1S1XB

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
397
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 109
structure length 397
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB02
1LWEA 1ZTWA 3QZ8A 1VRUB 2FJXA 4NLYA 2XGPA 4K4ZA 3IRXB 2ALZA 4H4MB 1TV6A 2GIRA 3I0RB 3CJ4A 3DOKA 3BGRA 1S0MA 1SV5B 1LW2B 3I0SB 5DG8A 2W9CA 1REVB 3MR2A 4J9SA 1NHUA 5DQIA 1VRTA 5L1KA 5C25B 2FJWA 4RW7A 2AGQA 4O3RA 1HARA 1I6JA 1KHWA 3DRSA 4RNFA 1XR7A 4O44B 3RB0A 2C28A 5EWGA 3PVXA 2HNYB 3RB3A 1S4FA 2UVUA 2OPPA 2JC0A 4NLGA 3T5LA 2YNHB 3DLKA 5FDLA 1HPZB 5KT4A 2FLLA 4Q0BB 2B5JA 3CIZA 1QE1B 3DDKA 4KHRA 5J2QB 4TN2A 1C1BA 4NZ0A 3UR0A 4RW8B 3V6JA 2EC0A 1JLFB 1LWCB 3HHKA 4R8UA 5KFEA 2R8KA 4IFVA 5KFCA 1MU2B 3TAMB 4RNMA 1HQEB 3CVKA 3JSMB 2AX1A 5KFVA 3CJ5A 1DTTB 3LANA 4NLRA 4KSEB 4LQ9A 5KT5A 2JEJA 2IM1A 2ASDA 3CDEA 1S1TA 1S6QB 4LSNA 4XPCA 3LALA 3M8PB 4IFYB 4TYBA 4YR0A 3GIIA 4J9NA 3RAQA 2WB4A 1RT4B 1TVRA 4NLOA 4J9QA 4F4XA 3EPIA 3SFGA 4KB7A 2V4QA 2XI3A 1FKPA 1UWBB 2YNGB 4O4GA 4WFYA 2BQRA 1HQUB 3DLGA 1N56A 4QWEA 1RTIB 1SUQB 3MEEB 5HROB 3CWJA 4NLSA 2W7PA 2J6SA 3T1AA 5J2NB 4J9RA 3NAIA 1C0TA 2D3ZA 4URGA 3KLIB 5KFWA 3KHHA 4J9KA 1T03A 2V9WA 4TQRA 4OL8A 3DRPB 4XPEA 4I7FA 2ILYA 3FQKA 4HKQA 1RYRA 4IRCA 1T05A 4Q45A 2FVPA 5F8IA 3T5JA 4RW4B 1JLGB 1RT2A 5C42A 4QW8A 2WHOA 3IG1A 2AGOA 5KFFA 3D28A 5KFUA 1K1QA 3MR5A 5D3GA 2JEIA 2YKNB 4ID5B 3KLGA 1RYSA 4NLUA 5DLFA 4MK8A 1HNVB 1SH2A 4QW9A 5I42B 4ECVA 2IC3B 5J1EA 3V6DA 1N5YB 5KT3A 4ICLA 2RKIB 3MF5A 1C1CB 4K4YA 4EBEA 3PW0A 3BR9A 4ED7A 5HLFA 4K4TA 1EETB 1JLCA 1RT7B 2VG7B 5JXSA 4EYHB 4EBDA 3NGDA 4DL5A 1S1VA 3DMJA 1KLMA 4PWDB 4WE1B 3DYAB 3JYTB 1ZTTA 1TKTB 1N4LA 2OPSA 2WONB 5J2MB 3KHGA 2BQ3A 2IAJA 2R2TA 3M9OB 1JIHA 2IM2A 4K4XA 2BQUA 4ECZA 2WTFA 2XI2A 5KFYA 1T94A 4NRUA 2JLEA 4J9PA 3PW5A 4TY9A 2VA3A 3LP1B 3FFIA 3M8QB 2UUTA 4LSLA 5KG6A 3N6NA 5KFPA 5DGBA 4DL7A 1S9FA 1IKXB 2UVRA 4ZHRA 4RW9B 1TQLA 3RB4A 5T14A 1RT6A 2D3UA 3KLFB 3V81B 3GV5B 4ED2A 2R8IA 3MEGA 4I2PB 1J5OB 3G6XA 4NLTA 4RUCA 2VG6B 5I3UB 4NLVA 5L9XA 2ZE2B 5HBMA 3LP2A 2B6AA 1DTQA 5CYMA 4KO0A 3C6TA 3IS9B 3KK3B 2FVCA 5KFZA 2W9BB 1BQMA 3V4IA 3NAHA 3MR3A 2RDJA 4Y2CA 1LWFB 4DG1B 1FK9A 1RA6A 1U09A 4WXOA 2HNDA 2IJNA 2FVQA 2OPRB 2C2RA 4EO6A 2BE2B 4KBIA 3BQ2A 1S10A 2IBKA 5CYQA 1QAIA 4ZVGA 3NL0A 4X2BA 3H5UA 5KFRA 1N48A 4I2QA 4ECTA 3DLEB 2D41A 3I5AA 1JLCB 1S1XA 3KLEB 3GYNA 4EEYA 1C0UA 1LWEB 3DM2A 3BSOA 1JX4A 4IH7A 1VRUA 4R5PB 4RNOA 3Q8PB 4WFZA 4Y34A 1RT1B 1TL1B 3MEDB 3KJVB 2IJFA 1TV6B 4G1QB 1OS5A 3I0RA 4NLQA 4O3SA 3BGRB 3PR4A 1SV5A 3MECB 3E01A 3I0SA 2ILZA 5KFOA 5KFNA 2W9CB 5L1LA 3FQLA 4IG0A 1VRTB 4RW7B 1S0OA 1TKXA 3HVTA 4NRTA 4EBCA 3C6UB 3HVAA 2OPQA 5KFBA 3BJYA 5KT7A 5EDWA 2V4RA 4YMEA 4FBTA 3ISND 2HNYA 1S9GA 4ZPBA 3DOLB 3LP0B 2YNHA 1RT3A 4J9OA 3CJ0A 5FDLB 1HNIB 1JLEB 2R2RA 4Q8FA 1HPZA 4MFBA 2HWHA 1IKYB 4MK9A 1DLOA 4Q0BA 1JLAB 1N6QB 2B5JB 1QE1A 2FLPA 4WYLA 2I5JA 4ED3A 1C1BB 4Q43A 1IM4A 3GIKA 4RU9A 4YP3A 4RW8A 3IGNA 1JLFA 4R8UB 1RA7A 3E51A 3DI6A 4MKAA 5J2PA 3KMSA 4O3PA 3OHBA 4ECRA 1ZETA 4PQUA 2XCAA 4KV8B 3M9NB 1HQEA 4ZP7A 3GIJA 4GC7A 1DTTA 4M94A 4IDKA 5C24B 3H4DA 4IR1A 1S1TB 1S6QA 5KG0A 3M8PA 4IFYA 2YKMB 3KLHA 4U6PA 2JEGA 5F9NA 1SH3A 4ECQA 1TKZA 1TVRB 1GX6A 2JEFA 1RTJB 2D7SA 2BRLA 1UWBA 2YNGA 3I5CA 2DPIA 2FLNA 2R8GA 1S1WA 5KFHA 1HQUA 4ECXA 1S49A 3MEEA 1EP4A 3KOAA 3OL9A 2HNZA 4KFBB 3HKWA 3RBEA 3QYYA 3KLIA 1S0NA 2W8KA 3QIDA 3TQ1A 2VA2A 1T03B 4WZMA 2YNFB 3DRPA 4IG3B 2FJVA 1D0EA 2R8HA 1IKVA 3LAKA 3D5MA 2HMIB 1RT5B 4Q44A 4RW4A 1JLGA 1LW0B 1RT2B 5C42B 1QAJA 3CDUA 4Y2AA 3OLBA 1KHVA 5KFSA 4F4WA 5F8HA 1W25A 2E9RX 4ED0A 2WOMB 1S9EA 2RDIA 5KFLA 5I42A 2IA6A 2IC3A 5J1EB 1TP7A 3CO9A 2RKIA 2CKWA 4KKOB 4ZPCA 4TQSA 3GILA 2UUWA 1S6PA 1EETA 5JUMA 1RT7A 2VG7A 3PJWA 3QGGA 4ZPDA 5KFXA 3VQSA 3QZ7A 2XCPA 4IQXA 3DMJB 3QO9A 3NKYA 4KHMA 3PW4A 3Q8SB 3GIMA 3FRZA 1S97A 3G6YA 4WZQA 5F8NA 2BANA 5K14A 5KG1A 4DL6A 1S48A 3H5YA 4K4WA 2IAJB 5KG2A 4J9MA 5KFDA 2W9AA 3NBPA 2AGPA 4ED6A 1K1SA 1HYSB 3N6MA 4JV1A 4K50A 3LP1A 3M8QA 4NCGB 4B3OA 5DGAA 4RW6B 4JV2A 5F8GA 4ZHRB 3G6VA 3MFIA 4URQU 1QUVA 1JKHA 5KFJA 1FKOA 2ZD1B 3SI8A 3BSCA 3V81A 3OL6A 3MEGB 2AX0A 1BQNA 4WXWA 4H4OA 2YNIB 4YQWA 3RB6A 4FBUA 4JV0A 4ED1A 3BQ1A 5I3UA 4TY8A 1RTHA 2QE5A 4RNHA 3PW7A 5HBMB 3LP2B 5CYMB 3QLHA 3KK3A 4KO0B 3FSIA 4ZP9A 1RAJA 5L1IA 1S1UB 4PUOB 4WYWA 4QWBA 3KK1A 3QGIA 1RDRA 4KE5A 3H98A 1LWFA 4DG1A 3QIPB 3OHAA 3T5KA 3BREA 2JC1A 2WCXA 3PJXA 1JLBB 2IM0A 2IM3A 3ITHA 3LAMA 3V6KA 4U7CA 3H2LA 1YVFA 1JLQA 4ECWA 2RF2B 4I2QB 1TL3A 5EWFA 3KHLA 3ICLA 1C0UB 3HVWA 3DM2B 4IR9A 2W8LA 3DRRB 4XO0A 4MH8A 4R5PA 4QWCA 3OL7A 1D1UA 1RT1A 3MEDA 1TL1A 1T3NA 3KJVA 4G1QA 2VG5A 2IMWP 2DPJA 4G3IA 4O3NA 1R0AA 4DL2A 1HMVB 2J6UA 3MECA 3E01B 1GX5A 4IG0B 5HP1B 1SH0A 4M95A 3M9MB 2B43A 4DEZA 2GC8A 5KFIA 1TKXB 2O5DA 3HVTB 2XWYA 1IKWA 3C6UA 1RTDB 5KT6A 5EUHA 2OPQB 3GV8B 2FVSA 3CJ2A 3KK2A 4TLRA 3H40A 2R2SA 3Q8QB 4HYKA 3RBDA 3IN5A 1S9GB 4WFXA 4RNNA 3DOLA 3LP0A 3BSNA 4FS1A 1RT3B 5F8LA 2F8EX 1JLEA 1HNIA 4MFBB 1IKYA 4ZMMA 4ZP8A 1DLOB 2UVWA 1JLAA 1N6QA 3IRXA 5KFMA 5KG3A 2AWZA 4H4MA 4IOBA 2I5JB 2WRMA 2I1RA 3RAXA 3DOKB 1WNEA 5KG7A 3OL8A 2ATLA 1LW2A 3DI6B 3IGVA 5J2PB 3H4BA 1REVA 4PQUB 3BQ0A 4KV8A 5C25A 2HWIA 3KHRA 3NMAA 3FDSA 2R8JA 3DRSB 1XR6A 2BR0A 5KFKA 4IDKB 5C24A 4O44A 1C2PA 3T19A 5DG7A 4Q8EA 2OPPB 2C2DA 2YKMA 3KLHB 4ZVFA 4ZVEA 3DLKB 2AU0A 3GQCA 2CJQA 1TKZB 4O3OA 4ZPAA 4JUZA 1RTJA 3BSAA 4NLDA 5EWEA 4Y3CA 1MMLA 1S1WB 3ISNC 5J2QA 3KLVA 1EP4B 4J9LA 4IRKA 2HNZB 4KFBA 4QWAA 3OSPA 1LWCA 5C5JA 4IFVB 2E9TA 2UVVA 1MU2A 3TAMA 4MIBA 2YNFA 3EPGA 4IG3A 3JSMA 2QV6A 1IKVB 3UPFA 4K4SA 4IKAA 2HMIA 1RT5A 1LW0A 4RZRA 4R0EA 4LSNB 4YR3A 4F4ZA 4QWDA 2WOMA 1S9EB 1RT4A 4TXSA 3PW2A 2V0NA 4ECSA 1NHVA 4ZVHA 1FKPB 4ZP6A 4KKOA 2ASJA 4O4GB 3PR5B 3PHEA 3KMQA 3DLGB 1S6PB 1RTIA 1SUQA 5HROA 2ZKUA 5F9LA 5J2NA 4URSA 3MTKA 1C0TB 3QO9B 4IH6A 4MK7A 2BANB 5K14B 3T5HA 4NLPA 4IH5A 4I7FB 5DLGA 4RUAA 3NBPB 5KT2A 2C22A 1T05B 3OSNA 1HYSA 2XC9A 4NLXA 4NCGA 4B3OB 1NNDA 3IG1B 4RW6A 4O4RA 4O3QA 4GC6A 1CSJA 2J6TA 5D3GB 2WK4A 3QGHA 2YKNA 4ID5A 3KLGB 3V6HA 1JKHB 1FKOB 2ZD1A 4YR2A 3PZPA 1HNVA 3UQSA 1N5YA 3V6DB 4ICLB 1BQNB 1C1CA 4ED8A 4DL3A 5DQGA 4ECYA 5L1JA 2YNIA 4H4OB 3MFHA 5HLFB 4FS2A 4NLWA 4TY8B 1RTHB 5KFTA 5F8MA 5KFAA 1S1VB 4MIAA 4K4UA 1KLMB 4PWDA 3QLHB 4WE1A 3DYAA 3JYTA 2R2UA 1TKTA 1XR5A 3H5SA 2OPSB 1S1UA 2WONA 4PUOA 5J2MA 1Z4UA 5KG4A 3TVKA 3KK1B 3GV7B 3N6LA 3QIPA 4IRDA 4KAIA 2C2EA 1JLBA 3OLAA 3ITHB 3G86A 3I5BA 3MR6A 2AQ4A 3EZUA 3FFIB 4LSLB 1JLQB 1IKXA 2RF2A 2HAIA 4RW9A 5DG9A 1TL3B 4F50A 4F4YA 4DL4A 3H5XA 5F8JA 1RT6B 3KLFA 4EYIB 2XGQA 3DRRA 4QPXA 3KNAA 2E9ZA 4I2PA 1J5OA 4ECUA 2FVRA 3SFUA 2VG5B 2VG6A 2ASLA 2GIQA 3CJ3A 1R0AB 2ZE2A 1HMVA 5HP1A 2B6AB 1DTQB 4TYAA 3UDLA 3C6TB 3IS9A 4NYZA 5KFGA 5KFQA 2W9BA 1BQMB 3V4IB 4K4VA 3H59A 1JXLA 5KG5A 3Q8RB 4LQ3A 2BRKA 1FK9B 2OH2A 2HNDB 2OPRA 2BE2A 1IKWB 1RTDA 2W7OA 5DQHA 5CYQB 3CDWA 4MKBA 3KK2B 4EO8A 4H54A 3DLEA 1S1XB 3KLEA
chains in the Genus database with same CATH superfamily
3EVWA 5F8NA 1CJUA 4FP9A 4KPCA 1ZYQA 2VV5A 4Z2XA 3I56S 2FJXA 3CJQA 4DQRA 4K4ZA 1FD8A 3TARA 2YY3A 4YHHJ 1NCLA 4WBFA 1TV6A 2GIRA 3I0RB 3CJ4A 5F3ZA 4GVBB 2DNRA 2DGXA 1UVJA 4OZ0A 2HHHJ 2ZBCA 1SV5B 3BDEA 1K8AT 1VQNS 1OSDA 2CJAA 2KJWA 2XMTA 4JI4J 4K0KF 3AD8C 2AGQA 2ZOMA 1XC9A 2CIMA 1ZZFA 1NZ8A 1RHMB 1WOPA 4N76A 1RHJB 4O44B 2EPIA 1Q53A 2EKNA 3RB0A 1WTFA 2GVDA 3NEKA 4ZLNA 3KUHA 4TU8A 2OPPA 3RB3A 1UKUA 3FMBA 5EX3A 4C3KA 1G4CA 5FDLA 3M32B 2E1RA 3TYTA 1XN9A 2ZH2A 4Q0BB 2IA0A 4ZVRB 3W64A 2B5JA 2ZWOA 4WK1A 1QE1B 3DDKA 4JI5F 5J2QB 1U1RA 1C1BA 4NZ0A 2E7XA 3GSDA 1V6HA 1VRQC 2FC9A 2ZNYA 3VZHA 3V6JA 3CPWR 3OD2A 1LWCB 2KL8A 1HI1A 5KFEA 2MZTA 3K8VA 2FY1A 2YWFA 4NMXA 3CJ5A 4NLRA 2AJ2A 2UUBJ 2BE7D 2ASDA 2Q43A 1N36F 3P5TL 2H5IB 1GXUA 2DHHA 2W2PP 1BHNA 2RQMA 4OMFG 4ETZA 1Y5NB 4M8LA 1WOSA 5IT9Y 4NLOA 1TELA 3VVTA 2KM8C 3FEXB 4ENOA 3NGKA 4C0OC 3Q23A 1UL3A 3DU6A 1SJFA 1WHXA 3NRBA 4DCJB 1HQUB 2X3DA 4OYWA 4QWEA 3CWJA 2AYGA 4NLSA 2HHWA 2J6SA 1Y0HA 2HQGA 5E3RA 2GCFA 4ZCIA 5GAEU 2WSCC 5AE2A 4Y65A 2QGFB 4BWJA 2PEBA 4DR1J 1JB0C 3RBXA 2OEJA 4I7FA 1U4BA 2D69A 4Q7AA 3WIUA 4BCAA 3VAKA 4Q45A 2FVPA 3ZZYA 4DX6A 1PG5B 3T6JA 2ADBA 4F3QA 1F1BB 2E5JA 1XERA 3TWZA 5HVHA 1X4BA 3CJKA 5D3GA 2YQ1A 3PO4A 2YKNB 3KLGA 1FWKA 2NUUG 1I94J 3D6HB 1CEZA 1O8BA 1LOUA 5DLFA 2HK3A 4MK8A 1KQKA 4QW9A 2OELA 2KYZA 2IC3B 1DARA 3V6DA 2Z0GA 3B82A 2DCLA 3LGHA 5KT3A 4K4YA 4PG5A 2FTRA 2O1PA 2L9WA 3BR9A 5ADZA 5HLFA 2LA6A 5D15A 1CJVB 1L3UA 4DL5A 1CS4A 4HR2A 4QYRA 3NGDA 1S1VA 2R7UA 4PWDB 4Z37A 4P72A 3JYTB 1VHFA 1X8DA 1PCAA 3DDNA 5IC4B 3ENVA 4PG7A 2G1HA 4A8OA 5J2MB 2LXIA 2VC1A 3CTRA 3KHGA 4A8YA 2Y9HA 3NNHA 3ENQA 1FNXH 2BQUA 2IM2A 2UUBF 4ECZA 2DJWA 5A8RB 2VODA 4C48A 2VA3A 2JLEA 2HQDA 3M8QB 2UUTA 5DGBA 4LSLA 3N6NA 3ILJA 1S4EA 2XMVA 2MGZA 3EVOA 5M2RA 4X4RA 4F2RA 1SC3B 1FWLA 1UFKA 1R6VA 2W4PA 3BH6B 4B3RF 1SIZA 4ED2A 3VQTA 5AE3A 4I2PB 5FIIA 4RL1A 2HS0A 3ZNJ1 1YJTA 5I3UB 4PXDA 1OYDA 2AV5A 2DNMA 1WDDA 1OO0B 1S6OA 2XG8A 2MJUA 5HBMA 4RLEA 5L9XA 5KFZA 4A8KA 4KO0A 3C6TA 4WU3A 3UNGC 2RDJA 4FYXB 1IBKF 3V4IA 4WPAA 1YBUA 4UZBA 4Y2CA 3DRYA 2RD5C 2VDIA 4JI4F 5DO2A 3PYDA 4EO6A 3BZQA 2JLGA 2UUCF 4AQYJ 4JI7F 4JP8A 3SCLE 2ZZMA 3EUNA 1QAIA 2M8HA 4ZVGA 4CTAA 3UCUP 2VDHA 4PR6A 2V2KA 5G0RA 8RUCA 1RKJA 2AW0A 2RB7A 5GMKa 4ED4A 4PG8A 5JVGQ 1S1XA 3GYNA 4F4AA 1KNZA 2B4VA 1UVNA 1HHQA 3DM2A 9RUBA 1CJUB 3A12A 4QIWD 4KC5A 1SJ4P 4DV5J 3SDEB 2NYIA 2VFSA 4HI2A 3C3LA 3MM5B 1V3RA 3MEDB 3KG4A 4Y2KA 4G1QB 4RPFA 3I0RA 2Q6BA 2MQLA 4YB1P 2RQKA 3A1YG 4GVBA 4DSIA 1I3OB 1FJ7A 4OI3A 1SV5A 2KM8B 4Y2IA 4IG0A 1N54B 1NUEA 1VS3A 1GK8A 1UJ6A 3M2UA 4GKKJ 3NG8A 4ELVA 4Y00A 2YWEA 4NRTA 5E0OA 3HM9A 1QVGR 3ZTRA 1YIJS 4FBTA 1SC6A 1WF2A 2FYXA 4B9SA 2MKYA 3GIIA 5LMUJ 3S01A 4J9OA 4JYAF 4TNOA 2CJKA 4KGVB 5DS7A 4ANEA 4Q8FA 1HPZA 4MFBA 2B3TB 3MD1A 1IJEB 4DFMA 4MK9A 1D9FA 4F25A 3KWMA 1N6QB 3IXQA 5RUBA 1ZM3A 1YRTA 2QL9B 4IYQA 2I5JA 1YJRA 1C1BB 3GFYA 3ZC4A 1FJGJ 4RU9A 4YP3A 4RW8A 4X62F 1PBAA 3OVSA 2RUGA 2VB6A 3UDCA 3DI6A 1N0UA 1RBAA 3O3LA 4RO0A 5E3CA 4PQUA 4C8LA 1R8HA 2MQMA 3ZZTA 5H9EK 3W61A 2Y8WA 4LFBJ 3J7YU 3L09A 4DPXA 1Q0NA 1VFJA 5HMYA 3G8TA 4OZ1A 1RSCA 1R7IA 4OZNA 4CP5A 4GC7A 5ETLA 3TUPA 4LFAJ 4DR4J 1S1TB 4W92B 1XEZA 2EXUA 3CMES 4LR9A 3KLHA 3GYGA 2LFVA 1S99A 4I1TA 4D3GA 4ECQA 2IDEA 4OZLA 3S8SA 6AT1B 3J7AN 1RTJB 3QMQA 3RG6A 2KFYA 1UMJA 3GR0A 2KO1A 3W9IA 2C3OA 2XNQA 3FNNA 2DNPA 2XMWA 4R0JA 1JWWA 1S49A 4WIQA 1DQ8A 2DH7A 3TANA 1FFSB 1NPPA 2CQCA 5CAAA 5HO4A 1H2TZ 2CNKB 1WD6A 2CPDA 3WC0A 1S0NA 2CYYA 1A6LA 1DBDA 1WELA 1ZA2B 2A0FB 2JWNA 2W4CA 2DGQA 2YNFB 2VC0A 4MTPA 3SCJE 3RR7A 2LECA 3V5RA 1WJ9A 2YKAA 1D0EA 2OMLA 3DHWC 2ZH1A 2RU3A 4JOUA 3AH6A 3CCQS 1J2VA 5E41A 3NWGA 2HVZA 3ETOA 4OHYA 4FXDA 4W4MA 3AB4B 3OXFA 2J8AA 5ETNA 3TR5A 4U9RA 5IV3A 3QFHA 4DV4F 1LXNA 1OPIA 3CO9A 2RKIA 2GHVC 2G9OA 4AE5A 4Y0FA 2RE1A 4HT7A 3HKZD 4C0BA 4TQSA 3BV8A 1URNA 2NQPA 4X62J 1RT7A 2VG7A 3QGGA 2XCPA 2GQQA 1YHQS 3OPKA 3PW4A 3MM9B 4WZQA 4LIRA 5K8NA 4C11A 1RBOB 1NH8A 3AB2B 4DL6A 2DHSA 4P9SA 4UT4A 3H5YA 2IRYA 1FHTA 1Y3KA 4UW2A 1CBKA 5HQLA 5KFDA 3UVJB 3UD3P 1ZPVA 4KY3A 1QSSA 3D68A 5C7PA 4P2MA 4ED6A 1XNQJ 1Z2ZA 4CCHA 5B0GA 2EEYA 2GHWA 4M5HA 1FTCA 4FKXA 3RUBL 4HLBA 4OJHA 5L38A 4ZHRB 2CPEA 4C8ZA 2FJEB 4ZJQA 3A3OB 1Q16B 3V81A 1BGXT 1S77D 3OL6A 2HSEB 1BQNA 1HIYA 1O6XA 4P74A 1QTMA 2Q66A 4H4OA 2YNIB 2DNYA 2C3PA 5HJXA 4B9LA 4RJVA 4ED1A 5I3UA 4LVNP 4TY8A 3JSBA 4RNHA 5HBMB 5CYMB 4FPIA 3BGOP 5ETSA 2XULA 1HBOB 2POKA 3VTIA 5EX0A 5JMNA 1S1UB 5L1IA 4BC7A 1R89A 1BWEA 1RDRA 1NK5A 2A6MA 3T5KA 4FYVB 3PJXA 4OFZA 3HULA 1APSA 1K44A 2IRUA 1NSPA 5G0RB 1PJ7A 2I6WA 2ZH4A 3MUTP 4ECWA 2DGOA 2N7YA 1A7GE 2H1YA 3PYEA 2L3MA 4DV2J 1NK9A 3KHLA 1YRXA 1NB7A 3HJFA 1ZAXA 2C2KB 4XO0A 3SDEA 2HQFA 2V2ZA 3MM7B 1U7LA 4DZ6A 3MEDA 2MQ8A 1SKRA 3KJVA 5U47A 2VG5A 2OD6A 2V8PA 1U1NA 2DPJA 1RCOB 2H48B 4GMKA 2ZC3A 2MZ1A 3I32A 3GMGA 4B3MF 1B70B 4CO2A 3IFEA 2P9GA 4M95A 1WI8A 2B43A 2MY7A 3D67A 5KFIA 4JI5J 1TFWA 1TKXB 2NCKL 4UTGA 1V9OA 2F7VA 2NPIA 5LOQA 4Z7YA 1BWVA 1U0SA 3G87A 3N4WA 5EUHA 3R97A 2FD2A 3SIPB 2R2SA 3MMCA 3H40A 5ETKA 3IN5A 3RBDA 2PI5A 2W7AA 4RNNA 1L3VA 1IBCB 3BDPA 4JV5J 1U26A 5A6WA 2PMZD 4UUXA 3OFHA 2VHGA 4ZP8A 2WVCA 4ES3A 2M4MA 3VAMA 3F73A 2I5JB 2HHVA 1HWUA 3K17A 1EX8A 2I1RA 3IC1A 3N5FA 3RAXA 1V5IB 2EG1A 1GT8A 3TA2A 5KG7A 4WF9Q 2JOQA 5E3AA 3MXHP 5J2PB 4LRDA 4Y6IA 4PQUB 1FRMA 2DCUB 4N77A 2CPFA 1LNQA 2ZM6J 5LT5A 2HFOA 2EFPA 1G2EA 2CDRB 1PAEX 2DK2A 2M7SA 4OHXA 2BR0A 3AOCA 3ZO7A 1WKJA 3RZAA 2GVDB 4QIFA 3P4UB 3OTCA 3W1YC 2ZJRQ 3HSZA 1RTZA 1VQ7S 2Q3PA 3A13A 1NSAA 3KLHB 1GTEA 2F9JA 1VMBA 1RCXB 1ZA1B 2HKEA 1PC5A 1Q7LB 2G0IA 2KT3A 2LCWA 4I69A 4DMZA 8ATCB 4B9MA 1MN9A 2MPUA 1J5EF 4LF9F 3RRHA 4AUKA 2R7SA 2VPZB 1LK7A 4USIA 4NLDA 5EWEA 3R7NB 2CPYA 1FDAA 4WP8A 1EKSA 2HHPA 1N34F 3QBCA 1EP4B 1PGZA 1S76D 3BB5A 1LWCA 2ZHAA 1I94F 1EKRA 3N5BA 3ADAC 3BN4A 1U8WA 2PGCA 4N41A 4DUYF 2E9TA 2UVVA 4MIBA 3TRGA 2YNFA 2I9SA 1TL5A 3FCWA 3NCRA 5IT0A 2W1BA 3EPGA 3EE3A 3LPYA 4P2FA 4IKAA 4K4SA 1RT5A 2LQJA 3L7OA 4MKVA 1HI8A 2VUGA 4NA2A 5ETPA 4AFFA 4CO0A 6FD1A 3CCJS 1SC4B 5T7LB 1N33F 1YGYA 2E5LF 2PMWA 2K06A 1IBMF 3R2DJ 4AT1B 3GCXP 2NYHA 3LW5C 4CDIA 3D2WA 4JI8J 1S9EB 4DSFA 2HVIA 2YQ0A 2V50A 3M2VB 4TXSA 2Z57B 3PW2A 2V0NA 3TZXA 1NHVA 2HVEA 4ECSA 3QQCD 4J7CA 1NDCA 1FVQA 4BS2A 4HVZA 2ASJA 2LDYA 4ZP6A 4X66J 3PR5B 2UUAJ 1PSDA 2M8DB 2OKQA 5F9LA 1I51B 4OYOA 1FTRA 1TZ0A 4RUHA 2VQEF 1L3SA 2HFNA 2HHQA 3SZ2A 3TUIC 3R1LA 1C0TB 4IH6A 2AJQA 1FESA 2HFSA 2HRUA 3M1VB 4NLPA 3G4SS 1YBTA 1Y11A 5DLGA 3GG1A 1UJ5A 3NS7B 2OSQA 5D0EA 1HD1A 4LRAA 4PWUA 1NNDA 1KEKA 1MWZA 4A8FA 2D3OR 4QZVB 5D3GB 1VQKS 4ID5A 2CDQA 1JKHB 1A0OB 4J9VA 4C7QA 3FCHA 2DR8A 3MPWA 3NGTA 2H4YB 2CWKA 1N5YA 3V6DB 2OEKA 3VGSA 4ICLB 1AXQA 1BQNB 4USVA 4ED8A 1VJWA 1M1GA 3PIPQ 4ECYA 3K5LA 1H38A 2CPHA 1CJVA 2GA7A 3N28A 2X1FA 4TY8B 2XMKA 1S1VB 4MIAA 2JVOA 3HP6A 4PWDA 3TEHB 3QLHB 4WE1A 3JYTA 4AD6A 5KG4A 2KU7A 5J2MA 1Q5YA 2HG4A 4N7TA 3G6ES 2QLXA 3GJSB 1ZPWX 3N6LA 2NS1B 3WQPA 2DR7A 2AYEA 1JLBA 1PJ5A 3OLAA 2X1AA 1RHQB 1SKUB 2XYHB 2N82B 5H9FK 4OYIA 2AQ4A 3P6YC 2GZOA 3FFIB 4XTTA 4LSLB 1IKXA 2FLOA 4F4YA 3UN3A 3H5XA 1TAQA 2B0GA 1FRLA 2Y3YA 4CO5A 4DL4A 3CCMS 4EU0A 5FJ4A 2GO8A 5K9FA 2J0QD 2HK2A 3Q8YA 2D74B 4MMOA 1EAYC 1DHMA 2K2PA 2V9KA 4ZOSA 1UWAA 5J1PA 3E8OA 2BJEA 2XTJP 4DR3F 1J5OA 4EZ6A 2E9ZA 2JFKA 4H4KA 2OLWA 3CD5A 3K59A 3CULA 1Q8KA 1R0AB 1KLNA 4X64J 3NNCA 2BMBA 2DHXA 2GQCA 1FI4A 4NYZA 1BQMB 3V4IB 1S79A 1ZOTA 3B4DA 3H59A 3R6GB 3Q8RB 4JI1F 1U25A 1VIXA 2BJDA 1FK9B 1SBRA 1WF1A 3MI7X 2IFXA 1WSRA 1RTDA 1NAQA 1YBAA 2W7OA 5CYQB 2NSCA 3TAQA 5HVGA 4CTAB 3MMCB 5JJBA 2B4OA 2UU9J 2L48A 4H54A 4ZK7M 2L9NA 3DLEA 5ETMA 4HTIA 1S1XB 3O44A 4OJ1A 2FJBB 5IZHA 1EQMA 2PD1A 1LWEA 3G8QA 1ZTWA 1JK9B 4MYUA 4DFKA 1VRUB 4AXJA 1O51A 2ALZA 1EJ7L 4OV1A 1R0BG 2DBBA 2DNGA 3V2UC 4DS4A 4F26A 1ZZNA 2HVHA 4O0NA 3PTWA 3S6EA 4B08A 1VOMA 5DG8A 3VWSA 4FKYA 3GSIA 5CH7B 4DQPA 4WKRA 5DQIA 1U6ZA 1KOOA 2MQPA 2FJWA 1TUGB 2KI2A 3M2UB 4TVAB 4O3RA 1KHWA 4DUYJ 4QIGA 3QSYB 2KHDA 1QUPA 2DNNA 1HNZF 2RRNA 4Q2LA 5DDRC 2E5HA 1SVDA 4DOZA 2VL1A 2OGUA 5EWGA 3MPVA 1S4FA 1FRXA 2JC0A 2P6TA 4LBIA 3DLKA 1NEEA 2BM1A 2CVEA 2PC6A 3E2EA 1HBMA 3NLCA 1WSVA 3WZ0A 1HPZB 4DCOB 5KT4A 4LF1A 4NZ7A 2GJFA 3VAGA 4JI8F 4DR3J 5L39A 2HFVA 2HURA 2OSRA 2XO6A 3CIZA 3W8PA 3DOMB 4NI2A 2H9ZA 2YKPA 2NXCA 3KKFA 4RKUC 4TN2A 4CO1A 4RW8B 1N5VA 2JH3A 2DNHA 4R8UA 4KR0B 4DXLA 2DGUA 2JL9A 4ZJOA 1T9TA 3U1NA 3VGTA 4DV4J 4RNMA 4OIXA 1NK7A 2IVYA 4YDDB 4OQJA 2A2CA 1ULRA 2JZ5A 2YX4A 3A3NB 2BW7A 3W5ZA 2MKSA 1QTNB 7AT1B 2V69A 4X66F 2W24A 4LQ9A 4XDDA 5KT5A 1HNWJ 2BKPA 2IM1A 3CDEA 1S1TA 1S6QB 4LSNA 2E5GA 4XPCA 3LALA 3CJSA 3M8PB 1DY3A 3AODA 3D1HA 1WKKA 2K7JA 5F0UA 2CPJA 4A8XA 4CLLA 2PN6A 4DPOA 3U1MA 1X5PA 4J9NA 4JI2F 3RAQA 2N3LA 3TX8A 1RT4B 4WCEQ 4J37A 1TMMA 2WVDA 4YN3B 2XI3A 2V4QA 1UWBB 2JFDA 1VHIA 5IS2A 1N56A 3BGUA 2W7PA 3MEEB 4MJKA 1ZBTA 4GRSA 1FNOA 3D9BA 1C0TA 2EFNA 1NLKL 4URGA 2MSSA 3BS9A 2CPXA 3KHHA 4DR5J 2XEXA 1NMEB 2GAHC 1H3DA 3TJ8A 2V9WA 2C3UA 4CT8A 1OWXA 4HKQA 3FQKA 5F8IA 1B99A 5C42A 2BACA 1MN7A 2NXUA 2W2QP 3BBCA 3G82A 2ABYA 2WHOA 4N5SA 3OJUA 3BO4A 2YXLA 3OT9A 3W5XA 3DRXA 5HVFA 2ZUAA 4ID5B 1RYSA 3JSYA 3QJPA 1MNEA 2BJ7A 2ZWPA 1HNVB 1X5TA 2QTWA 3M8WA 1N5YB 4ICLA 2RKIB 1YITS 1VLOA 3D1OA 3MM6B 1FEHA 2G2OA 2H51B 3UD4P 1OMSA 4MIWA 4EBDA 1EETB 1UVIA 1RT7B 2VG7B 1Q95G 1Q81T 4PWWA 4WE1B 2FZCB 4LRFA 3WC2A 5AJ3J 2R2TA 2QLFB 1YJUA 5F41A 4OYXA 3UVJA 5KFMA 4HEA9 3QGPA 3O8WA 2XI2A 4DX5A 5CD4A 4DU7A 4C2MA 3K0JA 4NRUA 1RWNB 1GXLA 2NXJA 4JB8B 4TY9A 3PW5A 4C6AA 3FFIA 3JQMA 1AFJA 2UVRA 2BBEA 3MAHA 1N5TA 1IKXB 4EWTA 3DKDA 4ZHRA 1M5KC 1X31C 2CQ1A 1ZAWA 4UUWA 1RK8A 2RS8A 3OR1A 3B54A 3RB4A 3KLFB 1BE4A 3V81B 1HW9A 2HQIA 3NY0A 2FZKB 3ONQA 2R8IA 2KT2A 1SXLA 3VHQA 2J6TA 1NKBA 2QZ8A 5B09A 2VQFJ 2VIHA 4ZS6A 1J5OB 2G0JA 2V8DA 4FPRA 3AJ2A 1PYOB 3K7RA 1JXEA 2HZAA 2XO7A 1FDDA 2XZDB 3SYZA 2ZE2B 5HP1B 5CYMA 1W26A 1DTQA 2QFIA 4ITSA 3HI9A 1HBOA 2M9KA 1BQMA 4OLPA 4G1PA 2MSTA 3GJTB 2C42A 5I3PA 1HR0F 1FK9A 1XQIA 4FF2A 3AQPA 2A3JA 4CH0S 4ZIWA 3BQ2A 1RUSA 2YPYA 4KBIA 2A1BA 4L76A 5CD4H 1S10A 5CYQA 3HHLC 3ISZA 2MEWA 3M05A 2RHSB 4ZVTB 1QSLA 1NBEB 3H5UA 3GB0A 2XMUA 2UV8G 2F8MA 4ECTA 3DLEB 1VLYA 2P8IA 4ZVPB 3Q8UA 5IQ6A 1ZH5A 1LWEB 5AE1A 3W63A 1NHKL 4RNOA 1VRUA 5FD1A 3TQEA 5A6PA 3Q8PB 3AD9C 4DQSA 2Z4PA 4P2XA 1DFDA 1N5QA 3GONA 1F6TA 3HZGA 3KJVB 1BMQB 4A8QA 4RBUA 4C8OA 1Q86T 4OX8A 2Y1JA 2LYVA 1AT1B 3QJLA 2QSFA 5KFOA 5L1LA 2JRSA 2V8GA 1EARA 4DI6A 4DFPA 4C8NA 3RAMA 2DGTA 4ANCA 4N56A 2V63A 5T41A 4FF3A 1TKXA 5BJRA 3PM9A 1DRZA 3CT9A 4EBCA 2GHPA 1QM9A 2OPQA 3BJYA 2V4RA 1RKIA 1VC5A 1U2CA 2IVMA 3BYRA 3DLJA 3IP0A 5CHCB 2FIUA 2KRBA 1RADB 1CLFA 2HFZA 3CJ0A 4EK2A 1HBMB 1HNIB 2DO0A 1R0CB 2OAUA 2XWXA 3KFWX 1IBLF 4LR7A 1IQZA 3VZIA 5HQMA 2CQ4A 3N01A 4WYLA 3GIKA 4Q43A 3AA9A 1TK0A 2A2DA 3EVMA 5GADU 1X4CA 2CWXA 1RA7A 1U2FA 4MYTA 4R8UB 1CJKA 5J2PA 3BBBA 4O3PA 3KMSA 4MAKA 4ECRA 1ZETA 4FF4A 2VBZA 2V8HA 3BF4A 2MKCA 5B0CA 3M9NB 2WBRA 5K8OA 4OHWA 4RWXA 1OJ4A 5ETVA 2W4DA 3GFZA 3GIJA 2RQCA 4IDKA 3C16A 5DZ7A 2QA1A 4DN0A 1U02A 4YUDA 3VALA 5AXLA 1S6QA 1FJGF 4HHJA 2QX0A 3BH7B 2DXEA 3M8PA 4IFYA 4ALZA 2N7CA 3T1HJ 1R43A 4DR6J 4OI2A 4QR0A 4YY3F 5F9NA 1XNQF 1V5VA 4ZVOB 5IWAJ 2QJ3A 2G2YA 3KNGA 2R7WA 1GX6A 3W2VB 3AFGA 4JI6F 4P10A 5HN0A 3MAQA 2JEFA 1XNRF 2D7SA 2BRLA 1UWBA 2DPIA 2Y1LB 2FLNA 5DZ6A 5IOLA 2Q1LA 1RAOA 3MOZA 3MEEA 1EP4A 1LK5A 4OX9J 3KOAA 1KRPA 4DBQA 1VQSA 3HKWA 2CZ4A 7FDRA 2P5VA 3IAM9 4KHPJ 5KAKA 4ZCKA 2W8KA 4NXNJ 3QIDA 4DLEA 1UETA 3IR6B 2FJVA 1IN0A 2BJ1A 1IKVA 1UPPA 3R3TA 9ATCB 1AUDA 3QRRA 1RT5B 5C42B 5HI7A 3EX7B 5T7LA 1KHVA 3SQOP 2E9RX 1UEUA 2OEMA 4DHVA 1GMUA 4ED0A 1YJNS 5D77A 1S9EA 5B0BA 3M2VA 3SSQA 3WX4A 3ZZUA 4ZITA 3MGJA 2YH1A 1TP7A 4DUTA 1H74A 2J8SA 1ICEB 5D4LA 1URRA 3PNIA 4ZPCA 3MPUB 3VCDA 3MM6A 3GILA 4LF4F 4HI1A 1UAWA 2GNKA 3W5YA 1EETA 2ZH6A 4ZPDA 3W7BA 1S7IA 3DMJB 2Z2YB 2ZBPA 3EXCX 3GIMA 1Q1KA 4QIEA 4MT1A 3M1VA 1S48A 2CZVC 4PPDA 3PX4A 2CA9A 4J9MA 1T9UA 3SEOA 3W60A 2W9AA 2J76E 4I6YA 4F2SA 4LF4J 3SXLA 1P1LA 4F7VA 4K59A 1HYSB 2VJUA 3N6MA 5H1SV 2DHAA 4K5RA 1VK8A 2XM3A 4NCGB 2R4FA 3FBEA 3J7A1 1KVJA 1FXRA 5CXTA 2WW8A 4JV2A 4JV5F 3G6VA 2DGWA 1JKHA 1WC6A 1TUWA 3OR1B 3B6BA 4KGXB 3TNVA 3C66A 5DETA 3SI8A 2F4VJ 5BYQA 4EGLA 1YZ7A 3M6VA 1XJWB 1BXNA 3JTPA 3LGNA 4WXWA 2PFDA 3C8YA 5GMDA 3R5DA 5HANA 4JV0A 1NM2A 1F9FA 2QE5A 4NYPA 1SCJB 3ETMA 4P7VA 4PEOA 4WU2A 3KK3A 1FJEB 3QLHA 2DRAA 2MKHA 2MTLA 1RAJA 2FHKA 2VJVA 4EMDA 5IC6B 4QWBA 2IJRA 4DV3J 2DHGA 2DNOA 1T7PA 1R8AA 3BREA 4LIWA 1SL0A 1JLBB 2MKKA 3LAMA 2VZ9A 3P49B 4LFBF 2AYMA 3ZZRA 2KVQE 5A8WB 4F02A 4HDGA 4WWSA 1OQ3A 2D3O1 2GV1A 1TL3A 2NREA 3LH2S 4XAKA 1FXDA 1K0TA 5EWFA 1AA1B 3CB4A 4X4TA 2VQEJ 3DRRB 3ILIA 4QWCA 2LXFA 2Y0SD 5GAEI 4DV7J 3B78A 4B3TF 2U2FA 3OL7A 5CYJA 4NPOA 3EYZA 2IMWP 1LFWA 2YBVA 2WVFA 4CO3A 4YS2A 4DF8A 4O3NA 1R0AA 1WTBA 2HS3A 4G3IA 2DH8A 1NSKL 2BVZA 4DV5F 2HBYB 2BOAA 2RH3A 4CZCA 1MROA 3U7JA 2GS8A 3R5AA 4V1Ak 1RTDB 2AF6A 3LWMA 2N4DA 2OPQB 2CJ9A 3CJ2A 4TLRA 4HYKA 5DDPC 2KXNB 3NP5A 2EKYA 1N0VC 2P2CB 1S9GB 2YH0A 4WFXA 1MLAA 3DOLA 2MLXA 3EGVA 2FC8A 3I31A 1VQLS 5CZXA 1MG7A 3GP9A 4C8YA 1HNIA 4NASA 4HL9A 3ENWA 3FBBA 2ZZTA 1RHRB 1FF2A 3KTQA 1P8GA 5KG3A 2AWZA 3WDOA 2E5LJ 3DXBA 2FJDB 3CO0P 4GKJF 3KDOA 2XHWA 4WTYA 1KQGB 4FZVA 3A4TA 2ATLA 1LW2A 2Z56B 4YY3J 4YDXA 4DSLA 4DV3F 3R7BB 1HNXJ 3CC4S 5AT1B 4QIVA 5K20B 1N32J 2B51A 5LSOA 5KFKA 4IDKB 1C2PA 3C16B 3MD3A 1UEVA 2C2NA 3T19A 2KVIA 5DG7A 3W3SA 3OJSA 5EHHA 5KOWA 1WG5A 5CCLA 4CT9A 4FYYB 2C2DA 4ZVFA 4OYZA 3DLKB 3GIRA 1HHTP 2AU0A 4JI0J 2ROEA 4PKDB 4X4SA 4O3OA 4DQQA 3QT5A 4ZPAA 1YK9A 5BR8J 4JUZA 1BQXA 1SJ3P 3RRGA 4C3LA 2DITA 1GAOA 2IPOB 2V2VA 4Y3CA 1GMWD 1S1WB 3DOMA 4NI2B 3UWTA 3MOJB 4J9LA 1RXOB 2B9YA 4USMA 3QFWA 3I55S 3HPOA 3OSPA 2X3GA 4NL5A 2XZWA 2VOPA 2O66A 2DRBA 3EJMA 5HJYA 1F3VA 2NXEA 3MCNA 4NYOA 1T9XA 1LFPA 3CD6S 1IKVB 1UJ4A 2HMIA 4A8MP 3TZWA 1GNKA 5LMNJ 4LSNB 2CQ2A 3WBZA 2ZEJA 5K8PA 2FB0A 3NGRA 1RT4A 5CQGA 2DKOB 4ZVHA 2B9EA 3A8IA 1Q8BA 1FKPB 2CPZA 4KKOA 2DNZA 2WZ1A 4O4GB 4B3TJ 4ZVQB 2E7VA 3KMQA 3DLGB 4ZN1A 1SUQA 4DX8H 3KG1A 1LXJA 1R6YA 2Q79A 3DXSX 4K2XA 4KGZB 4URSA 5ETRA 3QO9B 2FPHX 3LPEA 3MTJA 5LJ3Y 3OVAA 1PO6A 1YJWS 2XLIA 2B56A 3BR8A 3C14A 1FNMA 4B17A 3BO2A 1U49A 4KTQA 2XHCA 2UXBF 3NBPB 1S72S 5KT2A 2HBQB 2HBRB 2C22A 2AJFE 1HYSA 2GMHA 4CO4A 3JSRA 1S7HA 3T6BA 3G82B 1XMBA 4NCGA 4NLXA 1X4EA 3IG1B 3GR1A 1FCAA 3UO0A 1SKSA 1CSJA 3NS6A 4BHQA 4R25A 2WK4A 1X9WA 1L5UA 3Q8VA 3KJNB 2K1RA 3BN7A 1R8CA 5DDQC 1NK6A 4YR2A 1F2GA 3PZPA 1HNVA 1WC1A 4HTJA 2L41A 2B9XA 3IBWA 2ZITA 4DL3A 4IO1A 5CCMA 4FS2A 2CNLB 1WHVA 2BUNA 3ZTOA 1RTHB 5KFTA 1X4FA 5KFAA 1FKAF 1TKTA 4YB5A 3TVKA 2QSWA 3ZTPA 4PUOA 4ZVSB 3TP2A 4ZN3A 3T3FA 3EDQB 1M5PC 4OZJA 1TUVA 2UXCF 2LEAA 4KAIA 3PO5A 1SI9A 4G6VB 5A8KA 2KZZA 3G86A 3I5BA 3H20A 1AUSL 2VFTA 2V4JB 4I0WA 4OYAA 3H25A 1K9MT 2PIIA 3HHDA 1OIAA 3A8EA 5A8WA 5HMZA 3M8RA 2OIHA 1JLQB 3BYPA 3C15B 2HAIA 2GJIA 4RW9A 5DG9A 1TL3B 4F50A 4JI3J 2DD8S 2ZFHA 3PFOA 5BR8F 3KLFA 5F0WA 5SZTA 1IBLJ 4F8RA 3DRRA 1I1GA 4QPXA 5CA5A 3OFFA 2VBXA 1J27A 3W2WA 3KNAA 2AZ3A 4N8OA 3ZZ0A 3GJQB 1ACMB 3NCQA 2VG6A 3UD5A 1WC3A 2E1PA 3P45B 4JBCA 2ZE2A 5HP1A 8AT1B 2B6AB 1DTQB 5KFQA 4IR9A 2HHXA 1NO8A 1TL7A 3OFEA 2BXJA 4ES1A 1WC5A 4ETXA 4K4VA 4PXBA 3D0HE 5B0EA 3PG9A 2CFXA 2V34A 1FFGB 2OPRA 3HJVA 3CCWA 1IKWB 4M5NA 1U45A 4KQZA 1T0TV 1IR0A 4MKBA 3S7RA 4QYZK 3NOCA 3Q89A 4RU2A 1OSCA 1PKUA 3WIVA 1Y00A 5KTQA 3FBCA 4J9UE 2HHTA 2HHHF 3LO3A 1QVFR 2RIJA 3HT0A 1IR2A 3QZ8A 1IXKA 2BKOA 1Q78A 2XGPA 2XSFA 4DR2J 4C8KA 2ROGA 3QT6A 1H2VZ 4NE9C 3UE2A 3IWLA 3CCVS 1S0VA 1DQAA 3W65A 4ES2A 4IO9Q 2RT3A 4OX9F 1EB0A 5D4NA 2IYGA 3BBFA 3OTDA 3UW1A 5HMXA 5IWAF 1S0MA 1LW2B 3I0SB 2MYFA 3MR2A 3PXGa 4J9SA 1U48A 1NHUA 1QD1A 2PA8D 3IBCB 5C25B 4ILLA 3H7HB 1I6JA 2JSXA 3R2CJ 3M2RA 3DRSA 4RNFA 1RABB 2OI2A 2GJ2A 1X4DA 4BWMA 1XR7A 3PFEA 1VQOS 5CABA 4FDFA 1DQ9A 2C28A 3RTVA 2G1DA 1UA1A 2PMHA 1KTVA 1NK0A 4NXNF 2QO3A 2NR0A 2APOA 5K8MA 3HZEA 1VDHA 3BO3A 4I56A 2LQ5A 2U1AA 1WC4A 1H73A 1XMQJ 4F0MA 4NMLA 2H4WB 1NK8A 3ZZPA 2CQIA 4OV6A 1YJ9S 3UR0A 4CLYA 1HL6A 5LJ5Y 2I8EA 4G65A 4UF4A 3CSKA 2E1CA 3PY8A 2EC0A 1CJKB 3OTBA 4IFVA 2QIFA 3D6FB 1JNRB 4HH1A 3TUJC 5KFCA 3G9CA 3SBMA 2AZ1A 3PCOB 1HQEB 2RNEA 3CVKA 2D9PA 3IM9A 3JSMB 4OYPA 1RE1B 2AX1A 1M5SA 3SQGA 5B0DA 4DV1J 1GMWA 1DTTB 4F4KA 2HWTA 1U6FA 1VIOA 2M52A 2PI4A 2UXBJ 1WHYA 5HMWA 2XMAA 1WEZA 3SV3A 1TL4A 2KDOA 4IFYB 1PILA 2Z2LA 1WG4A 4JI3F 2AT1B 3F0NA 1D8ZA 1R8BA 2M2BA 4CLKA 2J5AA 4F4XA 1TVRA 3W2VA 4E2FB 1YZ6A 3PIOQ 3EPIA 3R8YA 2GQ2A 4J9QA 4ELUA 4IOCQ 1VYAA 3Q0AA 1FKPA 1WACA 4O4GA 3DHXA 2G0CA 4OZ3A 2V2QA 3DLGA 5KOXA 1SUQB 2VKRA 3ET6A 3O6QA 3RU0A 2NZ4A 4X4VA 3CD7A 4J9RA 4DQIA 3NAIA 3CCSS 2DY1A 3HCXA 2D3ZA 4OYBA 2DNLA 3GZ7A 4DV0F 5KFWA 4EZ9A 3POTB 3C14B 4J9KA 1B64A 1OY6A 1T03A 4FN5A 4C0HA 3TZZA 5GADI 3P96A 4OL8A 4KGKA 4XPEA 2ZBRA 5LL6d 2RQ4A 4QCLA 5DJBA 1RYRA 3L7PA 4IRCA 1BUXA 2PDAA 2AKWB 4RW4B 1RT2A 4QW8A 1NKCA 3SMZA 3IG1A 1VQYA 2CPIA 5KFFA 2AGOA 3D28A 2DT9A 1K1QA 5KFUA 2VICA 1EIYB 2LA4A 3J81j 4D3HA 4NLUA 1O5JA 2K1RB 4KE5A 4NEZA 3R7SB 1WORA 2MY8A 3NGUA 2EBGA 5AXMA 5D0GA 1CQNA 1P9QC 2DR6A 2LEBA 4ECVA 1WEYA 3K5NA 2J7KA 2V94A 3PW0A 1C1CB 1OY9A 2X1BA 3CW2C 2HZCA 4ZJLA 2RU9A 1YLXA 3GLJA 4FNHA 2KH9A 3DMJA 1HNWF 1KLMA 1ZTTA 1SIWB 1TKTB 3OR2A 2IAJA 1KWMA 3MEKA 1B4SA 4L6V3 2H5JB 2C2OB 3M9OB 1JIHA 4K4XA 2EFOA 4DDFA 2VPWB 5KFYA 3FEZA 1BC6A 1T3OA 1T94A 5IT4A 4X4UA 4HHUA 5KG6A 4DL7A 5KFPA 2MKJA 1S9FA 3D0GE 5I3QA 3QAEA 2EW9A 3DGVA 4RW9B 2KXFA 4CM0A 2DXFA 4AL6A 2I2YA 2YX1A 4DSKA 4NZ6A 2D3UA 1GQEA 3KG0A 3LWLA 3HFKA 3MCSA 2EFQA 4Y2MA 3W2WB 3MEGA 2W2OP 4LF7F 1KBRA 2BM0A 2EG2A 2KYXA 4WKYA 3G6XA 2YKQA 3J7ZT 4NLTA 3MM8B 1D3WA 2VG6B 1DJ0A 1WOOA 4NLVA 5GMEA 3VR1A 4X4NA 2XS2A 5M2PA 3PHTA 3ILOA 4DF4A 3KK3B 2B6AA 1HI0P 4U7UK 3TI0A 4DSJA 1CPZA 3AAWB 2W9BB 2VONA 1M0SA 3UNYA 2D1CA 1TR0A 3CCES 1U1PA 1KD1T 2BABA 3J81U 2OPRB 2XY6A 2C2RA 1R3NA 3L9ZA 4A8WA 2IBKA 2ZHBA 1RU2A 1X4GA 2KG0A 4C4WA 3SCIE 3M30B 4LT6A 1NKEA 1BD6A 1HBUB 1ZS6A 2OHDA 2QA2A 3F44A 4GO7X 3EWGA 3I5AA 4DZDA 4WFAQ 1JLCB 3KLEB 2FHJA 4EEYA 1B3TA 4LF2A 1U2RA 3BSOA 2ZH9A 1G1XA 3KYLA 4IH7A 1UEKA 2DH9A 3D7SB 1PC4A 2DTJA 2UU9F 2CQDA 1OS5A 1WWHA 2C3YA 4O3SA 2DB1A 3MHYA 4J5OA 3G8SA 2Z58B 3DCAA 3BGRB 1X4AA 3PR4A 2ILZA 3E01A 3I0SA 1XBWA 5KFNA 2W9CB 2DISA 1RLDA 3FQLA 2VU5A 1RWKB 5SUHA 3T9NA 2OFHX 4RW7B 2MHNA 2MLZA 2XBPA 1UVLA 3PKMA 1MROB 3HDSA 3P3DA 5E2QA 2QA4S 1UTAA 3HVTA 2MMYA 3C6UB 1F3FA 2G13A 4X65J 5KT7A 2QMXA 3DLBA 3ISND 2CQHA 5HATA 4OHZA 1S9GA 3I87A 3CDBA 4I64A 3DOLB 2DGVA 4PYAA 2HZVA 4U7UD 3L7UA 1DAXA 3MR7A 1QY7A 2CJYB 1JLEB 2R2RA 1FX4A 5FLXU 4NCBA 1T9WA 1T95A 2ZBQA 3U1LA 4AXIA 1TKDA 4HDHA 3VAIA 1NXIA 4X65F 1N52B 3FK4A 4ILMA 5B7WA 4V19J 4P2SA 1IM4A 4F67A 2FQQB 3UR3C 1M5VC 2R7VA 3AXKA 3L3CA 5BYSA 2VPXB 4JI2J 5MLCV 3OHBA 4OJGA 1F5CA 2XY7A 3HSGA 3R27A 4WIIA 1HQEA 3QPIA 1DTTA 4M94A 5LMUF 2EVZA 3BGFA 5C24B 3D3CJ 4JYAJ 3H4DA 4P52A 3VVUA 3FSYA 5KG0A 2YWKA 1MW7A 2Y1IA 2WW4A 3IBFB 2IY5B 1U24A 5BXIA 3R6LB 2JEGA 1HWLA 2MZSA 1TKZA 2P9CA 2W25A 1SJRA 1TVRB 2AEMA 1OQ6A 2PO4A 2J0SD 1S5ZA 2G4BA 1D09B 1U47A 3E3XA 3I5CA 1VBYA 2R8GA 1S1WA 4L73A 2E66A 4ECXA 4QR1A 1P1TA 2HS4A 2LP4A 3LF0A 2R42A 3OL9A 1RWPB 2OP5A 4ILRA 3KLIA 1Q5VA 2PFFB 2FGOA 3TQ1A 1T03B 3NMRA 2DXDA 4GKKF 2J9DE 1Q7YT 4WZMA 4IG3B 3TAPA 2ZOGA 2R8HA 3RRKA 1F2HA 3D5MA 2HMIB 3HHLA 3QT7A 4Q44A 2HLTA 4RW4A 1RT2B 1LW0B 1SQGA 2ZHOA 3PDNA 3RJMB 3CDUA 3OLBA 4Y2AA 4DR7J 1W25A 5D78A 4A48A 4DV6F 1U1LA 1SQFA 2DIUA 3DGPB 4YHHF 5J1EB 3AD7C 1VQ5S 2UXDF 4KKOB 1S57A 2LQ8A 1S6PA 5JUMA 3PJWA 4OYMA 3C19A 2LVWA 3PRVA 4I68A 2C2ZB 3VQSA 3IRWP 2I0XA 3CMAS 3QO9A 3NKYA 4Q2MA 3Q8SB 3TW0A 3J7YI 3P8BB 3JTOA 1RWUA 3J7Z5 2AD9A 2ZZNA 2CZ9A 3ZZOA 2IAJB 1UFWA 3MMBB 1LQ9A 2EI5A 4USHA 3OTOJ 4B3RJ 4YEAA 3O1LA 3NBPA 4FYWB 1JJ4A 4B3SF 1Y5LB 4FXWA 2WVEA 1QAXA 4HHHA 4JV1A 4FYDA 3LP1A 2OTLS 4DR6F 4DS5A 4CLTA 4WJBA 2XNRA 4E98A 2YQ3A 4URQU 3CE8A 3EGZA 1FKOA 2ZD1B 2DIVA 3A8KA 2QMWA 2QYCA 3BSCA 3HSDA 1Z2LA 4UY8T 3BKTA 3MEGB 2AX0A 2W2MP 4PCQA 4DV2F 2HYIB 1B0PA 2J0WA 1RB0A 2GGPB 4YQWA 4FBUA 2RHQB 1RISA 2COLA 4IOAQ 1T02A 1RTHA 4QQBA 3PW7A 3M7VA 3LP2B 3FSIA 2HGNA 4OX6A 4ZP9A 4ZLLA 4CH1A 3PX0A 3HFZB 3C46A 4DV1F 4PUOB 1Z1ZA 2VASA 1NSQA 1HNXF 2VKZG 3KK1A 3QGIA 2B7CB 2L08A 3H98A 1LWFA 4DG1A 2YVSA 1SJ1A 1OPZA 1X7VA 3SCKE 3U27A 2JC1A 5A8KB 1H7WA 4Y28C 3ITHA 3IMQJ 1YWXA 2EFVA 2V4JA 4U7CA 2MDAA 1VI7A 1YG0A 3QNWB 2F5GA 4DUZF 1AZSA 1JLQA 3C15A 4JI0F 2RF2B 3IWXA 1IBMJ 1WI6A 1Q8IA 1T9VA 2V68A 1C0UB 2BW2A 3ICLA 3I6PA 4PAAA 2ZJPQ 2W8LA 2KHCA 2BZ2A 3FKBA 4USWA 4R5PA 1MMDA 2VPYB 4B9UA 2B8QA 3LUYA 2B4UA 3N9UC 4C9DA 2V67A 2MZJA 5LSLA 3RW6A 2R3VA 2Y1RI 4K5SA 1N34J 1WUUA 3THTA 1HMVB 3I4HX 3E01B 1HWJA 1CVJA 1GX5A 1TL7B 1GMVA 3HHEA 1SH0A 6FDRA 1UCNA 3M9MB 3AHPA 3P5BP 4M5JA 3KJQB 1HWKA 2YPZA 3HVTB 1IKWA 3C6UA 5KT6A 2V5HG 1VJQA 2BKNA 2ZKTA 3Q86A 4FVCA 3ZFVA 2K8GA 1K0VA 1N33J 4J91A 2BX6A 2BV3A 3LP0A 2GO9A 1KFDA 4OJ3A 1CC8A 4RUBA 4WP9A 2H65B 4FNIA 3BSNA 4FS1A 2F8EX 3W9JA 4NCAA 4L75A 1JLEA 2JLFA 1M5HA 5ETOA 2QEXS 1FXLA 2AIRB 2GVZA 2UVWA 1JLAA 2VQFF 1N32F 1AROP 2ZJQQ 4IOBA 4QU6A 2NLWA 1Q4RA 1BLUA 5DM6Q 3DOKB 1FX2A 2B9WA 4ZKAA 1MWYA 1VBZA 3OL8A 1WNEA 2Z30B 4ZLPA 4DSEA 4BDPA 2EFGA 3MCMA 4NEYA 4ZCMA 1NPRA 4KV8A 5C25A 2HWIA 2QRRA 3ZTSA 3X1LB 4USKA 1HLWA 3ZNUA 3EDRB 4DV6J 3FDSA 3M2RB 3DRSB 1XR6A 5C24A 3CDAA 3IWNC 2CQ0A 4LR8A 3TA1A 4ER8A 4V19X 1BY9A 1UFLA 2F40A 2F65A 2LLZA 3HX9A 4KJIA 4ZVEA 3M8YA 4OZ5A 1XK8A 3GQCA 2CJQA 2PA3A 3OBIA 1TKZB 1SL1A 4OI1A 3BKUA 2IMOA 4X4QA 2CNNB 3NCPA 1U1QA 2N3OA 3ISNC 4PXEA 3DDIA 2AEFA 3K5OA 2VFRA 3HMJG 4IRKA 1FA0A 2HNZB 1ZAVA 2OFGX 4DLGA 3BPDA 2WSFC 4DCPB 2RVJA 4B3MJ 1P6TA 1RJJA 5C5JA 2FDNA 4ANDA 4IFVB 4XIUA 2MLYA 1MU2A 2AJ4A 2CUYA 3N79A 4YB7A 2HVDA 2Z8QA 4IG3A 3JSMA 4RX6A 3SQGB 2P6SA 2D9OA 5LXRA 2ZUGA 1FD2A 4CQ1A 1UZDA 5E5NA 4FF1A 1EQ0A 1LW0A 4RZRA 2Z2MA 4DN9A 1OY8A 2HHUA 4YR3A 1EZZB 1CULA 3I82A 4LVOP 4QWDA 3HXMA 2AP6A 2I38A 2CG8A 3W9HA 4AL7A 4LF6J 4CLFA 3OQ2A 2MKIA 1D9DA 4ATNA 2Y8YA 4F36A 4I4BA 1RWVB 2F3JA 3HHLD 4WFNQ 1Y5IB 4ID8A 4U8YA 5C2CA 2ZH8A 1MSWD 3MCOA 1S6PB 1RTIA 5HROA 2ZKUA 3ET6B 3OVBA 5J2NA 2LDIA 3MTKA 5ITHA 4ZA1A 3T5HA 2MHEA 3POTA 2WSEC 3MWBA 1K47A 4M1KA 1DZ5A 4DR7F 3MMBA 1VQ9S 1TFYA 3MMJA 5THWA 4RUAA 4LMZA 3EXYA 1RAIB 3H0PA 4XK8C 1WF0A 1VQMS 4L74A 1VBXA 3OSNA 2W01A 2XC9A 1SQEA 2OMOA 1ROFA 1S6UA 3J80Y 3K5PA 3MMAA 5B0FA 4GC6A 1CG2A 1RHUB 1VK3A 3QGHA 2FGCA 3V6HA 1UA0A 1VISA 1F0XA 1KDNA 1RWWB 3B8HA 1FKOB 2ZD1A 1IM6A 1D9AA 3R5GA 5G4DA 3UQSA 4JI6J 2ERRA 1XNRJ 3GCWP 2VD3A 1C1CA 3SSSA 2GGPA 3MFHA 4RR5A 1WKLA 2ZVSA 2X1GA 3JAMU 4AL5A 1N8RT 2RSQA 4K4UA 4NXMJ 1KLMB 3IGVA 3NGSA 3QYYA 4UZCA 3MUMP 4DR2F 3SSRA 2F8HA 3OR2B 2LKZA 2F4VF 3KK1B 3QJJA 4P71A 1NJIT 1HKAA 1VBKA 1AFIA 1M1HA 1VC0A 4C3MA 1L3TA 2C2EA 7FD1A 1AW0A 1RGVA 3ITHB 1JJCB 3CCZA 3M8ZA 4QPTA 1ZM9A 1E6YA 4BC9A 2RF2A 3CJRA 3EM1A 5A0YA 3EZOA 2FZGB 1G3OA 2K3KA 1RT6B 4M5MA 5ETTA 3IA0A 3R1HA 2LXUA 2XGQA 1B7FA 3GJRB 1CQMA 2DEIA 3KXDA 5E7OB 4CRJA 2XSJB 4UQTA 3I4PA 1JMTA 3L4BC 4ECUA 3SFUA 1HW8A 3MM8A 1C4CA 4IQMA 2FHJD 2JNJA 1X5SA 3CEDA 3ULHA 2ASLA 1HMVA 5GAGI 3UDLA 3IS9A 3DN9A 3AJ1A 2W9BA 1JXLA 4DU8A 4LQ3A 3MPYA 1M1KT 5DM7Q 3M4XA 2OH2A 4USJC 2HNDB 1NPKA 2ZDOA 3FRYA 3UCZP 3DLHA 1VQ6S 2HW3A 2G2ZA 5DQHA 3U02A 3CDWA 3KK2B 1UW4A 1RACB 2Q6CA 2ZH5A 3M30A 4EO8A 5DDOC 1HBUA 2XYGB 2EK1A 2CXEA 2FJAB 1B0TA 1JLCA 1WG1A 3KLEA 2LEPA 3FVYA 3NOGA 3VAFA 3HLUA 3C2PA 4LF6F 1P9YA 2H3EB 4I6AA 2GVZB 1JNZB 2ADCA 4NLYA 2E29A 3IRXB 2EK6A 3VV2B 4H4MB 1SKWA 4X4PA 2LQ9A 3DOKA 3QT8A 3BGRA 2DRDA 2ASYA 2IRXA 5M2UA 2QC3A 4LRBA 3CJTA 1FDBA 1RWMB 1REVB 2P9EA 3HD2A 2W9CA 4DR1F 1VRTA 4ZLJA 4CYUA 2LQBA 4RW7A 1RAAB 3OTEA 1NDPA 2VH7A 1HARA 2GMJA 5J1NA 3G96A 3Q22A 4NOHA 4PG6A 3ENAA 1ZM4A 2HBZB 3JQJA 1Q8LA 4K7QA 2GMLA 2L9DA 2A18A 4NWBA 2MZQA 3PVXA 2HNYB 2UVUA 3AOBA 4NLGA 3NNAA 1S59A 3T5LA 2CNOB 2YNHB 4PG4A 2SXLA 1NU4A 2NPFA 1HBNA 5H9FJ 4YFUA 1PYTA 1S12A 3DLLQ 2BEFA 3D6MB 3MUVP 4ELTA 1IQTA 2J9EA 2CQPA 3H8YA 3VAJA 1YKWA 2NUHA 2FLLA 4OI0A 3GYXB 2MQNA 5E3PA 1LWXA 4KHRA 2ZDPA 2OO4A 1PIEA 4KYZA 2R9LA 1N36J 3MPDA 1W7WA 1SPBP 2JX2A 1JLFB 1GXTA 5IQQA 3HHKA 4LF8J 2ALYB 2R8KA 3AA8A 1UP1A 3PKYA 1N88A 3CGIA 3DFEA 1MU2B 1SC1B 3TAMB 3NWRA 3R9LA 4EI2A 3JB9k 1H98A 4N47A 1F9HA 4CLZA 2VFUA 5KFVA 1SL2A 1LV5A 4EUVA 3LANA 1R8PA 4KSEB 2LU1A 2VA2A 2JEJA 3ZXWA 4LF8F 1WDTA 2PE8A 4USUA 1Y3JA 4TU9A 4TYBA 1CULB 4UOGA 3T1YF 4M5KA 3Q2SC 3IO1A 4P75A 5L8RC 2WB4A 1UZHA 2B4PA 1NJXA 3SFGA 4KB7A 4M5DB 1TU0B 3T41A 3G71S 4CWBA 2DVIA 2YNGB 1NH7A 4WFYA 2BQRA 1QDUB 1WEXA 3PACA 1RTIB 5HROB 1FFWB 4TU7A 1V3ZA 4ED5A 3T1AA 3UDEA 5J2NB 3QWPA 3GPAA 4S0MA 3GFXA 3VGVA 2XYPB 2XQCA 3KLIB 4W90B 4TQRA 2HIYA 3DRPB 4LBHA 4K0KJ 2ILYA 3RW7A 5D0RA 5HSPA 3T1YJ 3TZYA 1T05A 1E6VA 1PJ6A 3HHLB 4C8MA 3FCVA 3T5JA 3BPSP 1JLGB 4ZDNA 1XMQF 3QRQA 3D66A 3O5TB 3MMAB 4DR5F 3MR5A 3THVA 2UUAF 2JEIA 4CLUA 2XS5A 3CC2S 2QL5B 3PYFA 2OTJS 4P6QA 3TJ9A 1SH2A 3DGPA 5I42B 3H42A 3VGUA 5J1EA 4EBEA 1F9EB 3MF5A 4DPUA 1FRHA 2CG4A 3HSJA 2JHEA 4ED7A 2WBMA 4DFJA 4K4TA 4EYHB 1W2IA 3T9ZA 1VQ4S 2HEKA 5JXSA 2AMCB 4GKJJ 2MZRA 1HQ2A 3CCRS 4UQGA 1KQSR 3DYAB 1H7XA 1N4LA 3FZBA 5IFMA 2DR5A 2OPSA 2WONB 2BA9A 2QA4G 3M8SA 1RHKB 3L95X 2BQ3A 3CNQP 3N0VA 2QLJB 4OX7A 3PEHA 2WTFA 4H4KC 4AYBD 1YI2S 2KZMA 3VF0B 5HL7Q 4J9PA 4CNZA 5B08A 3LP1B 4Q5VA 3UI3A 1U1KA 2O67A 2CVIA 3HD1A 4LJMA 4YR0A 3QATA 1TQLA 4F04B 1N5SA 2K3IA 5IXUA 1TTHB 2KFNA 5T14A 3I9V9 1RT6A 2HQ3A 4HACA 3K8WA 3GV5B 2ACYA 2B8PA 5E33A 4IUFA 4RUCA 4Z7CA 3K2YA 2BJ8A 2GX8A 4WYWA 3TUZC 3LP2A 2CQ3A 4LF5F 3IS9B 2FVCA 5LXYA 2DO4A 4TLQA 4KHPF 3MR3A 3NAHA 4CLSA 2VF3A 2ACMA 1JXVA 3Q24A 1LWFB 4DG1B 1RA6A 1U09A 1RWOB 2HNDA 2IJNA 2FVQA 1CJTB 2FHOB 4UOFA 4OLOA 2BE2B 1RBLA 3S1TA 3KUGA 2KN4A 1FRKA 2VBWA 2YX7A 3GFHA 3H2VE 3TJAA 1KSPA 2XB2D 5L9NA 3RGIA 1GH8A 3AOAA 3K5MA 2CQGA 4X2BA 1AZSB 3M6WA 5KFRA 5F3TA 4I2QA 1N48A 1KFSA 1VCTA 2D41A 2AJ0A 2MB0B 2UXDJ 2RUSA 1C0UA 1RAEB 2DY9A 4NA1A 4EFAC 2XZTB 4LFAF 1Y4ZB 4DR4F 2MQQA 1JX4A 4R5PB 3OW2R 3IM8A 1KR4A 1X5OA 4WFZA 4Y34A 1X9MA 1RT1B 1TL1B 1IBKJ 2UXCJ 2IJFA 2HPUA 1TV6B 3FBFA 4GVLA 4NLQA 2AJ1A 2FY8A 3MECB 5LSRA 3OXLA 2M88A 3TOQA 3QAUA 1VRTB 2DR9A 1S0OA 2IBOA 1B0VA 1G7CB 1RAHB 4KPYA 2O3DA 2QL7B 2RS2A 2RDDA 1YJVA 3HVAA 3BKFA 4OI4A 2HRTA 3ELHA 4TKTA 1WC0A 5BYRA 5A76A 1KP6A 4YMEA 5IV4A 5KFBA 5EDWA 2HNYA 2WB1D 2HIQA 3LP0B 4ZPBA 4ZPVR 1IWAA 2YNHA 1KN6A 1RT3A 2HHSA 4QYZJ 2J7UA 5FDLB 3M32A 3TX0A 1HBNB 3GU0A 3KUEA 5MAOA 3O2IA 3HK2A 3D54A 1FRIA 2HWHA 1IKYB 2R7TA 2ZM6F 1QLNA 1KONA 1DLOA 4Q0BA 2RRBA 1JLAB 2F9DA 2B5JB 2V6AA 2ZOFA 4FXVA 2RRAA 5D0HA 1QE1A 2FLPA 1UW9A 4L3KA 2EBEA 4ED3A 4LF7J 3HO1A 3K89A 2ROPA 4QR2A 2AHOB 3IGNA 1JLFA 1X4HA 2XLJA 3E51A 3EGNA 2AEJA 4AQYF 4MKAA 4QJVA 3OXGA 2XCAA 1X0FA 1HR0J 4KV8B 1C4AA 2CADA 2WVBA 1F5AA 3TEGA 4YOEA 4ZP7A 1NRKA 4LRCA 4B9VA 1KVIA 4DPYA 3G2XA 4CI0B 1FEEA 1YJ7A 1VQ8S 2XMMA 1Y9OA 3LA0A 4U67Q 4LUBA 4IR1A 3PRDA 3I96A 1I5OB 5ETQA 2YKMB 4U6PA 2GIFA 1U8SA 1SH3A 3H2UB 1RU1A 1U0HA 2A6OA 4PXCA 5LM7E 5FLXY 3X3UA 5D6GA 1XMOJ 3ILLA 2YTCA 4M5DA 3W62A 4WP3A 1VGYA 2CJBA 4ZVUB 2YNGA 3DU5A 5KFHA 1HQUA 3FEYB 1FVSA 5HAOA 3PV8A 5EN1A 1JJHA 2ZBIA 1KVKA 3CCTA 2HNZA 2CRLA 4KFBB 4KGMA 4LREA 2MXYA 2M3DA 2VFVA 4XDCA 2OD4A 3UFCX 3RBEA 4FVMA 1KS2A 4RBTA 2BJ9A 2F1FA 2FUG9 1RWXB 2N4CA 3A3PB 2PSZA 1MMNA 4UOHA 3EGWB 5JVHQ 1K73T 2E5IA 3DRPA 2KT5A 4BBYA 4NX9A 1T8EA 1MWQA 2UZAA 4UOCA 5CZVA 2R7XA 2NXNA 3LAKA 5L46A 1YDLA 1JLGA 3GV8B 1NDKA 1XMOF 1QAJA 4F4WA 3NL0A 5KFSA 1JJ2R 5F8HA 1TMJA 2BE9B 3CJKB 2UUCJ 4JI7J 2DGSA 2E7WA 2WOMB 3QRPA 1HFEL 3US5A 5HQ8A 2RDIA 3UN2A 5KFLA 4CH7A 1QSYA 1T11A 5I42A 2E1AA 2RAQA 2IC3A 1CC7A 5E3QA 4CNYA 2IA6A 3BM7A 4J90A 2CKWA 4X4OA 2IIHA 5L1KA 5AXKA 1X0PA 4KH1B 1Q82T 4MKYA 2UUWA 2KRRA 2QT7A 3V4MA 5A2QY 3QZ7A 2IVFB 3A8JA 1CS4B 5KFXA 4IQXA 3QWUA 4KHMA 2IYIA 1NK4A 1S97A 4ZIVA 3FRZA 1NDLA 3G6YA 1YQHA 2BANA 5K14A 5KG1A 1M5OC 4DWIA 1GEHA 4K4WA 3EMTA 2HLUA 5KG2A 1FT8A 4C97A 4C98A 4CM2A 3OUYA 2CQBA 2YWGA 2AGPA 1NJYA 2ZH7A 5A8RA 1K1SA 4RBVA 3T1HF 1X60A 4K50A 3M8QA 4B3OA 5DGAA 1F5BA 4RW6B 4G1IA 1XWLA 1AB8A 2R7OA 3JS9A 4PQAA 5F8GA 4LF5J 4M5IA 3MFIA 2C3MA 3GTYX 4NA3A 4NXMF 1QUVA 1YSJA 4HACB 1P27B 2GFFA 4PPZA 5KFJA 2KJVA 2EC2A 2GAGC 2KG1A 3PYGA 1NJWA 5H9EJ 3RB6A 1B7YB 2J0XA 3GE9A 5A2QU 1H2UX 3BQ1A 1FDNA 4PYDA 2QYGA 3GWCA 4UY85 2ATCB 2HFUA 4KO0B 3FGVA 4BLGA 2J9DA 1FRJA 2R7RA 2NZCA 3KDNA 3QIPB 1NZAA 3AXMA 3OHAA 3SV4A 4E0DA 2WCXA 2IM0A 4KRWA 2IM3A 2C1EB 3V6KA 1IUJA 3CMQA 3NXZA 3UDVA 1ZM2A 3AJDA 4WK3A 1PYSB 3WX8A 1E6YB 4KT0C 1H0HB 1RAGB 3H2LA 1YVFA 5GAHI 3VAHA 2YWWA 5IM0B 4I2QB 5A0YB 2DNQA 4LFCJ 4I67A 4CLPA 1HA1A 1RQ0A 2RJZA 1RP5A 3HVWA 3DM2B 4A46A 4LF9J 2KTQA 1QAYA 2ZC4A 3R5CA 3D1QA 1U1OA 4M5GA 4P7TA 4MH8A 1W2BR 2XSJA 3PX6A 3MM5A 1D1UA 1RT1A 1TL1A 3LTOA 4HT5A 1T3NA 1PBUA 1UVMA 4G1QA 3FMWA 4L3NA 4F3MA 4U8VA 4ZPWR 5D4OA 3MDFA 3BGLA 2M5YA 4DL2A 3MECA 2J6UA 4B9NA 5D8HB 2NSBA 4IG0B 3MAAA 4QBUA 2JVRA 4O23A 3HHNB 1U1MA 5GVQA 4DEZA 2GC8A 2H5EA 4M63A 1TAUA 2O5DA 2XWYA 1IWGA 2PT0A 1QJHA 2YWHA 4LSZB 4U95A 2FVSA 3KK2A 2OUGA 4OI6A 3F56A 4PABA 1KQFB 1GTHA 3Q8QB 3CIMA 2K7KA 1RT3B 3ZTQA 5F8LA 2GW8A 2BOPA 5IT9U 3LOUA 2ZNZA 3TVZA 3W8GA 1V3SA 4MFBB 3K57A 2Y0BB 1IKYA 2RMLA 3F41A 4ZMMA 3H90A 1O0PA 3K58A 1DLOB 1N6QA 2E44A 3IRXA 3JXOA 4K2JA 4HH0A 5AXNA 2WAQD 4H4MA 4E8UA 2DEJA 3FSXA 2QFJA 2UP1A 2WRMA 2QLBB 1JQGA 3HFVA 4CIOA 3DI6B 3IR5B 1NB2A 3H4BA 1REVA 5D4PA 3BQ0A 3R5JB 4CYUB 1J5EJ 3LQVA 1AYEA 3KHRA 3NMAA 1H6KX 2R8JA 4M5LA 3J81Y 1ITPA 1KOHA 1IVZA 1WHWA 1R31A 4O44A 2MJNA 4A8SA 1NJZA 4Q8EA 3RYLA 2XS7A 3M6XA 4WTOB 2OPPB 5EGYA 4QOTA 3KJFB 4LFCF 2YKMA 3JTNA 2E1MC 5DRKA 2QN6B 2HAFA 4ZCLA 1U0HB 3HT3A 2BYCA 4DJBA 5LMNF 1A9NB 1LKZA 1RTJA 1U6BA 2M70A 3BSAA 2V8VA 3M6UA 4ERDA 2X7IA 3FUYA 1MMLA 1FE0A 1UVKA 2VBYA 1HNZJ 5J2QA 3RBZA 3KLVA 1KC8T 3CC7S 4JI1J 1KTQA 2RILA 3BEGB 4KFBA 4QWAA 1T9YA 2J9CA 2LMIA 1KKHA 2W2NP 5I4MA 3Q2TC 3FJ2A 1UPMB 1Y7PA 3PJ9A 4OHVA 3TAMA 3CCUS 2XLKA 3UN5A 1REGX 5AJ3F 1X9SA 3B4MA 4CLWA 1FO1A 2QV6A 2FHMA 2JJ4D 1VR6A 4A4JA 3UPFA 1H72C 1R27B 3PEJA 3CXCR 2HGMA 3Q83A 4R0EA 3QSIA 3R5BA 4F4ZA 2OJ3A 1Q79A 2WOMA 2CJXB 1TK5A 4I6WA 1ELOA 3WHIA 4LBPA 1YRUA 3PRBA 2IDLA 1PAUB 3IR7B 3ZZZA 2LU2A 3AT1B 3PHEA 4DPWA 4DPTA 1IJFB 2PEHA 1OYEA 3MM9A 4MK7A 2F4FA 4C11B 3FZ2A 1RAFB 3HVRA 2BANB 5K14B 2BJ3A 3OUYB 3GG0A 4IH5A 4I7FB 5HK4A 3DNCA 2XY5A 2QG9B 3D4JA 1T05B 1E6VB 2H54B 2HQCA 4WFBQ 2X51A 4KIAA 2M0GB 4W98A 3MURP 3CJ8A 4N8NA 2AYBA 2YKOA 1L3KA 4B3OB 1F60B 4O3QA 4RW6A 4O4RA 2ZH3A 1DURA 1SJQA 3W66A 1D8YA 4PRFA 2O01C 3UCGA 2YKNA 3KLGB 4DV0J 1HD0A 4OZ2A 4U96A 4F0KA 1FJCA 3EICA 1XTZA 3D0IE 3OV7A 3LGMA 2F63A 2HGLA 2CAJA 1Y10A 1FERA 3TO8A 5DQGA 5L1JA 2YNIA 4H4OB 4DUZJ 5HLFB 1IR1A 2JDJA 3IAS9 4NLWA 4USTA 4YB6A 2XMJA 5B0AA 1LEOA 4DX7A 2J7WA 2C2MB 4K8RA 1YX2A 5F8MA 2DNKA 4ZPTR 3DYAA 2R2UA 1XR5A 3H5SA 1TK8A 2OPSB 1S1UA 2WONA 1Z4UA 2UV8A 3GV7B 1HWIA 3HF5A 3RR8A 1RI7A 4PZVA 2MQOA 1HHSA 3QIPA 4IRDA 4P73A 4WXOA 4DV7F 4O0IA 1VQPS 3MR6A 3EZUA 2QMUB 2KKHA 2KXHA 3FC9A 2IHR1 2QLWA 3J80U 1XIQA 3TA0A 2MGZB 1VC6A 5IM0A 3TVYA 2EWHA 3AY0A 5F8JA 2B7BB 4DL0C 5GAHU 4L72B 1G6BA 4EYIB 3OFGA 2VOOA 3MZIA 1EHWA 1FWPA 3JQKA 1SB6A 3MM7A 4I2PA 4X84A 3I9ZA 2FVRA 3NS5A 3EZ5A 1YTYA 2KFZA 2VG5B 3JAMY 2DYAA 2GIQA 3CJ3A 3D6TB 4TYAA 4F3OA 4GO5X 5C2GA 3C6TB 5KFGA 1FE4A 3AQOA 3MAAB 2BDPA 4B9TA 3OTOF 5KG5A 3CCLS 2BRKA 3DC2A 2R7QA 4RWWA 2A10A 2KB2A 4KH0B 3CD0A 5K5MA 3THPA 1CJTA 5GAGU 4B3SJ 2BE2A 1GFWB 4A47A 1M90T 1RLCL 2ZVIA 4B02A 4F0HA 3CUNA 2Z2ZA 1RZMA 4QU7A 3CF5Q 4X64F 3D3BJ 2HRYA
chains in the Genus database with same CATH topology
4FP9A 1ZYQA 2VV5A 4Z2XA 3I56S 2FJXA 4DQRA 4K4ZA 1FD8A 2YY3A 1TV6A 2GIRA 3I0RB 3CJ4A 5F3ZA 1UVJA 2DNRA 2DGXA 4OZ0A 2ZBCA 1SV5B 3BDEA 1K8AT 1VQNS 1OSDA 2CJAA 2KJWA 2XMTA 4K0KF 2AGQA 2ZOMA 1XC9A 2CIMA 1ZZFA 4N76A 4O44B 2EPIA 1Q53A 3RB0A 1WTFA 4TU8A 3RB3A 2OPPA 1UKUA 3FMBA 5EX3A 4C3KA 5FDLA 3M32B 2E1RA 3TYTA 1XN9A 2ZH2A 4Q0BB 2IA0A 2B5JA 4WK1A 1QE1B 3DDKA 4JI5F 5J2QB 1U1RA 1C1BA 4NZ0A 2E7XA 3GSDA 1V6HA 2FC9A 2ZNYA 3VZHA 3V6JA 3CPWR 1LWCB 1HI1A 5KFEA 2MZTA 3K8VA 2FY1A 2YWFA 3CJ5A 4NLRA 2ASDA 2Q43A 1N36F 3P5TL 1GXUA 2RQMA 4OMFG 4ETZA 1Y5NB 4M8LA 5IT9Y 4NLOA 2KM8C 3FEXB 3NGKA 4C0OC 3Q23A 1UL3A 3DU6A 1SJFA 1WHXA 3NRBA 2HHWA 1HQUB 4QWEA 3CWJA 2AYGA 4NLSA 2J6SA 1Y0HA 5E3RA 2GCFA 4ZCIA 5GAEU 2WSCC 5AE2A 4Y65A 4BWJA 1JB0C 4I7FA 1U4BA 4BCAA 4Q7AA 3VAKA 4Q45A 2FVPA 3ZZYA 3T6JA 2ADBA 4F3QA 2E5JA 1XERA 1X4BA 3CJKA 5D3GA 3PO4A 2YKNB 3KLGA 2NUUG 1CEZA 1O8BA 1LOUA 5DLFA 4MK8A 1KQKA 4QW9A 2KYZA 2IC3B 1DARA 3V6DA 2Z0GA 3B82A 2DCLA 5KT3A 4K4YA 4PG5A 2FTRA 2O1PA 2L9WA 3BR9A 5ADZA 5HLFA 2LA6A 1L3UA 4DL5A 3NGDA 4QYRA 1S1VA 2R7UA 4PWDB 4Z37A 3JYTB 1VHFA 1X8DA 3DDNA 3ENVA 4PG7A 4A8OA 4A8YA 5J2MB 2LXIA 2VC1A 3CTRA 3KHGA 3NNHA 3ENQA 1FNXH 2BQUA 2IM2A 2UUBF 4ECZA 2DJWA 5A8RB 2VODA 2VA3A 2JLEA 3M8QB 2UUTA 5DGBA 4LSLA 3N6NA 2XMVA 2MGZA 5M2RA 4X4RA 4F2RA 4B3RF 2W4PA 1SIZA 4ED2A 3VQTA 5AE3A 4I2PB 5FIIA 2HS0A 1YJTA 5I3UB 4KPYA 2XG8A 2AV5A 2DNMA 4RLEA 1OO0B 1S6OA 5L9XA 2MJUA 5HBMA 5KFZA 1YIJS 2R7SA 4A8KA 4KO0A 3C6TA 4WU3A 3UNGC 2RDJA 3V4IA 4Y2CA 3DRYA 2RD5C 4JI4F 5DO2A 4EO6A 3BZQA 2JLGA 2UUCF 4JI7F 3SCLE 2ZZMA 3EUNA 1QAIA 2M8HA 4ZVGA 4CTAA 3UCUP 4PR6A 1RKJA 2V2KA 5G0RA 2HHSA 2AW0A 2RB7A 5GMKa 4PG8A 5JVGQ 1UVNA 1S1XA 3GYNA 1KNZA 2B4VA 3DM2A 4QIWD 1SJ4P 4KC5A 3SDEB 2NYIA 2VFSA 4HI2A 3C3LA 3MM5B 1V3RA 3MEDB 3KG4A 4Y2KA 4G1QB 4YB1P 3I0RA 2Q6BA 2MQLA 4DSIA 2RQKA 3A1YG 1FJ7A 4OI3A 1SV5A