1S1XB

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
397
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 109
structure length 397
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB02
3DLKA 1C1BB 1JLEA 1S1TA 2J6UA 2HNDA 4ZPBA 1RT1A 4YP3A 2IAJB 4NYZA 4Q0BA 2I1RA 1BQMB 5KFHA 2RF2B 2W8KA 3V81B 4TYAA 2YNHB 1S9EB 3GILA 1C1CB 1DLOA 2VG7B 4O4GB 3OSNA 3H5YA 1JLFA 2YNGA 4JV1A 1J5OB 3PJWA 2D41A 5DQHA 5KT4A 3T5KA 3LP0B 3IG1A 1RA7A 3MEDA 4ID5B 1JLQA 1U09A 1JLBB 1TV6A 4LQ9A 1JX4A 3OLAA 3PW2A 3Q8SB 2YKNB 1IKWA 5EWGA 2ASJA 3DRRB 3I0RB 4QWEA 1EETB 1LW0B 1RTJB 5KG5A 2ATLA 3N6LA 4DL6A 4IDKB 5HROA 4PUOA 3G6VA 4RUAA 1S1UA 3N6NA 4DEZA 3PVXA 1BQNB 3V4IA 2FJWA 3E01A 4O3OA 4FS2A 2BQUA 3LAKA 3SI8A 2WONB 2IJNA 2R8HA 2C28A 2BRKA 1HPZA 1TVRB 4WE1A 4ZPDA 1SH0A 2W9BB 3NBPB 4IR9A 1RT5B 2YNFA 5F8MA 1JLAB 1JLCB 5FDLB 1RT3B 3RB3A 4MK8A 1D1UA 3M9NB 4LSNB 4NZ0A 5DG9A 5KG4A 3LP1A 2FJVA 3HVAA 4JUZA 3GV7B 4DG1B 4NRTA 2W9CB 4I2QB 3T5LA 5KG6A 4FBTA 2FVCA 3M8QB 3MEEA 5KFNA 3OHBA 3NKYA 5KFYA 1TKZA 5J1EB 3LAMA 4IRCA 3BREA 4YMEA 1S9EA 3H5XA 2UVVA 5HLFA 2VG7A 3CJ4A 5DGBA 2ZE2A 5DQIA 4I7FB 4MK7A 4RW6A 1HYSB 3PW5A 4O3SA 3NAIA 3IS9B 3KK3A 1K1QA 3OL7A 2R2RA 1JLBA 3DI6B 2FVSA 2UUWA 4URSA 3HVTA 3GIMA 2C22A 1ZETA 2YKNA 5JUMA 2XGPA 1S49A 3RAQA 2ALZA 3MTKA 3IRXB 3KLFA 1RT6B 4ECWA 4IQXA 3SFUA 3IN5A 4RZRA 4TQSA 2XGQA 4IDKA 5HROB 2YNIB 1S6QB 1FKOB 3DRPA 4IOBA 5C5JA 5J2MB 4URQU 4F4XA 4JV2A 4KB7A 3KNAA 1BQNA 2IM0A 4KHRA 3V4IB 2OH2A 3LP2B 3KLIA 3RBEA 4B3OB 3RAXA 2EC0A 1TL3B 4EBEA 1T05B 2WONA 1TL1B 2HNZB 4MKAA 3RB4A 5DLFA 2IBKA 4RW4B 5KFCA 2WHOA 5KT7A 4RW9B 2YNFB 4H4MA 1N4LA 2XWYA 3QO9B 5FDLA 3PW7A 4ZP6A 4Q44A 1KLMB 3H59A 4ED7A 5I42B 2UVRA 5K14A 4KO0B 3JSMB 5KT2A 4RNOA 1HNIA 4RU9A 3QZ7A 5F8GA 1MU2A 3UDLA 2I5JB 2CJQA 3Q8PB 4NLGA 4KKOB 3C6TB 5JXSA 1TKXB 1TKTA 4XPCA 1SV5B 4XO0A 3M8QA 2ILZA 4R8UA 1T94A 4YQWA 1LWCB 3CJ0A 4O3QA 3T5HA 1RTHA 1HQEA 5J1EA 1RA6A 4EO8A 3MECB 5KFOA 4J9KA 5KT3A 4KAIA 1JLGA 4I2PA 3TVKA 1S1VB 3MR2A 5HLFB 4ZPAA 4IH7A 3BJYA 3BSCA 2YKMB 3MFHA 2HNYA 4I7FA 4KE5A 5F9NA 3M9MB 5KG7A 2AGQA 1LW2A 3CVKA 3DOKA 3UPFA 4Q43A 1N48A 3DI6A 3LALA 4KV8A 1LWFB 3QZ8A 5KG1A 1YVFA 3PR4A 2RKIB 4ED3A 3UR0A 1QUVA 3BSAA 1JXLA 4IH6A 3H2LA 1S9GB 4O3RA 3IRXA 3KLFB 1DTTA 1RYSA 5T14A 4F4ZA 1S0OA 4LSLB 4KBIA 4ICLB 5J2MA 2IC3A 1LWEB 5DLGA 4J9LA 2ZKUA 2F8EX 2B43A 4B3OA 3QGGA 4IH5A 4TN2A 2UVUA 1TL3A 3QIPB 1DTQB 3DOLA 1RTDB 5DG7A 1TL1A 2HNZA 4K4VA 2JEIA 4ZVEA 3KLGB 5CYQA 3NGDA 4RW9A 1NHUA 3RB6A 5KFAA 4URGA 5I42A 5K14B 2BE2A 2ILYA 4J9NA 1HNIB 2D3UA 3KMSA 3BQ2A 3DMJA 3UQSA 5L1JA 2C2EA 2ASDA 4KKOA 5J2QA 1SV5A 3DM2A 1EP4A 1QE1B 4IFVA 3PR5B 1FKPB 4Y2AA 4IRKA 3FDSA 1GX5A 4YR0A 2WRMA 5J2PB 4J9OA 3MECA 4IG0A 2XC9A 3GIKA 1JLGB 1UWBB 4I2PB 1S1VA 4NLTA 2BRLA 1CSJA 2YKMA 4KSEB 2HNYB 3G6YA 4ED2A 4F50A 3V6JA 2BANA 4G1QB 3GV8B 4H54A 1RTIA 2V9WA 4U6PA 3DLGB 1N56A 1KHWA 3BGRA 1HQUA 3DLEB 4K4YA 2AX0A 5CYMB 3KLEB 3TAMA 5I3UB 2R2SA 4ZMMA 5HP1B 2WOMB 5C25B 3OL9A 3KK1B 3C6UB 5F8LA 4ECXA 1RYRA 4O4RA 2VA2A 1C0TA 1RT2A 2AGPA 4ICLA 2IC3B 3H4DA 3KJVB 3KLHB 1N5YB 4MFBB 1R0AB 3GV5B 4ECRA 1SH3A 2V4QA 4J9MA 4TY8A 1RT7A 4PWDB 1RTDA 4FBUA 3MF5A 3FFIA 1S97A 2RDJA 3QLHA 4GC6A 3NMAA 1HNVB 5KFLA 1XR5A 2HWIA 4NCGB 4WYLA 3I0SB 5CYQB 2OPSA 1IM4A 4J9PA 2W7PA 2IM2A 4ECVA 2FVPA 3ISND 5KFFA 2ASLA 2IA6A 2B5JB 2BE2B 3KMQA 2WCXA 5C42B 1XR6A 4EYIB 4Y2CA 3T1AA 4Y34A 4NLWA 2FLPA 5J2QB 4RW7A 4TXSA 3DRSA 4QW9A 4EBCA 4TYBA 2W8LA 4ZP7A 2OPPA 5KG0A 2XI2A 5KFWA 5J2PA 3CJ3A 4LQ3A 3DLKB 3GIIA 4X2BA 2JLEA 3DDKA 3MEGA 3GYNA 1RT1B 3Q8QB 2IAJA 1C2PA 4Q0BB 4ZP9A 3DYAB 3H5SA 1RTIB 2HMIA 2RF2A 4NLVA 1C1BA 1JLEB 1S1TB 4JV0A 2VA3A 3DLGA 5L9XA 5KFSA 4M94A 1S48A 1BQMA 4MIAA 3ITHA 5EWEA 4GC7A 5CYMA 3KLEA 3V81A 5I3UA 3H98A 4O44B 4NLYA 1DLOB 1C1CA 2FJXA 4ZVHA 3MEDB 4ID5A 1JLFB 2YNGB 4O3PA 1J5OA 5KFBA 3MFIA 4HYKA 3C6UA 3EPIA 1TV6B 4KHMA 1OS5A 3PW4A 3RB0A 4TY9A 3IG1B 2OPRA 3JYTB 4EYHB 1KHVA 5EUHA 1JLQB 1EETA 1LW0A 1NNDA 4F4WA 4ED8A 3KJVA 3KLHA 1N5YA 1K1SA 2V0NA 1R0AA 1S1WB 3DRRA 3I0RA 2R8KA 4PUOB 4RNHA 1RTJA 2BQRA 3FFIB 3PW0A 3QIDA 1S4FA 4Q8FA 1S1UB 1HNVA 1D0EA 5F8JA 1T3NA 2E9RX 3E01B 3QGHA 3QGIA 2JC1A 2UUTA 1S1XB 4PQUA 4WZQA 3IGNA 2GIRA 4WXWA 1I6JA 3D5MA 3KLVA 4DL3A 3Q8RB 3PZPA 3M8PA 3EZUA 4RNFA 5KFDA 1HPZB 5C24A 4WE1B 1JLCA 3I5BA 3DRSB 3H5UA 2BR0A 3MR6A 1JLAA 3LP1B 4TQRA 4ZPCA 5HBMB 4DG1A 2W9CA 1RT3A 3V6DB 5KFIA 5EWFA 4LSNA 5KG3A 5DGAA 2B6AA 4R0EA 1VRUB 1VRTA 3OLBA 3MEGB 2XCPA 2C2RA 5KG2A 3CDUA 2FVQA 2J6SA 1TKZB 4TLRA 3DYAA 4ZHRB 2HMIB 5L1IA 3KK2B 3KHHA 2DPIA 3MEEB 3CO9A 3KHRA 5KT5A 4IG3A 3ITHB 4K4WA 3OL8A 1ZTTA 1W25A 4RW6B 1HYSA 2WTFA 4H4OA 4NLUA 4O44A 3KHGA 2AU0A 2J6TA 2JEJA 4J9QA 3BQ1A 3G86A 4J9RA 2ZE2B 2UVWA 2VG5A 2AQ4A 2OPRB 3JYTA 3IS9A 3KK3B 1NHVA 4NLQA 3FRZA 1RT6A 3HVTB 4MIBA 1S1WA 4ECTA 1S6QA 3DRPB 3HKWA 5F8HA 1QAJA 4XPEA 4QWCA 3FSIA 4ED0A 5KFUA 4DL5A 4WYWA 1T03B 4QWDA 4ZVFA 2YNIA 4MK9A 3KLIB 1FKOA 3T19A 3V6HA 3OHAA 1JKHB 4Y3CA 4WFXA 1T05A 1S1XA 4PQUB 4RW8B 4NLSA 3LP2A 4ZP8A 5KFKA 3KHLA 1ZTWA 2DPJA 5KFQA 3H4BA 1TP7A 2V4RA 3M8PB 2W7OA 5KFVA 3NAHA 5C24B 4RW4A 2E9ZA 5KFJA 4IRDA 3ISNC 3CJ2A 4H4MB 1RT4A 2R8IA 3QO9A 5F8NA 4O3NA 3HHKA 3BQ0A 3V6KA 1MU2B 5HBMA 3N6MA 2I5JA 5J2NA 1KLMA 4ED6A 4DL7A 3V6DA 3D28A 4KO0A 3JSMA 3C6TA 4WFYA 1TKXA 1TKTB 4R8UB 2B6AB 4ECSA 4YR2A 1VRTB 1VRUA 4K4TA 2R8JA 1MMLA 1XR7A 2WK4A 4ECUA 1HQEB 5KFZA 3NL0A 4ZHRA 1IKXB 2VG6B 1HMVB 3KK2A 4WXOA 1LWCA 3VQSA 3BSOA 5KFRA 2BQ3A 1RTHB 4IG3B 3OSPA 2IMWP 4J9SA 2AGOA 3CIZA 4RNMA 2CKWA 4H4OB 1C0UA 3ICLA 5F8IA 1LW2B 3CDEA 4RNNA 5KFGA 3FQKA 2FVRA 5DQGA 4K4XA 4KFBA 4KV8B 1S9FA 1FK9A 2VG5B 1SUQA 2FLNA 1S6PB 3GIJA 4NLDA 3DOKB 2IM1A 4R5PA 1S9GA 3MR5A 4K4ZA 1LWFA 3OL6A 1IKVA 2RKIA 1REVB 4LSLA 2QV6A 3BSNA 1LWEA 1DTTB 5KFEA 2W9AA 2R8GA 1T03A 4QWBA 5D3GB 1JKHA 4ECYA 3QIPA 3G6XA 4ECQA 2OPQA 4RW8A 4QW8A 3IGVA 1RAJA 4ZVGA 4IR1A 5KFPA 1DTQA 3DOLB 4WFZA 5F9LA 3MR3A 1IKYA 4G3IA 2GIQA 3GQCA 3KLGA 3PJXA 4QPXA 1RT4B 3DMJB 5J2NB 3I5CA 3I5AA 2ZD1B 3BR9A 2R2UA 4WZMA 5DG8A 2WB4A 3FQLA 1EP4B 1QE1A 4IFVB 4M95A 4IFYB 3CJ5A 3EPGA 1FKPA 2C2DA 3RBDA 1IKXA 1HMVA 2VG6A 3DM2B 5KT6A 1TQLA 1S10A 4FS1A 1S0MA 1N6QB 2IJFA 4NLRA 4IG0B 2BANB 4G1QA 2QE5A 4EBDA 2IM3A 1UWBA 1C0UB 4NLPA 2GC8A 2HNDB 4ED1A 4KFBB 1HQUB 3DLEA 3E51A 1FK9B 4F4YA 4DL2A 1SUQB 2JEFA 2E9TA 1S6PA 1QAIA 2YNHA 2D7SA 4R5PB 1SH2A 4O4GA 2O5DA 3BGRB 2WOMA 5C25A 2XCAA 1IKVB 3KK1A 1REVA 5L1KA 2JEGA 3TAMB 3LP0A 2FLLA 4NLOA 5HP1A 3M9OB 3TQ1A 1JIHA 4ECZA 4Q45A 1C0TB 1RT2B 5D3GA 1IKWB 4NLXA 1RDRA 4RUCA 4PWDA 2OPQB 5EDWA 3HVWA 3QYYA 4MFBA 1S0NA 5KFXA 4TY8B 4NCGA 1RT7B 3I0SA 2XI3A 4YR3A 4EEYA 4HKQA 1IKYB 2AX1A 3QLHB 1Z4UA 3CWJA 4K4SA 3PHEA 4Q8EA 3CDWA 2OPSB 4U7CA 2B5JA 4IKAA 5KFTA 4EO6A 3T5JA 1WNEA 5C42A 4DL4A 4MH8A 2AWZA 1TVRA 5KFMA 3KOAA 2W9BA 2ZD1A 3NBPA 4RW7B 1HARA 1RT5A 2D3ZA 2HWHA 5L1LA 4K50A 2OPPB 4IFYA 2JC0A 2HAIA 2R2TA 3SFGA 1GX6A 4MKBA 4QWAA 2RDIA 4OL8A 3H40A 4I2QA 1N6QA 4K4UA 4NRUA 3LANA
chains in the Genus database with same CATH superfamily
2BUNA 2V34A 3DLKA 2XMTA 3G87A 2DRBA 2HZAA 1JLEA 1S1TA 2KKHA 3QAEA 2G2ZA 2HNDA 4W92B 1Q8LA 4P2MA 1DZ5A 1BQMB 2AF6A 3HT3A 4PXCA 3TJ8A 2ZJQQ 3TA1A 1S76D 1S9EB 3MM5B 4ANEA 2GFFA 1WDTA 2VG7B 1KNZA 4JV1A 1JLFA 3SCKE 2DHAA 3GFXA 1WKKA 4LF4F 1FDDA 1HFEL 5KT4A 3BM7A 4KGXB 1U1OA 3HHLD 1U2CA 4ID5B 5IM0A 1JLBB 1Y4ZB 3PW2A 1E6VA 2GGPB 3BV8A 3Q8SB 1U2RA 2ZVIA 3RRGA 1EETB 4CNYA 1RKIA 2DIUA 4HEA9 3TUJC 4ZVQB 4DL6A 4LF7F 3PKMA 1FWPA 5B7WA 2CWKA 3RRHA 4USJC 2EFGA 2KZMA 1VLYA 2QMXA 3NWRA 5ETQA 5D0EA 4RUAA 1PGZA 3N6NA 3PVXA 1RHQB 3T3FA 1K73T 1BQNB 2BJ9A 3KG4A 3V4IA 2FJWA 3UVJA 1CC7A 3RRKA 1VMBA 1SIWB 2NQPA 3LAKA 2XMJA 5FLXU 2E1CA 2LXIA 2HVEA 2ZWOA 4WIIA 2E1MC 2VFRA 2DR7A 3C15B 1GTHA 2BRKA 2IFXA 4DX8H 1YI2S 2DGUA 1URNA 1Y00A 2V8HA 2VPXB 2V9KA 3QAUA 2W9BB 3W8PA 3FRYA 2R7TA 2YNFA 4B08A 3MMCA 1KQGB 5MAOA 3OUYB 2GO8A 3UCZP 5FDLB 4DX6A 5B0FA 1LKZA 1X9SA 4A8FA 3J7AN 2A18A 4DV5J 4MK8A 4OYPA 3NNAA 5DG9A 1CPZA 2L9WA 3PHTA 2FJVA 3W5ZA 3GV7B 1L3SA 4DG1B 2YPZA 3MWBA 1UZHA 3ONQA 5KG6A 4P6QA 3THPA 1EX8A 2QG9B 4OQJA 1SKWA 3J7YI 1RQ0A 3EDRB 4KPYA 1IR1A 4QU7A 1TKZA 3HHDA 2BM0A 2P9GA 4KQZA 1FVSA 4IRCA 1S0VA 1VLOA 3IR7B 4PXDA 2UVVA 2XS7A 3IAM9 3UCUP 5DGBA 4BLGA 2DGSA 4I7FB 4O3SA 3N4WA 3TAPA 2XY7A 3R5DA 3D0IE 3IS9B 4ZJLA 3OL7A 3UWTA 1CG2A 4URSA 3GIMA 3X1LB 3D6TB 3WC0A 3TI0A 1B0TA 1MNEA 1WJ9A 2XGPA 4C11A 2FTRA 4DF4A 1K8AT 3K5MA 3RAQA 4B3SJ 1VDHA 4WP8A 4OJ3A 3Q22A 2OMOA 4HHUA 4OJ1A 4IQXA 2H54B 4LFAJ 1CJTB 2YNIB 4JI8F 4USVA 1FKOB 3GG1A 4JV5F 4JV2A 4DPWA 4DR7F 2KXFA 8RUCA 2BABA 2V67A 3KNAA 2IM0A 3RBXA 3VCDA 3LP2B 3W9HA 1FO1A 3DRYA 1WC1A 4L6V3 2EXUA 5B0DA 1N34F 3D4JA 3R7SB 2ZH5A 4B3TF 4DN9A 1VBYA 1KEKA 1WTFA 1KR4A 2DEIA 3OFGA 3CCES 3G9CA 4RW9B 4DV4J 2XSJA 3PW7A 2HHHF 3GJSB 4ZP6A 3JAMY 1M90T 3BH6B 1M5VC 2UVRA 4KO0B 3JSMB 3HD1A 3ZTRA 1MU2A 2I5JB 1CULB 2CJQA 1QDUB 1N33F 4KKOB 3C6TB 1NU4A 2FD2A 1TKTA 5JXSA 2CVIA 4WKYA 2Y8WA 4ZK7M 2JOQA 1T94A 1UA1A 1LWCB 2J0SD 1PKUA 2DGXA 1TFWA 3T5HA 4CCHA 1N32F 5J1EA 1H2UX 1RA6A 5GAHI 3MECB 1SQFA 3M32B 4DCPB 4KYZA 2LKZA 4I2PA 4KAIA 1BHNA 4ZPWR 1Y7PA 3MR2A 3FSYA 2YKMB 2W4PA 3MFHA 2VHGA 4CYUB 4I69A 2ZJRQ 4KE5A 4C8MA 1WEYA 1ELOA 5F9NA 3M9MB 3VAMA 1WTBA 1Q7YT 2Z0GA 3DOKA 4Q43A 3DI6A 3LALA 4F67A 3FEZA 2VQEF 1LWFB 1KKHA 4DDFA 1YVFA 3CJTA 2RKIB 2R42A 4OI4A 5B0GA 2MJNA 4ED3A 2DB1A 2MZRA 1JXLA 3K5NA 1F5AA 1MN7A 3UN3A 1FFGB 3UD4P 1RYSA 4F4ZA 4DQSA 3TP2A 4LRCA 2MMYA 5LXRA 4KBIA 4ICLB 3EZOA 1HBOB 3NCPA 1Q16B 3OXFA 3A3NB 2IRXA 2ZKUA 1H2TZ 2UVUA 1NZAA 4TN2A 5ADZA 3J80U 4JI6J 1TL3A 2Y9HA 3DOLA 5DG7A 1RWXB 1TL1A 5G4DA 5E3RA 2JEIA 1WACA 1D8ZA 2HW3A 4A46A 4MTPA 3JAMU 2LQ9A 4RBTA 2EVZA 1OY6A 3IFEA 5HMZA 2RRAA 2K1RA 1NK4A 3CJSA 3NS7B 3OXLA 3GTYX 1HW9A 1UETA 5I42A 2V2VA 2E7VA 2BE2A 1FD2A 2CPJA 3Q86A 4J9NA 2D3UA 2N7CA 3WQPA 1X5OA 3LGHA 3KMSA 4RJVA 3DMJA 2C2EA 2ZH1A 1JNRB 1N88A 1F0XA 2VKRA 2ASDA 1X0FA 5J2QA 2DXEA 1U25A 4ED5A 3NGUA 2LVWA 3DXSX 4Y00A 1R6VA 2CUYA 4IFVA 3IA0A 2DNYA 4UOHA 2MZ1A 2X51A 4IRKA 3ZTOA 3W65A 1VQYA 2BOAA 3NWGA 4J9OA 3A8EA 2XC9A 4X66F 4NLTA 4K8RA 1S1VA 1YBTA 3G6YA 3D1OA 3NGRA 1AFIA 2XHCA 3GV8B 1RTIA 4LFBF 4U6PA 2CJKA 4E8UA 1N56A 4HTIA 1Z2LA 3BGRA 3M8ZA 4I6AA 4YEAA 1XMQF 3PM9A 4PYAA 3G6ES 4F0HA 5ITHA 1WKJA 4JBCA 5I3UB 1H2VZ 1N5VA 4A8OA 3W2WB 4OV6A 3KK1B 4K59A 3OR1B 1APSA 2EBEA 1YRTA 3JSYA 1AB8A 3MM6B 3O8WA 2IC3B 1XMBA 2MGZB 3NNCA 2J0WA 5RUBA 2UV8G 1R0AB 5CZVA 4ECRA 4NI2B 2F4VF 2XS5A 4J9MA 3CULA 4QU6A 1RTDA 3OPKA 1IBMF 4FBUA 3MF5A 3FFIA 1BUXA 4MYTA 3OJUA 2LYVA 5T7LA 5FLXY 4QCLA 1CC8A 1DBDA 5K8PA 2QTWA 4J9PA 1GMUA 2HWTA 4HACA 4YB7A 2YWHA 3O3LA 3ISND 3K58A 3B4DA 1MW7A 1QM9A 4F36A 5CAAA 3W2VA 2VPYB 4M5DA 1EKSA 2SXLA 1V5VA 2MZJA 1FJ7A 1XR6A 4LF7J 2OTJS 3T1AA 2R7UA 3UD3P 3GE9A 2CG8A 4DV6F 2M7SA 3DXBA 3K8VA 2W8LA 2NREA 1O8BA 4ZP7A 2OPPA 3SXLA 3T6BA 2VL1A 2EFNA 4QIVA 4Z37A 1FJGJ 5CYJA 2DHXA 5HSPA 2RH3A 4JI1F 8AT1B 1B64A 2BJ7A 3DDKA 1LOUA 1RT1B 1UW4A 3GYNA 3N0VA 4Q0BB 3QPIA 4WCEQ 4DR6J 3H5SA 5D0HA 2VA3A 3VWSA 2Y1IA 2DIVA 5E2QA 3CF5Q 2ZZNA 1BWEA 1A6LA 4KPCA 3R27A 4DFJA 1BQMA 1VJQA 3ITHA 2HSEB 5AE2A 4GC7A 1WDDA 3CMQA 1V3RA 2E1PA 1V3ZA 3H25A 2W25A 2AT1B 5HVFA 1IBKJ 1T9YA 1JLFB 3H2VE 5KFBA 4F02A 1QTNB 3C6UA 2BJ3A 1TV6B 1SXLA 3PCOB 3QSIA 4N77A 3RB0A 3IG1B 2FC8A 4DR2F 2PIIA 5EUHA 1JLQB 1PG5B 5A8KB 4F4WA 2HFOA 3KJVA 1KFDA 1RHMB 1S57A 2B4PA 5CA5A 2LMIA 1CJUA 4ILLA 4NOHA 1S1WB 2MQQA 3I0RA 1RAAB 3QIDA 3PY8A 1S1UB 3OFHA 1MWZA 1SJ1A 5F8JA 2VU5A 3E01B 2QO3A 2XB2D 1H7XA 2NXCA 3QGIA 3ETMA 2G2OA 1S1XB 4LREA 4ZCLA 3SIPB 4ZLJA 2VFVA 2QN6B 1QUPA 1I6JA 2MKSA 1NPKA 4B9UA 2HQIA 2NR0A 3M2VB 1QY7A 5B0CA 1VK8A 4B9SA 1M0SA 1N54B 2DNQA 2MY8A 3POTB 1NCLA 4XAKA 4WK1A 4B3SF 2MQ8A 3HSZA 1RZMA 4KHPF 1LK5A 3DDIA 4JI2F 1WC4A 5E5NA 1JLAA 3LP1B 4TQRA 2EWHA 2BJDA 2H65B 2CNKB 5K5MA 3V6DB 2KVQE 3UCGA 4YDDB 5A2QY 2W9CA 4AT1B 4CLLA 4CLWA 5CCMA 1TZ0A 3R2CJ 2MYFA 3A8KA 2XCPA 4ZCIA 2VFTA 1FNXH 2FVQA 1ZA1B 3CW2C 4DQQA 3DYAA 4YDXA 3HHNB 4JI4J 4S0MA 2WVDA 2HHSA 2MY7A 3CO9A 1IQTA 4DFKA 3H20A 3NP5A 3KHRA 1MWYA 5KT5A 1ZS6A 4NX9A 2WVEA 3LQVA 3OL8A 3ENVA 1NJYA 4RW6B 1HYSA 1GH8A 4H4OA 2V68A 5AXLA 2C2OB 2CQPA 5D6GA 1U49A 5HK4A 3EGVA 1U0SA 2PD1A 3IS9A 1NM2A 2Q3PA 3FRZA 1A0OB 4B02A 1RT6A 1BGXT 1H72C 2NXJA 2XYGB 5BR8F 4ZN3A 3UE2A 4C11B 1S6QA 2RQCA 5KTQA 4QWCA 1QAJA 1OO0B 4ECTA 3TAQA 5A8WB 2UU9F 2B9EA 2FHMA 3GYGA 4DL5A 1NJIT 1WG5A 3ZZOA 2M8DB 1Y11A 3CD5A 2MKJA 3T19A 4LFCJ 1GAOA 1JKHB 3M1VB 1F3VA 1EJ7L 4Y3CA 1T05A 4M8LA 2UV8A 3LP2A 1GNKA 1WELA 3W60A 2HVHA 1X31C 5SUHA 1TP7A 3JS9A 1KSPA 1PJ7A 3PACA 3M8PB 2I0XA 4WTOB 5KFVA 1IJFB 1V5IB 1FTCA 2FIUA 4JI2J 1M5KC 1PJ5A 4ZVPB 4CO3A 3ISNC 2B9WA 1WHVA 1KOOA 2P5VA 3MMAA 4HT7A 1NAQA 3P3DA 1W7WA 3BQ0A 2X1FA 3N6MA 3BEGB 1KTVA 5J2NA 4YOEA 4HT5A 2HBYB 3D28A 1U48A 3BF4A 4R8UB 4YR2A 1VRUA 4CTAA 2Q79A 4HVZA 4K4TA 1Q86T 2R8JA 2P6SA 2K8GA 1VQ7S 2WK4A 3WHIA 4DZ6A 2AP6A 2AW0A 3P5BP 2VG6B 1DQAA 3KK2A 4RO0A 4WXOA 1LWCA 3VQSA 1F60B 4FYYB 5KFRA 2UUBJ 2AJ4A 2FGCA 3P4UB 4I4BA 4B17A 3AODA 3FBFA 2C3YA 5AXMA 2G1DA 4LF5J 3MAHA 1R8PA 3HK2A 1T0TV 1T9TA 2CVEA 5HI7A 4ELTA 2RJZA 4DS4A 1LW2B 2HHWA 4RNNA 5DQGA 2FVRA 1N52B 4X62F 1I94F 2VG5B 2ZC4A 1SUQA 3W9IA 5HQ8A 3DN9A 4OX9J 3D68A 3CTRA 1T02A 1S5ZA 2Y0SD 4NEZA 4FXVA 2XNQA 2CQDA 1LWFA 2PFDA 3CNQP 2PDAA 3IXQA 3M2UA 4ZOSA 1BWVA 3CB4A 4WP9A 3ZC4A 5E41A 2QV6A 3QGPA 2UXBF 1LWEA 1CBKA 3SCIE 2HGMA 3D54A 1YJNS 4CT8A 2VKZG 1UWAA 2ZKTA 3OTBA 5F41A 3NEKA 4ZVGA 1Q1KA 1XMQJ 1ICEB 4ENOA 2RHQB 1U26A 4Q2LA 2CYYA 3UW1A 2Q6CA 1WSVA 2KRBA 4EK2A 1ZBTA 2JH3A 1CJVB 4KGZB 5I3PA 4ANCA 4AXIA 3PJXA 3NMRA 1DJ0A 1OPIA 4QPXA 4PXEA 1D3WA 5D4NA 4DSFA 4LRBA 4G1PA 3HFKA 3I5CA 2KYZA 1TL5A 1Z1ZA 4OJHA 3BR9A 4NMLA 1RACB 2HBQB 3AB4B 4M63A 3GYXB 4WZMA 3U27A 1IVZA 1JXEA 3FQLA 3D3BJ 4AD6A 4IFYB 3OD2A 2RE1A 2X3DA 1FKPA 5L8RC 3WX4A 2EK1A 4CO2A 5IWAF 3EPGA 4DSKA 3RBDA 1IKXA 1HMVA 5LSRA 3GWCA 2C3MA 2W2MP 5KT6A 2OJ3A 1FRMA 1TQLA 3Q8UA 3MM7A 1UCNA 4FS1A 1Q78A 1VYAA 2JWNA 4NLRA 4G1QA 1MROB 4EBDA 1C0UB 1JJ4A 4Y28C 2CZVC 3A3OB 2F65A 3I96A 2HNDB 4TKTA 4Y2IA 4FYVB 1IR0A 5HATA 5IS2A 4KFBB 2XMVA 2E5GA 3E51A 2GZOA 4ED1A 2D3OR 1HNZF 2JEFA 4GVBA 2E9TA 1EAYC 1G6BA 1FXDA 4QBUA 2O5DA 3CD7A 5AXKA 3HHLB 3L7OA 2B4UA 1REVA 2JEGA 3JSRA 3M9OB 1JIHA 4I0WA 4EU0A 2KG0A 3QRRA 3Q83A 1RT2B 1B99A 2IPOB 4BDPA 3PYFA 2RT3A 2JVRA 3NRBA 4YY3J 4DS5A 1YLXA 1UEVA 3D3CJ 2OPQB 1FRXA 1T95A 4OHVA 4BWJA 4AXJA 4JI7J 5KFXA 4NCGA 4OMFG 1RT7B 2W2PP 2BXJA 4HKQA 4YR3A 3I55S 3AA8A 3CWJA 4C0BA 4N5SA 4ZJOA 4Q8EA 2GMHA 2QEXS 4HHHA 3MTJA 1J2VA 1L3TA 3SZ2A 4U7CA 2B5JA 1W2IA 3SV3A 1ZM2A 3C15A 2M0GB 4ZCMA 5C42A 2XWXA 4MH8A 2AWZA 2FYXA 1F3FA 1NK9A 4LVNP 4HHJA 4RW7B 1SJFA 1WKLA 5IWAJ 1ZPWX 3A8IA 2NLWA 3PDNA 4K50A 1UFLA 2R7XA 4PR6A 3AJ2A 3HT0A 2ZH2A 4DPYA 5A2QU 3KJNB 1U1NA 2BKOA 1QSYA 1FESA 2V69A 4ZVRB 1NKBA 2MEWA 3GJQB 3H40A 3BB5A 4PAAA 1QTMA 2OGUA 1K9MT 4I2QA 3FQKA 4K4UA 3LANA 5JVGQ 1UMJA 2GNKA 2ASYA 2C42A 3TZWA 3VR1A 1C1BB 1VFJA 1RAOA 3L9ZA 3T9ZA 2J6UA 3BDPA 1RT1A 2V2QA 3UR3C 1WI8A 4QZVB 5KFHA 4Q0BA 2I1RA 3KJQB 2AV5A 4H4KA 5HVGA 2DCLA 3THVA 4TYAA 1YJ9S 1DLOA 3OSNA 2IDLA 2GVDB 1KS2A 4DR2J 4KC5A 1T8EA 3LP0B 2AEJA 2E7WA 1IBLF 1U09A 3L4BC 3V4MA 3ISZA 2CQIA 1Q8BA 1U1LA 1N0UA 4DFMA 3OLAA 1F9EB 3EM1A 3N79A 3TUPA 1IKWA 3D7SB 3PFEA 3DRRB 2MSSA 2N4DA 2OEKA 4ZITA 5KG5A 5EWGA 3L09A 2YXLA 4QWEA 5GAGI 2RRBA 5A6PA 2ATLA 3HMJG 2YH1A 3JTNA 1RXOB 3F73A 1WF0A 5E3AA 5GAGU 2WBRA 4HR2A 3CJKB 3RR7A 3VAGA 1N8RT 3E01A 2D9PA 5HQMA 3THTA 3MUMP 3ENAA 5EGYA 2RAQA 3BPSP 1GMWA 2LQJA 2WONB 2IJNA 2R8HA 1TKDA 4ZIWA 2C28A 3LWMA 4AL7A 4DUZF 1KP6A 2BVZA 4ZPDA 4DQRA 2C2NA 3NBPB 4WU3A 3PO4A 3WIUA 1FF2A 2CQGA 4WJBA 3KTQA 4NCAA 1JLCB 3AD7C 3WC2A 1AZSB 4CLZA 2JL9A 2YVSA 3BGUA 3UNYA 3M9NB 4NZ0A 2O66A 3LP1A 1ZOTA 1F9HA 2IBOA 2XLJA 4NRTA 4FYXB 2DR9A 2GAGC 4JI4F 4ZPVR 2FVCA 3AH6A 4A8QA 2XMUA 3MEEA 2QLXA 5KOXA 5KFNA 1EIYB 1WHXA 2FJBB 2OHDA 3F41A 1NXIA 2XY6A 3EWGA 1KOHA 2ZOMA 4DSIA 5HLFA 3P6YC 4RBVA 1R7IA 4UTGA 5K8OA 3S01A 5DQIA 1VRQC 4CH7A 4RW6A 1HYSB 2QMUB 5FD1A 5GVQA 3NAIA 3HI9A 2AIRB 1K1QA 4C8OA 2A1BA 1U6BA 1JLBA 3DI6B 4H4KC 1NK8A 4J7CA 3Q8VA 1H38A 1CVJA 1BLUA 2FJAB 2KRRA 5E3QA 4TVAB 5JUMA 1GMVA 3J80Y 3BO2A 1TU0B 1RT6B 5ETKA 3SFUA 4LFCF 1EB0A 2XGQA 2J9DE 2W7AA 5IXUA 4Y2KA 1YBUA 3DRPA 4F4XA 2DGQA 4KB7A 1H74A 3R5BA 4NZ7A 2V5HG 4KHRA 4PZVA 2OH2A 4FP9A 3UD5A 2XZDB 3MGJA 4B3OB 1H7WA 1U6ZA 1TL3B 3B4MA 1TL1B 3O2IA 3PFOA 4DLGA 3RTVA 2CPHA 4NMXA 2B4VA 3I32A 4RW4B 2PA3A 4RBUA 4F04B 5A0YB 3EGZA 2LDIA 5D8HB 2HQDA 2LXUA 2RS8A 4H4MA 2ROGA 2XWYA 3QO9B 4MT1A 1JQGA 5FDLA 1YGYA 2CPEA 4X4VA 2OP5A 5I42B 1NK0A 4L3NA 2QC3A 4RNOA 2YX7A 4LF2A 4U8VA 1SC6A 4DV0J 4OYBA 1LWXA 3QBCA 3WZ0A 2J7UA 4LMZA 1UFWA 3TEGA 2ADCA 3QZ7A 1TKXB 1RHJB 2G4BA 4XO0A 3T1HF 3S6EA 1S99A 4YB1P 4DR5J 4AQYF 4GVLA 2ZITA 2FZGB 2VQFF 4EZ9A 1IN0A 1SCJB 2HFVA 2ZBQA 1WI6A 3ENWA 3GCWP 2B9XA 1NSQA 4ALZA 5KT3A 1S1VB 4NWBA 3GCXP 4NYPA 3S1TA 3BJYA 4IOCQ 1ZZNA 2HFSA 3HLUA 2WZ1A 3ZTPA 2F8MA 4B9VA 2FLOA 2YKQA 3I9V9 5D4OA 1HNXF 5KG7A 4DV6J 3C16B 1C4AA 3UPFA 4PWWA 1WC5A 3GPAA 4KV8A 4XDCA 3KDOA 4RX6A 1FNMA 2WW4A 4GO7X 3DHXA 3TJAA 3BSAA 1PJ6A 3NS6A 3H2LA 4IH6A 2KTQA 4GRSA 1D8YA 1GXTA 2B9YA 3OR1A 1CJKA 2LCWA 4LSLB 4BC7A 1G7CB 3R7NB 3DHWC 3MM6A 2IC3A 2PN6A 3E3XA 2MGZA 3RW6A 3CCMS 1U1QA 2LLZA 3WBZA 3QMQA 2YQ0A 4E98A 1SI9A 2B43A 2A0FB 3KUEA 2HLUA 2LP4A 3MM8B 1R8BA 3QIPB 1DTQB 2HIYA 4OZ1A 2ZFHA 4OZ3A 4ZLPA 2J7KA 1VGYA 3K8WA 1Q8IA 4EZ6A 4UY85 4HACB 4PEOA 3C66A 1D09B 1RAGB 4LF1A 3VGUA 1RJJA 1CJVA 2AJ1A 1SC3B 4M5DB 4ELVA 5K14B 1Q95G 2ILYA 1L5UA 4FYWB 1HNIB 2CDQA 3QSYB 2OELA 2DNOA 3G8QA 4KKOA 3EGWB 4PPZA 1UP1A 2P9CA 2NUUG 3G96A 4DR5F 5F3TA 1HIYA 4AQYJ 1TUVA 2JLGA 3VV2B 4ES1A 1S79A 2IYIA 1GX5A 3FDSA 2WRMA 4OYZA 4DMZA 5J2PB 4FPRA 4YR0A 3MECA 2VH7A 4IG0A 2J9EA 2YWKA 3K5OA 3MURP 4I2PB 3GIKA 1S59A 5DETA 1NJWA 2KFZA 2BRLA 1CSJA 2YKMA 2HNYB 1NJZA 1Q5VA 3OBIA 4G1QB 1MROA 3FZBA 3D1QA 5BJRA 2KT5A 4CO1A 1YKWA 3OTOF 4Q2MA 3FUYA 2C2MB 1YJTA 2OTLS 2UXCF 2CPIA 2A10A 5HMYA 2JNJA 4LRDA 2AX0A 2D69A 3KLEB 3VGTA 1I5OB 1T9VA 2YY3A 3QT7A 1XMOJ 2LQ5A 3OL9A 2VONA 2HRUA 2VA2A 3C6UB 3CCUS 4ECXA 4O4RA 2E5LJ 1C0TA 5M2UA 4ICLA 1KRPA 1HBOA 3ADAC 4C3LA 3SSQA 1LXNA 3OVSA 2ZHBA 3KLHB 1N5YB 4P71A 3PTWA 1IR2A 2GJ2A 3TO8A 3GV5B 4F2SA 2V4QA 4HDGA 1BC6A 2BYCA 2GVZA 4ZKAA 1OY9A 2HS4A 4D3GA 2RDJA 1WOOA 3BKUA 4GC6A 3C2PA 3K0JA 2MQNA 3TZXA 1FHTA 1E6YB 4LFBJ 3KXDA 2KHCA 1EZZB 2V8VA 1R43A 4ECVA 3AHPA 4OHZA 4BHQA 3Q23A 3VZIA 2K1RB 3FBEA 2J0QD 2VBZA 3U1LA 1HI8A 3QT8A 4K2XA 5C2CA 2XNRA 2EBGA 3KMQA 2AZ1A 1I94J 5C42B 3POTA 4EYIB 1XNQF 3CEDA 5E3CA 1YITS 4Y34A 2QT7A 2FLPA 5J2QB 2ZH8A 4TXSA 3DRSA 2AEFA 1PIEA 3SSSA 4ZLLA 4QW9A 3TANA 2HFNA 1SL0A 1X8DA 1RWNB 5KG0A 3KG0A 1HQ2A 1OWXA 1SB6A 3G71S 1HNWJ 5KFWA 1NKEA 1DURA 4LQ3A 4USKA 4X2BA 5LJ3Y 2JLEA 2R7WA 1JJHA 3EVMA 4NEYA 3Q8QB 4PG8A 2DGTA 2YWEA 1RAFB 1N36J 3NG8A 1X5TA 5DJBA 1C1BA 4NA1A 4PKDB 3ZNJ1 2EEYA 3MM9A 2UXDF 5L9XA 3VGSA 2HHPA 4LIWA 2FB0A 4RU2A 3N01A 3K17A 1JK9B 1XTZA 5GADI 5CYMA 3FEYB 4B9MA 3PX4A 5I3UA 4O44B 2L41A 1PAUB 2PMZD 3FCHA 4NA2A 2E5LF 4ID5A 5K8NA 2BZ2A 1J5OA 5IM0B 1FI4A 1VQNS 3CCLS 2CNOB 3PRDA 2OPRA 1MG7A 1KHVA 3HFZB 1NPRA 1EETA 3D66A 3R97A 2V0NA 3UFCX 2W1BA 3DRRA 1KVJA 4PUOB 5A8RA 2WSFC 2BQRA 3FFIB 3CO0P 1FERA 2MLXA 4OYIA 1XNRF 4ZIVA 2GHPA 1T3NA 3OW2R 2Z4PA 4OX6A 2EFVA 4X62J 3VAJA 1VOMA 5E33A 1KFSA 4C8LA 4DUZJ 1VQPS 1U1KA 4GKKF 4QYZK 4RUHA 4WZQA 2OIHA 1IWGA 1YSJA 1FRHA 1WOSA 2NYHA 2V8DA 3D5MA 2RILA 4M5HA 4X64F 3Q8RB 2CQ4A 4RNFA 3MMCB 1O6XA 5A76A 5KFDA 1RB0A 4WE1B 3OUYA 3I9ZA 5L9NA 2HVZA 4DU7A 4D3HA 2VF3A 2RU9A 5EX0A 2FJDB 3MMAB 4QYRA 4HH0A 1RAHB 1UPPA 2G0JA 3A3PB 4ZPCA 4WKRA 2DVIA 1TAUA 5FJ4A 4DG1A 3HPOA 4B3MF 5KFIA 5EWFA 1UA0A 4LF4J 3ZO7A 2ZH7A 4R0EA 4DV5F 2AEMA 1VRUB 1CLFA 2RB7A 3CSKA 1VQOS 1N36F 4KT0C 3QT6A 5BXIA 3CMAS 4UQGA 1F5CA 1HBUB 3CDUA 1TKZB 3KUHA 4TLRA 5F0UA 4ZHRB 2HMIB 2VUGA 3KK2B 3LUYA 1Q81T 3HFVA 4U8YA 2RMLA 2HURA 3NGSA 3ITHB 1SJ3P 2ZUGA 4X4SA 2J7WA 1ROFA 2LFVA 3BYRA 1XQIA 3DU6A 3KHGA 1WHYA 2BDPA 1UJ6A 4OYAA 4WIQA 3BQ1A 5IOLA 1VISA 4J9RA 2UVWA 3IWXA 3AOBA 2VG5A 5H9EK 3OXGA 1TMMA 3JYTA 1Y9OA 1NHVA 3R7BB 4NLQA 2M70A 2CXEA 3AJ1A 1P1LA 3G82B 1S1WA 5GAEU 1CJTA 1H98A 5F8HA 4C97A 3LPYA 1YJRA 4OIXA 1FE0A 2RHSB 5SZTA 4WYWA 4ED0A 3VAKA 2FDNA 4ELUA 4IUFA 1RI7A 3IBCB 4NA3A 4MK9A 4ZVFA 3UDVA 1RISA 2CIMA 3CGIA 2WAQD 1S1XA 2LQ8A 3VVUA 2CFXA 4AYBD 3KHLA 4PPDA 2HQFA 2OFHX 2DPJA 5KFQA 3A8JA 3H4BA 1LFWA 2V4RA 2IY5B 3CJQA 2H5IB 5D0RA 1ZAXA 5C24B 2E9ZA 4IRDA 2OKQA 1J5EF 3HZGA 4OYOA 1BXNA 5F3ZA 1RT4A 2R8IA 3QO9A 1F2HA 2DNNA 1U1MA 4O3NA 3V6KA 1MU2B 2I5JA 1CULA 1NSPA 1NKCA 1WHWA 4DSLA 2GHVC 4DOZA 2K3IA 3DRXA 3R9LA 3AQOA 3HF5A 2VQFJ 2CPFA 4NASA 2J5AA 1MMLA 4ECUA 1FCAA 1FRJA 3P49B 3NL0A 1IKXB 1HMVB 2H51B 4M5LA 2VPWB 4NCBA 3CUNA 2BQ3A 4FKXA 1FJEB 1RTHB 1L3UA 3PO5A 4LFAF 4OZ5A 4R0JA 4J9SA 2XG8A 2FUG9 2AGOA 3QRPA 1S12A 2HRTA 3UDEA 1MSWD 1J27A 3ICLA 1M1GA 1NBEB 1BQXA 4Y0FA 1RU1A 1H6KX 4N7TA 3IRWP 4KFBA 3W5XA 1S9FA 1AW0A 1S6PB 1GTEA 4TU9A 1M5OC 4NLDA 3LH2S 2IM1A 4R5PA 1S9GA 4QR2A 4BCAA 4B3RF 4P9SA 1I1GA 1IKVA 1JXVA 2F8HA 1REVB 2HHUA 3K5LA 2CNLB 4FYDA 2GMLA 2Y1LB 3B8HA 5LMUJ 1URRA 1SL1A 2R8GA 4C48A 5KFEA 1FXLA 4UZBA 2ACMA 3ET6A 2K7KA 5D3GB 1RAIB 3M8YA 5ETNA 2A6OA 1JKHA 5DDOC 1NPPA 5HO4A 1RABB 2HK3A 1CEZA 4ECQA 2OPQA 4QIWD 2IIHA 1X4FA 2F40A 1N5TA 1RAJA 3IGVA 3PEJA 3ZNUA 4V19J 2HHTA 4JI3F 4YB5A 5KFPA 1DTQA 4WFZA 3TW0A 5F9LA 3A12A 3FZ2A 4CO5A 5J1NA 3I87A 3VAFA 1K47A 3HCXA 4GKJF 5FIIA 2RUSA 4AL6A 2PMWA 2RDDA 3IP0A 3MMBB 1GK8A 1TL7B 2DR6A 3KG1A 3DMJB 5ETRA 5J2NB 3T9NA 4ES2A 3CCVS 4I67A 3I5AA 1TAQA 3OFEA 3A4TA 5AT1B 4CTAB 2Y0BB 2WB4A 4DXLA 4ETZA 4IFVB 1DQ8A 1LNQA 3AFGA 2ZUAA 3CJ5A 1RWPB 3N9UC 4BWMA 4UF4A 2VQEJ 1TFYA 2IRYA 3RBZA 3JTOA 5JVHQ 2VG6A 2RD5C 4EGLA 1AUSL 1W26A 3BGLA 3VHQA 2CWXA 1N6QB 2BA9A 3EDQB 4IG0B 4PABA 4X65F 1UWBA 3IBWA 1TELA 2J9DA 1HQUB 3DLEA 1IQZA 2G0CA 4JI6F 4F4YA 1SUQB 1AXQA 3F44A 4DL2A 4QYZJ 1QAIA 1VK3A 2D7SA 2MJUA 3GZ7A 4KY3A 4QR0A 4O4GA 4B9LA 3W2WA 3CIMA 3HVRA 2DBBA 2HS3A 3MCSA 2BKPA 3KK1A 2DH8A 2YPYA 4OX7A 5L1KA 3TAMB 2XZTB 4FVCA 3LP0A 4I6WA 2FLLA 3VAHA 5HP1A 2H1YA 3TQ1A 4ECZA 1C0TB 3U02A 1VBZA 2NXEA 4RUCA 4PWDA 2P9EA 1EQMA 1LXJA 1U7LA 1X4BA 1O51A 2DGOA 3MPVA 5EN1A 4MFBA 3QWPA 2R7SA 1U6FA 4X84A 2C3PA 1JJ2R 2XI3A 3O1LA 3TQEA 5KAKA 3NCQA 1IKYB 5CD4H 3I56S 3PHEA 2UZAA 2HZVA 3NOCA 2FGOA 2LEAA 5H1SV 1GXUA 4EO6A 2DT9A 1RWKB 4IKAA 3R5GA 3R3TA 4MAKA 3IM8A 5BYQA 5JJBA 3T5JA 3KDNA 1TVRA 1U24A 2MZTA 4FZVA 3S7RA 4IOAQ 3NBPA 2YWGA 4UUXA 4EFAC 2D3ZA 2HEKA 1D9DA 5L1LA 1FA0A 2OPPB 4IFYA 1T9WA 2JC0A 3Q2TC 1F9FA 2HAIA 3SFGA 4MKBA 2RS2A 2XO7A 2HRYA 2OLWA 2V8GA 3CCZA 4K5RA 1ZAWA 1CQMA 5HAOA 5IT0A 4QQBA 4X65J 3R5CA 1NDLA 4WK3A 3V6HA 1M1KT 5DZ7A 2UXBJ 4KGVB 2EG2A 3QJJA 2ZWPA 4YP3A 4NXMF 4CP5A 2IAJB 4NYZA 4UZCA 4GVBB 2RF2B 2W8KA 3GB0A 4DR6F 1HL6A 1C1CB 2QLWA 2YNGA 4LR8A 2HPUA 2R7OA 4C2MA 2FC9A 1B7FA 2HVIA 5DQHA 3BBCA 2EW9A 4PRFA 3EUNA 3IG1A 2HGNA 3MOZA 1Q5YA 3UN2A 3T1HJ 1JLQA 5A8KA 1LFPA 1SIZA 4QPTA 1ITPA 3NS5A 1JX4A 2EK6A 3MPDA 5THWA 1UEUA 3I0RB 1LW0B 1RTJB 4F3MA 4JB8B 4L3KA 3B78A 3N6LA 1V3SA 4RR5A 3LWLA 4Y2MA 4WBFA 1L3VA 2LU1A 4IDKB 5HROA 2V2KA 4A8MP 1SBRA 4PUOA 2XULA 5A8RB 1RHUB 3MPUB 2QYGA 4UOCA 1R89A 4O3OA 4DR7J 2DK2A 2W2OP 2ZDOA 4FS2A 2LA6A 3SI8A 2QLJB 4U7UD 1SKSA 4PXBA 1U45A 1Q4RA 4DSJA 3BKTA 3TZYA 2ZOFA 2H5EA 3ILJA 5A0YA 1YBAA 2DNRA 4A8WA 2UUCF 5ETLA 1QVFR 2DGVA 4WFNQ 2VODA 1DY3A 2XYHB 4TNOA 1UKUA 1JLAB 4NYOA 3BBBA 4OHYA 1HNZJ 2DNGA 3TYTA 2QA4S 2ZBIA 1RT3B 4DV4F 3RB3A 1XC9A 1D1UA 4AE5A 2E5HA 1RBLA 4ZJQA 4FN5A 2KI2A 2B7CB 1WC3A 3B6BA 3DOMA 1NH7A 2P8IA 4I2QB 3T5LA 4FBTA 3HULA 1YZ7A 1VQ4S 3DLHA 2Y8YA 3M8QB 1PILA 2EKYA 3TR5A 5CABA 3CCSS 3OHBA 2OSQA 3NKYA 5KFYA 1RCOB 3C14B 2VC0A 2H5JB 3AY0A 2IMOA 1U0HB 1U02A 2IVFB 4G1IA 4YMEA 2L3MA 1VQ6S 4U9RA 3H5XA 4QJVA 2VASA 2Y3YA 4CDIA 4DR4J 3HHEA 4ZDNA 4JI7F 4CO0A 2UP1A 1PCAA 2ZH9A 1SC4B 3TX8A 3C16A 2R2RA 1YJUA 2C22A 3BBFA 1P9QC 5IT9U 2EI5A 2MTLA 3D0GE 5G0RA 2YKNA 1JB0C 3Q0AA 1Y10A 3PZPA 4B9NA 2QX0A 3MTKA 3KLFA 2ALZA 4Z2XA 2N3OA 2LDYA 1XBWA 4OLOA 2Z2ZA 4RZRA 3IN5A 2LU2A 2PSZA 3K57A 3RZAA 4WP3A 5J2MB 2HVDA 2VDIA 2X1GA 3M1VA 3Q2SC 4ES3A 2N82B 5E7OB 5BR8J 3HD2A 3PIOQ 1ZAVA 3MEKA 4YN3B 3CJKA 2POKA 3KLIA 5LJ5Y 1FDNA 3ILOA 3RAXA 4USUA 2EC0A 4DR3F 2MZQA 2WONA 2CJXB 1XMOF 2HNZB 3DFEA 2GJIA 4MKAA 1FD8A 2DXFA 3BS9A 3RB4A 5D15A 2MQMA 2IBKA 1RSCA 2KM8C 5KT7A 2AJQA 2MLYA 2L08A 2CZ9A 1GT8A 1ZM4A 1OYDA 1KLMB 2MQOA 1SPBP 3QJPA 3MUVP 3BN7A 5K14A 2CQCA 1HNIA 4TU7A 2PC6A 3UDLA 1RGVA 4C3KA 5IV4A 3V2UC 3Q8PB 3QWUA 4L74A 4NLGA 2QLBB 1Y3JA 4XPCA 5DZ6A 2ILZA 2BBEA 4ERDA 2XEXA 3ENQA 1CS4B 3CJ0A 1HR0J 2OAUA 4GO5X 1HQEA 2KT3A 1NK5A 4GKJJ 3FCVA 4J9KA 3TVKA 1JLGA 3GSIA 5HLFB 4ZPAA 3NLCA 1VHIA 3BSCA 4P2SA 3KJFB 4CLUA 2HNYA 1MN9A 3OV7A 2GCFA 1F6TA 1H0HB 2YX1A 3DGPB 3F0NA 3IM9A 4V1Ak 1V9OA 4LF9F 4NE9C 2DNMA 5DGAA 1N48A 2IJRA 4CH1A 3KUGA 5D4LA 3QZ8A 1AROP 2IVYA 2AKWB 5KG1A 3UR0A 2Z2YB 1QUVA 2PA8D 4DX7A 4NZ6A 3U1NA 4O3RA 1S9GB 3IRXA 4JI8J 1DTTA 4OFZA 2MHEA 3H8YA 5T14A 4LBPA 3BZQA 3SQGA 2DNZA 2YBVA 4W98A 4C98A 3P96A 4JP8A 2Y1JA 3HZEA 4F0KA 4RKUC 2ZHAA 3FC9A 3PNIA 4F4AA 4JI3J 4RWWA 1X9MA 1S7HA 2VJVA 4B3OA 3QGGA 5AJ3J 5CXTA 3IWNC 1WORA 4EMDA 2ZJPQ 4FF3A 1XN9A 3LGMA 2VB6A 2UUAJ 2XZWA 1E6YA 2MZSA 3J7A1 3KLGB 3NGDA 3HJFA 3CCRS 1OYEA 3JSBA 3D2WA 3GP9A 3W9JA 3RB6A 1RCXB 4RPFA 4QR1A 4K5SA 4U7UK 4AFFA 2VD3A 4F7VA 5D4PA 4CH0S 1REGX 5BYRA 3M8RA 1N33J 1FTRA 5K20B 3UQSA 4QIEA 5L1JA 3M6WA 4FPIA 2WW8A 2JRSA 3VGVA 4A8SA 5K9FA 1ACMB 1WEZA 3M4XA 1SV5A 4OX9F 2B4OA 3CDBA 2R3VA 1Z2ZA 1QE1B 1R8CA 3PR5B 3TZZA 5A6WA 4ZN1A 3R1HA 3TA0A 2HKEA 2V4JA 4OI6A 4C3MA 5LMNF 1RK8A 1VBXA 2ZBRA 1WWHA 3TVYA 1A9NB 2EC2A 2V50A 1S6OA 3KWMA 3D0HE 1LV5A 3G8TA 4F50A 4C0HA 5HJYA 1T11A 2PE8A 3SV4A 3V6JA 2R4FA 2F7VA 3DDNA 4H54A 2V9WA 2HGLA 4J90A 4KH1B 5B0EA 2AZ3A 4N41A 3DLGB 1B3TA 4DI6A 3T1YJ 1HQUA 3DLEB 3HHLA 2F63A 4K4YA 4MKYA 5CYMB 1YQHA 1EKRA 3EVWA 1B70B 3AXKA 5I3QA 5C25B 1HI1A 2XHWA 3B82A 3T41A 5F8LA 1RYRA 4DPUA 1IBKF 3GFHA 1RT2A 3PX6A 2AGPA 1VC6A 2ZZMA 2PFFB 1U4BA 1Q79A 4J37A 2ALYB 2CQ1A 2QLFB 3K7RA 1B0VA 4M5GA 1SH3A 2LEPA 3MAQA 2M52A 3IO1A 4TY8A 4RLEA 1RT7A 4PWDB 1RP5A 4K0KJ 1I51B 2OSRA 1S97A 3NMAA 1HNVB 2KJWA 3IWLA 1XR5A 2GQCA 2HWIA 1PC5A 3GFZA 3HSDA 4WYLA 3I0SB 5CYQB 1Y5NB 2ROEA 4M5KA 4PG6A 1S77D 3NNHA 2IM2A 4P52A 1NSAA 2AHOB 3FBCA 4ZS6A 4CNZA 4F0MA 1UJ5A 2ASLA 2ZC3A 3PV8A 2IA6A 2KB2A 4FXDA 2O1PA 2VZ9A 4OZNA 1WOPA 4USTA 4C4WA 2Z57B 3M2RA 5L39A 5LOQA 2B0GA 1QD1A 2N7YA 4NLWA 3MMJA 1YRUA 3TARA 4EBCA 1YTYA 3DLLQ 4C8NA 4JI0F 2LECA 2PEBA 4KHPJ 2XI2A 3SYZA 4F8RA 4I68A 4X66J 4DQIA 5J2PA 2WVCA 3D6HB 2QSWA 4Q7AA 4NXMJ 3AT1B 2G2YA 4FDFA 1YX2A 3MEGA 2YH0A 3D9BA 1HBUA 1C2PA 3GJRB 5HJXA 5E3PA 1UVNA 4JV0A 2HMIA 2H48B 1JLEB 1S1TB 4WF9Q 2VFSA 4OZ2A 2OO4A 2ACYA 4M94A 2RSQA 1S48A 2RQMA 2RUGA 3M8SA 3KLEA 4DPOA 3MXHP 3H98A 4ZVHA 1C1CA 3AOAA 2FJXA 2PT0A 3MEDB 1NUEA 2YNGB 4HI1A 4KH0B 4WU2A 4O3PA 3ZTSA 3S8SA 4IYQA 5DDRC 3EPIA 1QAYA 3NCRA 1OS5A 4TY9A 3CD0A 3JYTB 2GIFA 5U47A 3FBBA 2D3O1 1AYEA 1NNDA 3PYDA 1RLDA 2F4VJ 3KLHA 1N5YA 1K1SA 1NMEB 4CM0A 1S4EA 1E6VB 2GGPA 2GO9A 2HBZB 3L3CA 1T7PA 2QJ3A 1VQ9S 2R8KA 1RTJA 4Q8FA 1YZ6A 3PW0A 1OY8A 3QT5A 2XLKA 4C0OC 1D0EA 2FHJA 1X4HA 2YWWA 3RAMA 2DHGA 3W8GA 4WFBQ 2E9RX 4L72B 1SKRA 3H2UB 2AYEA 2B51A 3VZHA 2UUTA 3OT9A 4O0IA 2ZH4A 1FFWB 1FRLA 2P2CB 2GIRA 3IGNA 4WXWA 3TJ9A 4DPXA 5I4MA 2KFYA 2BJ1A 2R7RA 4B3RJ 2B7BB 3KLVA 5LT5A 4DL3A 1YJVA 2VV5A 4C6AA 2MKKA 2DNHA 5C24A 2QL9B 1JLCA 3FSXA 3OTOJ 3I5BA 1PYOB 3DRSB 3TVZA 2VC1A 4NXNJ 3ILIA 4Q5VA 2CPZA 1EARA 3LOUA 5HBMB 4UW2A 1RT3A 3FNNA 5CQGA 5KG3A 3O44A 4O0NA 2B6AA 4DUTA 4FNIA 7FD1A 3J81j 3DOMB 3MCOA 1SL2A 1S7IA 3GR1A 3EMTA 3LA0A 1Y3KA 3LF0A 2MQPA 1Q0NA 2C2RA 1D9FA 4UQTA 1YK9A 2DO0A 4LT6A 3KHHA 3ZZ0A 1IBLJ 2DPIA 3MM9B 5DM7Q 2RU3A 3D6FB 1SC1B 3FMWA 3VQTA 3C14A 2CQHA 1ZTTA 1U0HA 2FY8A 1UW9A 2WTFA 1OQ3A 4NL5A 2AU0A 4O44A 3ZXWA 1RBOB 4J9QA 3US5A 4LF5F 1X4DA 2K7JA 3G8SA 3L7PA 1IM6A 1FDBA 1WUUA 3BH7B 2AQ4A 2OPRB 3PRVA 1UVIA 1VQKS 1T9XA 1WF1A 3FMBA 3MD3A 2XM3A 4DV7F 1VI7A 4LUBA 2HS0A 3DRPB 3HKWA 1WEXA 2XBPA 1FNOA 3EJMA 1T03B 2X1BA 3HHLC 3WIVA 5J1PA 4DR3J 2YNIA 1YDLA 3I4HX 1FKOA 2VBYA 4DFPA 2AJ0A 1Y0HA 3OHAA 1RKJA 1MMDA 3NY0A 4DUYF 2EFPA 4WFXA 3PEHA 4PQUB 4ZP8A 4RW8B 1HA1A 2GQQA 4NLSA 3W7BA 5KFKA 1Q82T 1ZTWA 4C9DA 1M5SA 5B0AA 2CPXA 1FFSB 3HSJA 2W7OA 2BOPA 2ROPA 3WDOA 1WC0A 1M1HA 5KFJA 4LRAA 1KVKA 1FX2A 1QSSA 5HANA 3CJ2A 3ZZZA 2NZ4A 4DLEA 2ATCB 3RUBL 2HIQA 3MMBA 1TL7A 1JMTA 4DL7A 1HD1A 2OEMA 1KLMA 1TL4A 2QRRA 4DL0C 4KO0A 3JSMA 3KYLA 1TKXA 1R27B 2QSFA 1VRTB 3DGVA 1RAEB 1R31A 1WD6A 2E66A 5AE1A 3FVYA 2QA2A 1P8GA 5KFZA 1NEEA 5CHCB 4ZHRA 5IC6B 3WX8A 3CCTA 2K3KA 4USMA 3SCLE 4IG3B 2XMMA 2MDAA 2M4MA 4DWIA 3M32A 2CKWA 3EXYA 5IQQA 5EHHA 1BMQB 1HBMB 5C2GA 3CDEA 3D67A 3LO3A 2CJBA 1HHQA 3K89A 2RNEA 4U96A 5KFGA 4KV8B 4OZ0A 4K4XA 1FK9A 4OLPA 2HHVA 4LF6F 2FLNA 2KU7A 4CT9A 3EICA 3GIJA 2WSCC 3MAAA 3DOKB 1FDAA 4DPTA 4K4ZA 1FWKA 3GLJA 3JQMA 4X4OA 3OL6A 1PAEX 3G82A 2RKIA 1XEZA 4ILRA 2UU9J 4LSLA 2MHNA 5LMNJ 4IO9Q 1DTTB 2MQLA 3OR2B 2KYXA 3NOGA 4GMKA 4QWBA 4EI2A 4DUYJ 4XTTA 1TK0A 3RYLA 2OUGA 3TOQA 4YS2A 1PO6A 4DQPA 1HD0A 4ECYA 4AL5A 2C2ZB 3QIPA 2VPZB 3MCNA 4Z7YA 3G6XA 1Y5LB 4DV0F 1AUDA 4P74A 1NB2A 4YY3F 1OQ6A 1HLWA 5B08A 4IR1A 2P6TA 3HO1A 3DOLB 1RUSA 1SJRA 4XDDA 1B4SA 2BX6A 1IKYA 2Z30B 3J81Y 4G65A 3ZZYA 3MR3A 2QA4G 3M6XA 4KJIA 2GIQA 4LJMA 3GQCA 2XLIA 4CZCA 3KLGA 5HMWA 2J9CA 1NDCA 4RL1A 2M2BA 1RT4B 5GMKa 4JYAF 3CXCR 4OHWA 9RUBA 1KQFB 3UO0A 2EG1A 4P2XA 4LVOP 2JDJA 4DV2F 4CLKA 5L46A 3Q24A 1PSDA 2GHWA 4F2RA 2HK2A 2R2UA 4CQ1A 2DYAA 1G4CA 1FEHA 2HBRB 2M8HA 2ADBA 3IAS9 1EP4B 1M5PC 1L3KA 4UUWA 2C2DA 1HWKA 2UUBF 5ETPA 2HQGA 2FHKA 2KXHA 3MDFA 1S10A 2OFGX 3HX9A 1X4EA 2OI2A 2ZOGA 4KGMA 2IJFA 4DJBA 2FY1A 2BANB 4RWXA 2UUCJ 2GA7A 2COLA 2IM3A 3FK4A 3W66A 1XJWB 4CLTA 4G3IA 4FF2A 2LQBA 4A8KA 3BYPA 3DLBA 3R2DJ 1G2EA 4QOTA 3TX0A 1R8AA 1S6PA 3W64A 1NZ8A 3OTEA 2KM8B 4R5PB 2E29A 3O6QA 3BGRB 2WOMA 2J8SA 2RVJA 1IKVB 2E1RA 4U67Q 4X4TA 4FF1A 2Q1LA 3OVBA 4X4UA 3MZIA 3CCJS 2YWFA 2M3DA 3AXMA 5DRKA 1VC0A 2CJYB 3TUZC 3M05A 2QA1A 5ETSA 4Q45A 2GQ2A 1UJ4A 5D3GA 3VALA 2DITA 4A8YA 1IBMJ 4LBIA 4NLXA 1RDRA 2GVZB 3EE3A 4Y65A 2AYGA 1A7GE 4DSEA 4C7QA 5EDWA 3HVWA 2VBXA 3MCMA 4RUBA 1ZZFA 2DKOB 4CLYA 1S0NA 4TY8B 3UNGC 5LXYA 2EFQA 2K06A 4CIOA 4EEYA 1KWMA 2AX1A 1Z4UA 4MYUA 4N76A 3UVJB 1P27B 1U8SA 2CAJA 3BDEA 3N5BA 3CDWA 3C46A 2BM1A 2IHR1 3BR8A 1LQ9A 4R25A 3CMES 5KFTA 1KDNA 2ZZTA 4N8NA 1YIJS 4DL4A 2E5IA 3W2VB 3H7HB 2OD4A 2GJFA 5KFMA 3KOAA 3ZFVA 2ZD1A 2W9BA 1UZDA 2AJ2A 1KD1T 4KRWA 1HARA 2B8PA 4JV5J 2NPIA 3J7ZT 2FJEB 4P75A 1X0PA 5HN0A 4JI1J 2QL7B 1KN6A 2HG4A 3W61A 1S72S 4FXWA 4QWAA 1SJQA 2RDIA 4N56A 3CC4S 4F3OA 2Z56B 1ULRA 1DFDA 3JQJA 2DY9A 2KG1A 3ZZUA 1N34J 3MUTP 1N6QA 4B3TJ 4NRUA 5GADU 4X4QA 5HL7Q 4E0DA 4OYXA 2EFOA 3EZ5A 3K59A 1DARA 3JTPA 4ZPBA 3CD6S 2HHHJ 1IJEB 5GAHU 1TK8A 1EQ0A 3L95X 3V81B 2N3LA 2YNHB 2QFIA 3PG9A 3GILA 5H9FK 4O4GB 3H42A 2DHSA 3H5YA 2HAFA 5HVHA 1YHQS 1RBAA 1J5OB 3A13A 1HKAA 3PJWA 4PCQA 3SCJE 2D41A 1P1TA 2E44A 1LK7A 3KNGA 4LRFA 2ZH6A 3T5KA 2F9JA 1RA7A 2VOOA 3MEDA 3QRQA 1G3OA 3EGNA 2CDRB 1C4CA 3M7VA 1MMNA 1K0VA 1TV6A 1WG1A 4LQ9A 1FRIA 2AMCB 5G0RB 4OYMA 2YKNB 2ASJA 1OPZA 4ILMA 1XNQJ 1RE1B 1F2GA 1TTHB 4ZVUB 2QZ8A 3HSGA 1BE4A 1X7VA 1YRXA 5GMEA 3G6VA 4ATNA 1S1UA 4DEZA 3HKZD 1VCTA 1HNWF 2BQUA 4TU8A 4X4PA 1AA1B 3RU0A 2RRNA 5CCLA 3EVOA 2NCKL 4ID8A 2MKIA 1HPZA 3M30A 1TVRB 4WE1A 2WB1D 2EPIA 3AB2B 1SH0A 4PG7A 4DCJB 4IR9A 4BBYA 5D77A 1RT5B 5F8MA 3D6MB 2Z58B 4X64J 1QLNA 4CI0B 2AYMA 5D0GA 3P8BB 2KL8A 2DD8S 2ZNZA 4OHXA 4PYDA 2XS2A 3ZZRA 4LSNB 1IXKA 1ZYQA 5KG4A 2IYGA 3MOJB 3HVAA 4JUZA 1U1PA 2W9CB 2E7XA 1UAWA 1RWOB 3JB9k 2NUHA 5LL6d 2XSFA 4FNHA 5J1EB 4MJKA 3LAMA 3AA9A 1U1RA 1P6TA 3BREA 1S9EA 3MM5A 1XNRJ 2VG7A 3CJ4A 4HH1A 4K7QA 2DRAA 2ZE2A 2XMKA 4LIRA 4MK7A 1UVMA 4BC9A 3PW5A 1HBNA 4ER8A 1NLKL 3KK3A 1N0VC 1FT8A 1VIOA 4N8OA 2AD9A 4GKKJ 2PMHA 2UUWA 2FVSA 1ZETA 3HVTA 1FEEA 1HWIA 4M5NA 2F9DA 2BEFA 1RWVB 5HMXA 1S49A 3IRXB 2NYIA 4ECWA 1XIQA 2XY5A 4OI1A 3CC7S 4TQSA 4IDKA 5HROB 3MPYA 1S6QB 4IOBA 5C5JA 5DDQC 4URQU 3LPEA 2BW2A 1OSDA 3PYGA 5CD4A 4QIFA 1BQNA 3V4IB 1NH8A 5T41A 1PC4A 2W2QP 4ZVSB 3ZZTA 3RBEA 1Q53A 1X4CA 2D9OA 1T05B 3R5JB 4EBEA 3W3SA 1VIXA 3H0PA 5DLFA 3NXZA 5GMDA 2JSXA 2R9LA 4KTQA 1WG4A 1CQNA 5KFCA 4BS2A 2WHOA 2F1FA 2KDOA 3C8YA 3RW7A 3SMZA 2YNFB 3W62A 2D1CA 1N4LA 1UL3A 1UVKA 1ZM3A 5L38A 1QAXA 2U2FA 4Q44A 2H9ZA 3H59A 5DO2A 3OJSA 4ED7A 4C8YA 5KT2A 1ZA2B 3VTIA 4K0KF 4RU9A 5F8GA 4USWA 4YFUA 4LF8F 3OQ2A 2LA4A 3G2XA 5D78A 3TNVA 4M5MA 4R8UA 1KC8T 1SV5B 2MXYA 3M8QA 2MKYA 1U2FA 2HHXA 4YQWA 4OYWA 3IBFB 3OVAA 2WSEC 4O3QA 3E8OA 1RTHA 1RWUA 4JI5J 4EO8A 2V4JB 3GSDA 5KFOA 3SDEA 3CE8A 2I9SA 2DH9A 3QFWA 4DV3F 2GS8A 4IH7A 1HHSA 3AAWB 4LF6J 2CQ0A 3CT9A 4LSZB 4I7FA 2V6AA 3FJ2A 1HI0P 2GW8A 2AGQA 2XQCA 2K2PA 1LW2A 2WVBA 3CVKA 3KFWX 4A47A 1RHRB 1FJGF 5IT9Y 2ZHOA 3PR4A 2UXCJ 2Z2MA 2DTJA 1WSRA 1VQMS 4CWBA 3KLFB 1HW8A 1IUJA 2IA0A 3A1YG 4MMOA 4DBQA 6AT1B 2DCUB 3GJTB 5IZHA 1U47A 3ET6B 1S0OA 2PI4A 3MHYA 5J2MA 2I6WA 1LWEB 3TUIC 3VAIA 2C2KB 2O01C 3OR2A 1G1XA 1H3DA 3Q8YA 3GONA 5DLGA 4J9LA 4L76A 2I2YA 2DR5A 4V19X 2F8EX 4IH5A 4MIWA 4ED4A 1SJ4P 1RTDB 2YQ1A 2HNZA 5CH7B 5EX3A 4K4VA 4CLPA 2W4CA 4ZVEA 4F3QA 1VQ8S 2JVOA 1VHFA 2Q6BA 3TWZA 2YX4A 1VJWA 5CYQA 4W4MA 4DN0A 5AXNA 2CZ4A 4RW9A 2E1AA 1NHUA 2F4FA 5IC4B 3RJMB 4DV2J 2XSJB 5DS7A 4P73A 5DDPC 2ZBPA 4XK8C 2X1AA 2VIHA 5KFAA 4URGA 2KO1A 5H9FJ 3BGOP 4AUKA 4LF8J 2KHDA 3BQ2A 3SEOA 2KVIA 4E2FB 3VVTA 2Y1RI 2O67A 4DV1J 4JYAJ 2V8PA 4CO4A 3DM2A 1EP4A 1R0CB 4JI5F 3GMGA 1FKPB 4Y2AA 4X4RA 4USIA 4ZCKA 2V94A 2CADA 3BO3A 1M5HA 1JLGB 1UWBB 1GEHA 2JHEA 4DHVA 1ZH5A 3PXGa 4KSEB 1QVGR 1B0PA 3DCAA 2G9OA 2OD6A 4FKYA 4P72A 2BANA 4ED2A 2ZM6J 2VDHA 1TUWA 3F56A 3DGPA 5IV3A 1NO8A 1PYTA 2JX2A 4MKVA 5DM6Q 3RR8A 1KHWA 5M2PA 1KQKA 4UT4A 3CCWA 4CLSA 4ETXA 3IMQJ 3TEHB 3TAMA 2MPUA 4QIGA 2R2SA 4IQMA 4ZMMA 5HP1B 2WOMB 3CJRA 2J8AA 2HLTA 3RGIA 3SQGB 1QSLA 3H4DA 2DNPA 3ZZPA 1XWLA 1NSKL 3P5TL 3KJVB 2CA9A 5MLCV 1F1BB 4MFBB 1CJUB 1FVQA 2E5JA 1VR6A 2WBMA 2JFDA 1XK8A 5AE3A 5KOWA 3ULHA 3QLHA 5M2RA 2J76E 5KFLA 3FGVA 3K5PA 4NCGB 1KONA 3C19A 3IC1A 2OPSA 4N47A 1IM4A 3BN4A 2W7PA 2CPDA 1VQLS 2FVPA 2OMLA 2RQ4A 5IT4A 1PBUA 5CZXA 5KFFA 1HR0F 1N32J 3LW5C 4A8XA 2BE7D 3P45B 2B5JB 4WFAQ 2BE2B 2DEJA 2QMWA 3FCWA 4ITSA 4DV7J 3J7Z5 1UPMB 1R6YA 2WCXA 3PKYA 4CRJA 4Y2CA 1NJXA 3UDCA 4RW7A 2G1HA 3DLJA 1VS3A 1NK7A 4TYBA 3LGNA 4Z7CA 2NSBA 8ATCB 5LSLA 2EKNA 1HWJA 3GG0A 2IVMA 3CJ3A 3DLKB 1W2BR 3HJVA 2KH9A 9ATCB 1RWMB 2H4YB 3GIIA 4B3MJ 3MR7A 2APOA 3PYEA 3UI3A 2MB0B 2M5YA 2IAJA 1Q8KA 4ZP9A 3PRBA 3DYAB 3FEXB 1RTIB 2GAHC 2RF2A 1SQGA 3I4PA 4NLVA 3LTOA 2L48A 1NB7A 3C3LA 2C3OA 1SKUB 3PX0A 3DLGA 2HQ3A 5KFSA 2ERRA 3MPWA 3DKDA 4MIAA 5EWEA 3Q89A 3JQKA 3V81A 1DHMA 2C3UA 2LXFA 5B0BA 3AQPA 4NLYA 1DLOB 1BY9A 3FKBA 3AD9C 1KBRA 3MFIA 2B3TB 4HYKA 2DHHA 2CG4A 2DRDA 4KHMA 3PW4A 1OJ4A 3W1YC 1GQEA 3R6GB 4EYHB 2HQCA 2Z8QA 1LW0A 4ED8A 3I6PA 3EX7B 4J9VA 4IO1A 4KIAA 1R0AA 2OEJA 4NI2A 1VQ5S 4KR0B 4RNHA 5ETOA 1D9AA 2CQBA 3IR5B 4UOGA 5A8WA 3E2EA 1S4FA 4HL9A 3G4SS 1HNVA 2ABYA 2HFZA 3CDAA 3ELHA 2XMAA 5T7LB 4DR1F 3OFFA 1K0TA 4UY8T 3QGHA 3K2YA 2JC1A 1HWLA 4PQUA 4J91A 2ZVSA 2WVFA 4L75A 5LSOA 1SVDA 1V6HA 1RLCL 5B09A 1DRZA 3TRGA 2NXUA 3M8PA 2J0XA 3EZUA 3M6VA 3R6LB 2PO4A 1HPZB 1RHKB 2D74B 3M30B 4X4NA 1KVIA 2DR8A 1TUGB 2L9DA 3SQOP 3U1MA 1GFWB 3H5UA 4P10A 2BR0A 1YG0A 2NS1B 4B9TA 3MR6A 4I64A 1J5EJ 1Q7LB 3BO4A 3T1YF 2ZBCA 2PEHA 2A6MA 1R0BG 2ZEJA 4M5JA 3HDSA 4LSNA 3GU0A 4OJGA 1FX4A 5F0WA 1KLNA 4ZVOB 5ETMA 1VRTA 3OTCA 3R8YA 4DU8A 2XO6A 3OLBA 3MEGB 1OSCA 2ZNYA 5KG2A 4FVMA 3AJDA 2J6SA 1UVJA 4FF4A 1X9WA 5L1IA 4KGKA 3MEEB 1X60A 1I3OB 2GMJA 1JJCB 2W4DA 2R7QA 1UVLA 1T3OA 4IG3A 2DNLA 3PJ9A 3W63A 4M5IA 4K4WA 2XTJP 4A48A 1W25A 1IBCB 3EXCX 4NLUA 3QFHA 1TMJA 2J6TA 2JEJA 3DC2A 1HBMA 2KZZA 2CJ9A 3OTDA 3G86A 4YUDA 2ZE2B 2CPYA 1PBAA 2V2ZA 4YHHJ 1HHTP 5IFMA 3KKFA 1HBNB 1FWLA 3CC2S 3KK3B 4YB6A 2FHOB 1NK6A 3D1HA 4PWUA 4PG4A 2QFJA 3HVTB 2FZKB 4MIBA 4G6VB 1DAXA 3M2UB 2AJFE 3I31A 4PG5A 2B56A 5E0OA 4ZVTB 5H9EJ 1NDPA 4XPEA 1FKAF 3FSIA 1YJ7A 1Y5IB 2HZCA 5KFUA 4WPAA 1QJHA 4QWDA 4C8KA 1XERA 1OIAA 2W24A 1BD6A 2M88A 3J81U 2NPFA 1WC6A 3KLIB 2A2DA 2M9KA 2VBWA 2GV1A 4I56A 4OX8A 1RU2A 5JMNA 2BV3A 3BKFA 3CPWR 2DNKA 4XIUA 1RWWB 2FHJD 4ZLNA 3M2VA 2DJWA 4WWSA 3SBMA 2QL5B 3NAHA 4RW4A 3B54A 2V63A 2DO4A 2W2NP 2BW7A 2KJVA 2Q43A 3R5AA 4H4MB 3HXMA 5F8NA 1ZPVA 1N5QA 3HHKA 4DR4F 2ZDPA 5HBMA 4P7TA 4CLFA 4ED6A 3ZTQA 1EHWA 3VF0B 3V6DA 4ECSA 3R1LA 3C6TA 2VFUA 2DY1A 1TKTB 3H90A 2B6AB 4WFYA 4DX5A 2BACA 1NHKL 3N28A 2R7VA 3J7YU 1CS4A 3CJ8A 2DXDA 1XR7A 2AYBA 1HQEB 2DGWA 4DV3J 1VBKA 4F4KA 2CJAA 3BSOA 1X4GA 4W90B 4TLQA 1F5BA 1O5JA 3MM7B 3QQCD 3I82A 3MD1A 4K2JA 4ZA1A 1HNXJ 3OSPA 1JWWA 2IMWP 1FJCA 2FPHX 4CYUA 3CIZA 3SDEB 4RNMA 2PI5A 4H4OB 6FD1A 1C0UA 5LM7E 5F8IA 4YHHF 2H3EB 1FE4A 2I8EA 1O0PA 1X5SA 1UEKA 2YTCA 2GX8A 1MLAA 2CQ2A 4HTJA 4LR9A 7FDRA 1X5PA 5C7PA 3MR5A 4OI0A 3PIPQ 3NGKA 1P9YA 3O5TB 4LF9J 4OZLA 4J5OA 2FZCB 1U8WA 3BSNA 4NPOA 2W9AA 2H4WB 1T03A 3BPDA 1FXRA 2XMWA 1CJKB 2BE9B 2YKOA 1OMSA 2KT2A 5GAEI 4NXNF 2VOPA 2ZM6F 1T9UA 4OI2A 2YQ3A 4RW8A 4QW8A 2DISA 1S6UA 2JJ4D 2W01A 3MM8A 3IR6B 3RG6A 4Y6IA 3L7UA 2G0IA 1VQSA 1WF2A 2C1EB 2RIJA 3N5FA 3QNWB 5AJ3F 1UFKA 2KN4A 3ILLA 4PQAA 1MWQA 2NSCA 3V5RA 1TK5A 4C8ZA 2BKNA 3EYZA 4DF8A 3QATA 2IDEA 4OI3A 2CQ3A 1HWUA 1AT1B 4HLBA 1RADB 3T6JA 2X7IA 4OV1A 4DZDA 4DV1F 4WTYA 3TA2A 3CCQS 4EUVA 2RQKA 1KQSR 2ZD1B 2Z2LA 2L9NA 4UOFA 3X3UA 1GXLA 2XYPB 4EWTA 1RTZA 2DH7A 2HHQA 5DG8A 2HFUA 1QE1A 4M95A 1N5SA 2NXNA 1R8HA 4O23A 2MSTA 2JFKA 3GR0A 2A3JA 4CM2A 1JNZB 3DM2B 1DQ9A 4F26A 2I38A 4M1KA 2O3DA 2F3JA 1S0MA 1B7YB 3AD8C 2QE5A 4L73A 2PGCA 4LR7A 2QGFB 3SSRA 4NLPA 4HDHA 2GC8A 4DCOB 3ETOA 2X3GA 4J9UE 1FK9B 2B8QA 2LEBA 3DU5A 1LEOA 1AFJA 2QYCA 4P2FA 1VC5A 2YNHA 1SQEA 2G13A 2MKHA 1SH2A 2U1AA 3DNCA 3MAAB 5ETVA 5C25A 2XCAA 2UUAF 1PYSB 2GVDA 5LMUF 2YKAA 3MI7X 1FRKA 4LBHA 1IWAA 2BMBA 1R3NA 2VJUA 1YJWS 4NLOA 4USHA 3GIRA 2BJEA 7AT1B 4P7VA 3W5YA 2VICA 2KFNA 3UN5A 1NDKA 4OZJA 3HP6A 5K8MA 3U7JA 1IKWB 1TR0A 3QJLA 3GFYA 2UXDJ 2MKCA 4ZPTR 3QYYA 1X4AA 1GMWD 2CNNB 2KXNB 2F5GA 3I0SA 3NGTA 3BGFA 3QLHB 4K4SA 5BYSA 2Q66A 2OPSB 4ANDA 4HI2A 5ETTA 1ZM9A 2MLZA 3M2RB 2ZH3A 2IRUA 2QIFA 5HQLA 5IQ6A 2N4CA 3JXOA 1K44A 2JZ5A 2NZCA 2YKPA 3M6UA 4I1TA 4U95A 1RT5A 3AOCA 4I6YA 1WNEA 2HWHA 6FDRA 2HYIB 4F25A 1AZSA 2JLFA 4DR1J 1KTQA 1YWXA 1NRKA 2BJ8A 4JOUA 3HM9A 2R2TA 1GX6A 1UTAA 4A4JA 2CRLA 1H73A 4OL8A 2FQQB 2A2CA 3M8WA 4JI0J
chains in the Genus database with same CATH topology
2BUNA 2DRBA 3DLKA 2XMTA 1JLEA 1S1TA 2KKHA 3QAEA 2HNDA 1Q8LA 1DZ5A 1BQMB 2AF6A 3HT3A 4PXCA 2ZJQQ 3TA1A 1S76D 1S9EB 3MM5B 2GFFA 1KNZA 2VG7B 4JV1A 1JLFA 3SCKE 2DHAA 3GFXA 4LF4F 1FDDA 1HFEL 5KT4A 3BM7A 1U1OA 3HHLD 4ID5B 5IM0A 1JLBB 1Y4ZB 3PW2A 1E6VA 2GGPB 3Q8SB 1U2RA 3RRGA 1EETB 4CNYA 1RKIA 2DIUA 4HEA9 3TUJC 4DL6A 4LF7F 3PKMA 5B7WA 3RRHA 4USJC 2EFGA 2KZMA 1VLYA 2QMXA 4RUAA 1PGZA 3N6NA 3PVXA 3T3FA 1K73T 1BQNB 3KG4A 3V4IA 2FJWA 1CC7A 3RRKA 1VMBA 1SIWB 2NQPA 3LAKA 2XMJA 2E1CA 2LXIA 4WIIA 2E1MC 2VFRA 2DR7A 1GTHA 2BRKA 2IFXA 4DX8H 1YI2S 2DGUA 1URNA 1Y00A 2V8HA 2VPXB 2V9KA 3QAUA 2W9BB 3FRYA 2R7TA 2YNFA 4B08A 3MMCA 1KQGB 5MAOA 3OUYB 2GO8A 3UCZP 5FDLB 5B0FA 1LKZA 1X9SA 4A8FA 2A18A 4MK8A 3NNAA 5DG9A 1CPZA 2L9WA 2FJVA 1L3SA 3GV7B 4DG1B 3MWBA 3ONQA 5KG6A 4P6QA 3THPA 4OQJA 1SKWA 3J7YI 1RQ0A 4KPYA 4QU7A 1TKZA 3HHDA 2BM0A 2P9GA 4KQZA 1FVSA 4IRCA 1S0VA 3IR7B 4PXDA 2UVVA 2XS7A 3IAM9 3UCUP 5DGBA 2DGSA 4I7FB 4O3SA 3N4WA 3TAPA 2XY7A 3R5DA 3D0IE 3IS9B 3OL7A 3UWTA 1CG2A 4URSA 3GIMA 3X1LB 3WC0A 3TI0A 1B0TA 1MNEA 2XGPA 1K8AT 4C11A 2FTRA 4DF4A 3K5MA 3RAQA 4IQXA 3Q22A 4OJ3A 2OMOA 4OJ1A 2YNIB 4JI8F 1FKOB 3GG1A 4JV5F 4JV2A 4DR7F 2KXFA 2BABA 3KNAA 2IM0A 3VCDA 3LP2B 1FO1A 3DRYA 4L6V3 5B0DA 1N34F 2ZH5A 4B3TF 4DN9A 1VBYA 1KEKA 1WTFA 1KR4A 3OFGA 3CCES 3G9CA 4RW9B 2XSJA 3PW7A 2HHHF 4ZP6A 3JAMY 1M90T 1M5VC 2UVRA 4KO0B 3JSMB 1MU2A 2I5JB 2CJQA 1N33F 4KKOB 3C6TB 1NU4A 2FD2A 1TKTA 5JXSA 2CVIA 4WKYA 4ZK7M 2JOQA 1T94A 1UA1A 1LWCB 2J0SD 2DGXA 1TFWA 3T5HA 4CCHA 1N32F 5J1EA 1H2UX 1RA6A 5GAHI 3MECB 3M32B 3MR2A 2LKZA 4I2PA 4KAIA 4ZPWR 1Y7PA 3FSYA 2YKMB 2W4PA 3MFHA 4I69A 4KE5A 4C8MA 1WEYA 1ELOA 5F9NA 3M9MB 3VAMA 1WTBA 1Q7YT 2Z0GA 3DOKA 4Q43A 3DI6A 3LALA 4F67A 3FEZA 2VQEF 1LWFB 4DDFA 1YVFA 4ED3A 2RKIB 4OI4A 5B0GA 2MJNA 2DB1A 2MZRA 1JXLA 3K5NA 1F5AA 3UD4P 1RYSA 4F4ZA 4DQSA 3TP2A 2MMYA 5LXRA 4KBIA