4KSEB 4CJTA 1U47A 4Q45A 4L8RB 2VG7B 2RKIB 3QIDA 1U04A 1RDDA 2W9AA 3SCXA 1HARA 4EO6A 1JL1A 4QCLA 3ZT1A 3KHHA 1UAXA 1EP4A 2E6LA 4HCBA 2ATQA 1GOAA 3HPOA 4U7CA 4NLOA 3E01A 3BGRA 3IG1A 2WRMA 5KT3A 3VQ8A 4DS5A 3DLGB 3PJXA 1BQMB 4HUFA 5I42B 5KT4A 1HMVB 1HNVA 4DFKA 3ZT0A 3DRRB 1QHTA 1DLOA 3DOLA 4BWJA 4N41A 4FZXC 2IM0A 4O0IA 3U3GA 1ASUA 3BSAA 3QINA 4ZHRB 3I0RA 2GBZA 1U49A 4IRDA 3EPGA 3BREA 2XY7A 3KJVA 2XCPA 2AX1A 1HYZA 1RT3B 4OGEA 1CZ9A 3OHAA 1VK0A 2BE2B 2I5JA 4U6PA 3HM9A 1U45A 4IDKB 4Z4EA 4KHMA 3SPZA 3NF8A 3M8QA 4F50A 3PX4A 3LP2B 5KFPA 1NHUA 1TKDA 3GV5B 5KFFA 3C6UA 3RAQA 1SKRA 3BSCA 1WSFA 2ZQBA 2ASDA 2PY5A 1WN7A 4ID1A 4BE0A 3RAXA 3PUFA 2IOCA 3Q8PB 3SQ1A 3A2FA 2AWZA 1NOYA 2YNGB 1ASVA 4J9SA 1K1QA 4H54A 1NHVA 3GIJA 3AVKA 4R8UB 3V9WA 4CJVA 1TKZB 1X9MA 1IKVA 4M45A 4CFAA 4NLUA 4NRUA 1VSHA 4LY7A 4F8RA 3NF9A 2WK4A 2W9CB 4H4MB 3U3YA 4FK2A 4FJHA 3QGIA 5K14A 3OSPA 3TAPA 3QO9B 4RW9B 4KHUA 3SYZA 2VA2A 1JIHA 2JLEA 3QZ7A 3DRSB 1KSPA 3HVTB 4BDYA 1BHLA 3OS1A 4LH4A 1RA6A 3QETA 4M3ZA 4B08A 2JEGA 3AO1A 4CHQA 4PA1A 3MEGB 2XRIA 4Z4IA 2DPJA 2UUTA 1LWCA 3QEPA 5KFDA 3SNNA 3JSMA 4DEZA 4JS4A 1HPZB 3PO4A 3PZPA 4H4MA 1BCOA 3HVWA 5JS2A 4KB7A 1R0AA 4ZPCA 1U09A 1HNIA 4Q8FA 4E7KA 2BANB 3QLHB 1TGOA 4M95A 4XPCA 3HSTB 4ED1A 4DMNA 2Z1GA 1BIUA 2WHOA 4CFBA 4YQWA 4B9SA 1RT6B 3OL6A 3CM5A 5J2QA 4R5PB 4NLRA 4FCYA 4ZP8A 4BWMA 3TAMB 5KFUA 5DG7A 3O4NA 4BE2A 2YNFA 3FSIA 3OYKA 4DTXA 3VQPA 5DGAA 2OA8A 5HRRA 5C42B 1XI1A 1CSJA 3TVKA 3M9NB 4M42A 2KFZA 3GIIA 3QLHA 1FK9B 2EX3A 2XI3A 1BGXT 5SZTA 2GUIA 1NK4A 3KLFA 4KAIA 3L3UA 3SPYA 4PQUA 3TANA 1NK9A 1TL3B 1IO2A 3AA3A 5HBMB 3KKSA 4OKJA 3DMJB 2R2TA 1FKOB 1LW0A 2GC8A 4E7LA 4RW7A 3C6TB 1J9AA 3HP6A 3IRXA 3HYFA 3M8PA 4KHRA 4DSLA 2OPQA 3I5AA 3V1RA 4IOBA 4QPXA 4W5QA 3FFIB 2YNIA 1NK5A 3RB0A 5J2PA 4JV2A 1RTIA 3GQCA 4N47A 3NAEA 1VSDA 3KLGA 4H4OB 3VQ4A 1LW2A 3AO4A 3NE6A 1RT1A 3QGHA 4G1QA 3EYZA 4CEZA 1QE1B 4CEAA 1ZTWA 3HK2A 3CM6A 4HKQA 4ZVHA 4J9RA 1JLEA 3S3MA 5KFYA 1LWFA 4FK0A 1RT5B 1KTQA 4AHSA 4GC6A 4LSNA 1D5AA 3AA4A 5HP1B 3MR5A 1NK7A 1SL0A 2PYLA 3NF7A 1I3AA 1S1XB 3ZSXA 1O1WA 3RRHA 4KREA 1RTJA 3DLEB 1RAJA 4RNNA 2DY4A 1LWEA 1A5WA 4DTPA 2F8TA 3BQ0A 4I2QB 3SV3A 1WSHA 1C0UB 3V81B 4K8XA 5EDWA 3NHGA 3RBDA 2D0AA 1WNSA 3O4QA 3OYCA 4OVLA 1N5YB 2F8SA 1YTAA 3H59A 3V6JA 2KQ2A 4MFBB 2QE5A 3MEDB 3TAFA 4B9LA 1TKXB 4CESA 2FBXA 3DM2B 5DQIA 2ZD1B 1REVB 2YKNB 3DLEA 3OJUA 4Q43A 2A1RA 3KLHA 4FVMA 4O55A 4NYNA 4ECTA 2IGIA 1RBTA 3QYYA 5J2MB 4ZP7A 3RB3A 1N5YA 2P5GA 5FRMA 3MXMA 3HT3A 3KK2A 3KLEA 3LDSA 2Z1JA 1T8EA 4FJ8A 3K5MA 2OYQA 2XGPA 5CYMB 1JLQB 1S10A 2FJXA 2C28A 1CZBA 4C8MA 2YKNA 4RUAA 1RBRA 4B3OB 5KFHA 4LSLB 5KT5A 1VSEA 4IFYB 3PW5A 1T94A 3B6OA 1HYSA 5KGXA 4JRPA 4CCHA 4J2EA 1JXBA 4O4RA 1DTQB 3CWJA 2HVIA 1C1BB 2FBVA 3ITHA 3H5XA 3OL9A 4O3SA 1S6QB 4KKOB 1ZBHA 3AA5X 3HP9A 2AJQA 3KHGA 2OPRB 3EPIA 4F4XA 4FJ5A 3AO3A 4N5SA 5KGWA 4FLYA 4FBUA 3ZSZA 3LANA 5L1LA 3L2RA 4F2RA 3KHLA 1Q9YA 3I5CA 3RWUA 1IKYA 1SKWA 3L2WA 4NLYA 4IFYA 3D0PA 4CE9A 3OYNA 3TR8A 1CXQA 1ZBIA 1SUQB 4Q0BA 5CYQA 3T5KA 3JYTB 2HNDA 3AA2A 2G8WA 2FBTA 3PW4A 2BQ3A 4CJEA 4X2BA 1S1WB 1RDBA 2HHQA 3PV8A 1FKPB 1IG9A 4NCGB 3PR5B 1L5UA 3OYBA 4EBDA 1JKHA 3QIPA 5KFNA 2AGOA 4QOZB 2KZZA 3DLKA 3ZT3A 3T5LA 1JXLA 5DG9A 3GILA 1IKWA 3MR3A 2IM2A 4AHUA 2W8KA 4ED2A 1VRUA 4DL5A 3DLBA 2WOMB 4IG3B 4I9LA 1C2PA 2P5OA 1C0TB 1A5VA 3RR8A 2J6UA 1KHWA 1JLAA 4FLZA 4M3TA 4CF0A 5J2NB 3DI6B 4ZMMA 5HROA 3TAQA 3NL0A 4F3TA 2FVQA 3THVA 4YR0A 4CHOA 2GIRA 4I7FB 2B4JA 3DOKB 4Y1CA 4CJWA 3OS0A 4AHCA 4QWEA 3SZ2A 3C94A 4KFBA 4ELVA 3QESA 1XWLA 4DTOA 1JLFA 5EU7A 4EO8A 4FM0A 4PUOA 1Q9XA 2V4RA 2OZMA 1KLMB 2HNYA 4IG3A 4F4ZA 4FJXA 1D9DA 4CGIA 3QZ8A 2BR0A 3LP1B 3V6HA 5KRTA 4Z4CA 4Q44A 1QUVA 3H40A 4OL8A 4I7FA 5KFAA 3GIMA 1Z25A 4CHYA 5D3GA 1Q8IA 1KVBA 2E6MA 4E19A 3NGZA 4TYAA 4FK4A 1W0HA 1RTHB 2O4IA 2O4GA 2PYJA 3OLBA 3ALYA 3QEVA 3FQKA 2QKBA 2W7PA 2XGQA 3G6YA 4CGHA 4K50A 4TY8B 2D3UA 2B43A 2R2UA 4K4XA 1S1VA 2OZSA 2ZE2B 3LP1A 1JLCB 2RF2A 5DQHA 3PX6A 2WTFA 5HLFB 1HQEB 2YKMA 4RW4A 4CJ3A 2HWIA 3VQAA 4E7IA 3AVLA 2HNZB 4FLWA 5KFWA 4NLWA 3SQ4A 4RW8A 4PY5A 1RT2B 2ITGA 4QW8A 4I2PB 3AV9A 4IRCA 1QQCA 1QAIA 4TY9A 4CEFA 4MK7A 3DDKA 4CERA 3V9XA 2HVHA 3ULDA 3AO5A 1EP4B 3I0SA 4YMEA 3U6FA 3E01B 3BGRB 3IG1B 4IKAA 4TSXA 1FXXA 3Q8RB 3ICLA 2RN2A 2WCXA 4ELUA 3QEWA 1S9EA 3DRPA 2KW4A 4KHYA 4B9MA 1DLOB 4ED0A 5KFLA 3PY8A 4I2PA 2KZMA 1MU2A 5KFXA 1JLGA 2B5JA 3NGIA 5I3UA 3OYMA 1KCFA 3I0RB 4RNMA 1WSJA 3KJVB 3NAHA 4LD0A 5DQGA 2UVRA 1C0MA 2I5JB 3CG7A 3OHBA 4DS4A 4O3OA 3OYGA 3H4BA 2IDOA 3M8QB 3VQCA 3BJYA 3FQLA 4IBNA 3LPUA 3NMAA 3MEEA 4WZMA 4ZPBA 1S5JA 2IMWP 3C6UB 4URSA 4NLPA 4RW6A 3WNFA 5F9NA 1CLQA 4CEDA 2GV9A 1NJYA 3ZSWA 3HL8A 4PWDA 2XHBA 4WXWA 4CK3A 3GV8B 1HRHA 2DFFA 4KO0A 5KG5A 1RDAA 3SI6A 3SUOA 3IS9B 1NJWA 3H2LA 4CIEA 2AGPA 3H08A 4RZRA 1IKVB 4FJLA 3CDUA 1LV5A 4F3OA 4WYWA 5K14B 4CEQA 4RNHA 3AVNA 4KV8A 1S97A 3V6DA 1JXEA 4EZ6A 1BL3A 3OYIA 2HHSA 3PO5A 3D5MA 4B9VA 1RYSA 4TQRA 4OPJA 2G8KA 4NLGA 5KFRA 3IS9A 4YR2A 1ASWA 4GMJB 4FZZA 2VA3A 3KLVA 1T05B 3SJJA 1LWCB 5KG2A 3CVKA 3O3GA 1T03A 3JSMB 4NCAA 2Z1HA 4CFDA 4IR1A 1QTMA 3L2QA 4RU9A 4FS1A 1R0AB 5KFQA 2R2SA 3HXMA 1KFSA 1HNIB 5DK5A 3V9UA 3CIZA 1D1UA 1NJZA 3I5BA 4W5TA 3RTVA 4CGFA 1T7PA 5J2QB 2R8JA 2OPPA 3OYDA 4ECZA 1TK5A 3HPHA 2DFEA 3S9HA 4WE1A 1SL1A 2C22A 5KFBA 5EWGA 2IJNA 2YNFB 2BQUA 2HMIA 1NKBA 4HVJA 1T05A 1BISA 3VQ5A 4CEOA 4XIUA 1TKTA 3MECA 4WYLA 5F9LA 4CEBA 3V9ZA 1S6PA 1SH2A 3IN5A 3KTQA 3KLFB 2HAIA 2UVVA 5HRSA 1QS4A 3OYAA 4PQUB 1QAJA 4DQPA 4CF1A 5F8MA 3S3OA 1XHXA 3TI0A 1LW0B 1NKCA 4RW7B 3GYNA 1EKEA 1JLBA 2E9ZA 4IKFA 3IRXB 3WNHA 3FRZA 3M8PB 3VQDA 3RMBA 1VRTA 2OPQB 1NK0A 4DQSA 2WONA 1TAQA 4OGCA 2YNIB 5CZ1A 1RDCA 4GVMA 2FVCA 4M3YA 5J2PB 1RTIB 3KMQA 5DGBA 4QAGA 3KLGB 4JV1A 3CJ2A 4O0JA 1LW2B 4F4YA 4Y2AA 4KHQA 2YHBA 4H8KA 1DTTB 1RT1B 1XR7A 1HQUA 4G1QB 2W8LA 3ASMA 4IG0A 4E3SA 4NLTA 3M9OB 3EZ5A 1SL2A 2V9WA 4K8ZA 1JLEB 2JC1A 3V9SA 1LWFB 5L9XA 1RILA 1G15A 1VSIA 3AVIA 3OJSA 3MAQA 5KFTA 3CFRA 5KFIA 4KE5A 4J9PA 4LSNB 4DFPA 1RDRA 4ECSA 4OPKA 3P83D 4DTJA 4ICLA 4EBEA 3N6NA 4DU1A 1RTJB 4K4VA 1QSSA 1RA7A 1LWEB 4ID5A 2PZSA 1DTTA 5KFCA 3H4DA 2OH2A 4Y34A 3NAIA 4ZPAA 1RTDA 3SQ2A 3G10A 4FM1A 2YNHA 3MFIA
chains in the Genus database with same CATH superfamily
3H7HB 2RT3A 5JUMA 4DHYA 1DEJA 1VQMS 2FVPA 2UXBF 2NYHA 5D4PA 1GLBG 4FOIA 3N6LA 4EK2A 1N33J 4P72A 2OI2A 4ED7A 2EWHA 4OIXA 5E3RA 2Q66A 3VEZA 1CZAN 3ZEUB 1GNKA 3CC4N 4IXCA 1LK5A 1JL2A 3M5RA 1UWBA 3KG4A 4A8KA 3M8ZA 4M5JA 4DHVA 2JLGA 3NH1A 3VESA 3H0PA 2QYCA 3GYGA 2RU9A 1KVKA 1S0OA 4OJHA 2LXUA 4JKGA 2CJ9A 4E2FB 2YH0A 4A47A 4PWWA 1HYSB 3W8PA 4U7BA 2W24A 1WAFA 2UYTA 2ASYA 4YB5A 2XY8A 2JVOA 2J6SA 1AB8A 4DF8A 1L3TA 1WEXA 2FHOB 2J7KA 1VBXA 4JI8K 1NDLA 2NXEA 2ZKTA 3FVYA 4UF4A 4M94A 1VQOS 2B6AA 4J91A 3C6AA 2XMKA 3M2RA 1X5TA 2UXDF 5T14A 3UDLA 3OUYB 1B0VA 3SUNA 3M32A 2FTRA 1VLYA 5A8KA 1ULRA 2DKOB 2HHTA 4USJC 3SMZA 2XEXA 2DIUA 5HATA 3AHPA 1BWFO 2D3O1 3NFAA 3S8SA 1JKHB 4M5GA 2WFBA 4FW1A 3CETA 1ROFA 4CLZA 1F2HA 2I1RA 4PL7A 5H1SQ 1ZBFA 1REGX 3OVNA 5C2CA 4WZQA 3N6MA 4CF8A 4JD2B 1NNDA 3PR4A 1AUSL 1P9YA 1HI8A 2BGGA 4FJKA 2K1RB 1DZ5A 1NAQA 1D8ZA 5DMRA 2R3VA 3K8VA 4YB6A 5AQNA 4B1YB 1VSJA 1HR0K 4KFBB 2MKSA 1PAEX 3R7BB 4M3RA 1IR0A 1RT7A 4NYPA 1N6QA 5AZIA 1UJ5A 1B70B 5FPNA 2ASOA 2HIYA 3M8SA 4CIFA 5T41A 3N79A 4B3RJ 3U1LA 1IR2A 3QRPA 4L6V3 2J76E 4UY85 5F0WA 3CCRS 4DV3K 1U1MA 3E9OA 1HNXF 3QWUA 1N48A 2XO7A 4DV3F 1LNQA 1X9WA 1FDBA 1NH7A 3NDKA 5KFVA 2BRLA 2KJWA 4YOUA 3GV7B 4OMFG 2HSEB 2FBYA 3JQKA 3LPYA 4LF9J 4HACA 1SJRA 1QHAA 2WSFC 4DR4F 1S1VB 2GO8A 2HOEA 2NZTA 1QZ6A 4IQMA 1YJWS 1RZMA 2G8VA 1FNXH 3MAAA 5GAGP 1VOMA 4ZLPA 1HWJA 1NLVA 4RW8B 4NA2A 4FWPA 2FHJD 2VPXB 3R6GB 1SS6A 2BKPA 1CQMA 2V51B 4GKJJ 4Y1DA 3N28A 3OQ2A 2PI4A 5D0EA 1EETA 5SWMA 3CJSA 4Z4GA 1K8KA 2E1AA 3KUGA 1JXVA 1Y5LB 1EQYA 1PKUA 1VHXA 3LDOA 4IFEA 2X1FA 1BCMA 3DRPB 4DN9A 2I7PA 4FPIA 2O3DA 2VQFK 1EB0A 4AXIA 3MM8B 2B5JB 2O01C 5I3UB 1B7FA 1Q16B 2ETJA 4AD6A 3H6EA 1BI4A 3A5MC 2ZHAA 3HF5A 1DARA 3BO2A 2UXCJ 1Q8KA 4C4WA 3FEXB 5ADXH 4ZPDA 7FDRA 3ZT2A 2CQBA 3SAHA 5DLFA 3CCES 5HQ8A 1UFWA 4IR9A 4JRQA 4JI7K 3CHWA 1NGGA 4RW6B 2X3GA 1ATRA 3OS2A 4OPHA 3UN3A 4FVCA 4PAAA 3G82B 4HHTA 4U67L 1S0MA 3G0ZA 4KO0B 3FMWA 5A76A 4HDGA 1HKBA 2YHYA 1HWUA 2B9XA 1B0TA 1NLKL 1D8YA 4OZ5A 3UCUP 4OX9J 2NRZA 1GLDG 3LA0A 3TJAA 4BRKA 4IJNA 1A6LA 3QNWB 1VQNN 4S0MA 1RAEB 2VWKA 5AXNA 1S9GA 1QAXA 3BQ1A 5L38A 2YKPA 3QT6A 2R7YA 5AE3A 3T6JA 1GMWA 5JLFA 1S72N 2C2OB 1S7IA 2V2ZA 4DL6A 3CDBA 2W2OP 4PKHA 4CJ5A 1RCXB 1K6YA 4LF8F 1L3UA 3KJNB 1F9EB 1OIAA 1UA1A 2HHXA 5AZJA 2W4PA 1QM9A 3FE1A 1X9JA 2EFGA 1NB7A 2APOA 1FHTA 2Z2LA 2UUWA 2OPPB 3NMRA 1FX2A 3EE9A 3EL2A 3DRRA 5L39A 4IDHA 4WE1B 1D9FA 1TU0B 1Q0NA 2XLJA 5AQKA 4QWCA 4KYZA 1ZTTA 1ZPVA 2BE2A 3SMPA 2IC3B 4TQSA 1HNZJ 1S6PB 1V4SA 3FLCO 1C4AA 4FF3A 3K58A 3FDSA 2ZFHA 1R31A 5KFJA 2F96A 3NVKA 1RWWB 1S79A 1X4FA 1YJ7A 5IM0B 1JLBB 5C2GA 2CQ1A 5F8GA 3HLUA 2KO1A 1VGYA 1T11A 4QIEA 2YNGA 1J5EK 1U6BA 2IC3A 1IWGA 3CCWA 2N7YA 1K1SA 3BZCA 1PC5A 1TKZA 3HBTA 2MYFA 1J5EF 4KIAA 2WB4A 2ZBIA 4CJ7A 3QPIA 2EWSA 2DNNA 2JDJA 3ZYYX 2KTQA 3QO9A 4LF7J 4CW7B 4KGVB 1FJGK 4KH5A 3O2IA 1JX4A 1FJGF 1T9WA 2HQFA 5IC6B 5AQPA 2IS3A 2BW7A 2CPZA 3D1QA 2RNEA 3SFGA 4D3HA 2AP1A 4GW6A 2VBYA 2DXDA 2E5LJ 1KAYA 3RJMB 1MWYA 3MEGA 3AY0A 1FCAA 3F73A 3CD5A 2KM8B 2VWJA 3NF6A 4ZKAA 4M3WA 1WUUA 2MKJA 4MYTA 2BZ2A 1KQFB 3JTOA 3KD5E 1Q95G 5M1KA 1XBWA 5L1JA 5F2RA 2HS0A 3CCLN 2FD2A 3J7Z5 1X3MA 4R5PA 3J80O 4IO9Q 1BMQB 3PJWA 1FWKA 1KD1T 3N0VA 4FP9A 1HYVA 3IBCB 1GOBA 2KB2A 4BDPA 2VWBA 4J37A 2OFGX 3CDWA 3ILJA 3PW7A 2FHKA 4EU0A 1FK9A 2G0CA 2XY5A 1F5BA 3JB9k 3J81U 4OO1J 3O6QA 2ZH4A 5KTQA 1VLOA 1RCHA 4PPZA 2HWHA 4USMA 1SQKA 5B0FA 4A48A 4KRFA 4F25A 4E1NA 3M6UA 2PFFB 3ZTSA 4C8YA 3DMJA 4N8NA 1NJIT 1YTUA 3A5NC 2E20A 2DYAA 2RIJA 3DXKA 1LAWA 2WVEA 2ZBQA 2M0GB 5F8LA 5HL7L 4PG8A 4H0YB 1NGJA 2GWKA 3ZNUA 4C3LA 1GEHA 3UVJA 3W2WB 4IOAL 5HO4A 3CCJS 3ZSYA 4N7TA 1KKHA 5HJYA 3EGNA 1BQNB 1T3OA 2Y9HA 4H4KC 5BYQA 4OZLA 3DLHA 1WAJA 1TL4A 1W97L 1R7IA 4CDIA 2KVIA 4JYAJ 3ZT4A 2Z56B 4CJKA 1EKRA 4BR0A 4I2QA 2DHXA 4DLGA 3RSEB 3V81A 3RW7A 4X66K 2NPFA 5A2QU 4N76A 4X62K 3HM8A 2ZJQL 4X66F 2GHWA 4X62F 3TO8A 4HTJA 2CZVC 4MFBA 4O44B 1TL7A 3CYMA 2B7BB 2FVRA 3DM2A 2ZD1A 2KI2A 2QXFA 1I39A 1NK6A 3IRWP 5BRDA 1UMJA 2R8GA 1IKXB 2K3KA 1J5OB 2HWTA 1W25A 1TAUA 4YY3K 2D9PA 4OQJA 3UPFA 3A4TA 5C24B 4DPYA 1DURA 3CFOA 4YY3F 2ZJRL 3D6MB 3LPEA 1S1TB 4YOYA 1B92A 3ISZA 4F4WA 3KK1B 2XY6A 4A2BA 1UP1A 3VAMA 3DU5A 3BYRA 2GVDB 2NRXA 4ZLJA 4DV5J 4DR1J 4KBIA 3ATVA 4LF6K 3HVAA 2DD8S 3OR1B 1S6QA 4LF6F 1U25A 4YHHJ 5M1PA 3BS9A 4NMLA 5C24A 4UOFA 1MN9A 3QATA 2FLPA 1S4FA 2O8BA 1YGYA 1URNA 5LMNK 2E66A 4A8YA 4QW9A 4LJMA 3K57A 2BM1A 1VQ5S 1SV5B 2QYGA 4MO5A 3W3DA 4KTZA 1SUQA 3MUVP 4O5BA 2QFIA 3QEIA 3DYAB 4DTUA 4F9OA 4CJPA 2EXUA 3L2VA 3QBXA 4F0KA 4QBUA 1S1WA 1XR5A 1WEZA 4A5AA 1SKSA 2FUG9 2YV0X 2OKQA 4OYIA 4CK2A 4GRSA 4BE1A 4WKYA 2MLYA 2CJQA 4MDAA 1Z2LA 2JNJA 1VQPS 2A2DA 1NM1A 2WOMA 1XNQJ 3TWHA 2DTUA 4BRLA 1C0TA 4N77A 1UVLA 3T1HF 2RVJA 1TL1B 3DI6A 3OPKA 1N56A 3IFEA 4KB1A 1C1CB 3LAKA 3PTWA 2FJEB 3LP0B 4C3KA 5E5NA 3T41A 4X4OA 5EWFA 3NY0A 5KQDA 4DOZA 4KI4A 1HHQA 2C2RA 5TKWA 4XEIA 2CAJA 4CLLA 1AXQA 2RUGA 2J9CA 4P10A 5IOLA 5K8OA 1NKEA 4OJRA 2IA6A 1EWRA 1KD1O 3TA1A 4DV4J 5AQFA 1WSGA 4KHWA 4C8OA 2CPEA 1EZZB 1WC0A 2HB5A 3D9BA 1RT4B 3M30A 4GV6A 3AVCA 1CULB 4QWDA 4B1ZA 1U2VB 3PIPL 2DH8A 3N5FA 5JS1A 1U2CA 2NRVA 3AA9A 3UR0A 4B9UA 1NJIO 1WSVA 3M8RA 3D2EA 5IS2A 4KSEB 4Q45A 4L8RB 2VG7B 2WVDA 5E7OB 1Q1KA 1S99A 2X51A 3ZT1A 4EWTA 5BXIA 2J7WA 1UAXA 1EP4A 2E6LA 5GAGU 3HPOA 4NLOA 6AT1B 3G71N 3IG1A 1S6OA 4A8XA 3VQ8A 3JXOA 5BPNA 3PJXA 1BQMB 4ILMA 3BZKA 2G0IA 2CFXA 5I42B 1GLLO 5KT4A 3MURP 1HMVB 5H9EK 1VQKN 1F9HA 4BWJA 5JMNA 1IBKJ 4KQZA 4N41A 4FZXC 2IM0A 3NVMA 1NBEB 3D6RA 3E8OA 3UFCX 4CZGA 2Q43A 4ZHRB 4NB4A 3EPGA 3UNGC 3R8YA 2DGWA 1FO1A 1VK0A 1N32F 4M7XA 3MHYA 1G6BA 1PG5B 3NF8A 5GAEP 3PX4A 4ISGA 3LP2B 5KFPA 3W61A 1TKDA 3GV5B 3MMVA 4DCOB 1RLCL 3J7YI 5DM6L 2V94A 1CJUB 1E6VB 4BC4A 3TZYA 1X31C 2QLBB 3RAXA 1CG2A 3PUFA 1RWKB 3Q8PB 4A8FA 1K1QA 4H54A 1NHVA 5KOWA 3GIJA 3AVKA 2KT2A 2CNLB 1GXUA 1HHSA 1IKVA 4M45A 1CJTB 4CFAA 4NLUA 4NRUA 4LY7A 1HHTP 2WK4A 2W9CB 2KRBA 5K14A 3TAPA 3UR3C 1SB6A 2PN6A 2HHHK 2UUCF 1JIHA 3Q8UA 1PC4A 1E6VA 3HVTB 1RA6A 3L6QA 1WD6A 4CD3A 1SJFA 4M3ZA 1W7WA 2YX1A 2LMIA 4PRFA 3MX2A 2I7NA 2P9IA 4F04B 2UUTA 3QEPA 5KFDA 3D67A 3JSMA 2FDNA 1BCOA 3HVWA 1H2UX 4Q8FA 4E7KA 5B0GA 1T9VA 4XPCA 3HI9A 3HSTB 4UY8T 2CPFA 1JJ2M 3L95X 5J2QA 1N5QA 1U1LA 2AEJA 2UZAA 4KH0B 3W63A 3FCVA 2H1YA 4BE2A 2B4OA 2W6LA 2GQCA 2KDOA 4KGMA 1UVNA 5MAOA 5HRRA 4DCHA 5C42B 3MM7A 2NYIA 4X4UA 3VTIA 5SZTA 1JCFA 9RUBA 3AXKA 3Q89A 3KLFA 3CJRA 3FBFA 4CO2A 3SPYA 5K20B 3FR0A 2DHAA 2A42A 4C7QA 4ZVPB 3M2VB 3ZZYA 3FBEA 1FKOB 1LW0A 2GC8A 1VQ8S 4JK9A 4H0XB 1KC8T 1FJEB 3O80A 3HP6A 3KUHA 1SJ3P 1VFJA 2MPUA 3JS9A 2RRNA 3U9DA 3V1RA 4IOBA 4CZFA 1WBBA 3UO0A 3FFIB 2Y1LB 1WORA 4GNIA 5J2PA 2HPUA 4P74A 1P1LA 1HKCA 3ENVA 3GSIA 4BVOA 1WOOA 2A41A 3EDQB 3FBCA 1N88A 2GX8A 2GV1A 2DRAA 2GJ2A 3AO4A 4TU9A 4EHUA 4G1QA 2HLUA 4CEZA 1QE1B 1H98A 3G87A 3CM6A 3I33A 1JLEA 1Q81T 2QLJB 3UWTA 2X3DA 4GC6A 5IXUA 5HP1B 2HBZB 2BJ9A 2BW2A 3NF7A 2F9TA 1S1XB 3RRHA 4NEYA 1KWMA 4HI2A 4RNNA 2DY4A 2FZKB 4DTPA 2F8TA 3CPWR 1AA1B 1HW9A 1YZ7A 3DLLQ 1LXJA 5EDWA 3L0QA 3VF6A 3O4QA 4PKIA 3H59A 2XS7A 5AQGA 3HSCA 3ID8A 1TKXB 4K25A 3I6PA 4FWRA 8AT1B 2CQIA 2AD9A 1REVB 1NSPA 4HEA9 4Q43A 4JKAA 2LVWA 1PCAA 5M1FA 5GAHP 1VHFA 4XTTA 4QR0A 4ECTA 1WSRA 2VBXA 2PSZA 2F8HA 4LF5F 5FRMA 3HT3A 3K5MA 5CYMB 1JLQB 3SIPB 1RHQB 3ULEB 2I2YA 4JI1K 3ZZOA 4B3MK 1VSEA 4YORA 3QQCD 4B3MF 4CCHA 5IC4B 5HSPA 4O4RA 3I96A 1VQ4S 3ITHA 3H5XA 2HGLA 1OVQA 2GMLA 3AA5X 2ATCB 3PEJA 3O1BA 4KT0C 4FJ5A 3SSRA 1G1XA 3R97A 4FLYA 1KP6A 1ZC6A 6FDRA 1HKAA 5L1LA 1TUVA 4F2RA 1HLWA 1Q9YA 3I5CA 4KR0B 2ZBCA 1IKYA 1SKWA 2IVYA 3TPQA 2Z4PA 4CH7A 2KJVA 3OYNA 3M3ZA 3TWZA 4B02A 3CC7S 3JYTB 5IT0A 2HNDA 3AA2A 3LDPA 1YJUA 2XZDB 2BQ3A 3DXMA 1N36K 1RDBA 3LQVA 2RSQA 3IWXA 1XMQF 1L5UA 3LDQA 4TKTA 2A5XA 3GFHA 3CF5Q 3EEQA 4QOZB 4GO5X 3ZT3A 2ZF5O 3NNHA 3A5LC 4JI8J 1OJ4A 1H74A 2F9DA 2HQ3A 3P31A 1U8SA 4ED2A 1CBKA 3DLBA 2BJDA 3GJRB 2P5OA 5CE3A 1HJOA 2UUAK 2WVBA 2R7RA 4M3TA 1B99A 2RS8A 2FVQA 4YR0A 4CHOA 3KWIA 3VEOA 4AHCA 4CJWA 1YI2N 3O9SA 4QWEA 3SZ2A 1VCTA 2WB1D 4DTOA 1JLFA 4EO8A 4FM0A 2AW0A 2H48B 4WFNL 3D7SB 4IOCQ 3ULHA 4FJXA 4YOTA 2BACA 4PXEA 3WXLA 3K7RA 2IA0A 1FXDA 4BR2A 4UY8O 3QZ8A 2BR0A 3FFKB 3LP1B 2YY3A 1PJ6A 3CPWM 2R42A 4ILJA 5FPDA 3FSXA 1KS2A 3TTCA 3W65A 4CHYA 5D3GA 3HFVA 3VWSA 1RWNB 3EDRB 2A6OA 3J7ZT 4OLOA 1HBNA 3OLBA 3TTDA 3FQKA 3HOTA 1O51A 2XGQA 4CGHA 2XMJA 4TY8B 1HR0J 4PYDA 2OZSA 2ZE2B 3LP1A 3ZX2A 3PX6A 5HLFB 2DGQA 2YKMA 4DR3F 2N7CA 3K8WA 4FF4A 3AVLA 3OXGA 1Y11A 2DNGA 3HT0A 2J0WA 4FF1A 4FLWA 2XM3A 5JVGQ 3AD8C 1KC8O 2OTJS 3H3NO 1RT2B 2ITGA 4I2PB 3I9V9 1OVYA 3HHLB 3AV9A 4CEFA 3MPWA 3DHWC 4DV3J 2RQMA 1TYQB 1FRIA 2HVHA 5LJ3Y 4WYBA 3AO5A 5ETKA 4ZCMA 2Z8QA 5G4DA 3CMES 3KZBA 2Q79A 2MZTA 2M7SA 1U1KA 2VCPA 1XQIA 2XB2D 1Q81O 4KHYA 2ZBPA 1CJVB 4I2PA 1MU2A 1JLGA 2I38A 3R5CA 3R2DJ 3OYMA 3MWBA 4MMOA 1YJNN 1FF2A 2CVEA 4KJIA 2G2YA 3MEKA 1YK9A 3CTRA 4RTFD 2UVRA 1JNZB 4L3QA 3B8HA 2P8IA 3OYGA 3H4BA 2IDOA 3HZEA 3J81O 3M8QB 3VQCA 3BJYA 3LPUA 4ZOSA 2B9YA 2FJDB 2IMWP 2BE9B 4URSA 2I6WA 3MUMP 1RWOB 2AZ3A 3WNFA 2KT5A 3OR2B 2LEPA 1SXLA 5GIOA 4AF1A 4WFAQ 3D54A 2XHBA 4WFBL 3BEXA 2L9WA 4M5KA 2VASA 1HRHA 5KG5A 3CD6N 2XNRA 5GIPA 1NJWA 1VQLS 4ISEA 1VBYA 2IVOA 3CC2S 3CDUA 1LV5A 4DMZA 5IV3A 3AVNA 1LCUA 3V6DA 2N3LA 3UD5A 4EZ6A 1BL3A 3OYIA 4B9VA 4CTAB 2DCLA 2V69A 4TQRA 4OPJA 2CPXA 1T3VA 2QMWA 2XNQA 1ZAVA 2WBRA 2V7ZA 3AXMA 2VODA 4PG4A 3KLVA 5KG2A 3T1YF 4WP3A 3MOJB 1AW0A 1AT1B 4YDDB 3D2FA 4EGLA 2Q0RA 4IR1A 2E7VA 4NWBA 2HG4A 2LLZA 1M5OC 3QBCA 3IR6B 3CIZA 5A2QO 1S5ZA 3DGPA 5E0OA 1WB9A 2KLAA 4E98A 3EE8A 2VDIA 4ECZA 3UN2A 4JI5K 1WOSA 2PDAA 3FGUA 3OHRA 2EI5A 4OYMA 1SL1A 4JI5F 4I6WA 1M90O 2BQUA 4QS7A 1YLXA 3O44A 2C3UA 5AQZA 3CCQN 4XIUA 3BPSP 1TKTA 3MECA 5F9LA 3TEGA 2VIHA 1NMDA 3IN5A 5IWAK 2J4RA 2HAIA 1YUWA 5IWAF 3OYAA 1RBAA 3S3OA 3H8YA 3TI0A 1NKCA 4YOEA 4B17A 2RUSA 4IKFA 3SSSA 3RMBA 5GAEU 1NK0A 2K7JA 1VHIA 1TAQA 2HVZA 5HK4A 2FVCA 4M3YA 1RTIB 4JEPA 1N33F 3MCSA 3TVZA 2RQKA 4QAGA 2CJYB 2LQ8A 2ZOFA 4O0JA 3EXCX 4H8KA 3ASMA 3QDKA 2LQJA 5AFUA 1PJ5A 1LWFB 5GVQA 2A18A 1NDKA 1V5VA 2KYZA 3GE9A 4A8MP 1F5AA 3VTHA 3ET6B 1RDRA 4UZBA 4DTJA 4ICLA 4J9VA 4EBEA 3CCSN 4OI0A 1XC3A 4DU1A 1QSSA 2WTUA 4EMDA 1UTAA 5KFCA 1U6ZA 3ZTRA 3OFEA 1J5EJ 4X84A 3H4DA 1S3XA 2YWEA 4BY9C 4ZPAA 4A8OA 1RTDA 3SQ2A 3G10A 2K7KA 3EICA 2ZJPL 3M2UB 3V4IA 1IQZA 2DGUA 3AJ1A 4EZ9A 1YSJA 2ALZA 4FYVB 1FJGJ 4J9NA 4J8FA 1RHJB 4TN2A 1Q5YA 2R7VA 1Z2ZA 3KLHB 3GIRA 4BC7A 4C3MA 4P2MA 4R0EA 3C14B 5A8RB 4LQ3A 2L48A 3KLEB 1S7HA 2QK9A 2JOQA 2MQMA 3GIKA 3PYDA 5J1PA 3NCQA 2QSFA 4UOGA 4IO8A 1UW9A 4DN0A 3THXB 3JTPA 1RISA 5BYRA 2BDPA 3KLIA 3G6XA 4GVBA 2D1CA 3KFWX 4A57A 2DO0A 1T6DA 3OTCA 4HT5A 3DC2A 4OKKA 3GYXB 2QIFA 3P1GA 2KM8C 2YX6A 3MCPA 1XMOK 5BREA 2GELA 2NSCA 1XMOF 1E6YB 1LKZA 1H72C 2FJVA 1GLFO 3KK3A 1LFPA 3RW6A 1S4EA 2XMVA 2EFNA 2ZEJA 2F8MA 3A8IA 3MCMA 3LPTA 2B4UA 3MXHP 1KFDA 4IQXA 2K8GA 4BGAA 1HLUA 2FLLA 2OTLN 3AD7C 4ZVEA 5B8HA 3HVRA 2QO3A 4MQ3A 2EC0A 2VPZB 4LRDA 4ZVTB 3ZZZA 2JHEA 1YTYA 3ILIA 4FVUA 3FZBA 4ZPTR 4L73A 5F0XA 3RR7A 4LMZA 1YX2A 1TVRA 2V4QA 3HHKA 3W62A 5E41A 2X7IA 2CJBA 4LH5A 3MZIA 3NH2A 2DH9A 3OLAA 2R8IA 4HHJA 2OEKA 4CO3A 4LF9F 1OYDA 3PM9A 2QV6A 4FWNA 5DETA 1S22A 2XMTA 1VRUB 1F5CA 3VQQA 2KHDA 5CXTA 3WXKA 1JLAB 5FDLA 4CO1A 5DM7Q 3BO4A 3VAKA 4BC3A 1YHQN 3N9UC 1K9MT 3TABA 3FK4A 5F8HA 2V34A 1WC4A 3R1LA 1SJ1A 3BM7A 1TV6A 2O8EB 3WDOA 3PX0A 4PUOB 1VC5A 3Q0AA 2HNYB 2V8HA 4X66J 3KOAA 2HZVA 4X62J 2A1BA 3GR0A 2GIQA 3PLAA 2BRKA 6FD1A 3ZSVA 4DG1A 4BC5A 2MZ1A 2CQGA 4J9OA 4LF1A 3BF1A 2O1PA 1YJVA 3EKSA 2VB6A 4OI2A 4RU2A 1KNZA 2O8FA 2ITMA 2RS2A 4BCAA 3TJ8A 4PCQA 2W42A 4W5OA 1NDCA 3ZZPA 2C2EA 3KG1A 3MMCA 4EYHB 3G8SA 4KH1B 1RU1A 1GLEG 5C25B 4YY3J 1FERA 2Q31A 1OYEA 2QWPA 1FFGB 4KRWA 1OY8A 2BQRA 1U26A 4LREA 1HBMA 1Y9OA 4E7JA 3U02A 1TUWA 2W9BA 2QT7A 4O4GA 3VV2B 3ZSRA 4MT1A 5EXWA 3IUCA 3ZCMA 2CUYA 2ZZMA 4LF6J 3QIOA 3BN7A 5C5JA 2P51A 3VETA 3K59A 2ZH6A 3OFGA 4DL2A 3KUEA 4O3PA 4AL6A 4OX9F 5T7LA 2ZH3A 5C25A 3Q83A 4DV2K 3NCIA 3O5BA 3OYHA 4RWXA 4UOHA 2CQDA 4DV2F 4DLEA 1S9EB 1OS5A 4F0HA 1B9FA 4BLGA 5LMNJ 2QEXN 3P5JA 2IAJB 1OPZA 4GC7A 2UV8G 4WU2A 2VL1A 5FROA 3EY1A 3E51A 1BHNA 1KTVA 4O8UA 3ZZTA 2OLWA 3HHDA 1DFDA 3VQSA 3BH7B 4ANCA 3NCPA 3J81Y 1YITN 4ZVUB 3ZZ0A 1RAOA 5KFKA 4CK1A 2R7UA 5KPRA 3MWTA 4BACA 1KHVA 2IAJA 3EVOA 3QAUA 4O3RA 4DQRA 2LEAA 3B54A 3H42A 2P5VA 1U1RA 4UTGA 1H3DA 1F60B 3RMAA 4L3NA 3T5HA 4OHWA 3BGOP 3AVBA 4OLAA 4OYOA 1ITGA 3BR9A 4AFFA 2AGQA 4DL3A 4ECRA 2CJKA 2DISA 3A5OC 2MZJA 1RB0A 2XYPB 3MF5A 3M1VB 3FSYA 4OLPA 3H98A 4A61A 3DU6A 1U0HA 5ETTA 2YPYA 2NLWA 2P9PB 2H51B 3V1OA 2D7SA 4JI0K 2ZDOA 1FWPA 2P9LA 1ZBTA 2HGMA 2V2KA 2G2ZA 4QOTA 2RKIA 1T03B 2HHWA 1I51B 3CJ3A 3O3FA 1VSLA 4DR2K 5A2QY 3VF4A 4FJIA 4DR2F 4DUYF 2YWWA 3DLGA 2MZSA 4NXMK 4NI2A 4BGBA 1VR6A 2Y1JA 3PXGa 4CO5A 3KKFA 3GG0A 5A0YA 4HHUA 3HFKA 4RCHA 2HMIB 3HKWA 1E4FT 3ISNC 4DSEA 4DJBA 1RT3A 3VA3A 3M6VA 5CY4A 2F63A 3SCLE 3OYEA 1GMWD 5BN9A 1X9SA 4IDKA 1KONA 1MROA 4KB0A 1ZM3A 4JUZA 4FYXB 3EGZA 5C7PA 3BQ2A 1FDNA 4FJ7A 5LT5A 2J8AA 1URRA 1RBUA 1UAWA 4P71A 1VRTB 3M6XA 3D45A 5H9EJ 3RMCA 4PXDA 3CJBA 3RG6A 4FM2A 2GGPA 2PBDA 1XQSC 2GQQA 4FZYA 2W01A 3SI8A 1WDTA 2IIHA 1L3VA 2JGUA 4H5WA 3CQ8A 3IR7B 1N32J 2ILYA 1VQSA 1HQUB 2OFHX 4IG0B 3ZZRA 4AM6A 4Z4FA 4PXCA 3VZHA 3D0IE 4WIIA 2K06A 2RE1A 1RBSA 1T3NA 5AQQA 2VBZA 3O3HA 2IYGA 3PNIA 3WEEB 2J0QD 3SQOP 1RUSA 3MR2A 1LXNA 4CM0A 4HI1A 3SV4A 1UOCA 1XC9A 4NYZA 4WWSA 2AA4A 1HPZA 2YJEA 4EIAA 2GZOA 3IBFB 5L8RC 3LL3A 2VDHA 4BRFA 2H5JB 4IH7A 3QNOA 4DU4A 4V19X 2MQLA 2BANA 5KG0A 2DPIA 4ZN1A 4CZLA 2EBEA 4PG7A 1RT6A 2R2RA 3CD7A 3SCKE 2J0SD 4ELTA 2RMLA 2YNHB 3KD1E 3THYA 2UUCJ 4OHVA 1RFQA 2HS4A 5CA5A 1RTZA 3VMFB 4JLHA 1CS4B 3MM6B 4CHPA 3I87A 4H4KA 2KU7A 2D41A 1YT3A 4FO0A 1YRXA 2FLNA 3M6WA 3KJFB 4P9SA 2H54B 4F02A 2PD1A 1BXNA 2E1ZA 2FC0A 3N01A 3BB5A 1K0TA 1R6VA 4DPWA 4YR3A 4DFMA 3MMBA 1FXLA 2O8DA 4CIOA 1RAIB 5L9NA 2M4MA 2HBQB 2LECA 2FHMA 3G8QA 4FLVA 2ZH2A 2NNWA 1WKLA 2J5AA 3PFOA 5HBMA 1CS4A 2D74B 1KOOA 4LR9A 2PFDA 2DGSA 4J9KA 4Z4HA 5EWEA 1R43A 4Z2XA 3CJKA 1JK9B 3ILOA 2VG5B 2KYXA 3GJTB 3QICA 4NLVA 2E9RX 2VD3A 3UDCA 1X4DA 5KPTA 4N8OA 4H4OA 2LFVA 3CD0A 4KTWA 3JSBA 3PCOB 5THWA 1YI2S 4DUZK 2PI5A 2N82B 4YDUA 4HH1A 3THTA 2VH7A 4B1UB 4RG8A 3NBPB 4DUZF 4RUCA 4DQIA 2W7AA 3OBIA 4CJRA 3FZFA 1NBWA 5CHIA 4KGZB 4C23A 1N5TA 2QWMA 1KEKA 4WF9L 2B7CB 4ECQA 4DL4A 5EOYA 4IO9L 1TTHB 4JHDA 2DH7A 4ECWA 1WUAA 4YHHF 3ZLJA 4DL7A 2V68A 2V8GA 2CXEA 4ZS6A 2FVSA 2E4LA 4JI3K 1XNRK 3P45B 4CZHA 2E9TA 1RBVA 1HJRA 2DK2A 3FEZA 3OBWA 3DXSX 1U0SA 2QMXA 3HD2A 3L9ZA 2AEFA 1DKGD 2MGZB 4K8RA 1D9AA 3MTKA 1KVJA 1R59O 4FSVA 3NH0A 5HRPA 2WC9A 5LOQA 1IWAA 3LOUA 4RX6A 1F0XA 2CQ4A 2F4VF 2G0JA 1RLDA 4RBVA 1YQHA 3WNGA 1ILYA 3FGVA 2HBRB 1S0VA 2R7SA 3UKRA 3Q7CA 3WX4A 2OPSB 1YVFA 1FNOA 3KHRA 2XS2A 1XNQF 3MM5A 2AV5A 1UA0A 4JV0A 2CYYA 3I4HX 4CD1A 4WP9A 4BG8A 4L76A 4LVNP 4OYWA 4RBTA 1FXRA 3R1XA 5CZ2A 3P96A 2OANA 2OPRA 2XCAA 1O0PA 4F2SA 4JKFA 3LALA 3OYJA 3ENWA 4CJQA 2IPOB 4C97A 3WIVA 4LF5J 1BUXA 3BBBA 4EYIB 4FLUA 2FHJA 1FJCA 4USTA 4J9QA 2YQ3A 3JAMU 4C0OC 2YKQA 1WSIA 4DWIA 4KH6A 1XERA 1WF2A 3TVYA 2V67A 1FDAA 3VEWA 4JB8B 1S0NA 5FLXU 4KHNA 1ZBLA 4ZTFA 1XHZA 5ETMA 4B3MJ 4L72B 4OZ1A 2HVDA 2P9KB 3R7SB 3E66A 4PG5A 3U27A 4IJAA 4DV0K 3W64A 4J9MA 3M8WA 2XZWA 1KRPA 5GAGI 4DV0F 2VKRA 4DTRA 4U67Q 1Z26A 3ATUA 5EHHA 4MIBA 4NYFA 2EFOA 3LH2S 3NG8A 1H7XA 1UFKA 3OYLA 2HBMA 4OHZA 2MKCA 1YJ9S 3ELHA 4BC2A 4P6QA 5KQ8A 1EARA 2P9KA 5J2NA 4ZCIA 3VGUA 3R9PA 3DOKA 1HWIA 4TLRA 1RQ0A 1Y64A 1XMQJ 3QJPA 1FFWB 2FJAB 2PIIA 4WFYA 1YRUA 2CIMA 2GEMA 1KLMA 1J53A 4TU7A 4NXNK 2B8PA 1OSCA 5ETQA 4G3IA 4NXNF 2DR6A 4WU3A 5E3PA 2C3MA 1IBKF 1IVZA 1QLNA 4YNQA 4FLTA 4OJGA 3F9KA 3MPVA 2HVEA 1R89A 4RNOA 2UUAJ 2FLOA 3AVGA 4R79A 3H5YA 3O9TA 3L8BA 3C15A 1NB2A 5KG7A 3N5BA 3PW2A 1NG9A 1DT9A 4LRFA 5C2DA 2WAQD 4RNFA 2J0XA 2VYPA 3VALA 4Y28C 3CCVS 1NK8A 3UDVA 2V8DA 3C16B 1JLCA 1T9UA 4CBUA 1HQEA 3RB6A 4YEAA 3ZETB 3CCZA 4C98A 4Q7AA 1QVFM 1HBOA 2X1BA 4JKEA 3ENBA 4DTSA 4P7VA 3WNEA 5KFGA 3TAGA 2P9UA 4A8WA 1HNVB 3SDEB 4BRGA 2GWJA 2DNMA 2BH1A 3SAFA 5AQSA 1WEYA 3QIDA 2W9AA 4EO6A 3H2VE 3CDAA 4U7CA 2R7WA 2P2CB 4XDDA 4DS5A 3OVAA 4JKCA 2HBKA 2CG8A 2ZUGA 4DV6F 1VI7A 4GY2B 4BRPA 5G0RB 1HNVA 1QHTA 1DLOA 4O0IA 1MNEA 3SBMA 2NQPA 3U3GA 1EHWA 3KDNA 3BSAA 3PRBA 4WK3A 3BREA 3CCUN 2XY7A 1RDWX 3GR1A 2XCPA 1SPBP 4ANEA 5EY4A 1Q86T 2I5JA 2Y3YA 4IWVA 5A8WB 4ITSA 4WTYA 2XS5A 4Z4EA 1RXOB 3SPZA 2P9NA 3WBZA 5CABA 1AUDA 3CJTA 3C6UA 2XSJB 2DY1A 3BSCA 1WSFA 2PY5A 2QG9B 3IDHA 2VHGA 2QA4G 1NEEA 5CR4A 3F5TA 2QWNA 3ZFVA 1JJHA 3J7YP 4R8UB 5ETRA 4CJVA 1LFWA 4C1NI 2J9EA 2F4FA 3TZXA 1SVDA 2GAGC 2FIUA 2QFJA 4F8RA 3FCHA 3U3YA 4FK2A 4LRAA 5C12A 4QIFA 4RW9B 1PYSB 2QWRA 2C2MB 2VA2A 3GONA 3MAHA 3DRSB 2M8DB 2OAUA 2BKOA 4BDYA 2QJ3A 1CJKA 4LH4A 3IO1A 4XH1A 2HFZA 2YH1A 4B08A 3AO1A 1Y5NB 4G1PA 3L4BC 3QFHA 3SNNA 2GFFA 2A6AA 3GSDA 4KB7A 3V4MA 2C2ZB 1HNIA 3PEHA 5DJBA 3QLHB 4DL0C 1TGOA 1HWKA 4ZJLA 5FPMA 1BIUA 2WHOA 3OL6A 3U9ZA 2HURA 2DO4A 2HLTA 4G65A 1T6CA 3TAMB 5KFUA 3LGMA 4USUA 2YNFA 3FSIA 4M8LA 3OYKA 3VQPA 2BXJA 1U2RA 3THWB 4M5HA 2DNHA 4RKUC 2OTLS 3I56N 4LFBK 3T9ZA 1XI1A 1CSJA 2R7QA 3P4IA 3M9NB 4OX6A 3L3CA 2WW8A 3QLHA 4C2MA 2EX3A 4CZMA 3SAGA 3T69A 3L3UA 2HFVA 3M8YA 4PQUA 3TANA 3DRXA 1TL3B 3SBGA 1N34K 4UUXA 4OKJA 4BRDA 2RRBA 1N34F 5DZ6A 3C6TB 1J9AA 1WG5A 4ERDA 3M8PA 3SMSA 2OPQA 4JI5J 3CW2C 4W5QA 2YBVA 2YNIA 1FEHA 3B6BA 1GLJO 3RB0A 3D4JA 3WXJA 3DOMB 4Y2KA 3NAEA 3NCRA 3KWMA 1R8CA 3P8BB 4RPFA 3KLGA 3VQ4A 4BR5A 1LW2A 3DXBA 1ELOA 2ALYB 3G4SN 4DI6A 3NE6A 1WC5A 3EYZA 1RK8A 4CEAA 1ZTWA 3HK2A 4B3SK 4JBCA 4J9RA 3S3MA 1W26A 4B3SF 5IWAJ 4FK0A 1RT5B 1KTQA 2VJVA 1G4CA 3NNAA 3TRGA 3OBYA 1SL0A 4JI6K 3W2VB 4AM7A 4Y2IA 3ZSXA 4JI6F 5DZ7A 3DLEB 1FRMA 2J9DA 4E1JA 1A5WA 4WKRA 3BQ0A 3SV3A 1C0UB 1IR1A 4BR7A 2XHWA 1LQ9A 3OYCA 2F8SA 1Z1ZA 2PMZD 1YTAA 3DFEA 4A8QA 1XMBA 3V6JA 2KQ2A 2QE5A 4CYUB 3BGLA 3MEDB 5EX0A 2UP1A 2EKNA 3O8WA 1YF5L 3DLEA 1NSAA 3HSGA 4I56A 3CPEA 4FVMA 4O55A 2H4YB 2IGIA 1FTRA 2MQQA 1RBTA 3ZEUA 2QM1A 5J2MB 3MXMA 3VERA 4FJ8A 1RHUB 5K5MA 3M05A 2XQCA 3VPZA 4ETZA 4JI8F 1X4GA 3MMJA 4B3OB 4LSLB 5KT5A 2KXNB 4IFYB 3PW5A 4DBQA 3PKMA 3NS6A 1T9YA 4W98A 1HYSA 3B6OA 5KGXA 5F3TA 4J2EA 1S76D 1JXBA 1DTQB 1C1BB 1VISA 3AODA 4O3SA 1EQ0A 4KKOB 4Z37A 2AJQA 1Q53A 1FE0A 2GMHA 4F4XA 3CQYA 3AO3A 2OEJA 5KGWA 3ZSZA 4BBYA 3L2RA 3CERA 3L2WA 4NLYA 2BOPA 4IFYA 2HF3A 1I3OB 3DLLL 4CE9A 1ZBIA 1CXQA 5C2FA 3B78A 2NRTA 1KQKA 3U7JA 1IBMK 2G8WA 4JN4A 2QN6B 3T7ZA 2FBTA 3OUYA 4HTLA 1IBMF 4CJEA 3SLCA 4KGXB 3PV8A 2DGTA 2YWKA 1FKPB 1IG9A 4FNHA 4NCGB 3OYBA 1RABB 2RQCA 1JKHA 1XMOJ 4CLSA 2JRSA 1ZM2A 4ZITA 1DAXA 3GILA 2V9KA 3GMGA 2H3EB 1VQMN 2V8PA 1HR0F 4BRMA 4CZIA 3D66A 4DL5A 4JD2A 4I9LA 1A5VA 3PYFA 5F0UA 1NU0A 2K1RA 4ZMMA 5AXMA 2ZZTA 3TAQA 5CQGA 4HR2A 3NL0A 3THVA 4F3TA 4Y1CA 3OS0A 3C0BA 4CO0A 4X4QA 3C94A 4KFBA 4ELVA 5LMUK 4B1VA 1V3SA 3T9NA 1Q9XA 4XDCA 2Y0BB 3MN5A 1WF1A 4CGIA 2JWNA 2EKYA 3EN9A 1IXKA 4LFAK 1RWPB 4DX6A 1ZM9A 4LFAF 3H40A 3GG1A 1YJRA 2P6TA 5KFAA 3GIMA 4USWA 1M5HA 2E6MA 4E19A 3GBTA 1FRHA 3SQGB 2P9GA 1UJ6A 1VQON 1W0HA 2ZWHA 1RTHB 3QEVA 3ALYA 2QKBA 2PMWA 2LDYA 2UU9K 2W7PA 2XYGB 1H38A 3EJMA 1N5VA 4K50A 4RWWA 2D3UA 5IT9O 4K4XA 1S1VA 2LXIA 2WTFA 4QPTA 2ZNYA 3D0HE 3NEKA 1GLAG 3CF5L 4CJ3A 2HNZB 3IAM9 3EKUA 5DDPC 1WWHA 2ZITA 5KFWA 2QXLA 3UCZP 4H0OA 1YAGA 2MY8A 4RW8A 3AD9C 3GP9A 3MX5A 1S59A 4FN5A 2BBEA 2F3JA 1HBUB 1QQCA 4TY9A 1ZZNA 5E33A 2VQFF 5DM6Q 4YOXA 3MCOA 3VGLA 4EI2A 3QT7A 2GA7A 4YMEA 2M8HA 3E01B 3BGRB 4IKAA 3IM8A 4TSXA 1RAFB 1H0HB 1D4XA 4PPDA 4FKXA 3J7A1 4YOWA 3DRPA 4ED0A 3VGSA 4WQ5C 4PEOA 2KZMA 3MM8A 2B5JA 4JI7F 3NGIA 5I3UA 1MDUB 1B64A 3I0RB 2YKAA 3AJDA 3KJVB 3NAHA 4LD0A 2V50A 1BU6O 1M5VC 5FIIA 3Q22A 5AE1A 3B8AX 3CG7A 5FPEA 4CBXA 2LA4A 2AEMA 4ZPBA 3N4PA 4JI2K 4BG9A 2E5IA 3C7NB 1LEOA 4RW6A 4JI2F 3CMQA 2GV9A 4DV2J 3ZSWA 3MUTP 1U7LA 2PC6A 3HL8A 2BE7D 3A13A 3G82A 1RHKB 2MMYA 1WG4A 4PQAA 4KO0A 4QJVA 3SI6A 4NEZA 3IS9B 2FYXA 3QB0A 4CIEA 2AGPA 2GJFA 3H25A 3TU5A 5JVGL 4FJLA 4FXVA 1RAGB 4WYWA 1IUJA 5E2QA 1VQ9S 4LVOP 1YJWN 4CEQA 4FWLA 5AQOA 1SC6A 2CDQA 1JXEA 4NA3A 3D5MA 2FY1A 4Z7CA 3HSJA 3OW2M 1X3NA 3IS9A 4GMJB 1RE1B 4FZZA 4C11B 1T05B 1LWCB 4DQ8A 3TUJC 4G1IA 4YUDA 4CFDA 1ZAWA 1NGIA 3I55S 5DDQC 1CPZA 1ATNA 4FS1A 1R0AB 4OX8A 5DK5A 4HH0A 4P2FA 4WCEQ 3V9UA 5B0EA 4DV7K 1D1UA 1A7GE 2E5GA 4W5TA 1T7PA 1UCNA 4DV7F 2R8JA 2OPPA 2FQQB 4E8UA 3HPHA 2DFEA 2B3TB 3C65A 4WE1A 2GO9A 2XYHB 2C22A 4HVJA 1T05A 2HYIB 1BISA 3VQ5A 4CEOA 2RHQB 4JI0J 2BV3A 1GT8A 2GQ2A 3NGTA 2I9SA 3J7AP 3G9CA 3CCEN 4CEBA 3V9ZA 1S6PA 3Q2SC 1SH2A 4PWUA 1N54B 4A46A 4UOCA 1B7YB 2LQ5A 2UVVA 2PMHA 4BQLA 4DR2J 5TKYA 4DUYJ 1XHXA 2C42A 2UUBK 4UQTA 5IM0A 3BBCA 4RW7B 3GYNA 2VICA 1JLBA 2ZGZA 2G1HA 1ICEB 2UUBF 4Q2MA 1M0SA 3A8EA 3IRXB 1YWXA 1I94K 4DQSA 5AFUH 3I32A 4GVMA 4K2JA 3EUNA 2FZGB 4PXBA 1HW8A 4Y2AA 3G96A 1RT1B 5GMEA 5ITHA 2NUHA 3QJLA 1SL2A 2VBWA 2V9WA 1VQ7S 3GOIA 1GMVA 2N3OA 3CFRA 3E3XA 2V63A 4KE5A 4J9PA 3VENA 4LSNB 2W1BA 3K0SA 3P83D 4AE5A 2KRRA 2O8CB 2ROEA 2ACMA 4ZJQA 1RTJB 2Q3PA 4OYXA 2W4CA 1RA7A 1LWEB 2DHSA 4IO1A 1IN0A 4X4SA 1QVGM 2CA9A 3OTDA 1PBUA 1GQEA 1NPKA 3R9LA 1RAHB 3BDEA 3AB4B 2QI2A 2QA4S 4OYAA 3MFIA 1R3NA 1LOTB 3NGYA 3G8TA 2JFDA 4O3NA 2D0CA 5KG3A 5CZVA 5LM7E 4JI4K 3POTB 2ZM6K 4JI4F 2DRBA 5D4NA 3VHQA 1N4LA 1RI7A 5K8NA 3KK2B 2X1GA 4CLFA 2CVIA 5EX3A 3UCGA 2YI1A 2NUBA 4WPAA 1QSYA 4O5FA 3KNGA 2CRLA 4TXSA 4MKYA 2HBJA 1RYRA 2G8FA 4FLXA 1EKSA 2A10A 3V5RA 3Q24A 4CLTA 2IJFA 4JKHA 2RDIA 5AT1B 4CI0B 4GMKA 2QL5B 1Q7YT 4RBUA 5I3PA 1NHKL 4QQBA 3W2WA 3ZZUA 1L3SA 5BPMA 1RHMB 3TQ1A 3DNCA 4NLXA 3H1QA 3FUYA 2W41A 3CULA 2EG1A 2V2VA 1J54A 1BQNA 1OQ6A 2PEBA 3OVBA 2DFHA 4Q0BB 5CYQB 2AIRB 4DSJA 1Z05A 3DWLA 3S1TA 4U95A 3EM1A 4CI6A 3LZJA 2LKZA 2Y8WA 2P1JA 3MMAB 1AROP 1NMNA 4ISFA 5HANA 2RPIA 5J1EB 3RSEA 3CDEA 3CJ5A 3TA2A 4FJNA 3BV8A 3QIPB 3L7UA 4HYKA 4YDUC 1QQNA 2PA3A 3DLKB 4DCJB 4BDZA 1IKWB 4DUZJ 2Q97A 4O44A 5KT7A 3FCWA 1U2FA 3K5OA 3PRVA 1N8RT 3H20A 4K2XA 3G6ES 1YBAA 1WG1A 2M9KA 2ASJA 4JKDA 3CCMS 3K89A 2CZ9A 2QTWA 4F67A 5J1EA 3R5JB 4KHSA 1PILA 5HROB 4AQYK 1M5KC 4DPOA 2U1AA 2G8HA 1EXQA 1SAZA 1IKXA 4AQYF 5K8PA 1J5OA 2VPYB 3MWPA 4QU6A 5D0RA 3J80U 4BRAA 3CMAS 1Q4RA 5FJ4A 5B0CA 2F1FA 5FRNA 2W7OA 1EJ7L 4HLBA 1S1TA 3AFGA 1HL6A 3NGKA 2DY9A 4GV3A 3KK1A 5ETSA 4U96A 4JI3J 4URQU 1XNRJ 3BZQA 4DV4K 5ETPA 2GVDA 4UUWA 5LMNF 4CO4A 1HFEL 3OR1A 2ASPA 4K4WA 1FNMA 3VF0B 2OUGA 3CCJN 4K4TA 4CHZA 1VQYA 2DTJA 1MLAA 4B1WB 4LC9B 3ZTQA 1IJFB 3BPDA 4YB1P 5IT9Y 2F4VJ 4M5MA 2AU0A 1KVIA 2BABA 4EEYA 1T9XA 3AGKA 1V6HA 3GTYX 4I69A 3UD3P 1SV5A 3SFUA 2RF2B 1HD1A 4JAXA 5F8JA 1TP7A 1NNEA 4RW4B 3IAYA 2F8EX 3QNNA 3T19A 3DYAA 5J1NA 2GTDA 1R27B 2NR0A 4MLEA 5KG1A 2AJ1A 1S1UB 4X64K 3RRGA 1AFJA 5I9EB 4X64F 1MSWD 1Y4ZB 4M41A 4HUEA 5F8NA 4K0KK 4MKBA 4K41A 2GVZB 4K0KF 2ZOMA 4YS2A 1GOCA 4WFBQ 3I0SB 1R0CB 3ZSOA 4QS9A 5DM7L 1Q79A 1VK3A 3TZWA 2ZGYA 4RLEA 1N5SA 4MJKA 1FWLA 2H5IB 4ZVGA 1NWKA 4CIGA 1S1UA 4FJ9A 1FD8A 4ZVOB 1SQEA 3QAEA 3R6LB 3MDFA 4CZKA 4QIVA 3B4MA 1TL1A 1TFWA 5IT4A 2GVZA 2QWOA 5LXRA 1ZM4A 1JJ2R 4TYBA 1FEEA 1C1CA 4DR6K 3PHTA 2D5RA 4N56A 3LP0A 2JC0A 4DR6F 5M2RA 4FW2A 2DNOA 4DV0J 1C1AA 2E5HA 3CSKA 2D3ZA 2Z30B 4WP8A 3FNNA 3MEEB 5CCMA 1UZHA 1H73A 2Q3SA 4PWDB 4B9NA 3OL8A 4KBOA 3GFXA 4CLKA 5KT6A 4ZVSB 3EVWA 2P9SB 4IUFA 4OV6A 3F56A 4J9LA 3BF4A 2BEFA 1VMBA 3AY9A 2GAHC 1VQ5N 2XI2A 2L3MA 1Z4UA 2OD6A 3D7EO 2IJRA 2EHGA 1MWZA 1RT4A 2RH3A 5DDOC 1F6TA 4KV8B 4LRCA 1CULA 1IV0A 3PHEA 4X4VA 1UPPA 1U2VA 2QGFB 1ZETA 5F3ZA 4B3TK 3TSUA 4NXNJ 1SC1B 4M5DB 3NNCA 4B3TF 4W5RA 2HK2A 1S49A 4OLBA 1Y97A 2CPDA 3W5YA 1RAAB 3EGVA 4OZNA 4MO4A 2VG7A 3O1WA 4DTMA 3HULA 3D6HB 1UKUA 3DHXA 1X5PA 3CO9A 4DDFA 1VQ6S 1FD2A 2DNYA 2CH5A 1ZS6A 4USHA 1VQPN 2R7XA 1Q7YO 1TK8A 2PFUA 3QFUA 3TUPA 1BQMA 2Q6CA 4AL5A 4FNIA 5D6GA 5I42A 1JQGA 3QERA 1HMVA 2XBPA 1Q7LB 2OIHA 1RKJA 4PYAA 4BC9A 3TX0A 4ZHRA 5CCLA 4FYDA 2QLFB 3MM9B 4FDFA 2KH9A 2OO4A 4ZP9A 4F36A 4CEEA 1F3VA 5BPLA 3VN5A 1VBKA 5MLCV 2CWKA 3MPUB 3LP2A 2CQ0A 3WIUA 3K5LA 3CC4S 4WIQA 2IM1A 1YVNA 4RUBA 4PZVA 3CT9A 5K8MA 2GHVC 4CJFA 1CJUA 3BR8A 4ZVQB 4DV6J 3T5JA 2HHHF 3L2UA 2MB0B 4I6MB 1FRLA 3HOSA 2WONB 4Q8EA 1N8RO 4E7HA 1QSLA 2QL9B 2CQCA 3KIOA 2HW3A 4B8AB 4QWBA 2ZJPQ 1EX4A 1CJTA 2EK1A 4ID8A 1BA0A 5IQ6A 3BF3A 5E84A 2W9CA 2MSTA 2HBLA 1OSDA 1R8BA 3HCXA 1RACB 2E88A 3MK6A 3VAFA 1V5IB 3R5AA 2O67A 2VFVA 3JAMY 2LSNA 3SXLA 3HVTA 3BEGB 3IGNA 5HVHA 4EHTA 2WSCC 3H5UA 2ASLA 1HPMA 3N4QA 3NWGA 4FPBA 3IXQA 3AT1B 3C2PA 2XO6A 4MDBA 4CZEA 5KFSA 2C3OA 2OELA 2CKWA 2QW9A 2NRWA 4CQ1A 2Y8YA 4ID5B 1Y0HA 4P2XA 2Q2RA 1T02A 1A0OB 1ZBSA 2L08A 2X6NA 5DG8A 5H9FK 1WC6A 3H2UB 2AT1B 3WHIA 5HMXA 4DB3A 2BMBA 4ALZA 1U8WA 1G3OA 2UVUA 4CJUA 2MXYA 5DLGA 1V4TA 1NRKA 2AX0A 1APSA 2GIFA 4BHQA 5C42A 2D0BA 1ZPWX 1QJHA 2QKKA 2XSFA 3LWLA 4NZ0A 4CGGA 4F4KA 1WTFA 2ZHOA 4K4ZA 3L3VA 3C95A 1SC4B 3V6KA 1BE4A 5D4LA 4ECVA 3FKBA 4LFCK 1UWBB 2HIQA 3TYTA 4LFCF 4M3UA 3FZMA 2HZCA 3M2VA 2UXBK 3R5BA 4X4RA 1FKOA 2W2PP 3VA0A 2KKZA 4JKGB 2PAVA 4MK9A 4CFCA 3FFIA 5AE2A 3CJ4A 1GLCG 3GCWP 1JCEA 3NS5A 2MZQA 4WTOB 3HD1A 3WC0A 1VSMA 4LFBJ 4ED8A 4J2AA 2V0NA 2E1RA 1Q18A 3UNYA 1QE1A 3ZXWA 2DCUB 1SH0A 2YHAA 3C19A 5JVHL 3QGGA 3A12A 2A1SA 2IVPA 2L41A 4EFHA 2G8IA 2OP5A 2B6AB 3T1AA 2RQ4A 4DPUA 4NO7A 3VVUA 2YX4A 3M2RB 1N34J 5HQMA 1X4EA 5HP1A 1JCGA 4K59A 3O6WA 4R0JA 1YZ6A 1S1XA 3M32B 5A8KB 5LL6d 4W5NA 1X4CA 1E3MA 3W9HA 3WQPA 3NGSA 3LW5C 2X1AA 1NGAA 2J6TA 3D3CJ 4FJJA 2O5DA 1NGDA 4DTNA 1ATSA 2J8SA 4OHXA 4J5OA 3KHYA 2YJFA 4A8SA 5D4OA 3TARA 2UXDK 4J2BA 3PDNA 1JWWA 4GKKK 2IRYA 2B8QA 1RBLA 5B0DA 1TKXA 1U1OA 4B3SJ 4GKKF 4A5BA 4ZVRB 2CPJA 1X60A 1REVA 4JS5A 4ZP6A 3EZUA 4PG6A 4JI1F 1BC6A 3OV7A 1XJWB 1TL5A 3MR6A 3TOQA 3BDPA 4JI6J 3K9KA 3PIOQ 2DHGA 4OKEA 1RJJA 1VQ8N 3TUZC 1RT7B 3J81j 3LGHA 5CYMA 1JLQA 1N6QB 5AZIB 1YBUA 1ZYQA 3ULEA 3KWGA 3PW0A 4IZ9A 4AYBD 4CRJA 2IY5B 2P6SA 4MLHA 1RCOB 4CF9A 2H3GX 2VC0A 4YFUA 1T95A 3MN9A 1YVUA 1NPRA 3TSQA 3R5GA 1RSCA 3AQPA 4NCBA 2ZDPA 1OY9A 3A3PB 2R7TA 2DNZA 3H45C 2IM3A 3EE3A 1IH7A 1N36F 2YPZA 3KKRA 5D8HB 5KFEA 3P3DA 1KAXA 4CGJA 4HACB 4IFVB 3W1YC 2VUGA 3H90A 1OO0B 2C3YA 2IYIA 4NRTA 1HNXK 2MQOA 3CQXA 3JYTA 2O66A 4PKGA 2FSJA 1VQNS 4K43A 4DKWA 3MAAB 4FXDA 5GMKa 2I0XA 4NMXA 3QRQA 4CECA 2G2OA 3UE5A 2GX9A 3VAJA 2UUAF 3I31A 4ECYA 3AOAA 1S72S 3AVAA 4GVEA 4DR4K 3BYPA 4P2SA 5HVGA 4IFVA 1EETB 1UVJA 2DBBA 3CI5A 4DX7A 4KY3A 4M63A 3SUPA 1K8KB 1MA9B 3P49B 1T9TA 1ZAXA 4CP5A 2JEIA 3NKYA 1X4BA 3AB2B 1WLJA 1CQNA 2XWXA 4JK7A 4OHYA 3D2WA 2VQEK 4NLDA 5IZHA 2A2CA 2ILZA 2EW9A 1ESVA 4KH4A 2VQEF 3CJ0A 1QD1A 1IBMJ 1UVMA 1ZBUA 4X4TA 2R8HA 3ILLA 3MFHA 4USVA 1BI4B 3I82A 2MHNA 3Q86A 3B6PA 5KI6A 1M1GA 2LU2A 2HRYA 2Y1IA 4AHTA 4I9QA 1B4SA 4IEEA 1X5SA 3LO3A 4C8KA 1VQ4N 3G25A 3GL1A 4E0DA 2VC1A 2WVCA 2KL8A 4FJMA 2XULA 1Y3KA 1NM2A 3Q23A 4DV1K 4EBCA 2D69A 4DV1F 3EZWA 3CC7N 4TY8A 2MTLA 2OJ3A 4TNOA 3MPDA 2ZE2A 5LMUJ 1LAVA 1GX5A 5HLFA 3BGFA 1S9GB 3U8XA 2Z2ZA 1HNWK 2ZH1A 3HPGA 1F9FA 5BR8K 1HNWF 1SQFA 5BR8F 1RT2A 1NGEA 4LFAJ 4CM2A 2E1PA 2AJ0A 3HHLA 1U47A 4XK8C 2VFSA 1TYQA 2K2PA 2WSEC 3RBZA 3SCXA 2M70A 4QCLA 1CLFA 2M2BA 5ETLA 4HCBA 4F3MA 2ATQA 1A9NB 2G1DA 1ZZFA 5KT3A 5AZJB 3QGPA 2KFYA 2F9WA 3O4WA 1SQGA 2UU9J 1NSQA 4USIA 4DFKA 3ZT0A 3DRRB 2M5YA 1D3WA 3K0JA 5BR9A 1CJVA 4DU8A 2MDAA 3CCLS 5AQYA 3QINA 2FC9A 4LF8K 4XH5A 4HDHA 2AX1A 3OHAA 4U9RA 2BE2B 5GADP 2VQFJ 2JJ4D 4CH0S 1P8GA 4GV9A 2M52A 5CZXA 2ZWPA 3M8QA 4F50A 5A6PA 1SJ4P 5KFFA 2HFOA 3RAQA 3OR2A 2ASDA 2EK6A 1R0BG 1WN7A 3CGIA 4JI7J 3SQ1A 3A2FA 1NOYA 3GLJA 1YRTA 2YNGB 1ASVA 1OKJA 1VIXA 1TKZB 2W25A 1VSHA 2AF6A 4H4MB 1H6KX 4FJHA 1I5OB 3QGIA 2E2OA 3QO9B 1P9QC 3GCXP 4CLWA 2JLEA 2OTJN 1O13A 4CTAA 4ZCLA 3OS1A 1RGVA 2CG4A 3QETA 5HMYA 3W8GA 4JI2J 4ZCKA 2YVSA 2JEGA 3AH6A 2NXNA 4CHQA 3LUYA 4F0MA 3F9MA 3MEGB 2XRIA 2AJ2A 2DPJA