1S1XB

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
397
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 397
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB02
3DM2A 2FJXA 1HNVA 3GV8B 3OSNA 1S1TA 2O5DA 1HQEA 1T94A 3I0RB 4ECUA 4O4GB 3DLKB 5T14A 3BSAA 2VA2A 3DYAB 4KV8B 1RA7A 1OS5A 3MR3A 2OPSA 2JEFA 2UUTA 4B3OA 4DL6A 4ZVEA 1ZTWA 4TY8B 4J9QA 2WB4A 3BJYA 3BSCA 3I0RA 2FVQA 3GIJA 2OPQB 4O4GA 3DLKA 3FRZA 3DYAA 1TKTB 4KV8A 3UQSA 4WXOA 1XR6A 4TY8A 5KFKA 1RTHB 5KFGA 1DTQB 3RB4A 4FBTA 4JV1A 5DQHA 3BSNA 4IH5A 4Y2AA 5L1LA 3MFHA 2OPQA 1XR7A 1HPZB 4H4MB 2ZKUA 4QWBA 3DRSB 4O3QA 3QGHA 4I7FB 1TP7A 4RUCA 4J9SA 3BR9A 3HKWA 5L9XA 1RTHA 5J2QB 1DTQA 5KG4A 4YMEA 4Q44A 4ED6A 3KLEB 4TYBA 4G3IA 1HPZA 4IDKB 5KFPA 3QZ7A 1C2PA 3DRSA 2QE5A 3N6NA 4I7FA 3IGVA 3Q8QB 2C22A 3V4IB 4ZPCA 3PR4A 5J2QA 2AWZA 2HAIA 4H54A 4Y3CA 4R8UB 3KLEA 2AX1A 4NLRA 4RW9B 5KFHA 3KHRA 2FLPA 2VG6B 4IDKA 5KT6A 4MKBA 3T5JA 2C2EA 3H5XA 5DGAA 1C1CB 3V4IA 2GC8A 4ZP9A 1SV5B 1HQUB 5KG6A 4K4WA 4R8UA 1EP4B 2QV6A 4RW9A 5DLGA 3MFIA 2VG6A 2ASJA 3NAHA 3QGIA 1R0AB 3MF5A 2ILZA 1C1CA 5KFVA 4X2BA 1SV5A 1HQUA 2AGQA 3RAXA 4KO0B 1EP4A 1TKXB 3OL6A 3PW2A 1S1XB 1T03B 5J1EB 4HYKA 3D28A 1FK9B 4MIAA 3G6YA 4NCGB 2I1RA 1R0AA 4FBUA 1RT4B 5EWEA 4RNOA 4MK8A 5I42B 2RKIA 4KO0A 4JV2A 1TKXA 1FKOB 3T19A 3ITHB 3SFUA 1S1XA 1S6PB 5J1EA 2C28A 1FK9A 3FQLA 3LANA 4NCGA 4RW6B 1HARA 1RT4A 1VRTB 3DI6B 3OL7A 5I42A 1DLOB 3CWJA 2ILYA 3TAMB 3KHHA 3MECB 3ITHA 1S6PA 3I5BA 4QWCA 2W7OA 1D1UA 3NL0A 3LAKA 2BANB 2FVSA 3UDLA 1N5YB 2IAJB 4O44B 4RW6A 5HLFB 2I5JB 3KK1B 4JUZA 1VRTA 3DI6A 3CJ5A 1JIHA 4RUAA 3H4DA 4OL8A 3OHBA 4TY9A 1DLOA 3TAMA 5J2NB 3MECA 3CIZA 4U7CA 1QAJA 5DG9A 1TV6B 1XR5A 2BANA 4XO0A 2GIQA 1N5YA 2IAJA 4O44A 2JC1A 5HLFA 2I5JA 3KK1A 4IOBA 3GV7B 4J9NA 4WE1B 3RAQA 1S9FA 1N48A 1ZTTA 2XWYA 5J2NA 1TV6A 4MIBA 4ECQA 1HYSB 2FJWA 5KG0A 2AU0A 3HVTB 5KFZA 3V6HA 1K1SA 4J9OA 4WE1A 4J9RA 3I0SB 4R0EA 4IR9A 2BQ3A 4O3SA 2XI3A 1S4FA 2J6UA 2CKWA 1HYSA 3MTKA 2OPRB 3HVTA 1QE1B 5KFCA 2HNYB 4ID5B 1JX4A 5F8GA 4WZMA 2JEIA 3I0SA 3KLGB 1BQNB 2JLEA 5CYQB 4WFXA 5KFFA 4KAIA 3KHGA 4J9MA 3OL9A 4Q8FA 3LP1B 1MU2B 3DOLB 4KBIA 4WXWA 2W8KA 4NLOA 2HWIA 2OPRA 4NLWA 3ISNC 1QE1A 1U09A 2HNYA 4ID5A 3LAMA 4NLUA 3CDEA 3KLGA 1BQNA 5CYQA 3M9MB 3MEGB 1KHWA 3DLEB 3LP1A 1MU2A 3DOLA 1SH3A 2IM2A 3VQSA 3KK2B 5KG5A 3GIMA 3Q8PB 4F50A 2YNGB 4KHRA 2ALZA 1LW0B 1N4LA 2FVPA 3H2LA 3GIIA 4IG3B 3QIPB 2B6AB 4F4XA 1J5OB 4RW8B 4ED0A 2IJFA 3MEGA 4JV0A 3CJ2A 3DLEA 2BE2B 3KK2A 2W9AA 2YNGA 5CYMB 1LW0A 1I6JA 4NLXA 3KMSA 3V81B 1KHVA 4IG3A 3QIPA 2B6AA 3TVKA 2V4QA 1J5OA 4RW8A 4FS2A 2E9ZA 1T05B 2UUWA 4Y2CA 5JUMA 3NAIA 5DG7A 2HWHA 2XCAA 2R8JA 2BE2A 3LALA 1FKPB 2YKMB 5CYMA 1LWCB 1TKTA 5KFTA 2D7SA 3V81A 2IM0A 4Q45A 1RDRA 4YP3A 2E9TA 4K4UA 4YR2A 3T1AA 3V6KA 1T05A 1S1VB 3DOKB 4KKOB 1N6QB 3KOAA 4MH8A 4ZVFA 1FKPA 2YKMA 4H4MA 4WFYA 4IKAA 1LWCA 3BSOA 3UR0A 3GV5B 3MEEB 3KHLA 3KLIB 1C0TB 5KG3A 1S10A 4XPCA 2BRLA 3DRRB 4IFVB 4ICLB 1S1VA 4IH6A 5C42B 3DOKA 4KKOA 1N6QA 3OL8A 4DL5A 1LWEB 4K4SA 1HNIB 1D0EA 4TLRA 3MR2A 5F8LA 5EWGA 1RT5B 4QW8A 1TL3B 5F8NA 4LQ9A 3MEEA 3KLIA 1C0TA 3NKYA 5L1JA 3DRRA 4IFVA 4ICLA 4MFBB 5KFDA 5C42A 3OLAA 3QZ8A 1LWEA 3Q8SB 3GILA 1HNIA 4ZPBA 2XGPA 4EBEA 1RT5A 4NLSA 1EETB 1TL3A 1JLAB 1N56A 4J9LA 1LW2B 3KNAA 4U6PA 1JLEB 2D3ZA 4MFBA 5KFRA 3T5HA 1ZETA 3G6XA 2R8IA 3LP2B 1TL1B 1EETA 1JLAA 1S1WB 4TYAA 3OLBA 5F8JA 1RTIB 1JLEA 2XCPA 2B43A 1C1BB 4QWDA 1JLQB 2DPIA 3NGDA 2W9CB 4K4ZA 1T03A 4O3RA 4PUOB 1TL1A 1RTDB 4ECYA 3Q8RB 3IRXB 4YQWA 3CVKA 1RTIA 3M9OB 2R2TA 2FLNA 4ZP6A 2IA6A 5JXSA 4WYWA 3I5AA 1C1BA 1JLQA 1FKOA 3C6TB 3H40A 2W9CA 2EC0A 3DDKA 4PUOA 3TQ1A 3T5LA 5DLFA 3RB3A 5KFWA 4ED8A 4KSEB 1RTDA 5KG1A 2UVUA 4EYHB 3PW5A 4URGA 3IRXA 4RU9A 2R8GA 4YR0A 2AGOA 4ECZA 3C6TA 2IJNA 4M95A 4YR3A 4KHMA 2UVWA 4TN2A 4ZP8A 4RNNA 4TXSA 1JLGB 3M9NB 5FDLB 2WONB 4TQSA 5L1KA 3JSMB 3BGRB 3H5UA 3H98A 5KFOA 5KFMA 3FDSA 3LP0B 1S0MA 4ZHRB 5C25B 3C6UB 4QW9A 1C0UB 5F8IA 4TQRA 1JLGA 5FDLA 4F4WA 4WYLA 4RNFA 2RDJA 2BQRA 3JSMA 3BGRA 3QLHB 2AQ4A 2BR0A 5F9NA 1K1QA 3LP0A 3IN5A 4ZHRA 4URQU 3PR5B 5C25A 3C6UA 3KLVA 3CDUA 4IRDA 1C0UA 5KT7A 5C24B 4F4ZA 1IKXB 2XI2A 3V6DB 4NLTA 2VG5B 1RT7B 3QLHA 3PZPA 3MR5A 3BREA 1JLFB 4O4RA 4J9KA 4R5PB 4EO6A 5J2PB 2WRMA 3E51A 4EBDA 3HVAA 4K4TA 2FJVA 5C24A 1IKXA 2UVVA 3V6DA 2VG5A 1RT7A 5KFLA 2FVRA 1W25A 3PW7A 5KT4A 4IQXA 1JLFA 5KFJA 4PWDB 5F8MA 4XPEA 4R5PA 5J2PA 2J6TA 2WCXA 3M8QB 1RT6B 1GX6A 1JKHB 4RW7B 5K14B 1S49A 2FVCA 2WHOA 1IKWB 4NLDA 1SH0A 4DL3A 4IG0B 3RB6A 3PVXA 4PWDA 1QUVA 3PJXA 2R2UA 3M8QA 1RT6A 4NRUA 1JKHA 4RW7A 5K14A 4NZ0A 5KFXA 5KT3A 1IKWA 5KG7A 5DG8A 1WNEA 4IG0A 2YKNB 3MEDB 3EZUA 3HVWA 2W8LA 1UWBB 2ASDA 2R2SA 1RYSA 3BQ1A 4IR1A 4PQUB 5J2MB 2HNDB 3QYYA 5KFAA 2F8EX 3JYTB 2AX0A 4NLVA 2YKNA 5EWFA 3MEDA 4QWEA 3BQ0A 3RB0A 2ATLA 1RTJB 1UWBA 2WOMB 4NLGA 2YNFB 1SUQB 1S48A 4K4YA 3EPGA 4ECSA 4PQUA 5J2MA 5D3GB 4DL4A 2HNDA 2WTFA 5KFIA 5HBMB 3RBDA 4EEYA 2ZD1B 3JYTA 4MK7A 5F8HA 3DLGB 1RTJA 2D3UA 2WOMA 2YNFA 3NBPB 2XGQA 4ED7A 1SUQA 2DPJA 3PHEA 1JLBB 1S9GB 1HMVB 5D3GA 3H5SA 2V4RA 3H59A 1JXLA 5HBMA 4IFYB 2V9WA 1TQLA 2WK4A 2AGPA 3QGGA 5KFSA 4Q8EA 2ZD1A 3KMQA 3MR6A 4K4VA 2HMIB 4M94A 3DLGA 1RAJA 1QAIA 1TKZB 3NBPA 4GC6A 1JLBA 1S9GA 1HMVA 3QO9B 4EO8A 2IC3B 4IFYA 2RDIA 3BQ2A 3I5CA 1IKYB 4HKQA 2HMIA 3ISND 2ZE2B 3D5MA 1TKZA 4ZPAA 1T3NA 1NHUA 3CO9A 1RT3B 3CDWA 3QO9A 3IG1B 1NHVA 1REVB 2D41A 4K50A 3N6MA 1LW2A 2IC3A 3V6JA 3DMJB 4G1QB 4Q43A 1CSJA 4ZP7A 1IKYA 2R2RA 2ZE2A 2W7PA 4F4YA 3IS9B 4QWAA 1YVFA 4URSA 3DRPB 2VA3A 2FLLA 3GYNA 3LP2A 3PW4A 4IRCA 2VG7B 1RT3A 2OPPB 3KK3B 3IG1A 3OHAA 1REVA 2ASLA 3IGNA 5HP1B 1S1WA 3DMJA 4G1QA 3PJWA 1IM4A 5KFQA 5EUHA 1S0NA 2V0NA 3HHKA 2E9RX 2GIRA 4J9PA 4ECXA 4DEZA 3IS9A 1IKVB 3SI8A 1S6QB 3DRPA 2RKIB 2VG7A 4LSLB 2OPPA 3KK3A 2YNIB 1RA6A 2BRKA 4O3OA 4FS1A 4ECRA 1S9EB 4I2PB 1LWFB 5HP1A 3CJ3A 3FSIA 2XC9A 3KJVB 4DL7A 3GQCA 4LQ3A 1IKVA 4NLQA 5F9LA 1S6QA 4I2QB 5DQIA 4LSLA 3G6VA 2OH2A 2YNIA 2J6SA 1S9EA 2UVRA 4I2PA 1LWFA 4Q0BB 4K4XA 5DGBA 4ECVA 3KJVA 1RT1B 5DQGA 3GIKA 5KFEA 2IM3A 2W9BB 4ECTA 3NMAA 4I2QA 3CJ4A 2HNZB 3UPFA 1BQMB 5KFYA 3EPIA 2YNHB 5C5JA 4RZRA 3SFGA 4Q0BA 1MMLA 5KT2A 2IMWP 5KT5A 1RT1A 1GX5A 2W9BA 4WZQA 2WONA 3FQKA 4EBCA 3E01B 2R8KA 1RT2B 2HNZA 2BQUA 1BQMA 4ED3A 2YNHA 1JLCB 4LSNB 4O3NA 4QPXA 4NLPA 1S1UB 3H4BA 4ECWA 3ICLA 4KFBB 4IRKA 4ZVGA 3T5KA 4H4OB 4NLYA 4NRTA 3E01A 3KLHB 1Z4UA 5KG2A 2C2RA 1DTTB 1RT2A 3M8PB 1S97A 1JLCA 4LSNA 3KLFB 4ZVHA 3RBEA 2JEJA 1S1UA 4IH7A 4NYZA 3PW0A 4GC7A 3OSPA 4KFBA 1RYRA 3FFIB 4MKAA 3H5YA 5L1IA 4H4OA 2C2DA 4RNHA 3CJ0A 4EYIB 2B5JB 3KLHA 1NNDA 1TVRB 4O3PA 1DTTA 3M8PA 5HROB 4KE5A 1KLMB 3KLFA 4RW4B 5EDWA 5KFUA 4ZMMA 5I3UB 1VRUB 5KFBA 3FFIA 1SH2A 4DG1B 5KFNA 2RF2B 2B5JA 4ZPDA 3QIDA 3G86A 1TVRA 4ED2A 3DM2B 2R8HA 4RNMA 4DL2A 4WFZA 1HNVB 2JEGA 5HROA 2JC0A 1KLMA 1S1TB 4RW4A 3N6LA 4Y34A 4ED1A 1HQEB 1S0OA 2IBKA 5I3UA 1VRUA 2CJQA 4KB7A 4DG1A 2IM1A 2OPSB 2RF2A 4B3OB 4MK9A
chains in the Genus database with same CATH superfamily
4NL5A 2FJXA 3GV8B 3OSNA 1S1TA 3K5NA 5LJ5Y 2DEIA 4B9NA 2I8EA 3FRZA 1LXNA 1XMOF 1WC6A 3P49B 4BC9A 4DSFA 4Y2AA 2FQQB 4QWBA 3O3LA 1QM9A 1RTHA 1F1BB 1KR4A 1R3NA 3QZ7A 1C2PA 3BV8A 2GCFA 2QE5A 3N6NA 3AT1B 3CB4A 1UAWA 3V4IB 4CCHA 4R8UB 3KLEA 5KTQA 2VG6B 4ZVQB 3H5XA 3DFEA 2HG4A 1B99A 3D6FB 3P96A 2QV6A 1WHYA 3GCWP 2AD9A 2R7OA 5AE3A 2HHHJ 3GJSB 3D28A 4RNOA 1PYSB 2SXLA 3FNNA 4OYOA 4JP8A 3OL7A 4MMOA 1NKEA 1HA1A 2WZ1A 1F2GA 2VPWB 3VGTA 1N0VC 3C2PA 4U7CA 3SCKE 5DG9A 2GIQA 4IOBA 5HLFA 2RS2A 1S9FA 2QG9B 1UEKA 3O1LA 1EZZB 2NPFA 2VD3A 2NYIA 2ROGA 4O3SA 2OPRB 3K7RA 4FYDA 2JLEA 5CYQB 4WFXA 3GIRA 4PXDA 3CDEA 3PG9A 4RBVA 3KK2B 4RX6A 4QR2A 3DLEA 1HWIA 3UDCA 4BDPA 1G1XA 3T9ZA 1X4DA 1Q81T 1FKPB 1LWCB 5KFTA 4JI8J 3T1AA 4KKOB 1M5KC 2ZM6F 2VFRA 2PDAA 3ZZUA 3DOKA 2NREA 5HQLA 3MEEA 2VU5A 2QC3A 1SXLA 3W5ZA 3I56S 4ZCLA 2D9PA 4ZPBA 1JLAB 1LW2B 1I1GA 4CWBA 1AB8A 2DJWA 6FDRA 4DFPA 5HO4A 1FXDA 2YPYA 2D9OA 1JLQB 3M6UA 2V9KA 4PXCA 5JXSA 2KU7A 2KB2A 4RU9A 4RLEA 2W4CA 1GXTA 4V19J 2UVWA 4RNNA 4CI0B 2MQPA 2WONB 3LP0B 2N4DA 1CJVA 1H98A 2QLFB 4OYPA 4RNFA 1NJWA 1K1QA 3PR5B 1SIWB 2FJDB 2MQMA 4O4RA 4DPTA 3PIPQ 2U1AA 4PG6A 5HVHA 1IN0A 1OMSA 3FBBA 2CQBA 1WHWA 4RW7B 1S59A 2EFNA 1SH0A 3MWBA 4PWDA 5BYRA 3TQEA 2K8GA 3D3CJ 4X65F 1Q7LB 4DR6F 5CXTA 2DNGA 3R2DJ 5HAOA 3TJ8A 3RB0A 5D4PA 1VQPS 4NLGA 4DR3J 5HBMB 5LSRA 5HL7Q 1P8GA 1B0PA 3RBXA 2UXBJ 2QZ8A 2N82B 3PFOA 2FDNA 2PC6A 3R8YA 3G2XA 4OIXA 1CSJA 2OHDA 1IKYA 4FF1A 4O0IA 3IG1A 1HNWF 2G1HA 2FY8A 1Q8LA 1S9EB 1XBWA 1U1LA 1MN9A 4ERDA 3ETMA 2KRBA 1DBDA 4ECVA 3GIKA 3R97A 2H9ZA 4ECTA 2MQLA 1F3FA 2XEXA 4LUBA 3CCUS 1OY9A 4Y0FA 3KLHB 2CJBA 3KJQB 2FYXA 3AJ1A 4NYZA 4LF1A 3CPWR 2B5JB 4B3MF 5KFUA 4ZMMA 3EGNA 2KFNA 4ZVSB 5KFNA 4IRKA 4I69A 3N6LA 1ELOA 1S0OA 1Y5LB 5LL6d 2EKYA 2CQ0A 2XTJP 3DM2A 2DHSA 3M8RA 2PSZA 4ECUA 5AXNA 1WD6A 4K5RA 2OPQB 2XZTB 3M7VA 4V19X 3KG0A 2NSBA 1T8EA 4HDHA 5KFGA 4YMEA 5J2QB 5KG4A 3Q0AA 2GIFA 4IDKB 2H54B 4WP9A 1UVJA 3H2UB 2NLWA 2E29A 1WI6A 1WDTA 3V4IA 4R8UA 3FCVA 5DLGA 4WFBQ 2VG6A 4DPOA 1K44A 1R0AB 3TA2A 2RS8A 5D0HA 3Q8YA 5EWEA 4JV2A 4LFAF 2EG2A 2HFUA 4ZA1A 2UUCJ 5D4LA 1K9MT 2DHAA 1VBXA 3BKFA 3NL0A 2BANB 3H4DA 3FEYB 3UN2A 5J2NB 2HQ3A 3CULA 1EHWA 3EVWA 3BYRA 5DZ6A 1VCTA 1VOMA 2JVOA 3HHLD 2J7KA 3I9ZA 3VHQA 3CDBA 4J9RA 3PHTA 4B9SA 1FDAA 1W2IA 3T3FA 4U96A 4QJVA 3CCTA 1KD1T 4Q5VA 1PC5A 5F8GA 1FESA 4N76A 1MWZA 2J9EA 2OPRA 1GMUA 1WI8A 2P6TA 4UZCA 5CYQA 5A2QY 4DQSA 2J0SD 2YNGB 3GJQB 4A46A 4IG3B 2EKNA 2VIHA 4JV0A 3KK2A 1Y3JA 1U6BA 2XCAA 4EU0A 3A8EA 1K73T 4Z7CA 3ENAA 4U9RA 2Y9HA 2EW9A 4P52A 1FKPA 1LWCA 3PXGa 2KG1A 5C42B 4KKOA 4KIAA 1YJ7A 1H6KX 4KT0C 4LRFA 2OO4A 1IJFB 3IR7B 1NRKA 1EKRA 4G6VB 3IWXA 1W26A 2FJBB 1AYEA 3T41A 3BGLA 1Q53A 1PJ7A 3LP2B 4JI5F 1JLAA 2V63A 4Z7YA 3PIOQ 3JAMY 3M9OB 2YQ3A 1JLQA 1T9TA 3PW5A 4OZ1A 2R8GA 1YHQS 3AH6A 3CSKA 2AHOB 3KDOA 2MKKA 5C25B 3EDQB 2W2QP 3AXKA 2CDQA 2CUYA 4O23A 2BR0A 3MMBB 5F9NA 3LP0A 5BYQA 3LWMA 3HSJA 3AB2B 3BEGB 2H3EB 3CC7S 2DIVA 3KYLA 3UN5A 4NLTA 4HI2A 1NDPA 2UV8A 5I4MA 4LF9F 4J9KA 4WCEQ 5J2PB 1Y3KA 4P75A 2MQ8A 1S77D 2KFZA 1U4BA 1HR0F 1TUVA 1XNQJ 1V6HA 4Y28C 4DS5A 1M90T 5B0CA 4NYPA 1NKCA 2GW8A 4RW7A 1I94F 2CQ3A 4ELUA 2RDDA 3TUIC 2AX0A 5AE2A 2FGOA 4FYWB 5F3TA 4FZVA 3HLUA 4B9MA 3IR5B 1NJYA 3U1LA 3RBDA 4K59A 4EEYA 4MK7A 2VJVA 3QT7A 4MJKA 1LWXA 3ADAC 5HBMA 3DNCA 4Q8EA 2YX1A 3KMQA 1QSYA 2FY1A 4JBCA 5IM0B 2Y3YA 1F0XA 4LJMA 2RQ4A 1NMEB 1SVDA 1Q78A 1YJRA 2VBYA 3OHAA 4NPOA 2CPDA 3TAPA 1IM4A 2L9DA 1S9EA 2ZH9A 1U2FA 1VHFA 2CQGA 2VL1A 3CC4S 3QAEA 4CLSA 3T6BA 1PAEX 1RZMA 3FQKA 1F9HA 1U8WA 3OTOJ 3FUYA 4B9UA 3C46A 3CF5Q 1Z4UA 4DF4A 3PKMA 4ZVHA 4A8SA 1SCJB 3VVTA 2Z8QA 1O8BA 2UP1A 3KLHA 4R25A 3D1QA 1YX2A 5KFBA 2B5JA 4ZPDA 4DL2A 2JEGA 4TKTA 5CD4A 2KVQE 3TO8A 2M88A 2FGCA 4P2SA 3GU0A 2HHWA 3GR0A 1Q95G 2UUBJ 2G1DA 4GRSA 2GNKA 2KG0A 4XDDA 4HH0A 5C2CA 3MFHA 2OPQA 2QEXS 3DGPB 3V5RA 5AXKA 2HW3A 2C22A 2VKZG 5J2QA 3D0HE 4H54A 4ED4A 1ROFA 5D15A 4IDKA 4NXMJ 4ZP9A 1U1MA 4OZNA 2PMHA 2DO4A 5KFVA 3N01A 1VHIA 4DV7J 1TKXB 2VQFF 1R0AA 3ILLA 2RKIA 3OFEA 3BO3A 2G2ZA 5IC6B 2CZ9A 1Q5YA 1HARA 1HWUA 4W98A 3I5BA 1CQNA 3HZGA 5BR8F 4USTA 2B4UA 2DGSA 4KJIA 3SV4A 2BANA 3GFHA 2JC1A 4LF5J 5J2NA 3FCHA 2FJWA 2ZH7A 3R5DA 3TP2A 1AXQA 4P73A 1CPZA 1C4AA 3CEDA 2P8IA 2DH7A 2W8KA 2XNRA 2K1RB 1HW8A 2UXCF 3ZTPA 2RQKA 3ZZRA 3SIPB 5GADU 4RW8B 1QTNB 3TX0A 2YNGA 3EGWB 4JI7J 4IG3A 4Y2CA 1ZA1B 2R8JA 4KYZA 7FD1A 2D7SA 4NZ6A 1RU2A 4YP3A 1RDRA 2G2YA 1YZ6A 4M5LA 2XB2D 2HVZA 1DQAA 5HN0A 1WKJA 5D0RA 1R7IA 5AXMA 1MSWD 4I6AA 5C42A 4EBEA 4F2RA 4AQYJ 2E1PA 3JXOA 1NJXA 4F8RA 3PRDA 2MKSA 5E41A 2ZC3A 1FA0A 4LRDA 3Q8RB 2CPFA 3CIMA 3R2CJ 2QT7A 4EYHB 3D2WA 5M2RA 4URGA 2MKHA 1UW4A 2CPYA 4DJBA 2XY6A 4U8VA 2BVZA 4TXSA 4PEOA 2MZSA 3MUMP 3SCIE 3H98A 1IQTA 5A2QU 5KFMA 3FDSA 1S0MA 4WYLA 4C0OC 2XBPA 1UFKA 5D0EA 5C25A 2MJNA 4B17A 4R5PB 4DX6A 1FX2A 3HVAA 2YKPA 1HNXF 1KTVA 3QJPA 1W25A 2DNMA 5J2PA 1BGXT 2FVCA 2DXEA 2XY5A 1IKWB 2XS5A 4ZS6A 1U0SA 1N54B 1WF0A 5KOXA 4EMDA 8RUCA 4IR1A 4PQUB 5ETNA 4UUWA 1FEHA 2LEPA 2KL8A 2HHTA 2JSXA 1MG7A 1S9GB 4MAKA 3JAMU 2NZ4A 5IXUA 3D4JA 3M8SA 2OSRA 1SQGA 3HHLC 3KNGA 4NX9A 1HD1A 5IM0A 4B3RF 2WVCA 3CCES 3KK3B 5HP1B 1N36J 4MYTA 2PFFB 4FKXA 3SI8A 1YG0A 3CJ3A 4N56A 1BWEA 3BM7A 5KFEA 3VAJA 2E44A 5C5JA 3TR5A 1PG5B 2Z2YB 4DUZF 3TUJC 2R8KA 2BQUA 1DURA 3DDNA 4O3NA 4QPXA 1WKLA 3E8OA 1KOOA 1CC7A 2EFGA 3IO1A 3I9V9 4RNHA 2AKWB 1PBUA 4KE5A 3EDRB 4C98A 4DOZA 4TU9A 4PXEA 1NDLA 1VRQC 4OYBA 5HJXA 1FRXA 4Y34A 3W3SA 5M2PA 3TANA 3HM9A 2WSFC 1UJ5A 4F0MA 2DNNA 3MR3A 2YKAA 1OS5A 5HMYA 4TY8B 1IWGA 1E6VB 2F1FA 1U2RA 2QA4G 3NGUA 4DLEA 3R7NB 4UY8T 3EE3A 4WKRA 4DV6J 4O3QA 3MM6A 4DUYF 3N9UC 1IBKJ 2HK3A 1QAXA 3DGPA 3PR4A 4RW9B 1HW9A 2ZBRA 4NZ7A 2GA7A 1VJWA 3NAHA 1V3RA 3RUBL 4X2BA 3VR1A 3OL6A 5HVGA 4ZVTB 2KXFA 4FBUA 2VJUA 3OJSA 2K7JA 1TKXA 1BXNA 3MR7A 2VDIA 4L3NA 4DV5J 4DFJA 3IWNC 1EJ7L 1VBZA 2GQCA 1NDKA 2DNKA 2DO0A 1KS2A 3PRBA 3EGZA 2BXJA 2CNNB 3CIZA 1QAYA 4CQ1A 3RAQA 4JYAF 4P2FA 1PJ5A 3M30B 4U95A 1WC1A 5IT4A 2XMTA 1PILA 1FD8A 1QD1A 4KGXB 1JX4A 3L4BC 4XK8C 4QIGA 4Q7AA 4WXWA 1Q0NA 3VZHA 2VV5A 4I1TA 2IM2A 2K1RA 3HSZA 3MTJA 3QAUA 2B8QA 3KOAA 1TU0B 1KHVA 3S7RA 4RW8A 3R5BA 3A3NB 4BC7A 2J8AA 3RZAA 2IM0A 4DR6J 1V5VA 4PAAA 1VK8A 1VJQA 3D1HA 3OUYB 3Q22A 4FXWA 3DLLQ 3KLIB 2MLZA 4K4SA 1SKWA 1TL3B 4UOGA 3GLJA 3ZC4A 5MLCV 4F26A 3FZBA 1ZM3A 1YJVA 4FKYA 2LVWA 1X4CA 2HLUA 3ELHA 1S1WB 1LXJA 2HIYA 2GQQA 1TR0A 2W9CB 2ASYA 1GT8A 1JJ4A 1X4EA 4J9UE 3CJTA 3H40A 2O01C 4C4WA 3CCVS 1N5QA 3ZTRA 2BJ3A 3ZZPA 5K8OA 1B70B 1Q79A 1NDCA 4WTYA 4PYDA 3V2UC 3SXLA 2COLA 4QIVA 1U25A 3D6HB 3AA9A 1IKXB 2QMWA 1UW9A 2VPZB 1RB0A 2NUHA 4M5DB 4DFKA 2FJVA 4ZITA 2FVRA 1SKUB 4DR5F 3LW5C 5KFJA 4R5PA 2J6TA 2WCXA 3NG8A 3AJDA 3TARA 1VQOS 3RW7A 2HS0A 5DG8A 3PX0A 1IKWA 2IFXA 3EZUA 4CLFA 5IQ6A 5J2MB 2R42A 4CNZA 5LOQA 2VBWA 4PG8A 2F8EX 2MHNA 2YNFB 4PQUA 3KUEA 1MWYA 3W64A 3OTCA 2PGCA 1NJIT 2XGQA 3PHEA 4HHJA 4I6YA 4GC6A 1S9GA 3BN7A 2P9CA 2G9OA 1NK0A 4NE9C 1X9WA 4KPYA 5D8HB 1HBUB 4GKKJ 2J9DE 2DCLA 2B7BB 1UVIA 1UZDA 3H7HB 2R2RA 3D3BJ 2RSQA 4WIIA 4JI2F 2IRUA 2QA2A 3PJWA 3R5JB 2KKHA 4LSLB 3KK3A 5HP1A 1TTHB 4HI1A 4P7TA 4J37A 4OI1A 3TEGA 5K8MA 4WK3A 1U1QA 4Q0BB 4CLYA 1NK8A 1TKDA 1R6VA 3NMAA 3K17A 2IMWP 3MOZA 3FC9A 1JLCB 2N3LA 3PX4A 3W65A 2WW8A 4QIEA 3F73A 2VKRA 1VR6A 2E5LF 2NYHA 2ZH4A 4QIWD 5DRKA 3OR1B 1M5SA 3ZTSA 3HHLB 4DR1J 3G96A 1NKBA 3W5YA 4DPYA 3RJMB 4LF6F 3HMJG 2ATCB 2O5DA 3AA8A 2VDHA 1T9UA 3OXGA 1RHMB 2A0FB 3VZIA 1TKTB 4LR7A 4PRFA 3J7AN 1FO1A 3AODA 4TY8A 1AFJA 4K2XA 4JV1A 4K5SA 2KHDA 2RUSA 1E6VA 4ZK7M 3ZNUA 8AT1B 4H4MB 2AZ1A 1NAQA 2LA4A 1X4FA 2XSFA 3WDOA 5KFPA 4LF2A 2XYGB 2AIRB 4CO5A 3CJSA 5EHHA 3WC2A 2CFXA 2RAQA 4RW9A 1BMQB 3Q8UA 3MF5A 7AT1B 2EFPA 4HTIA 1VGYA 3PW2A 2M4MA 2QLBB 1IUJA 4FPRA 1FF2A 2APOA 1Y00A 4JI5J 5I42B 1KRPA 4WTOB 5A8RB 3OXLA 3LANA 4X4TA 4FNHA 2J8SA 1WEYA 1X5OA 3CJ5A 1JIHA 4X66F 4NCBA 5IWAF 5E3CA 2RRBA 4QZVB 1VQ7S 2AEMA 4JI1F 1N5TA 4ECQA 4X4RA 1U1RA 1FVSA 3G6ES 4YUDA 1OY6A 2MKIA 3M30A 1UA1A 4FYVB 2QFIA 1YK9A 3MGJA 2HNYB 1OYDA 2RUGA 1NZAA 3OT9A 1FJEB 4J9MA 3G8SA 1TK5A 1MWQA 2CNLB 1VISA 2DY9A 1Y0HA 2JFKA 3C8YA 3NCQA 1RAGB 4KHRA 2ALZA 1HI8A 2AJ1A 2B6AB 5E3PA 4ED0A 1HR0J 1NHKL 3VWSA 4LF4J 2ZHOA 4B02A 4DUTA 4PR6A 3EUNA 5DETA 4ELTA 2EI5A 1CJKB 1HBNB 3X1LB 3W2VA 2CJYB 4Q45A 1IBMF 1RP5A 3BSOA 4J90A 2VQEF 3PDNA 3NWRA 3OL8A 1D0EA 3OUYA 3MR2A 5DDQC 3KLIA 1UPMB 4MTPA 1IXKA 1VQLS 2RHSB 2BKPA 1TL3A 3K5MA 3GPAA 5B0EA 2VODA 1WSRA 2DRAA 1Q5VA 2ADCA 3AOBA 2CA9A 3B4MA 4KGZB 1V9OA 1C1BB 3IRXB 3CVKA 2W9CA 4N5SA 2MMYA 1TMJA 3AY0A 4YR0A 3O5TB 4YOEA 1URRA 1KVIA 4CT8A 4CLZA 1WC3A 3CTRA 2ROEA 3UD3P 4ZHRB 3DN9A 1RSCA 1U48A 5LMUF 4UTGA 1Q1KA 3QLHB 3LUYA 4KC5A 3QNWB 3GYGA 5CD4H 1BHNA 2CG4A 1JJCB 1IKXA 1VDHA 5CHCB 2JJ4D 2AJFE 1NJZA 4M5DA 2LQ5A 2CWKA 4DSEA 1JKHB 1S49A 2QJ3A 3D1OA 4AFFA 5E0OA 1QUVA 3T6JA 5HMXA 2D74B 2Z58B 3A8IA 1VQ9S 2X1AA 1HBMB 3QYYA 3MUVP 5J2MA 1VK3A 1FVQA 1X4AA 2WBRA 1VYAA 1UEUA 4HEA9 2YNFA 4ED7A 2HGNA 1D9DA 3AQPA 3RR7A 4J9VA 2HZVA 2WK4A 3ENWA 3CCWA 4EO8A 5DO2A 3I5CA 2KVIA 2G0JA 3QT6A 3TEHB 2VFSA 1HBUA 1YVFA 2V8GA 1M5VC 1URNA 3PY8A 1QDUB 5ETQA 1S0NA 4P72A 2V8PA 5CCLA 2V0NA 2GIRA 5LMNF 3UW1A 4DBQA 1B3TA 4ZLLA 2QO3A 3ISZA 4LSLA 4XDCA 2DNPA 2E7XA 4K4XA 4ILMA 4DV3J 4X4UA 1NU4A 4USWA 4DR2F 4QU7A 3W61A 4Q0BA 2GJ2A 2F8HA 1VFJA 4HT7A 1SJFA 1A7GE 4EK2A 3CXCR 4BS2A 3L9ZA 2HBQB 3HHEA 2C2NA 3J7Z5 1Z1ZA 1UP1A 4JI4F 1JLCA 3KLFB 2DHGA 3H5YA 3CJ0A 1D9FA 1KLNA 5JVGQ 4H4KC 1N34J 2Z56B 4F25A 5I3UB 3OR1A 3SCLE 4RU2A 3HHLA 1CG2A 5T14A 1TAUA 1HHQA 4J9QA 3K2YA 3IP0A 5AXLA 4MKVA 4RKUC 1IBLJ 1FDNA 1DTQB 4OX9J 5DQHA 1H2VZ 2KFYA 1RWPB 2ZKUA 4RUCA 1VQ8S 5D6GA 4PWUA 2BE7D 4CDIA 4F3QA 4CIOA 5AJ3F 3SSSA 3KHRA 2GMJA 5KT6A 1M1HA 1HD0A 2RU9A 1JMTA 5KG6A 1L5UA 2IIHA 4KH1B 3QT8A 4Y6IA 5GMEA 5K8NA 5D0GA 2I1RA 5B0FA 1RT4B 2XZDB 3QSIA 1R0CB 3UR3C 5HK4A 3FBCA 5I42A 5A8RA 3THVA 5LXYA 4CM0A 3EYZA 3VVUA 4OI0A 1H74A 4JI3F 5E33A 4J9OA 3MAHA 2HFSA 1QE1B 1FFGB 3KLGB 2V4JB 4KR0B 5CCMA 3WZ0A 3R6GB 2HNYA 2Y0SD 2BACA 2DGUA 4CZCA 1BQXA 3ILOA 2OP5A 4RO0A 2FVPA 3GIIA 3Q24A 2HVHA 4WWSA 4C8MA 1K0VA 2B6AA 2HHPA 3FK4A 2UUWA 1HKAA 3HSDA 2FHJD 1Y10A 2X7IA 2YKMB 1SJ3P 3HJFA 1HBNA 3QWPA 2OMLA 4RL1A 1Y5IB 4JI6F 5IT0A 1SC1B 1S10A 1RISA 3EM1A 1YIJS 3KKFA 1O5JA 1FI4A 3CCSS 4OX8A 2ZZMA 1FFWB 2LMIA 5DM6Q 1U1NA 2J5AA 2ZUAA 4NXNF 1N56A 2CG8A 4PXBA 4JI0F 5KOWA 2D3ZA 3ZTQA 1ZETA 3OR2B 5THWA 3LPYA 1TL1B 1UJ4A 5F8JA 4OV1A 2B43A 4GVBB 2HRYA 3CMAS 3ULHA 1J2VA 3SSRA 5I3PA 1RAHB 4ZP6A 4DZ6A 1C1BA 4CP5A 4ZLPA 1WF2A 5FIIA 3IRXA 4NMXA 3BB5A 2ZVSA 1L3SA 1FNMA 2J0WA 2H65B 1JLGB 2WVFA 4QW9A 2KT5A 4GVLA 4DPXA 1BWVA 4ZHRA 4DUZJ 2C1EB 3T9NA 3QLHA 3VF0B 1CBKA 1J5EJ 3EJMA 2W7AA 2XYHB 1U26A 2E5GA 1RT6B 2JEJA 2BV3A 1WHVA 1NLKL 4DN9A 3OD2A 3HSGA 1YRTA 4FDFA 2R2UA 1JKHA 2B56A 1UWBB 2NCKL 4C8ZA 1RAFB 2CJAA 4FF4A 1X4BA 2XS2A 2U2FA 2PO4A 3DLHA 4K4YA 1HBMA 3F56A 5F8HA 4ZVOB 4DR7F 3DLGB 2FIUA 1HMVB 1N33J 3MM7B 2PEHA 2AGPA 4YY3F 2DRDA 2M5YA 2ZH6A 1IBCB 1RCXB 5CYJA 1GTHA 2UUAF 3CCJS 9RUBA 1KFSA 3KTQA 2YH1A 2VUGA 2VFUA 1NHVA 3PYDA 1UEVA 2KT2A 3DRPB 3C16B 3PW4A 2P2CB 4ED5A 3G71S 2HFZA 2E9RX 1J27A 2E1MC 2VFTA 2BRKA 2YNIB 4DV4F 4OYAA 3WIUA 2C3UA 2XC9A 1CEZA 2KXHA 3N5FA 2WSEC 4ID8A 2W9BB 3SCJE 1FERA 2ZBPA 4EBCA 3M6XA 3IM8A 1S1UB 2F9DA 2D3OR 3A3OB 3AAWB 3M8PB 1RTZA 4I6WA 3L95X 3RBEA 1T9YA 2ERRA 2UU9J 2BOAA 4X4SA 2P9EA 2LXUA 2OI2A 1KLMB 3KLFA 5J1NA 1WG1A 1SH2A 2LXFA 2XHCA 3QIDA 4C6AA 2RILA 4G3IA 2ZOMA 3ET6B 5I3UA 3HD1A 4X64J 4EZ6A 2B4VA 4G65A 4B3SF 4LREA 3DLKB 4KV8B 1RA7A 5LSLA 2GX8A 3PACA 3SEOA 5IOLA 1Y7PA 2IA0A 3BR8A 5E5NA 3H42A 2HQIA 3BR9A 3HKWA 1DTQA 3MXHP 4B08A 3FBEA 1G7CB 2ADBA 3FEXB 2K06A 3IGVA 4KHPF 2A2CA 1FDBA 2HAIA 4JV5F 3T5JA 4Z37A 4E2FB 2OAUA 4DMZA 4LFBF 2Z0GA 4J7CA 4UF4A 2JLFA 3ZZZA 1X4HA 1TL5A 2ILZA 2AGQA 4KO0B 1S1XB 1HHTP 3M1VB 3JTNA 4ZPTR 4KQZA 4FPIA 1RT4A 4CLLA 3MECB 4QPTA 1U1KA 4O44B 3HK2A 4P9SA 5CAAA 3QRRA 1X8DA 3ETOA 1JJHA 3DCAA 4AE5A 1DRZA 2N4CA 1HYSB 1Q4RA 2FJEB 3KJFB 3TUZC 2CZ4A 4EGLA 2HKEA 2XM3A 5IS2A 1LV5A 4AYBD 5KFCA 3UVJB 1BQNB 4I67A 1U2CA 5DDPC 1QE1A 5A8WB 2R7TA 3KLGA 2GVDB 2PEBA 2HBRB 3K5PA 4FXVA 4F4XA 4OLPA 2IJFA 5L38A 5H9FK 3A8JA 2M70A 4OHWA 3F41A 2FHOB 2DNYA 3HFZB 2GVZB 1C4CA 2YKMA 2O66A 3OJUA 3C15B 1FRIA 2ZH8A 4IH6A 3ZTOA 3MOJB 4CRJA 3NKYA 3AOAA 2ZH1A 1AW0A 3GILA 2F3JA 2B4PA 4NLSA 2XMKA 1RKJA 3FEZA 4J9LA 3GG0A 3U27A 3KFWX 2R8IA 1FRKA 2MJUA 4TYAA 3OR2A 2V8HA 1U45A 1TL1A 3VAIA 1LQ9A 3I5AA 4GVBA 4ZOSA 4F0KA 1UPPA 3QJLA 3DDKA 3PYGA 2V8VA 5KFWA 2OEKA 2OTLS 2LQBA 2Z57B 3HJVA 1UL3A 2V5HG 2QA4S 3K58A 1WACA 1GMWD 1C0UB 1JLGA 2F4VF 3AD8C 3PFEA 3G8QA 4DU7A 2VG5B 1X7VA 2HFOA 3GTYX 3R5AA 3I31A 4EBDA 1JWWA 4IQXA 2VZ9A 2HHQA 2GMLA 1RADB 3MD3A 2HZCA 5KT3A 1RT6A 2QRRA 2ZC4A 4A8YA 3MAQA 4LF6J 4M5KA 5KFAA 1UWBA 3WHIA 2WTFA 5GMDA 3H0PA 3QGGA 4F4KA 3MR6A 4M94A 3DLGA 2K3IA 1HMVA 3MM7A 3HVRA 2L9WA 1QTMA 2ZE2B 3D5MA 4TNOA 4USHA 4U7UD 1G6BA 2D41A 4CT9A 1UVMA 2XMUA 1U49A 3DMJB 2KRRA 2XWXA 4HVZA 1WEXA 4F4YA 2GHPA 2GO9A 1U1OA 1O51A 5EUHA 4NA1A 3DRPA 3C16A 2DR7A 2XMVA 1LWFB 4M5GA 1ZBTA 1RAIB 3M32B 2YNIA 2YVSA 2CXEA 1R0BG 4OJGA 2YWEA 2W9BA 1P1TA 4LF7J 1S5ZA 2ZZNA 3B6BA 1RAEB 2B0GA 3ICLA 5IWAJ 3T1HJ 3PM9A 1DZ5A 1FE0A 1XMQJ 1S1UA 3CCRS 3R7SB 3FFIB 2C2DA 4JI1J 1VC6A 2ZWOA 2V6AA 1TVRB 3M8PA 3DGVA 5EDWA 3GSDA 2QYGA 1FTCA 2EBEA 1LNQA 1KLMA 1NBEB 4I0WA 5AT1B 5IT9Y 4JI8F 2E5IA 2CWXA 2BW7A 3ET6A 4YDXA 4ZPWR 4OYZA 4LRCA 1H2TZ 1RQ0A 3DC2A 4E8UA 1ZTWA 2AT1B 3VAFA 3I87A 4L73A 3DLKA 4KV8A 4FP9A 3QBCA 2DH8A 2JH3A 2EEYA 4Q44A 1XJWB 2OFHX 3PKYA 3C66A 3RRHA 2VOOA 2C2EA 5DGAA 4K4WA 3VCDA 1YWXA 2ASJA 4WP8A 3N79A 2FHMA 2X3DA 4UQTA 1OPIA 3HHDA 4H4KA 4MIAA 4KPCA 2NXJA 4KO0A 2W4DA 5JVHQ 1S1XA 1S57A 3M1VA 5GAGI 1QJHA 4RW6B 4RWWA 1ACMB 1HWJA 1DLOB 1QUPA 4OL8A 3OHBA 3MECA 1X0PA 4ETZA 4GKJJ 4USVA 3TX8A 2Y8WA 4O44A 3LGNA 4RBUA 3PJ9A 4ATNA 3G82B 1ZTTA 2XWYA 3DHXA 4DV2F 1XMBA 1M0SA 4Z2XA 1DQ9A 1HYSA 2G0IA 2NR0A 5DDRC 4YHHJ 2FC9A 3OL9A 2DNLA 3R5GA 3BN4A 4Q8FA 2ZBQA 4KBIA 2I2YA 3MCNA 3QMQA 3UVJA 2R7XA 2Q1LA 2OEMA 1BQNA 5ETOA 3MHYA 3BO4A 1OWXA 4LFCJ 5A8WA 4ZIVA 4DR3F 4WJBA 2GVDA 4DR4J 4OQJA 3IMQJ 2W2PP 3KMSA 4OX7A 2NS1B 3TVKA 3U1NA 2UXBF 4XIUA 4DQRA 1S79A 5DG7A 3UWTA 3LALA 4D3GA 4HACB 5L39A 4UT4A 4QIFA 2GVZA 3MPDA 4HT5A 3UR0A 2BJDA 2H4YB 3BBFA 4QW8A 3PO5A 3C15A 2B7CB 1DQ8A 1KNZA 2FB0A 2ZKTA 1HI1A 3H8YA 3IAM9 2KT3A 2IY5B 1PGZA 3TWZA 1UVNA 2DKOB 1YKWA 1NCLA 2HK2A 2N3OA 2WVBA 3OBIA 4LVOP 3B4DA 1T03A 3Q23A 2DR9A 1P1LA 2R2TA 4PPZA 3T5LA 2Q66A 1SIZA 1U0HB 2AJQA 1ICEB 5T7LB 3M9NB 3JSMB 4OZJA 5KFOA 3N0VA 3FBFA 3G9CA 3OTEA 4F4WA 1LK5A 2CQDA 2RHQB 3CDUA 1C0UA 1HHSA 3F44A 3SQOP 1E6YB 4J91A 3R27A 2JRSA 1M1GA 2VG5A 3X3UA 4XPEA 1JNZB 6FD1A 1Q8BA 1RHJB 3K59A 2F63A 2QX0A 3QWUA 4JB8B 1NB7A 2ASDA 5GAGU 3UO0A 3PCOB 5F0WA 3FVYA 4QWEA 2IMOA 5EWFA 3BDEA 2ATLA 1SUQB 3EPGA 4FYYB 2LU2A 1WTFA 4RR5A 2LDIA 2ZDOA 1U6FA 2BA9A 3D54A 1JXLA 2YWHA 1QAIA 2FZKB 4YFUA 3VV2B 4P71A 3DLJA 2IC3B 2DR5A 1UMJA 5AJ3J 1WELA 2HGMA 4CLWA 2ZE2A 2BE9B 1R8BA 3GYNA 2N7CA 4F67A 3M2VB 3DMJA 2F8MA 3MI7X 1ZH5A 2RKIB 4N77A 3M2RB 2J6SA 1LWFA 5DGBA 2IM3A 2JLGA 4GO5X 3M32A 4Q2MA 1NXIA 1VC0A 3CCZA 4YB6A 4HR2A 2LFVA 3PTWA 1RT2B 5CZXA 4CLTA 4KFBB 4N7TA 2RJZA 2BM0A 2D3O1 1RWXB 3GWCA 3OSPA 2CPZA 3H2VE 2KYXA 4O3PA 4LF8J 1KVJA 2CNOB 3JTOA 1KWMA 2DK2A 1HNZJ 1EKSA 3FFIA 3WX4A 3J81Y 2R7WA 4PWWA 1A6LA 1TVRA 4WFZA 2VBXA 4TU8A 4B3OB 2Z30B 3M8YA 3U1MA 3I0RB 3S01A 4LT6A 2VA2A 3BSAA 4UOHA 9ATCB 4ZVEA 3MCSA 2RNEA 2WB4A 4DWIA 3GIJA 1NH7A 4WXOA 1RWMB 1RWKB 1Y4ZB 2D69A 3NGRA 3M8ZA 5A6WA 4P74A 4W4MA 1KKHA 1UVLA 4I7FB 2POKA 4OHVA 3AXMA 3IFEA 3JQMA 2O3DA 2AWZA 5K20B 2YXLA 3RBZA 2DB1A 4B3TJ 2UXDJ 2A18A 3BBBA 3MFIA 2AV5A 4M63A 1RGVA 1XNRJ 3KWMA 4RJVA 5DM7Q 3LWLA 2IDEA 1S6PB 2YBVA 1O6XA 3IWLA 3HFKA 3DI6B 5BJRA 1ITPA 2HFNA 2MTLA 2FVSA 4CM2A 4RW6A 2GGPB 4RUAA 1VIXA 4TY9A 1DLOA 3HXMA 1XR5A 5IT9U 3NGSA 4MIBA 1AROP 1NK6A 1OQ6A 1XWLA 4P2XA 3G82A 4X84A 2J6UA 3GFXA 3CD7A 1FNXH 2FZGB 1RHKB 1MU2B 3SBMA 2L08A 2NPIA 2O1PA 4DV1J 3NNCA 2EFVA 4IYQA 1FWLA 1ZM9A 3Q8PB 1FJ7A 3N4WA 3HO1A 2M52A 3US5A 3TA0A 4Y65A 5C7PA 2XSJB 4OJ3A 2QL9B 2B9XA 2JNJA 2Z4PA 1LFPA 2E1AA 4A48A 2G0CA 2P5VA 2XG8A 4OZ3A 5HQMA 3MM5B 2VB6A 3MURP 4MH8A 4ZVFA 1RWVB 4HACA 1PKUA 3O2IA 2PT0A 1A0OB 3DRRB 5DDOC 3B78A 1HNIB 4P6QA 5F41A 5EWGA 2M7SA 5ETVA 2RQCA 2VPXB 3QZ8A 3NNHA 2GMHA 4F3MA 5HJYA 2DYAA 5JJBA 2NXCA 5KFRA 2UUAJ 1SB6A 2DTJA 2RE1A 2BOPA 4HHHA 4K4ZA 3GB0A 4RUHA 4DI6A 4XTTA 5B0DA 1YJUA 2BZ2A 4KSEB 2K3KA 1ZOTA 1Y9OA 4DV4J 3I96A 4TN2A 3CJKB 2MSSA 3CUNA 4PYAA 1U0HA 4D3HA 3WQPA 4TQSA 2D1CA 5T7LA 5BYSA 4C8NA 2HURA 3L7PA 3JSMA 2AQ4A 2AMCB 7FDRA 4DV0J 1TFWA 4ZJOA 1CC8A 4C11B 2KM8C 1U8SA 4TVAB 2WRMA 2UVVA 4L6V3 3CE8A 1FX4A 4OZ0A 2YWFA 1PCAA 1E6YA 2CVEA 4K2JA 4OZ2A 4TLQA 5CZVA 5E2QA 2UUBF 1VBYA 1GX6A 1SQFA 1X4GA 3UI3A 1UTAA 4NZ0A 5KG7A 3AD9C 4LR9A 4ENOA 3MEDB 2DEJA 2DH9A 2MXYA 3DU5A 4NLVA 3BQ0A 4EZ9A 4B9VA 1K8AT 1X5TA 4DSJA 1SUQA 2HYIB 3M2UB 3MM6B 4NXMF 2V4RA 5KFSA 5HSPA 3NWGA 3HKZD 2DIUA 3NXZA 4DV7F 1FWKA 2MZRA 4F3OA 3CDWA 4YB7A 4K50A 3N6MA 2IC3A 3V6JA 4QWAA 2JHEA 2KHCA 1VS3A 2ASLA 2VC0A 1QLNA 1NK9A 4DEZA 1IKVB 5IQQA 1VLYA 4O3OA 3HULA 1M5OC 3I4HX 3M2VA 4AXIA 3KJVB 3O6QA 2AF6A 2HIQA 2RU3A 3G6VA 2QLXA 4LF5F 3GYXB 1RT1B 2XO7A 3HDSA 2LLZA 3POTB 3M2RA 1BQMB 2M0GB 5KT5A 4UQGA 1OSCA 4LSNB 2RD5C 2GAGC 3L7UA 1X60A 4ILRA 3DOMB 1F6TA 3MUTP 5E7OB 3P45B 1RT2A 4KFBA 2V2VA 2H5IB 1REGX 2KTQA 4LR8A 3DKDA 3DLBA 3UN3A 2A6MA 4DCJB 2OSQA 3G86A 4ED2A 3ZZYA 1HNVB 3CJQA 4IOAQ 3ZZTA 2GQ2A 3ONQA 4F0HA 2MYFA 4CO1A 1T94A 1D8ZA 1WUUA 2UUTA 4B3OA 3L7OA 1F5BA 2L41A 2CQCA 3I0RA 2FVQA 1H73A 2B4OA 3KUHA 2H4WB 2BBEA 3D6MB 4DZDA 5L1LA 3NS5A 4OX6A 4PKDB 1UCNA 3ZNJ1 4OI6A 1N5SA 2CQ2A 5LJ3Y 4TYBA 4I7FA 2M2BA 3HT3A 4ELVA 1U1PA 2RIJA 3W1YC 1SV5B 5EX0A 2C3PA 4F02A 4DSLA 2X1FA 2HSEB 3OTDA 1YBTA 2H5JB 4U8YA 5K9FA 3RAXA 1WG5A 3IBFB 3M6WA 4MK8A 4CYUB 1WEZA 2ZJQQ 3CO0P 4BCAA 1VRTB 1RK8A 2LKZA 1SBRA 3JSBA 3SYZA 1S6PA 1TK0A 2AYGA 3UDLA 3J81U 3DI6A 1VQ6S 2E1CA 2FD2A 2KYZA 1RXOB 1T3OA 2HVIA 2GGPA 1L3TA 1DAXA 2C2ZB 4JOUA 3V6HA 3PX6A 3D9BA 2XI3A 1CVJA 2CKWA 3MTKA 3GJRB 2CQHA 1EQ0A 3KHGA 1EQMA 2VICA 2DGVA 3WIVA 5IV4A 4NLUA 4LIRA 3P8BB 4WK1A 1JXEA 1MU2A 4UOCA 1YLXA 1P9QC 1TFYA 1TAQA 3Q83A 2XSJA 3T1YJ 2LP4A 3HT0A 3G87A 4QYZK 5DJBA 4CH1A 2ZH3A 3KUGA 1S1VB 1RHUB 3QJJA 5KG3A 2DNZA 2LCWA 4ICLB 3MM5A 1XMOJ 3J81j 4FF2A 3D0GE 3LGHA 3C3LA 2MQQA 3DRRA 2OELA 1N36F 4DPWA 1UFLA 1HNIA 2MY8A 3HX9A 1KONA 2X51A 1KQGB 3G6XA 2DGXA 3RU0A 2CADA 1RLCL 1P9YA 3CCLS 4USKA 2EVZA 2DPIA 1KQKA 2HHUA 3ZFVA 3RYLA 1NK4A 2FLNA 4WYWA 3J7A1 1FKOA 3R1HA 2ZHBA 5LM7E 5KG1A 2PI4A 1VQNS 4HH1A 4YR3A 1Q16B 1S6UA 3K8VA 3BGRB 3CJKA 1U6ZA 2A2DA 4LBIA 3EXCX 2QTWA 2BQRA 5F0UA 4M5JA 1NO8A 4IRDA 2HQFA 2L48A 4F4ZA 4DF8A 1IM6A 1RT7B 4AXJA 1GTEA 2PIIA 4C11A 5H9EJ 4CH0S 3BS9A 4M5MA 4DL3A 4WBFA 2Q6CA 4QBUA 1JNRB 4A8OA 2FLOA 4NRUA 4MT1A 1N0UA 4ZPVR 1WNEA 4ZCKA 3HVWA 4DV6F 3L09A 2W8LA 3BQ1A 1CS4B 1N32F 4QOTA 3MEDA 1IBKF 4ECSA 4X4OA 2KZZA 2D3UA 1JLBB 5GAEI 3WX8A 4K4VA 4Y00A 1FRLA 1TL7B 4DN0A 3TYTA 3M2UA 2V8DA 2ZM6J 2HQGA 4OJ1A 1ZPWX 1WC0A 2KM8B 4Q43A 3RR8A 4BHQA 2VA3A 3IS9B 3NP5A 4URSA 3RGIA 2DXFA 4DV5F 4FF3A 1UWAA 2MKYA 4NI2B 1H3DA 2Y8YA 2WSCC 3J7YI 2AW0A 4OHZA 2W24A 2KJWA 4DL7A 3IRWP 2R7SA 1IKVA 1I51B 2HRTA 2B3TB 3KJVA 5DQGA 5KFYA 4RZRA 2DNQA 4I56A 4OLOA 1RT1A 5T41A 3H20A 3POTA 1BQMA 4ED3A 2LEBA 2PFDA 2B9WA 4LSNA 4Y2KA 2CQ4A 3DOMA 2DRBA 1MLAA 1F9EB 4DV2J 1T9WA 4YEAA 5HROB 3BF4A 4DG1B 2W25A 1GK8A 1BY9A 3OVAA 1OO0B 4ED1A 4EWTA 4RPFA 2IM1A 1HNVA 4C8OA 4C97A 2I38A 3DYAB 2G2OA 2MLXA 3LPEA 1APSA 1GXUA 3P5BP 2X1BA 3W2VB 1JQGA 2CQ1A 3MCOA 2V34A 1FE4A 3TOQA 3RB4A 3CCMS 4X65J 3W9JA 5GMKa 2JFDA 4IH5A 1HPZB 5CH7B 2V67A 5L9XA 1RWNB 1QVGR 2K2PA 3B8HA 1EB0A 2M3DA 3IBCB 2VOPA 2AX1A 1Q82T 5KAKA 1C1CB 2NQPA 1ZM2A 1S6OA 3HP6A 1SV5A 4B9LA 4OMFG 4FNIA 5HQ8A 4N8NA 4NCGB 3L3CA 1UFWA 4CH7A 5DS7A 1B64A 1QSSA 3PNIA 2R7RA 4KTQA 1NPPA 3EGVA 2J0QD 1QVFR 1HNWJ 4CYUA 2XS7A 4JUZA 1EIYB 1VRTA 4PQAA 1RLDA 2OUGA 3EVOA 5D4NA 1KEKA 3HZEA 3W63A 4C3LA 4KY3A 2LYVA 2OD4A 5DZ7A 5GAEU 3H90A 1L3KA 2QLJB 1LK7A 5KFZA 4A8QA 5JMNA 3VGVA 3CDAA 4IR9A 2KXNB 1S4FA 3VAGA 4ID5B 2HPUA 2J0XA 2F65A 1GMWA 4KRWA 1XERA 4NA2A 3J80Y 4B3MJ 4O0NA 3J7YU 3QATA 2W9AA 1RBAA 2E9ZA 1MMNA 3S6EA 4C8KA 3W5XA 1TUGB 2H5EA 2CNKB 3V6KA 4X4NA 3R6LB 3D7SB 1ULRA 4K0KF 4GKKF 3BDPA 3GV5B 3KHLA 4DX5A 1S1VA 4TLRA 2JZ5A 5D4OA 2V50A 1KFDA 4ICLA 1OIAA 3Q8SB 3JB9k 2HAFA 1EETB 1VLOA 2AEJA 5B0GA 4M5IA 1JLEB 4HHUA 3J7ZT 5IZHA 3C19A 2L9NA 1SC6A 1Y5NB 4PUOB 3UCZP 2GS8A 1RCOB 2AJ0A 2QA1A 3BH7B 1RTDB 4ECYA 4K8RA 2KJVA 3CW2C 4AL7A 4WKYA 3G8TA 4NA3A 1PC4A 2W1BA 4C0HA 2DY1A 2Y1LB 4LFAJ 1HL6A 2Y0BB 1NH8A 2RQMA 5F8IA 4A47A 1B0VA 2DGWA 3C14B 4DR1F 2RDJA 3BGRA 2E1RA 1YZ7A 3V6DB 2YPZA 2IRXA 4DCOB 4RWXA 2QFJA 1RT7A 3MMAB 2GAHC 2AYBA 2HLTA 2WHOA 4M8LA 4C9DA 3RB6A 3GONA 2EBGA 3CD0A 4DQPA 5ADZA 2MSTA 5C2GA 5HMZA 1RE1B 2R2SA 2OKQA 1PO6A 3IBWA 3PRVA 2F40A 4F2SA 3BH6B 2HVDA 4CLKA 4DL4A 1CS4A 4ZVUB 1DARA 2ZD1B 4WFAQ 3CGIA 3CMES 4OHYA 5IC4B 2BJ1A 2ZZTA 3UNYA 1UJ6A 3HFVA 5IFMA 1JLBA 2OMOA 4CO3A 2RDIA 2KZMA 1PYOB 1AT1B 1TL7A 1NHUA 3CD6S 4LMZA 1VQMS 1LW2A 3OPKA 1WC5A 2HS3A 1YRXA 2OPPB 1KQSR 5KFQA 1Z2LA 3HHKA 3OVSA 2IVFB 4ECXA 3IS9A 3I4PA 3W60A 4WPAA 2WW4A 3FSIA 2M8DB 1R27B 4NI2A 2NSCA 1NZ8A 1KSPA 1FJGF 2UVRA 3CJRA 3HPOA 3EZOA 1FHTA 3BGUA 5KT2A 3Q89A 2WONA 2MB0B 3TZZA 4H4OB 3DXBA 4ANEA 1S97A 2QL7B 4PPDA 2XYPB 1Q8IA 1UA0A 2Y1IA 3NOCA 3TNVA 4LF4F 2QMUB 2HVEA 2RF2B 5HROA 1VQ5S 2ALYB 1LFWA 4KB7A 2J9CA 4DG1A 3SSQA 1T95A 2ZITA 4LF9J 1GH8A 1NSPA 2ZFHA 2DISA 3QSYB 2FPHX 1FKAF 1LOUA 1Q86T 4HL9A 4M1KA 1YJWS 4DL0C 4QQBA 4MKYA 1GQEA 1W7WA 2VF3A 3DYAA 3UQSA 5G0RB 4U7UK 4OI3A 4FBTA 1I94J 2MPUA 1W2BR 3DRSB 2FZCB 3QGHA 2ZNYA 3VGSA 1HPZA 2FLPA 3RRGA 1WHXA 1PJ6A 1YJTA 3LQVA 2MQNA 4MKBA 3TI0A 2BM1A 2MKCA 2MHEA 3A12A 2DITA 2B51A 1MROB 3QGIA 3K8WA 5GADI 1C1CA 1LEOA 3AFGA 4X62F 2V69A 1U7LA 4OYWA 3G6YA 2BJ7A 1PIEA 3OXFA 1QSLA 4CLPA 2C28A 1ZPVA 4NCGA 5EX3A 3KHHA 1YI2S 2RT3A 4WIQA 4QWCA 1F9FA 1N5YB 2IAJB 3KK1B 1JB0C 3IA0A 2AYMA 4YS2A 3EX7B 2BMBA 1N48A 4WE1B 2AJ2A 2JOQA 2FC8A 3HF5A 3TJAA 4L3KA 3W8GA 1NM2A 2V2QA 3BKUA 1HQ2A 1TL4A 2CRLA 4R0EA 1H7WA 2DHXA 1RHQB 4DPUA 1F5CA 4KAIA 4FYXB 3LP1B 2HWIA 2A6OA 1U09A 3NGTA 3A3PB 4ID5A 3LAMA 3EICA 3MEGB 4B9TA 4DCPB 4F50A 1LW0B 1H0HB 3CJ2A 2BE2B 3THTA 5CYMB 1I6JA 4L76A 3GZ7A 5GAHI 1T05B 3NAIA 3GR1A 2HBYB 3IXQA 2ZH5A 2LEAA 4YN3B 3D68A 3NRBA 2BRLA 2DXDA 1LWEB 5F8NA 2CJXB 2IBOA 3FJ2A 2XGPA 1SKSA 1RU1A 3MPUB 2GJIA 1EETA 3RG6A 1JLEA 4DV3F 1WOPA 2LECA 1XC9A 4PUOA 1RTDA 4ZVPB 2VQFJ 2IVMA 5MAOA 2AGOA 5FD1A 1FEEA 2AP6A 3EMTA 1S4EA 3IM9A 1H2UX 5A76A 2ZBCA 3J80U 2YKQA 3SZ2A 4DXLA 1N34F 4EI2A 1V3ZA 2M9KA 1FJCA 3GG1A 3W9HA 2Z2ZA 4NCAA 5BR8J 3IN5A 2BDPA 3AQOA 5C24B 3C14A 1VQYA 3PZPA 1DJ0A 1JLFB 2XLKA 4A8XA 3V6DA 5KT4A 1KQFB 3P3DA 2W2MP 4IG0B 3MMAA 3B82A 4ES1A 1IBLF 4OX9F 3FSXA 3VGUA 1UKUA 2UXCJ 2HNDB 3LF0A 2DVIA 2HEKA 2DT9A 3JYTB 4N8OA 4R0JA 1RTJB 2WOMB 1XEZA 4I68A 4A8WA 1S7HA 1NSAA 4IFYB 1TQLA 2ZD1A 2HMIB 1TKZB 4CLUA 1SJQA 3BQ2A 2R7VA 1JXVA 3BPSP 3CO9A 5GVQA 3RRKA 1EAYC 3QRQA 4A8MP 1KOHA 4OJHA 3LP2A 4L72B 2R7UA 4TU7A 2VC1A 2R3VA 2OPPA 3OQ2A 4ECRA 4W92B 4QU6A 3GQCA 5F9LA 4C8YA 5DQIA 4ZN1A 2ZVIA 3SMZA 5GAHU 2NXUA 2FJAB 1X0FA 1ZAVA 4FXDA 5ITHA 1VQSA 2F5GA 3NS7B 2M8HA 3OTBA 1H7XA 1XN9A 2YQ1A 3D67A 3OVBA 2C2RA 3MMBA 1RYRA 4H4OA 2DHHA 1NNDA 3EZ5A 4RW4B 4F7VA 2CVIA 3CNQP 1VRUB 3B54A 4USUA 1KTQA 4DSIA 4RNMA 1Q7YT 1HQEB 2IBKA 3W9IA 5FLXY 2KO1A 2RF2A 1S0VA 5A6PA 1HNXJ 1FXLA 2MGZB 1X5SA 3R9LA 5J1PA 1TMMA 2XZWA 3BJYA 3BGFA 4BBYA 3MM9B 4ZDNA 1XR6A 3ZZ0A 5KFKA 2YH0A 5ETPA 1FRJA 2C3YA 1D3WA 3ENVA 4USMA 5G0RA 1JJ2R 4ED6A 2IYGA 1WF1A 2X3GA 3DRSA 4ZPCA 4Y3CA 2LQ8A 2OEJA 1RWOB 4UW2A 1YSJA 4PG4A 1SL2A 1RBLA 4ALZA 4AUKA 2QLWA 1OYEA 1IJEB 1X9MA 5J1EB 1MN7A 1MROA 4ZN3A 4YB1P 2XQCA 2Z2MA 4BWJA 1BC6A 2V2KA 2XNQA 4B3RJ 4C48A 3A8KA 4P10A 1OQ3A 2CAJA 1Z2ZA 5IV3A 3GFZA 4AL6A 2I5JB 3ILJA 2VFVA 4USIA 4DHVA 1N5YA 2IAJA 4J9NA 3GV7B 3KK1A 3D0IE 1J5EF 3DRXA 1K1SA 4WE1A 3DXSX 1MNEA 1NK5A 1XTZA 1RUSA 5KFFA 3MAAB 1T0TV 3CJ8A 4NLWA 1CULB 2C42A 1NSKL 3M9MB 3N5BA 4CO4A 3LP1A 3CMQA 4QCLA 3H2LA 3QIPB 3MEGA 2CIMA 3BYPA 4C3KA 1LW0A 2B9EA 1UZHA 3V81B 2V4QA 1N33F 3M4XA 2HQDA 4AT1B 2BE2A 1FNOA 5CYMA 4NEZA 4YR2A 1T05A 1N6QB 1N32J 1GFWB 4IKAA 3RTVA 3TZXA 3WC0A 3W2WB 1RJJA 2A3JA 4DL5A 5F8LA 1M5PC 3P5TL 4OZ5A 2ZUGA 4CTAB 5KFDA 1YITS 4MFBB 1KC8T 1LWEA 2C3MA 1K0TA 3JSYA 4U6PA 4DUYJ 2KI2A 5HVFA 1OPZA 2IYIA 2ZNZA 2H51B 3QPIA 2HWTA 2PMZD 2DR6A 2XLJA 5DLFA 4ED8A 2I6WA 3A1YG 4A8KA 3Q2TC 2CQPA 2J9DA 4ECZA 3NEKA 1ZM4A 3GCXP 2ZJRQ 4KHMA 2CPXA 1NK7A 3SQGB 2UU9F 3LH2S 5HMWA 2HS4A 4Y2IA 2CPJA 3U02A 3U7JA 3AHPA 2RVJA 2MZJA 3QFWA 2GHVC 2EPIA 3QGPA 3KLVA 4LIWA 5KT7A 3UNGC 2XI2A 2LQJA 5EN1A 4X64F 4JYAJ 4K4TA 5C24A 5H9FJ 5KFLA 4DSKA 2L3MA 1LKZA 1JLFA 5F8MA 4QR1A 1V5IB 1SL0A 1UETA 3O44A 2VH7A 5H9EK 3GP9A 1S7IA 3GE9A 1G2EA 1V3SA 2QL5B 5EGYA 5KFXA 2G4BA 4IG0A 2NXNA 5G4DA 3EVMA 3PV8A 1SJRA 1RYSA 1RACB 4HDGA 2W2OP 1R8AA 4DS4A 3HHNB 4DX7A 3KJNB 5E3QA 2HNDA 5KFIA 3JYTA 1F2HA 1RTJA 2WOMA 3NBPB 2PI5A 3H5SA 4I64A 2V9WA 2OFGX 5HANA 1ZAWA 5A8KB 2W4PA 3W8PA 4IFYA 1NB2A 1BD6A 4HKQA 2HMIA 1TKZA 1T3NA 4KGMA 2XLIA 4G1QB 4ZVRB 1WOSA 2FLLA 2V2ZA 1HWKA 3FMWA 4C2MA 1AUDA 3NGKA 4OV6A 3MMCB 4J9PA 2EK6A 3S8SA 1RA6A 1RABB 4I2PB 4UOFA 2I0XA 4LQ3A 4I2QB 2JDJA 4P2MA 1R31A 2Z2LA 4QYRA 3CJ4A 2ACMA 3EPIA 3SFGA 1MMLA 1GX5A 4OI4A 4G1IA 1WDDA 4WZQA 5L8RC 3K5OA 4G1PA 3LTOA 2XO6A 4ECWA 1B0TA 2YX7A 4NRTA 2DNRA 1XK8A 4UZBA 2R9LA 2MQOA 1IQZA 4F36A 3PW0A 3EWGA 4PCQA 5L1IA 3Q2SC 2VBZA 2Q3PA 1SJ4P 2IDLA 4IRCA 1U02A 4RW4A 2X1GA 1VRUA 4BLGA 1R8PA 1HQEA 1ZAXA 4DR5J 3MD1A 2MGZA 2IJRA 4FVCA 3MM9A 3KDNA 1CLFA 4J9SA 5ETTA 1F3VA 1HIYA 1YRUA 3MM8B 1SKRA 4K0KJ 2BUNA 5B0BA 4NLRA 4IO1A 5KFHA 4OI2A 1HQUB 1L3UA 1T03B 1FRMA 1R8CA 4U67Q 2HHVA 1WORA 4OHXA 3BGOP 3SFUA 3T19A 5J1EA 1HLWA 3AOCA 3FQLA 4JI2J 1RWWB 5K5MA 2QYCA 2ILYA 3TAMB 1D09B 4NEYA 4CNYA 3V4MA 2W01A 1DFDA 3TW0A 5FLXU 2I5JA 2MKJA 5KG0A 3I55S 3MPWA 3THPA 1HI0P 4FN5A 2I9SA 1SPBP 2YQ0A 2JEIA 5U47A 2DGOA 3QQCD 3TAQA 4KGKA 2E5LJ 2PN6A 2PE8A 3VQSA 3MAAA 2HHSA 1CULA 1VQKS 2GZOA 3IR6B 5CA5A 2MZQA 1NEEA 5HATA 1XQIA 3LO3A 4AL5A 4NLXA 3QIPA 4FS2A 3I32A 5K8PA 2HWHA 3MPVA 2H48B 3V81A 2ZDPA 3O8WA 2A10A 1X31C 4WFYA 4A4JA 1C0TB 4IFVB 1N6QA 2IHR1 1H72C 5RUBA 1RT5B 2QMXA 3W2WA 1FXRA 2HBZB 3OLAA 5F3ZA 1R43A 3EXYA 2HHHF 1GXLA 4CTAA 3RW6A 4MFBA 3T5HA 1FCAA 3OLBA 1RTIB 2XCPA 3FMBA 4O3RA 2WVEA 1FDDA 2CJKA 4PG5A 1TK8A 4YQWA 4UY85 1O0PA 3RB3A 4LF7F 1XIQA 1IVZA 4DX8H 3G4SS 1KDNA 2DNHA 2ZOFA 2IJNA 2WAQD 2ZHAA 3T1HF 2AJ4A 1N52B 5LXRA 1FJGJ 1XMQF 2E7VA 3SQGA 1VC5A 5D77A 1HWLA 4URQU 2H1YA 4X66J 1VQ4S 3MR5A 3BREA 5SUHA 1NPRA 1RBOB 4EO6A 3TJ9A 1PYTA 2OJ3A 3PW7A 2AEFA 1GAOA 1ZZNA 3D6TB 2C2KB 2LXIA 5K14B 4NLDA 1GMVA 2Q6BA 3HCXA 1HFEL 1RI7A 4NYOA 2YKNB 1N5VA 3UCGA 4KH0B 2PMWA 5D3GB 5L9NA 4P7VA 2R7QA 4ITSA 2PA3A 2DPJA 4V1Ak 3FZ2A 2UZAA 4L75A 3NBPA 5CABA 1IBMJ 3JQJA 1SJ1A 3DHWC 2B8PA 3ISND 3OV7A 3PO4A 1RT3B 5A8KA 2VQEJ 1YJ9S 2BW2A 4PABA 4ZP7A 3RAMA 1WWHA 2JL9A 1NPKA 2N7YA 3IGNA 1S1WA 4G1QA 2ROPA 1YBAA 4ZJLA 5M2UA 2DBBA 4IOCQ 4X62J 4GKJF 4DU8A 3MMCA 4I4BA 2C3OA 2OH2A 4I2PA 4W90B 3IC1A 1IR0A 4I2QA 1X9SA 2P6SA 2ZH2A 3TZWA 3PYEA 1SC4B 3UFCX 1OY8A 4DFMA 5SZTA 4C3MA 3E01B 5H1SV 5E3RA 4YHHF 3VAHA 3H4BA 4NLYA 1N88A 1Y11A 4M5NA 2OGUA 2RMLA 2VPYB 3VAMA 4IH7A 4OYXA 4EYIB 4LFCF 1Q8KA 2IRYA 2R4FA 3K0JA 3HI9A 2Q79A 1FD2A 2CPEA 5LMUJ 4USJC 1D8YA 4DR4F 3R1LA 2R8HA 3VAKA 2NZCA 2JC0A 2C2OB 2OPSB 2GHWA 1MW7A 2RH3A 1IWAA 2GV1A 2XMJA 4ANCA 4O4GB 4DL6A 2E5HA 3P6YC 3BSCA 4N41A 2BJEA 2LDYA 1YBUA 1EARA 1TZ0A 1FRHA 1D9AA 1XR7A 4IQMA 1CQMA 5B0AA 4ES2A 2O67A 3GMGA 1B7YB 4IUFA 3OFHA 2HZAA 3F0NA 3Q8QB 3W7BA 3DDIA 5HI7A 2MZTA 1FFSB 3MM8A 1YTYA 3AB4B 2ABYA 1EP4B 3NCRA 3TRGA 2DGQA 1HQUA 1U47A 1AUSL 1FK9B 1WTBA 2ZJPQ 2LQ9A 1S12A 3ITHB 4MIWA 1ZZFA 3QFHA 1OJ4A 2QSFA 4X4VA 4L74A 3CWJA 4PZVA 3UCUP 1YQHA 1D1UA 5LMNJ 2EC0A 5FJ4A 3OFFA 3TAMA 1TV6B 1AFIA 3MMJA 4XO0A 4ZJQA 3N28A 3UD4P 3JTPA 3HVTB 4DR2J 3I0SB 4OYIA 2DR8A 2BQ3A 2BEFA 2MY7A 3GSIA 3NOGA 1BUXA 6AT1B 3ILIA 4C8LA 3TA1A 3NCPA 1KP6A 2BJ8A 2RB7A 3DOLB 2FUG9 2GJFA 4JI4J 3BPDA 3A13A 3GIMA 2W2NP 1N4LA 1YJNS 3M6VA 1J5OB 4ILLA 3K89A 1CJUB 1WSVA 4ZCIA 1UVKA 4CO2A 1IR2A 2ACYA 1TKTA 2YWKA 1IR1A 2E9TA 4K4UA 1P6TA 2Y1JA 1L3VA 1CJTB 3CT9A 2VHGA 4H4MA 2A1BA 2PA8D 4NASA 2AYEA 4XPCA 2B9YA 3PYFA 4WP3A 1GNKA 4LQ9A 1KN6A 1C0TA 5L1JA 4IFVA 1MMDA 1ZYQA 1WKKA 4S0MA 3KG4A 3AJ2A 4FVMA 1RT5A 1K47A 4M5HA 4LRAA 3SV3A 3KNAA 3NNAA 1G3OA 1M5HA 1WC4A 2JWNA 2MEWA 2EXUA 3MZIA 3SDEB 3DU6A 4QWDA 1S99A 1T02A 1QY7A 2UUCF 2PD1A 2XHWA 2IA6A 4EUVA 2HRUA 1RTIA 2CPIA 3C6TB 1YGYA 2UVUA 2JVRA 4WU2A 3JQKA 4ANDA 4M95A 4ZIWA 4ZP8A 3Q8VA 5FDLB 1RAAB 5L1KA 3H5UA 4ZCMA 4LRBA 3C6UB 4LF8F 4E98A 1HNZF 1VI7A 1HBOB 2XMWA 1SQEA 2IPOB 2CJ9A 2Y1RI 4MYUA 2FTRA 3E51A 4Y2MA 3ENQA 4JI3J 3M8QB 2QIFA 2F9JA 4DQQA 4A8FA 5K14A 3UDEA 3S1TA 3BBCA 1G4CA 1P27B 2IVYA 4LVNP 1CJKA 2XMMA 2YKNA 1SC3B 4RBTA 1S48A 4LSZB 1NSQA 3Q86A 4B3TF 1B7FA 5D3GA 2UXDF 2FHKA 3VQTA 2YWGA 2E5JA 3TUPA 3QO9B 1WJ9A 4JI6J 1XNRF 3GFYA 1REVB 1S72S 1X5PA 2W7PA 4K7QA 2XULA 1ZS6A 2VG7B 1RT3A 2UV8G 4GMKA 4NWBA 3R3TA 3I82A 3JS9A 1AZSB 4GO7X 4NOHA 4NXNJ 1I5OB 1S6QB 1GEHA 4JI0J 2J76E 5CQGA 4IO9Q 4NLQA 1T9VA 2QSWA 1TUWA 2BYCA 2YKOA 2HNZB 4NMLA 2YNHB 1OSDA 1PAUB 2G13A 2OTJS 5B7WA 1N8RT 3A4TA 5A0YB 1EX8A 4QR0A 2QGFB 4OFZA 3LGMA 1B4SA 2DD8S 1KVKA 2F4FA 4ZVGA 3E01A 5KG2A 1DTTB 2WBMA 1S76D 3MPYA 4GC7A 4DV1F 4MKAA 5BXIA 3HD2A 1XNQF 2V94A 1TELA 3LOUA 3W66A 3FGVA 1S1TB 3QRPA 2WB1D 2CYYA 1M1KT 2CJQA 4MK9A 5ETRA 4Q2LA 1A9NB 5ETLA 2BKNA 2JEFA 2OPSA 2LU1A 2XMAA 3M8WA 4O4GA 2Q43A 4KGVB 3CC2S 5B09A 1H38A 1RTHB 1RKIA 3BSNA 4CO0A 4HLBA 1TP7A 3BKTA 3FKBA 2RRNA 3KLEB 1I3OB 3IAS9 3E3XA 1R6YA 2CQIA 2EFOA 1ZA2B 1FWPA 5ETKA 3ZZOA 4DR7J 2BJ9A 5ETSA 2GC8A 4YY3J 2VASA 4UUXA 3PEHA 2EWHA 2WVDA 1EP4A 2YTCA 4HYKA 4WFNQ 4OYMA 1FKOB 1FK9A 3FRYA 5LSOA 3ITHA 3KXDA 2W7OA 3OTOF 3LAKA 4LBHA 5HLFB 4DV0F 3R7BB 4DDFA 1QAJA 2BKOA 4N47A 2E66A 2ZWPA 3ZO7A 3GJTB 1TV6A 2ZBIA 2AU0A 2ZEJA 2CZVC 2EG1A 3HVTA 4PG7A 4X4PA 2KH9A 2OD6A 2MDAA 2KDOA 4WZMA 3I0SA 3P4UB 4NLOA 3ISNC 2MZ1A 1KHWA 3DLEB 3DOLA 1SH3A 5KG5A 1R8HA 1FTRA 3I6PA 2YX4A 1DY3A 1J5OA 5JUMA 1CJUA 3H25A 4HTJA 4DLGA 3E2EA 2GFFA 4ES3A 4B3SJ 4ER8A 3DOKB 2GO8A 1T9XA 1WG4A 3MEEB 2KN4A 2OIHA 3UD5A 1CJTA 4E0DA 2J7UA 2CPHA 3NS6A 3UDVA 2E7WA 4LBPA 4ZKAA 2OLWA 3MDFA 2XY7A 2K7KA 4KHPJ 2NXEA 3AD7C 2AZ3A 2F7VA 2RRAA 2DNOA 3FSYA 4RUBA 3BO2A 4JV5J 3NGDA 3NY0A 2P9GA 4LFBJ 3SDEA 3K57A 4EFAC 1RWUA 3TQ1A 4AD6A 2MLYA 4X4QA 2NUUG 1F5AA 3ZXWA 3C6TA 1JK9B 1CJVB 3M05A 3VTIA 3R5CA 3W62A 1R89A 2EK1A 3VALA 4TQRA 5FDLA 5L46A 1BLUA 2C2MB 1KBRA 3C6UA 4ZLNA 4WU3A 2EFQA 2BABA 1HBOA 3TVYA 5E3AA 2V4JA 4C7QA 4PWDB 4WF9Q 3DRYA 3NMRA 3TVZA 2J7WA 4J5OA 2HHXA 3MEKA 1RHRB 2DGTA 4JI7F 3PVXA 1SL1A 4QYZJ 3PJXA 3M8QA 5AE1A 1NUEA 1SI9A 5D78A 1U24A 2QN6B 1WOOA 4OZLA 3BZQA 1FT8A 2ZOGA 3WBZA 3OFGA 3MCMA 3H59A 2HFVA 3CD5A 4XAKA 3UE2A 1RAJA 4AQYF 5I3QA 1IKYB 4ZPAA 4C0BA 4F4AA 2FHJA 4YDDB 3QO9A 3IG1B 1T7PA 5ETMA 4F04B 1DHMA 5B08A 1AA1B 3FCWA 4BWMA 1REVA 4DQIA 3JSRA 2VG7A 1PBAA 4FS1A 8ATCB 1AZSA 2HQCA 3K5LA 4YB5A 1S6QA 2V68A 1VBKA 3KG1A 3UPFA 3PEJA 1F60B 2YY3A 2DCUB 1BE4A 2HNZA 2YNHA 3QT5A 4NLPA 2BX6A 3NLCA 3T5KA 4ETXA 5LT5A 2EC2A 5A0YA 1YDLA 2HGLA 1VIOA 3OW2R 1RAOA 2CDRB 2VONA 1DTTA 1PSDA 3LA0A 3TZYA 2F4VJ 2JX2A 2LA6A 3DM2B 4ZLJA 3D66A 1VMBA 3CCQS 3T1YF 2YWWA 1T11A
chains in the Genus database with same CATH topology
4NL5A 4LF6F 2FJXA 3HMJG 1S0VA 3GV8B 3OSNA 1S1TA 5A6PA 2O5DA 3AA8A 1FXLA 3U1MA 3I0RB 3S01A 5LJ5Y 3K5NA 4LT6A 2MGZB 2VA2A 3BSAA 1X5SA 4B9NA 5J1PA 4ZVEA 3MCSA 3OXGA 2RNEA 2XZWA 2WB4A 4DWIA 3BJYA 2I8EA 3GIJA 3BGFA 3FRZA 1LXNA 3VZIA 4BBYA 1TKTB 3MM9B 1XMOF 3P49B 1NH7A 4PRFA 4WXOA 4BC9A 4DSFA 4ZDNA 1FO1A 1XR6A 4TY8A 3ZZ0A 1AFJA 5KFKA 4K2XA 4JV1A 4K5SA 2KHDA 2YH0A 1E6VA 4ZK7M 1Y4ZB 4Y2AA 1FRJA 4H4MB 2C3YA 5A6WA 1D3WA 4QWBA 3ENVA 5G0RA 1JJ2R 3O3LA 4I7FB 1UVLA 1QM9A 1NAQA 1RTHA 2LA4A 2POKA 4ED6A 2IYGA 1X4FA 2XSFA 4OHVA 3WDOA 1WF1A 1KR4A 1R3NA 5KFPA 2X3GA 3QZ7A 1C2PA 3DRSA 2GCFA 2QE5A 3IFEA 3N6NA 3CB4A 1UAWA 3V4IB 4ZPCA 4CCHA 2O3DA 2AWZA 4Y3CA 4CO5A 3KLEA 4R8UB 5KTQA 2VG6B 2DB1A 5EHHA 3WC2A 2CFXA 4UW2A 3H5XA 3DFEA 2HG4A 2A18A 1YSJA 3P96A 2QV6A 4RW9A 3MFIA 4PG4A 1WHYA 2AV5A 1SL2A 4M63A 4ALZA 3MF5A 4AUKA 2AD9A 2QLWA 2EFPA 4HTIA 1VGYA 2R7OA 5AE3A 1IJEB 3PW2A 1X9MA 5J1EB 2M4MA 3D28A 1RGVA 1IUJA 1MROA 4FPRA 1FF2A 2APOA 4YB1P 3KWMA 4RNOA 5DM7Q 1Y00A 3LWLA 2SXLA 2Z2MA 4BWJA 5I42B 1KRPA 1BC6A 2V2KA 2XNQA 1S6PB 3FNNA 3IWLA 5A8RB 3OXLA 3LANA 4X4TA 3HFKA 4FNHA 3DI6B 1OQ3A 3OL7A 4MMOA 1NKEA 1HA1A 5BJRA 1F2GA 2VPWB 1Z2ZA 1WEYA 1X5OA 3GFZA 2HFNA 2FVSA 4RW6A 4AL6A 2I5JB 2GGPB 3CJ5A 1JIHA 1N0VC 4X66F 4RUAA 1VIXA 4NCBA 4TY9A 2VFVA 1DLOA 3C2PA 4U7CA 3SCKE 3HXMA 5DG9A 5IWAF 5E3CA 1XR5A 4USIA 4DHVA 2RRBA 4QZVB 2GIQA 1VQ7S 1N5YA 2IAJA 4IOBA 4J9NA 5HLFA 3GV7B 3KK1A 3D0IE 2RS2A 1S9FA 1J5EF 3O1LA 4JI1F 3DRXA 4MIBA 1N5TA 4ECQA 1AROP 4X4RA 1U1RA 1NK6A 1FVSA 1K1SA 3G6ES 4WE1A 3DXSX 2NPFA 1OQ6A 1XWLA 4X84A 4YUDA 2VD3A 2NYIA 2ROGA 2MKIA 1MNEA 1NK5A 4O3SA 3M30A 1UA1A 1XTZA 2J6UA 2OPRB 3K7RA 3GFXA 3MGJA 3CD7A 2HNYB 1FNXH 2RUGA 1NZAA 1FJEB 5KFFA 4FYDA 2JLEA 5CYQB 4WFXA 4J9MA 3G8SA 1TK5A 1MU2B 4NLWA 2C42A 2L08A 2NPIA 2O1PA 4PXDA 1Y0HA 2JFKA 3C8YA 3CDEA 3NCQA 3M9MB 3N5BA 3NNCA 2EFVA 4CO4A