1S1XB

Crystal structure of v108i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
423
structure length
397
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGLKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 397
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1xB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1xB02
4KFBB 2HNZB 1ZTWA 4QWEA 1LWCB 2VG5A 3DOKA 5KFXA 1C0TB 4ZPAA 3OLAA 4K4VA 1RA6A 2ZKUA 4O3QA 1R0AB 4NLRA 1TKXB 4GC7A 3BSAA 2OH2A 4IH5A 3SFGA 2WTFA 1JKHB 5DGBA 3GIKA 1S9FA 2XI2A 4RNOA 2AGQA 3QIPA 4I2QB 3RB4A 4ECSA 1RTIB 1DTTA 3CO9A 3OHBA 1LWEB 1SUQB 5F8GA 3KMSA 3JYTB 1IKYA 5KFAA 2WOMB 3RAQA 3NGDA 4K4SA 1TKZA 4J9OA 4PWDA 3VQSA 1RT3A 2OPSB 1JLGB 3G6VA 3GIJA 4NZ0A 2C2EA 3DOLB 3H4BA 1HQUA 4MKBA 4IRKA 3KLGB 4WFXA 4IG3A 2W8LA 3MECB 2OPRB 3HVWA 5KG4A 3V6HA 3FQKA 1JLAB 4K4XA 1TP7A 2AGOA 4TQRA 4ED1A 4DL4A 5C24B 1HNVB 4ZHRA 4Q45A 3NBPA 4MIAA 4R8UB 3QO9A 1C1BB 3M8PA 3IS9A 2FJVA 1KLMA 3C6TA 3SI8A 5F8JA 1QE1A 2GIRA 2IBKA 2YNGA 2WK4A 2BANB 3GILA 1UWBB 3JSMB 3LAKA 2QV6A 3GV8B 4NCGA 2AU0A 2V4RA 3H59A 4DL6A 2ILZA 4IH6A 2ZE2A 4TN2A 5F8LA 2D41A 3BREA 4G3IA 1DLOA 4JV1A 1MU2A 3KK3A 4RW4A 4FBTA 3KLFB 2W9BB 5KFVA 5DGAA 4NLXA 1D1UA 3KLIA 3G86A 3HKWA 4MIBA 1LWFB 2FLPA 3NMAA 3PHEA 2ASDA 1RT4B 2IM3A 4ECZA 3QYYA 4NRTA 2HNYB 4KO0A 4IH7A 2W9CA 4OL8A 4U6PA 3MFIA 3IGNA 1IKXB 2UVRA 3MFHA 3KLHA 2JLEA 2FVRA 1T03A 1S9EA 3OLBA 1SH0A 5D3GA 4J9MA 1VRTA 4ECUA 4TQSA 2RKIA 5KFKA 3DLKB 4B3OB 5CYMB 3OSNA 5L9XA 3KOAA 1J5OA 1JIHA 1RT1A 1S6QB 3I0SB 2YNHB 3G6XA 1HPZA 2OPQB 2GC8A 1OS5A 5DQHA 2JC1A 3DRPA 3FRZA 4J9PA 4J9KA 5HBMA 5C42A 3H5YA 2WHOA 2AQ4A 3TAMA 3V6JA 3I5BA 5HP1B 1S1UB 5DQIA 5DG9A 4EYIB 2C2DA 1S1VA 2QE5A 5KFPA 2WONA 4M94A 3UDLA 1TV6A 4MFBB 1RT7A 4IFVB 2BQRA 4Q43A 2JEGA 1EETB 2J6SA 4IG0A 3E01A 4TXSA 4J9NA 1N6QB 2OPPA 2BE2A 3T5KA 3N6NA 4RNHA 3EPIA 3NKYA 4ECTA 3DLGA 1S49A 1BQMB 4ED6A 1S1WB 4EEYA 1RTDB 3BGRB 5CYQA 2O5DA 1K1QA 3LP1A 5J2NA 4Y2AA 1JX4A 3BSOA 3LALA 4RW6A 2HNDA 1VRUA 1TKTA 4H4MA 5KFMA 3KK1B 2ILYA 3DDKA 4Q0BB 1REVA 4QWBA 4JV0A 4K4UA 5EUHA 1C0UA 4MK8A 4O4GB 2IA6A 2YNIA 1T94A 3I0RB 5HROB 2AX1A 3GIMA 5EDWA 2YKMA 4KHRA 2C22A 4WYWA 2JC0A 3QLHB 4IOBA 5J2MA 4NLYA 4YR3A 1XR7A 2AGPA 4ICLB 4KE5A 2BQ3A 4IFYA 4I7FB 4MH8A 5FDLB 1T05A 4QWAA 2R8HA 2JEIA 5KFWA 1TVRA 2IC3B 5C25A 3V6DB 4WYLA 2ZD1B 4O3PA 5I42A 5HLFB 3BSNA 4O3OA 1JXLA 1N56A 1RTHB 5KG7A 1LW0B 2UVWA 4ID5B 3MR2A 2JEJA 4R5PB 3KJVB 3FQLA 4URQU 4LSLB 4ZPDA 1JLCB 1FKPA 4ED7A 1EP4A 3CWJA 3V4IA 2I5JB 3HVTA 4LSNB 4RW8A 1HYSB 2R2TA 1GX6A 1RDRA 5I3UA 2VG5B 3BR9A 5J1EA 1N5YB 4K4YA 5DG8A 4F4ZA 1QUVA 4ZP7A 2F8EX 1TL3B 4RW7A 3BSCA 1FKOA 2VG7A 3DRSB 3M8QA 1SV5B 4J9SA 3TQ1A 2I1RA 3LP2B 3RB6A 1Z4UA 4KV8B 4KFBA 5KG0A 2HNZA 4RW9A 1LWCA 3DLEB 4KKOB 5K14B 3QIPB 1C0TA 1JLEB 1FK9B 2RF2B 2FVCA 5KFQA 3DM2B 1S1XA 1TKXA 4KSEB 4PUOB 5F9NA 3CJ0A 4IR9A 4DL3A 2UUWA 2FLNA 2R2RA 3QZ8A 3MR6A 4FBUA 2E9RX 3V6KA 4QW8A 4I2QA 1TKZB 5KFJA 3DRRB 4ED2A 1C2PA 1K1SA 1JLQB 1RTIA 4IDKB 2WCXA 4NLGA 3QIDA 2FLLA 5KFGA 4EO6A 1SUQA 4ZP9A 3MTKA 3V81B 3JYTA 4PQUA 3DMJB 4ECVA 4RUAA 4ZVEA 5KFOA 2WOMA 4EO8A 4XPCA 2R8KA 4H4OA 2OPSA 5KFUA 4IR1A 3KHHA 1JLGA 4ZHRB 3NBPB 3DOLA 5KFTA 1NHVA 1IKVB 5DLFA 2W7OA 3CJ2A 3KLGA 1QE1B 2OPRA 1LW2B 1JLAA 3PJXA 2BRLA 5C24A 4R8UA 4NLUA 1C1BA 3QZ7A 4ZVFA 2DPJA 3HHKA 1S9GB 1RAJA 5KG1A 1MU2B 1S6PA 3CVKA 2BANA 1UWBA 3KHLA 1TL1A 2VA3A 4FS2A 2EC0A 1S1TA 3KLEB 1S97A 3T1AA 4O44B 3H2LA 3BQ2A 3MEGB 4JUZA 2V0NA 3N6LA 1S4FA 4F4WA 4TY8B 3GIIA 5EWGA 3KLFA 3RAXA 2W9BA 2VG6A 5KT3A 4O3SA 4ECQA 4DL2A 2HMIB 2GIQA 3T5HA 1LWFA 4WFYA 4MK7A 2VA2A 4K4ZA 3H4DA 1T03B 1S9EB 4DL5A 5L1LA 1S0NA 1RT4A 3MEEA 3GYNA 4Y34A 1HQEB 2HNYA 3KLVA 4DG1A 5L1IA 4EYHB 2IAJA 4J9LA 5KG5A 1RTJB 2V9WA 1IKXA 4F50A 1RT6B 4EBDA 4R0EA 2J6TA 1RT5B 1YVFA 4ED3A 1JLBB 3DI6A 2E9ZA 4YMEA 5C42B 3DLKA 4B3OA 5CYMA 3M9MB 2D7SA 2D3UA 2RDJA 3EPGA 5DG7A 2BQUA 1WNEA 3RB0A 1XR6A 3OL7A 4NYZA 4I2PB 2YNHA 3TVKA 3LP0A 5J2PB 3RBDA 2OPQA 4URGA 4YP3A 3M9NB 3UPFA 4TYBA 4Y2CA 5DLGA 3E01B 3PW2A 4NLPA 3IG1B 3FFIB 1S1UA 5HP1A 4RUCA 3BQ0A 4ECRA 4ED8A 1T3NA 1C1CB 1RT2A 2CJQA 4MFBA 4IFVA 3DLGB 4Q8EA 1BQNB 1EETA 1S0MA 5KFDA 3PJWA 2B43A 3Q8SB 2XI3A 4MK9A 2YNFB 1N6QA 1IKWB 1SH2A 2WRMA 2XCPA 5F8NA 5J2NB 2FVSA 3MEDB 4NLTA 5KG2A 2B5JB 5L1KA 1XR5A 2IMWP 1MMLA 2RDIA 2ATLA 3KK2B 1JLFB 4WXWA 5F9LA 1S1WA 1RTDA 3BGRA 1RA7A 4WE1A 5KG6A 1DTQA 5KFSA 2JEFA 3OL9A 2C2RA 5DQGA 4Q44A 3IRXB 2IM0A 3T19A 4DEZA 4U7CA 2FVQA 1HMVB 3DYAB 5KT7A 5F8HA 2UUTA 2W9AA 2ALZA 4G1QB 3CJ5A 2B6AB 3C6UB 2R2UA 1T05B 4O4RA 1QAIA 5F8MA 4IRDA 3ITHB 1TVRB 5J2QA 3I0RA 5HROA 3PW7A 1HNIA 3KMQA 2XCAA 4ZP6A 3CJ4A 5JUMA 3FSIA 4NLOA 3QLHA 2UVUA 2D3ZA 2YKNB 4F4XA 4ICLA 4ZPCA 2ASJA 4NLQA 4I7FA 5FDLA 4LQ3A 3DOKB 2FJXA 1U09A 4GC6A 2IC3A 3V6DA 3UR0A 3CDEA 2ZD1A 3ISND 4RW8B 5HLFA 3OHAA 3NAHA 1RTHA 4RNNA 1LW0A 4ID5A 1QAJA 3E51A 5KFRA 3T5JA 3PW0A 4LSLA 1JLCA 2WB4A 4KBIA 3M8QB 2AX0A 4QW9A 4RNFA 1R0AA 4YR0A 2I5JA 1DTTB 4LSNA 1HYSA 4RW9B 4H54A 4TYAA 4Y3CA 3PW5A 4Q8FA 2R8IA 1RYSA 5KFBA 1N5YA 1JKHA 1IKYB 3H5SA 1TL3A 1RYRA 1KHWA 1S1XB 2CKWA 4PWDB 3DRSA 1I6JA 1SV5A 4ED0A 1RT3B 3LP2A 4KV8A 4KAIA 1LWEA 3DLEA 4KKOA 3ISNC 1HQUB 5K14A 1JLEA 2RF2A 1FK9A 3IN5A 3BJYA 4IG3B 4DL7A 3DM2A 1NHUA 3PW4A 4NLDA 3D5MA 3PZPA 2R8GA 3QGIA 3FDSA 3H98A 4PUOA 4J9QA 1N4LA 4JV2A 3D28A 4YR2A 3CDUA 4PQUB 4O3RA 3QO9B 5KFZA 3M8PB 3IS9B 1KLMB 3C6TB 3DRRA 1TQLA 4H4OB 1JLQA 3MECA 2YNGB 4IDKA 3BQ1A 4NCGB 3V81A 1IM4A 1HNVA 3DMJA 1W25A 2E9TA 2ZE2B 4XPEA 5C5JA 4X2BA 3OL6A 3IGVA 1DLOB 3LAMA 4RNMA 3KK3B 3JSMA 4QWDA 4RW4B 5EWFA 3PR4A 1IKVA 3KHGA 5KFEA 3QGGA 3NAIA 3KLIB 1S6PB 5EWEA 2R8JA 1LW2A 4J9RA 1TL1B 3OSPA 1S1TB 4ECYA 1S0OA 4KO0B 4K4TA 2W9CB 1S9GA 2BR0A 4ZPBA 2FVPA 1KHVA 4RZRA 2XGQA 3KLHB 1SH3A 2XWYA 4WXOA 3KLEA 1HARA 1VRTB 2VG6B 5D3GB 3CIZA 4HYKA 4O44A 4TY9A 3GV7B 2RKIB 3MEGA 3CDWA 1S10A 4IQXA 3M9OB 1J5OB 5KFCA 1RT1B 4TY8A 3I5CA 3MEEB 4KHMA 4ZVHA 3H5UA 3RB3A 3NL0A 4WZQA 1HPZB 4DG1B 5T14A 2IAJB 3DRPB 4ZMMA 2HMIA 4TLRA 5HBMB 1CSJA 2R2SA 3PR5B 4ECWA 3TAMB 5KFIA 3PVXA 2BRKA 3ICLA 4ZP8A 2XGPA 1S6QA 1S1VB 3DI6B 3I0SA 1HQEA 2WONB 1S48A 3LANA 1TV6B 1RT7B 3MR3A 3KNAA 3CJ3A 1RTJA 5KFFA 4K4WA 4IG0B 2DPIA 1RT6A 3N6MA 2OPPB 3UQSA 1RT5A 2BE2B 3LP0B 2FJWA 2V4QA 1JLBA 5KFLA 5KFYA 5KT2A 5KT4A 1NNDA 5KT6A 4YQWA 2W7PA 3H40A 4LQ9A 5JXSA 2IM2A 4RU9A 4I2PA 5CYQB 1RT2B 2IJFA 5J2PA 5KT5A 3LP1B 4QPXA 4RW6B 3Q8PB 2HNDB 1VRUB 1TKTB 4H4MB 2W8KA 3Q8QB 2IJNA 3T5LA 4URSA 4FS1A 3RBEA 1BQMA 1REVB 3FFIA 3IG1A 4HKQA 4XO0A 1C1CA 1C0UB 3I5AA 2YNIB 3SFUA 1BQNA 1ZTTA 3GQCA 2YKMB 3HVAA 4O3NA 4ECXA 3KK1A 2YNFA 1ZETA 1IKWA 4WE1B 4NLSA 1DTQB 2UVVA 5J2MB 4Q0BA 3EZUA 3MEDA 3QGHA 4ZVGA 4NLVA 2B5JA 4IFYB 4O4GA 2HWIA 3Q8RB 2C28A 4NLWA 2J6UA 3KK2A 4F4YA 2ASLA 1JLFA 5C25B 4M95A 3KHRA 5KFHA 2HWHA 4KB7A 4QWCA 1D0EA 5I42B 5F8IA 3GV5B 3IRXA 5J2QB 1HNIB 3G6YA 4MKAA 4NRUA 2XC9A 4EBCA 1HMVA 1FKPB 3DYAA 1N48A 1EP4B 3OL8A 2IM1A 5L1JA 4K50A 4G1QA 3V4IB 2B6AA 3C6UA 3HVTB 4IRCA 5I3UB 5KFNA 3ITHA 4EBEA 4WZMA 5KG3A 5J1EB 2AWZA 4R5PA 3MF5A 4IKAA 3KJVA 4RW7B 2HAIA 1FKOB 2VG7B 3MR5A 2YKNA 3H5XA 1GX5A 4WFZA
chains in the Genus database with same CATH superfamily
4KFBB 3ZXWA 1RAEB 2QLWA 4RLEA 2KHCA 1UPPA 4DHVA 2OH2A 4OHZA 3GIKA 3QIPA 1RTIB 1W2BR 3RAQA 2IYIA 3DOLB 2HHQA 5LJ3Y 1IBCB 2I38A 1NK7A 3CD0A 2MQMA 4X84A 4J91A 3FEYB 1HNVB 3MMBA 2DR7A 3TEHB 2WK4A 5E3RA 4B3TJ 3OR1A 2RJZA 1RWKB 2QL7B 1RWPB 4AE5A 2BBEA 1VLOA 3HJFA 3BR8A 2YKOA 4OHVA 1RU2A 2DEIA 3TX8A 4KT0C 1AFJA 1HLWA 1FWPA 4X66J 3SXLA 2RE1A 3FMBA 1O5JA 3H5YA 1VLYA 3MOJB 2QE5A 2YVSA 2PIIA 2VOPA 4IFVB 1NHKL 3B54A 3ZZ0A 5BR8J 2VBWA 4ELTA 4DU7A 2RHQB 1K1QA 4DZDA 1WSVA 2ILYA 5D0RA 2YX7A 3K2YA 4CTAB 5MLCV 2V94A 2AZ1A 3UCUP 2FYXA 1VR6A 1U2CA 3DLHA 3PFEA 3BSNA 1T8EA 3AAWB 2OHDA 3IFEA 4LSLB 3CWJA 3QJLA 5E3PA 4DR1F 2OTJS 1N5YB 1TL3B 4RW7A 3EX7B 3CJSA 3DLLQ 4M63A 3D68A 4E0DA 4DL3A 2R2RA 5LSOA 2UUBF 2LMIA 4QW8A 5KFJA 3QIDA 4CLLA 5D6GA 4X4TA 4K8RA 4HH1A 1IKVB 3VAMA 4H4KC 1N5VA 2QFJA 1IBKF 2DPJA 1U1LA 2F8MA 3SDEB 4L3NA 1RAJA 2F63A 3ZNUA 1VBZA 2A2CA 3ILJA 4NXMF 4FYVB 2XLKA 4FS2A 8AT1B 3H2LA 1GT8A 2W9BA 3R1HA 5EHHA 1X0PA 2VG6A 4ECQA 3H4DA 1RT4A 3MPDA 4EBDA 3MGJA 3VHQA 1WHVA 2B0GA 2OKQA 2AMCB 1H2TZ 2QSWA 1JWWA 1EETA 1JJCB 4M5NA 2XI3A 1IKWB 4DL0C 5RUBA 3R7BB 5EN1A 1S1WA 5DQGA 1SC6A 3TUIC 1N5QA 4JV5F 1SI9A 3DYAB 1VCTA 1W26A 2I0XA 2QMWA 1DAXA 2MQ8A 5ETTA 4B3MJ 1PO6A 1SIZA 2EFVA 2E5HA 4NEYA 2CZ4A 4RW8B 5HK4A 2GNKA 1CC8A 2V5HG 3M8QB 2XY6A 1EB0A 4Y3CA 4NYOA 2XZWA 2H54B 2OIHA 1FTRA 2P9GA 5JVGQ 3LP2A 4KAIA 3I55S 2GMHA 2R8GA 3UN5A 4F4KA 3IS9B 3MECA 4JI2F 4YFUA 4CP5A 2CQBA 1S0OA 4OX6A 4KO0B 4CT8A 3RTVA 4JI7J 5HMYA 4WXOA 3BGOP 3BKFA 2PEHA 3D1OA 3IO1A 4KHMA 4DPUA 1FD2A 1DJ0A 3PYGA 2BRKA 3QWPA 1HW8A 2J5AA 4C7QA 2ZVSA 4MAKA 2DPIA 2V4QA 3G8QA 1X0FA 3AOBA 1XN9A 1NDCA 1S59A 3GE9A 5CYQB 3D6TB 4QPXA 1PYSB 3Q8QB 2IJNA 1U8SA 3O2IA 3N4WA 5JVHQ 4DCJB 3MPWA 4C11A 5J2MB 2C28A 4D3GA 2ZUAA 3IXQA 3FEZA 5I42B 4Q5VA 4LF5F 3ENVA 1RSCA 8RUCA 5IT4A 1HMVA 1LK7A 3FUYA 1TKDA 2VG7B 2DNQA 4EK2A 4W90B 4D3HA 4ES1A 1VQYA 7FD1A 1VC0A 1ROFA 3OXFA 5I3PA 2Q6CA 2E29A 6AT1B 2LA6A 2Y1RI 2GZOA 1TKZA 4PWDA 1RCOB 1X4CA 4M5IA 2UUCF 1FJ7A 3H4BA 2OUGA 4LRBA 2GQQA 4ES2A 3C6TA 5F8JA 1YK9A 3JSMB 3GV8B 5D0EA 2PD1A 3TAQA 1LWXA 1MU2A 3AODA 4FXWA 3FBBA 1UEUA 2HVEA 1TMMA 3WHIA 2DGOA 2UVRA 1YX2A 3AJ1A 1BC6A 1DBDA 3BBFA 3D6FB 1S6QB 2UXBJ 5D15A 4YB7A 2CZ9A 2F4VF 5LMUF 1NZ8A 3KYLA 2RAQA 2HFUA 2G9OA 3B4DA 4QIVA 5HP1B 1RLDA 5CZVA 4MFBB 2M88A 4TXSA 3CW2C 3U1MA 4LIRA 3NKYA 4OX9F 2HVIA 4DV6F 1S49A 3RBZA 3C3LA 4HLBA 1H3DA 1REVA 1SL0A 3VF0B 4UUXA 1U0HB 4EGLA 3HZEA 4NLYA 2FHJD 4KE5A 1SKUB 2OEMA 3AT1B 4QWAA 3H2UB 1GH8A 3UWTA 3BBCA 2NR0A 1S6UA 3KDNA 3M2RB 1HYSB 4ZP7A 3EMTA 3RB6A 3AB4B 5HN0A 4KSEB 1LK5A 3RGIA 2FLNA 1R8AA 4UW2A 3T6BA 4MMOA 3L7UA 3D2WA 4DSIA 2HRYA 4ECVA 4RUAA 2EBGA 3UD4P 1E6VA 4A8FA 4ZVUB 2BJ9A 4X4PA 2XM3A 3NLCA 1HI0P 1QM9A 1YJ9S 2HFVA 2VPZB 3OXLA 3R3TA 2B3TB 4C3LA 2VL1A 2YWHA 4PQAA 4CM2A 1KRPA 2DNKA 2AEJA 2BANA 4USHA 4WWSA 4O44B 3M1VA 1S4FA 1R31A 3B4MA 2GIQA 2L08A 5L1IA 2IAJA 2M4MA 2B9EA 2XMAA 4K2XA 4NZ6A 4PR6A 1Q79A 1NH8A 3RBDA 2DGVA 1U24A 4B3TF 3SV4A 4RUCA 5C2CA 3C16B 4DS5A 5K8NA 4TU9A 5GADI 2FQQB 1TU0B 2RDIA 1XMOF 4DDFA 2NYHA 4F02A 2HLTA 4G1QB 3QT5A 4PEOA 3GYGA 4ZS6A 4ZP6A 3A8IA 2RNEA 2Y0BB 2UV8G 2MKJA 3UE2A 4RX6A 4LQ3A 4I0WA 4OZ0A 2NCKL 2BM0A 2EK1A 5DDPC 1TAQA 2K06A 4USVA 1N0VC 1HD0A 2RMLA 3GJTB 2HEKA 3GFZA 2RF2A 4DL7A 3D5MA 3QO9B 1PAEX 2OLWA 3MD1A 1HNVA 2WZ1A 2ZDPA 4RNMA 1VRQC 3TO8A 4YHHF 3QGGA 2CQ3A 1TL4A 1GNKA 1TL1B 1FNMA 5DETA 1RZMA 2ZH7A 2DCUB 3CCVS 3MXHP 1S10A 4QIFA 2X7IA 3N5FA 1SL2A 3GJQB 3IWXA 4R25A 1X5PA 1NJXA 3PR5B 2OJ3A 3PVXA 1RWMB 1FRKA 2DITA 3Q2SC 1T02A 1KN6A 2ZC4A 3HI9A 4UQGA 2B9WA 3LGMA 2BJEA 2XMMA 3I87A 4RU9A 1OY8A 5JJBA 1RT2B 1BXNA 2FPHX 1TUVA 1ZZFA 1C0UB 4NLSA 5IWAF 2XHCA 3MEDA 3KK2A 4QWCA 3IRXA 2E5GA 3MM5A 4NPOA 3EYZA 3HVTB 5GAHI 4F2RA 2QT7A 2XZDB 2FGCA 4O3QA 2HLUA 2BKPA 2LQBA 2AGQA 1VBXA 1U6ZA 3NGTA 2DXDA 3OT9A 4K4SA 4F0HA 2C2EA 3I9ZA 2J76E 3POTA 4X4RA 1HQUA 3CULA 3KLGB 2QLXA 2WVBA 1TP7A 1EHWA 4WP3A 4Q2MA 2W2NP 4B3MF 4O0IA 2IJRA 5IOLA 4UUWA 4JI0F 1VQ9S 1B3TA 3S1TA 4K7QA 4OZ1A 1N34F 3P3DA 4LF6F 2AJ0A 3IGNA 2QEXS 5KFKA 1NEEA 1SJFA 2XO7A 1S79A 1IXKA 3I0SB 4DV1F 1RBOB 1CBKA 2YWKA 4DX8H 4LFAF 2DGXA 3R9LA 3F73A 3J81j 4ZJOA 2VDIA 4AXJA 4H4MA 1TKTA 3KK1B 1VMBA 2DXEA 4NEZA 4O4GB 2GCFA 3RR7A 1YBUA 1SBRA 2IRXA 2IRYA 5FDLB 2HHSA 2JEIA 5HQLA 2ZD1B 4U95A 2UXCJ 1KVKA 3FQLA 4USKA 1HHSA 1CEZA 4RW8A 5B0GA 2MKIA 2QC3A 1ZS6A 2A10A 2ZOMA 3GPAA 1RBAA 3M8QA 4J9SA 1XMBA 3D0IE 1JLEB 1VQLS 2HURA 3VWSA 5HL7Q 1TKXA 3DNCA 2BOPA 8ATCB 1PC4A 1B0PA 4KGMA 4MT1A 2FUG9 1JLGA 1Y00A 4JYAF 2HHHF 1VOMA 5F0WA 3SQOP 2BRLA 2EFNA 2N4DA 3CVKA 3ZZUA 1V5VA 1S97A 2LVWA 1VQMS 2FZCB 4JUZA 4QR2A 4F4WA 1U1RA 3MM7A 4CLKA 2ADCA 4A48A 2J8SA 4NXNJ 3JQMA 2HNYA 1UWAA 2K7JA 2NSBA 3KLVA 3W5ZA 2DY9A 3TQEA 5AE1A 3OL7A 1RWOB 1C4AA 4CO5A 3HFVA 3E01B 3IG1B 1S1UA 5HATA 4KQZA 2CA9A 2O1PA 2CQGA 2QTWA 3OTOJ 2OD6A 2H1YA 1Y5NB 2HZAA 2LP4A 1IJFB 3I6PA 2GQCA 4OYIA 3BGRA 4M5LA 3T1HF 1WG5A 1HR0F 3TOQA 4GRSA 2UXBF 3FSIA 4B17A 4F4XA 1RWUA 1FVQA 2FLOA 4OYXA 5DM6Q 1TTHB 3WBZA 2YX1A 2Y9HA 1IKYB 1CJUA 1KHWA 1H2VZ 2CPIA 1N5TA 3DM2A 2KT3A 4A8KA 3PZPA 3D28A 4M5KA 3UNYA 2QN6B 2R7RA 4O3RA 1FNOA 1NK9A 4IDKA 1RWWB 1S76D 3NNAA 3HSGA 1T11A 3MD3A 3IGVA 3JSMA 1FD8A 5KFEA 3JAMY 1J5EJ 3GB0A 2ZM6J 2W9CB 3TR5A 3ET6B 5CZXA 3SBMA 4OI6A 3MEGA 3RZAA 1RABB 2BJ7A 2CPHA 3IR6B 3RB3A 1E6YA 3P49B 5T14A 2BE9B 3DOMB 3TAMB 1S6QA 1TV6B 3KNAA 2RQKA 5M2PA 5KAKA 1KKHA 1YJTA 2BXJA 3EZ5A 3PG9A 3LP0B 3C66A 4ELUA 2XMTA 5KT4A 2W01A 5D77A 4RPFA 2GGPB 3ULHA 2IJFA 4ZOSA 2ZBQA 4JI6J 4Y0FA 1ZA2B 1XMQF 2AT1B 4NLVA 4IFYB 2J6UA 2EFGA 3M8SA 1C4CA 4G1IA 1N48A 1FRMA 5L1JA 3U7JA 3SCKE 5LSRA 1HBUB 4I67A 4IKAA 2X1GA 4OI3A 4P7VA 2MXYA 3MR5A 2YKNA 4WFZA 1R0CB 3TANA 2DHAA 3HHDA 3W63A 3UR3C 3ISZA 2R7VA 1D9FA 1HD1A 1EQMA 2XMVA 2Z2MA 1U1MA 3P5TL 2YQ1A 1QVGR 3GIJA 2MQPA 4KR0B 4WIIA 2D3OR 3U1NA 2UU9J 3O6QA 2YNGA 2AU0A 2V4RA 2VBYA 2DXFA 2DO4A 4G3IA 3KLFB 1RU1A 4MIBA 1LWFB 1RWNB 2MPUA 2KRRA 1U8WA 4IH7A 2V8DA 4Z2XA 2JLEA 3NWRA 2PFFB 1WF2A 2LU1A 3CCTA 3BPSP 5CYMB 5L9XA 3HX9A 1OS5A 1PC5A 1ZA1B 2W2OP 5HSPA 4JOUA 4ZVTB 5H9FJ 1OIAA 4WP8A 2DRAA 3EXYA 5BXIA 3HSZA 2YQ0A 3EGWB 4MKVA 1FDBA 1RTDB 2XS7A 3MCSA 2HNDA 1HWJA 2QL9B 1FFSB 3OPKA 4M1KA 4DQSA 3QLHB 1H98A 3FEXB 4YR3A 1XR7A 1FNXH 3E3XA 4IOCQ 4YY3F 1NCLA 1T3OA 1IBLF 3GWCA 4O3OA 4ID5B 2JEJA 2MZ1A 1FKPA 2ACYA 2VG5B 3LO3A 5DG8A 2BVZA 3PX0A 2IMOA 2ROEA 4KKOB 5A0YA 3WDOA 4PUOB 3CJ0A 2GJFA 3L7PA 2O3DA 1C2PA 4B02A 1S0VA 3PCOB 2HFZA 2FLLA 2PMZD 2QFIA 3RAMA 3K8VA 2OPSA 3W66A 2YY3A 1WD6A 3MM6A 2CFXA 4U7UK 3KJFB 4NLUA 2MY7A 1TL1A 1EQ0A 3JB9k 1Q8BA 2CDQA 1LNQA 2V0NA 4QIEA 3CJTA 1H74A 2HHXA 5DDOC 5KT3A 4DL2A 4DPYA 2LA4A 3NGRA 4EYHB 1URRA 2JZ5A 1FRJA 2BQUA 2NREA 3R5DA 1MW7A 4YP3A 4TYBA 1M90T 4DUTA 1F2HA 3G4SS 1T3NA 4CNZA 1D9AA 1RT2A 2CJQA 1JB0C 2EW9A 4JI5J 1R8BA 1N88A 1NPPA 2CRLA 1KVIA 4LR7A 1N33J 2XG8A 1NLKL 4YB5A 4A8YA 5LMNF 2JL9A 2RH3A 4ENOA 3PYFA 3QNWB 4K2JA 2B4UA 2VPWB 4AD6A 4ED5A 2V2VA 5H9EK 3CDEA 4EU0A 4BC9A 1JLCA 2LXFA 4QW9A 3AY0A 5M2UA 2B9XA 4FF2A 3LA0A 4CLWA 4TU8A 4QIGA 3IN5A 3ZTPA 4DCPB 5HVFA 1N32J 4JV2A 5HVGA 4PQUB 2BZ2A 1SIWB 5K9FA 4U96A 2UXCF 4H4KA 1W25A 2E9TA 2ZE2B 3OL6A 3A8JA 1L3TA 1OSDA 4M5MA 4IOAQ 4K5RA 1H72C 4W98A 4K4TA 4Y28C 3PFOA 2FVPA 3RUBL 4A4JA 2RKIB 4ANDA 4IQXA 4HI2A 1HNWF 4WKYA 1UAWA 1A6LA 4DPWA 1S1VB 3I0SA 2M8HA 2CJYB 1L3VA 4P10A 1JLBA 5KFYA 2Y0SD 1XJWB 4LQ9A 4OZNA 1NK5A 4RR5A 4I2PA 3LP1B 1VQ5S 3CD6S 3T5LA 3P45B 3SFUA 3KK1A 2VD3A 2UVVA 4EWTA 4LF9J 2DYAA 3R5GA 4ZVGA 3THVA 3Q8RB 4O4GA 4NLWA 4ZA1A 5A8RB 5KFHA 1KR4A 1UA1A 4KB7A 3TUZC 2CJAA 1R8HA 2F9DA 2HS4A 4U7UD 1JJHA 1LWCB 1DHMA 5KFXA 3R27A 4ZPAA 2D1CA 1RA6A 2ZKUA 4YDDB 4NLRA 2H65B 3O8WA 3V4MA 5AXKA 3PV8A 4OYMA 2E1PA 3JYTB 5KFAA 4NYPA 1BWVA 2COLA 4AL5A 4ED1A 4X4QA 4MTPA 3M8PA 3PRBA 1KLMA 3K59A 2DGQA 2POKA 2DNZA 4RW4A 2AJQA 3A3OB 5FLXU 2EI5A 3QYYA 2VQFJ 3VGUA 3MFIA 2BDPA 2Q3PA 3OSNA 4DQIA 1JIHA 2Y1JA 3D0GE 3G6XA 2GC8A 2JC1A 1K0TA 4FPRA 4DR4J 1B4SA 3HSJA 5AXNA 3CJKB 2Z0GA 1PSDA 1T9WA 3CSKA 3PKYA 3E01A 4NI2A 3UDCA 2HKEA 3DDNA 2XSFA 3VAKA 1YG0A 1J5EF 3L4BC 1MN7A 4NCBA 2G1HA 1NMEB 2XTJP 5HROB 1NZAA 4M5DB 3TAPA 4PABA 2YBVA 2QSFA 5LM7E 1B0TA 3V6DB 2RQCA 6FD1A 1DURA 1TUGB 1YBTA 5E3CA 2PDAA 3CCZA 1QY7A 2XB2D 4OI2A 1UA0A 2CDRB 1NKCA 1R6VA 2DRDA 2BYCA 4DMZA 4I64A 2XQCA 5GMKa 4HHHA 3MR6A 1WF1A 4CH1A 4LF4J 3X1LB 3EDRB 3GLJA 3G96A 2OSRA 3NCRA 1LW2B 1HA1A 6FDRA 1RLCL 1L3KA 2EBEA 1S9GB 3OBIA 1CULA 4S0MA 3KLEB 3NGUA 4FYWB 3ET6A 4FKYA 2W25A 5A8KB 4MK7A 2VA2A 3KG1A 1HQEB 3BV8A 1DQ8A 2QL5B 1RTJB 1FHTA 3CDAA 2C2ZB 2KT5A 3RB0A 4FZVA 3LP0A 5J2PB 2OPQA 4V19X 3VZHA 4P75A 3FFIB 2MZSA 4QU7A 4QYRA 2GGPA 4OX7A 4DV3F 4DPOA 1S0MA 4USWA 2FVSA 1YJRA 2FC9A 5KG2A 4UT4A 3C14B 3M2VA 1UZHA 3IA0A 3MMJA 1RAOA 4ZCIA 3JTPA 3VGVA 5F8MA 3A13A 5HAOA 3I0RA 5CXTA 2HQ3A 1A0OB 2CWKA 1DQAA 4Q7AA 1U26A 3B6BA 5D4LA 3QT7A 3NAHA 1SQFA 4RW9B 2V69A 1S77D 4OHYA 3BH7B 2XMUA 5SUHA 2EFOA 4CYUB 2XYHB 3TEGA 2RQMA 4ZVOB 2Q66A 2KM8B 2CIMA 3ONQA 4KRWA 3GCWP 3BQ1A 5IV4A 4UF4A 4TVAB 3KK3B 4HT5A 4M8LA 5AE2A 4QPTA 4QJVA 1EARA 2VJUA 4DV4J 1JMTA 5I3QA 1LOUA 5DM7Q 1SH3A 1X5OA 3R6GB 2VODA 1QUPA 2J7KA 3IBCB 1F60B 1HPZB 4DG1B 2AHOB 3DRPB 3JS9A 3WC0A 2KI2A 4CWBA 2DEJA 3ICLA 1PJ5A 1CPZA 2F5GA 2XGPA 1GMVA 2ZKTA 3QFHA 3KTQA 4U8VA 2V34A 3MAAA 4OZ2A 1UJ5A 2WSEC 1VRUB 4ITSA 3CC2S 4FS1A 3J7AN 4XO0A 3W2VB 1U1KA 2HHWA 3GQCA 3CIMA 1Q5VA 4WE1B 1DTQB 2LXIA 4BWMA 2ASLA 1TK8A 2HWHA 4YS2A 3GV5B 5J2QB 2BKOA 3OTDA 1RAGB 1LFWA 2RRBA 2HIQA 2WVEA 3NNCA 1FA0A 5I3UB 5J1EB 3AD9C 4GVBA 1X4EA 2VDHA 3HHLC 1FJGF 2VG5A 4HVZA 1X4HA 4JI5F 1MWYA 2IVYA 3GP9A 2XEXA 3GFXA 5FIIA 1PGZA 1SUQB 1KC8T 1PYTA 1RT3A 4KHPJ 1NSAA 1LQ9A 1KLNA 3MOZA 4Q45A 3LH2S 1C1BB 1KWMA 2P5VA 1GXUA 3ILIA 2DHSA 2LDYA 1R8PA 4C3MA 1FDNA 2DISA 4NASA 4C0HA 1P1LA 1RHQB 3G86A 3A3PB 2DH7A 4A8MP 4C8NA 4OYZA 3PDNA 2ZNZA 4U6PA 1IKXB 3M30A 4J9MA 1N32F 1Y4ZB 5IM0B 5A8WA 3DGPA 1UPMB 3FRZA 4J9PA 5HBMA 3W2WA 2C2DA 4IUFA 4QBUA 2DNYA 2WONA 2VBXA 4PG6A 2IPOB 2K1RB 1BWEA 1M1KT 3KJNB 1HNXF 3C2PA 1VJQA 3BN7A 1VQ7S 4RW6A 1TL7B 3M4XA 3IRWP 3BN4A 2GVZB 2MEWA 2AGPA 4ICLB 3FMWA 3EVWA 1OQ6A 4I56A 2K7KA 1KQFB 2EPIA 5HLFB 2BE7D 4C8YA 2KU7A 2I2YA 2J9DA 2AJ2A 1SB6A 4LVOP 4B3SJ 3BR9A 2APOA 2XSJA 4PG5A 4UY85 2F8EX 1FRIA 2F4FA 2GO9A 3DRSB 3U27A 3G8SA 4QYZJ 4LSZB 5U47A 4I69A 4PQUA 4EO8A 4XPCA 2VPYB 4ZHRB 3CJ2A 4N47A 4HTIA 1RQ0A 5AE3A 5HO4A 3DFEA 3KJQB 4CO4A 1P9QC 4BS2A 3TUPA 2IDLA 1N36J 3HMJG 2H51B 4LRAA 5KG5A 2CQ0A 4QR0A 2AJ4A 3EPGA 1WELA 3CB4A 5LOQA 3PW2A 3HZGA 4LF8J 3BQ0A 4P2XA 4B9LA 1QDUB 4OZ5A 3CJ8A 5KG6A 1UVKA 1KONA 1X4GA 1M5PC 3NG8A 4LF1A 1RK8A 1T05B 5CHCB 4YB6A 3F0NA 2DR6A 3E8OA 3M8WA 4KGXB 4OIXA 5AXMA 3QFWA 2E7VA 2MZTA 4ZCKA 2E5IA 3PW0A 3BEGB 1YSJA 4KBIA 2I5JA 4LSNA 5B0BA 2R8IA 4C48A 2KFZA 4ED0A 2OMLA 2JDJA 4LF7J 1S57A 4DLGA 4IG3B 3FDSA 3HK2A 2MSSA 2ZEJA 4ZPTR 4OYBA 4ZIWA 3V81A 4OFZA 4DU8A 2LYVA 3PR4A 3KHGA 4J9RA 4DWIA 2BR0A 4DSKA 1NK8A 1I94F 4DLEA 1CJKB 2XWYA 5D3GB 2L9DA 3NL0A 3KDOA 1WJ9A 2R2SA 3M2UA 1VC6A 2RU9A 3R1LA 1RT6A 1PBUA 2DY1A 5KFLA 2MTLA 2XZTB 3AQOA 1AYEA 1NK4A 2DBBA 4G1PA 1WKJA 2AEMA 4J9UE 3NCPA 3G8TA 1RHUB 2YNIB 1BQNA 2YNFA 4XAKA 2KXFA 4M95A 4M5DA 3AFGA 1HNIB 1NBEB 3NMRA 4EBCA 1FF2A 1Y5IB 1K8AT 4DR5F 1UTAA 5K8MA 5FD1A 1Q53A 4QWEA 3DN9A 4C0OC 1KOOA 5CABA 2M5YA 1M5VC 3UCGA 4IH5A 1JKHB 5DGBA 2GJ2A 3ILLA 1S9FA 2HBQB 3EE3A 2VJVA 4ZLJA 3CO9A 1XERA 3D4JA 5F8GA 1IN0A 2WOMB 3NGDA 1HBNB 4P71A 1VQPS 1RAAB 4IRKA 2X1FA 2QLBB 1QSLA 3OUYB 1UWBB 4AFFA 2HHVA 1VGYA 4LFCJ 1EX8A 1X8DA 2FHKA 3PHEA 2ASDA 4F7VA 4OJ3A 3CCRS 2LLZA 4N41A 3BF4A 3BH6B 3KLHA 2FVRA 2MYFA 4ECUA 1QAYA 9RUBA 3CMQA 1RT1A 1YITS 2DTJA 2XHWA 2E1AA 1Q7LB 3S01A 4TLQA 4PG8A 3V6JA 5A76A 4CLTA 5DG9A 1V3RA 3F44A 2Q1LA 4FNHA 4NA2A 4JI4F 3GZ7A 3MMAB 4DV4F 1AZSA 2EEYA 4EEYA 1T9TA 1GEHA 2K3KA 2MLZA 3BSOA 4LVNP 3C14A 2UXDJ 3W7BA 2AX1A 4LR9A 4DZ6A 2B8QA 2CG8A 4CO2A 1YRXA 3BGLA 3HKZD 4QYZK 1VQ4S 4OI4A 4URQU 1SJ4P 4GKJF 2ZC3A 2ATCB 2R2TA 1RDRA 4JP8A 4F67A 2HRUA 5KG0A 2HNZA 4RW9A 3EDQB 5BJRA 2FVCA 1C0TA 2DR8A 4KTQA 4IR9A 5E41A 1JXEA 1S12A 1ITPA 4FBUA 1JLQB 4CYUA 2QYGA 5KFOA 2KN4A 2R8KA 4P6QA 2ZDOA 2NXEA 1NHVA 4OLOA 3QSYB 1JLAA 2CNNB 2W2QP 5C24A 1ZAWA 2Z2YB 3FZBA 2AD9A 4RU2A 1ACMB 2OELA 4B9UA 2HWTA 2VQEF 4FYYB 1N54B 2HBZB 5DDRC 1F0XA 3C15A 1UVJA 1F9FA 4WFYA 5J1PA 2CPYA 4DG1A 4RJVA 3GG1A 5C7PA 3D3BJ 4DSJA 3GJRB 4B3OA 3ETMA 2RDJA 1ZM3A 3TVKA 3F41A 3ZZZA 5T7LA 2XLIA 4K0KF 3HD2A 4ECRA 3OR2A 3FSYA 4QIWD 2FZKB 1FDAA 1RHMB 1PIEA 4P9SA 2XS2A 3W2VA 4B9VA 3DGVA 1MMLA 4WE1A 1DTQA 1B99A 5DJBA 1KDNA 4LRDA 4HHJA 4J7CA 3C6UB 1QAIA 1T9YA 3ITHB 5J2QA 3I4PA 2DKOB 4I7FA 3W64A 2NPIA 1NKBA 5KFRA 4HACB 5D4PA 4B9SA 1TMJA 4HDHA 2V4JB 1W7WA 3MM9B 1YJUA 4HDGA 1TAUA 1I6JA 1SV5A 2LQ8A 2KDOA 3DLEA 5K14A 2KO1A 3NWGA 5G0RB 1VIXA 1WEYA 3C46A 4N5SA 2DR5A 1P9YA 3QWUA 1VQ8S 3DRRA 2N3LA 1TQLA 2KZZA 4NCGB 5CYJA 4ELVA 4XPEA 1O0PA 5C5JA 1DLOB 3QPIA 3GG0A 2J0SD 1GTHA 4JI8J 4B3RJ 4FVCA 4LT6A 3PXGa 3KLIB 2DNMA 3V5RA 3OSPA 2V8VA 2J7WA 4ZPBA 3ZZRA 1H7WA 2GMLA 1Y0HA 1YZ7A 3OXGA 1CJTA 3CIZA 3JXOA 1IBMF 3GCXP 1NJIT 2OTLS 3H5UA 2L48A 5E2QA 2ZH4A 2PEBA 4ZP8A 1WEZA 2CPFA 1S48A 3LANA 4CCHA 1RT7B 3DC2A 5KFFA 2IFXA 2XS5A 3M7VA 2OPPB 1GFWB 2CJ9A 4CQ1A 2J9CA 3HULA 1NNDA 4MYUA 2WBMA 1OY6A 1T9UA 2K1RA 1F9EB 3HD1A 1C1CA 1RTZA 4HI1A 1P27B 3CUNA 1NAQA 1QD1A 3CC7S 2FHOB 1N36F 2GVZA 2B5JA 1S72S 2LDIA 1JLFA 2C3YA 2AIRB 2HQCA 3AOCA 2IM1A 1WACA 2Y8YA 2YH1A 1MWQA 4DV7J 1CJVB 4Y65A 1FJCA 3FSXA 4DR6J 2DGWA 2MQOA 3I56S 3WX4A 4AL6A 4NZ0A 2K3IA 1ZBTA 3O5TB 1XNQJ 4GMKA 4MJKA 4NA1A 5KG4A 3UCZP 4ZHRA 4MIAA 4XDCA 3H90A 2FTRA 1HBMB 2P9EA 3MZIA 2JLFA 4OX8A 2MSTA 1HWUA 3QRQA 3T41A 1HW9A 2HG4A 1ZH5A 3BYRA 4ZLPA 1EKRA 3WX8A 4ZVPB 1RAHB 1G2EA 3DLKB 2WB1D 3KOAA 1GMWA 2YNHB 3M6UA 3D6MB 1IR0A 1L3UA 4IG0A 3M6WA 2M8DB 4WIQA 1HI8A 4WFBQ 2VV5A 1ULRA 5LXRA 3PX4A 5F3TA 3P6YC 3TJ8A 3NP5A 4DV5J 3PIOQ 4OJGA 5CCLA 3J7ZT 2YKMA 2JHEA 3MMCA 3OFEA 1T05A 2R8HA 5ETLA 5C25A 1LXNA 2G2OA 1K9MT 1N56A 2GVDB 1RTHB 1LW0B 4ED7A 3FBCA 4CLYA 5ETKA 4B9TA 2W4DA 3TWZA 3CCWA 4X4OA 2H3EB 1FKOA 2HS3A 4KV8B 4CO3A 2VU5A 2FB0A 3CCES 1PJ7A 4CLFA 3OJSA 3L3CA 3ZTOA 4I2QA 1KNZA 4NLGA 2U1AA 5KFGA 2BEFA 2WVCA 1HL6A 3DMJB 2CQCA 2AYMA 4DV0F 4ZLLA 2KT2A 5DDQC 2X3DA 1SC1B 5KFTA 4X62F 2OPRA 1Z1ZA 2LQ9A 4R8UA 3US5A 4ZVFA 1OPZA 5KG1A 3BBBA 1AROP 4BBYA 2VA3A 5K8PA 2ALYB 3I32A 2ZH3A 3CCJS 1X4BA 4TY8B 1CJKA 4P2MA 4DQQA 2Z56B 2E1MC 3PJ9A 3TW0A 3OTEA 1WUUA 4Y2MA 1YVFA 4ED3A 1MMNA 2PN6A 3M9MB 5DG7A 2N7YA 4OYOA 2GX8A 3VAIA 4NYZA 1TK5A 2LKZA 5DLGA 4OV6A 2QLJB 3UVJA 1CC7A 5GVQA 2PMHA 1N6QA 4GVLA 5L1KA 1APSA 1MROA 3VQTA 1AFIA 3FJ2A 2GV1A 3K5MA 2X51A 1TVRB 1HNIA 1KBRA 2UVUA 2JVOA 4DR2F 5FLXY 4DUZJ 4RUHA 2IC3A 3OD2A 2KJWA 1Y3KA 2QGFB 1RE1B 4NWBA 5L46A 2DRBA 4RNFA 2AYEA 3PW5A 4Q8FA 4L6V3 1HNZF 1JKHA 4Z7CA 2UXDF 2E5LF 1FK9A 3BJYA 3SV3A 4A8WA 5T41A 2DJWA 1U1NA 3DDIA 2GJIA 4UY8T 4F3QA 3IC1A 2GHPA 3UDEA 1FVSA 3OR1B 2ZH2A 5LXYA 1ZOTA 1WTBA 4DQRA 2AW0A 1S6PB 2QA1A 2HGNA 5E33A 3FGVA 3MPUB 3LTOA 1YJWS 1Q8KA 1RCXB 5KFCA 2XNQA 4WZQA 3ENQA 2CXEA 3QBCA 2HMIA 3T1YJ 4LFBJ 5KFIA 1AW0A 2WSFC 1FESA 2PA3A 2IA0A 1RT5A 2QYCA 1SJ1A 3H40A 2EWHA 1PG5B 4W4MA 3ZTSA 4URSA 2N3OA 5CAAA 1SQGA 3TJAA 4HHUA 3OTBA 4CZCA 4ILRA 1P1TA 1H73A 1WC5A 2HAFA 4NL5A 3SMZA 4J5OA 4MKAA 2I9SA 1FCAA 5A2QY 2M52A 2B6AA 4JI1F 4RW7B 1WTFA 1UVIA 2C2MB 3EZOA 3DOKA 5CA5A 1NU4A 1TELA 3FZ2A 1RACB 1OY9A 2M2BA 2WTFA 1XC9A 2A0FB 3VTIA 4GKKF 1DTTA 3D1HA 5HVHA 4AQYF 3HVRA 1I1GA 3O3LA 1CLFA 3NGKA 2PO4A 2ZH8A 2NXUA 3NEKA 2W9BB 4F3MA 1PILA 1MWZA 3JTOA 7AT1B 4C8LA 4PPDA 1RT4B 4ECZA 2VFVA 4J90A 2JOQA 3UD3P 1VRTA 4LBHA 3ENAA 3A4TA 3CXCR 1J5OA 2V9KA 4EYIB 4DR1J 2C3PA 4Q43A 2JEGA 1EETB 4DXLA 3WZ0A 4J9NA 2GAHC 2BE2A 2JRSA 5F3ZA 3T5KA 5LSLA 3EPIA 1BQMB 2QMXA 1S1WB 3E2EA 1WOSA 4CH0S 2UUBJ 1RAFB 4K4UA 4V1Ak 4ATNA 1YRTA 2E44A 3BB5A 3HP6A 2HZCA 4XIUA 4X4VA 1SJ3P 1NRKA 5KOWA 1IBKJ 5GMEA 5EGYA 4RBUA 4X66F 1HWIA 5IC6B 3K5LA 4ZPDA 1EP4A 4NXMJ 3HHLA 2HGLA 3V4IA 1HHQA 3DU5A 3TVYA 1R8CA 1M5KC 3MM9A 1X7VA 3LP2B 2J9EA 5BR8F 4KFBA 1SQEA 1CS4B 1RTIA 2WCXA 2KRBA 3MTKA 2ZJPQ 4ZVEA 1PCAA 1DZ5A 3SQGB 3KHHA 4DF4A 3DOLA 4LF2A 2BW7A 2C1EB 3MM8B 3PJXA 3OVAA 3J80Y 2CJKA 3EUNA 1IWAA 1FI4A 2CZVC 4O23A 4DFMA 4JV5J 2W2MP 3ZTQA 3GYNA 5L39A 4OHWA 4J9LA 1R7IA 1XNQF 2E9ZA 5C42B 3N01A 1YWXA 2BOAA 1GAOA 2ASYA 4ED8A 2QLFB 4IFVA 3HFZB 3W5YA 3TA2A 2C3UA 4C11B 2B43A 2PI4A 4A8SA 4NLTA 2NZ4A 5F9LA 5SZTA 1X9WA 4FYXB 1HMVB 3IAM9 5KT7A 2HVDA 9ATCB 2W9AA 4Z37A 3PYEA 4CTAA 4NLOA 1G7CB 4FNIA 4E98A 1HKAA 1U09A 4X4NA 3Q8UA 1O6XA 3BM7A 4Y2IA 3T5JA 4LSLA 4C0BA 2KXHA 4YR0A 2P8IA 4H54A 3IBWA 3GYXB 1N5YA 1TL3A 2CKWA 4PWDB 1XK8A 3H2VE 5ETMA 4ZK7M 2NUHA 3TZXA 3QGIA 3R5JB 4N7TA 4C98A 2QO3A 5IZHA 3PO4A 3NS7B 3C6TB 1R3NA 2YKPA 2ZHOA 1FXLA 4I68A 3G82B 4ES3A 1YJ7A 2FJDB 2MGZB 3LAMA 2Z8QA 1IKVA 1VBKA 4DI6A 1HHTP 2B4OA 3SDEA 4RZRA 4DV2J 1VC5A 3GV7B 3W5XA 2YKQA 2MZQA 4LF5J 1OYEA 3IM8A 1MSWD 2VASA 2V68A 3S8SA 2GS8A 1F5AA 2VFSA 2OGUA 4Q2LA 1VJWA 1SKSA 3N6MA 4L72B 3CEDA 5EX0A 3JSBA 5KT5A 2CQ4A 4Z7YA 1REVB 4HKQA 2V8PA 5LT5A 1RHKB 2HK3A 3RBXA 3HSDA 4C8ZA 4CNYA 1IKWA 2UUCJ 1F2GA 1WOOA 4JI7F 3RW6A 3R2CJ 3CCUS 3IBFB 4NRUA 1RAIB 3DYAA 4A8OA 1ZPVA 4QR1A 1G4CA 5KFNA 2HBYB 3CCSS 5F41A 3PX6A 3RRGA 1ZTWA 3OLAA 1XBWA 4E8UA 4P73A 3ZNJ1 2P6TA 3SFGA 2VONA 2HS0A 2KVIA 1WWHA 3KUEA 4X64J 4OI1A 3QT8A 4Y2KA 3PYDA 1S5ZA 3PEJA 1QTMA 2A18A 2F4VJ 4F8RA 2ZH1A 2NSCA 5LMUJ 3L7OA 4MIWA 3HVWA 1KQGB 1VHFA 4DL4A 2EFQA 3Q89A 3IS9A 4KGVB 1Q8LA 4DUZF 1T7PA 2BANB 3LAKA 1Q95G 4DV6J 4DL6A 3JSYA 2FJAB 3M1VB 3N28A 1UW4A 4KYZA 5KFVA 2NYIA 5E7OB 3K8WA 3J81Y 2HYIB 4NRTA 4KO0A 3SSSA 2VHGA 4FF3A 2EG2A 3MHYA 2UP1A 3LQVA 2KTQA 4YN3B 4CRJA 4M94A 1X60A 3B78A 1N0UA 2FHMA 2CNOB 4WU2A 2VICA 1V6HA 4F0KA 4PZVA 2QX0A 1N5SA 5CYQA 1BHNA 2C2KB 4Y2AA 3GONA 4YOEA 4JV0A 2M3DA 1EIYB 3OFHA 3AJDA 4YEAA 1NSQA 5J2MA 4ZKAA 2BQ3A 2BMBA 2H48B 1TVRA 3HHEA 1KQKA 4O3PA 4ETZA 5I42A 2ZJRQ 3ZTRA 2V2ZA 1HBOB 3PHTA 2Z2LA 5KTQA 4CO1A 1NDKA 1VISA 3EICA 1LFPA 3W1YC 2VG7A 1GXLA 5EX3A 2RF2B 5I4MA 5KFQA 3I4HX 3W8PA 3M6VA 2Q43A 1IQTA 2BACA 1FEEA 2KHDA 4F26A 4TKTA 1WHYA 3TARA 1OPIA 3FK4A 2CQ1A 5KFUA 1YBAA 5DLFA 2W7OA 4OYWA 1WI6A 1S6PA 5D4NA 2KG0A 3HDSA 1M5OC 5BYQA 1XMOJ 2V63A 3Q2TC 1S7IA 3CGIA 3T5HA 3QATA 2H4WB 2XO6A 2QA4S 4Y34A 4F50A 2HW3A 4OZJA 3DKDA 3EGZA 1PYOB 4URGA 1F3FA 1F5BA 2AJFE 4EZ9A 4C8OA 3Q22A 5HP1A 1M5SA 4MFBA 4K5SA 2RSQA 5E5NA 3MEDB 4WU3A 2ATLA 3KK2B 4N8OA 1QVFR 3OL9A 3IRXB 5F0UA 4WTYA 1X4AA 2F1FA 4U7CA 1URNA 4DFKA 3MM5B 3CJ5A 2R2UA 4FXVA 4O4RA 2HIYA 3D54A 3BGFA 3CJ4A 1U0HA 1G6BA 4BC7A 3L09A 4YHHJ 4ZPCA 3ZZYA 3BO3A 3J7YI 1YZ6A 2RT3A 3E51A 5IQQA 2AX0A 3M2RA 1OYDA 3GIRA 1HYSA 2G2YA 3S7RA 3THPA 2FZGB 1RYRA 2JX2A 1S1XB 3HCXA 1TR0A 3POTB 1Q7YT 3ISNC 1HQUB 2W24A 4L3KA 4DOZA 2V67A 5GADU 2BABA 1Z2LA 3G87A 2RQ4A 1VK8A 4H4OB 2B4VA 1M1HA 2QZ8A 2B8PA 1N52B 4X2BA 1U47A 3R7NB 2KM8C 1KFSA 2ZH9A 3TZWA 4M5GA 1U4BA 3GJSB 3JQJA 4FKXA 5DZ6A 3BS9A 3FCVA 5IWAJ 3IR5B 4EFAC 4O44A 2ZZNA 3CDWA 4ZVHA 1RBLA 4CM0A 2VFRA 2DCLA 3K0JA 3SSRA 4K4WA 3UQSA 1W2IA 2EFPA 3Q8VA 5KOXA 2LEPA 1FX2A 1NSKL 4H4MB 1TKTB 1BQMA 2C3OA 2MKSA 3VZIA 3C16A 4ECXA 3MUTP 3G9CA 1NK6A 2KL8A 4JI3J 3LGNA 2JNJA 5AJ3J 3M05A 4P2SA 3AA8A 4GO7X 3G6YA 3R6LB 4X4UA 4G1QA 4WCEQ 2FHJA 2AWZA 4JI0J 3JTNA 2F65A 2HAIA 2YKAA 2ADBA 4NZ7A 2FY8A 5E3QA 1N34J 3K89A 1R0AB 1TKXB 1WHXA 5B0DA 4LF6J 2HFOA 3LWMA 2CAJA 3KKFA 1RGVA 3QJJA 4YDXA 2DO0A 1O51A 3R5CA 4PWWA 1CS4A 1JLGB 5A6PA 4WFXA 4DV1J 5GAEI 2AYBA 3SQGA 4ANCA 3BGUA 5IC4B 3QO9A 4USMA 1OSCA 3SI8A 4WJBA 4LFAJ 3MM8A 4DF8A 1K0VA 4ZIVA 4TN2A 3GSIA 1JNRB 2D41A 4FDFA 5GAHU 3MM7B 1NSPA 7FDRA 3QJPA 2W4CA 4UOFA 4WPAA 4U9RA 3NMAA 5GAGI 2HNYB 2CPZA 1M1GA 5C42A 2WHOA 2AQ4A 1S1UB 5KFPA 4E2FB 1U25A 3NS5A 2ZBPA 2PSZA 3HJVA 3CCLS 2PC6A 2DNGA 1OMSA 3EXCX 4RNHA 2A6MA 1FFWB 3HF5A 4NA3A 4ED6A 5L38A 2CNKB 5HMXA 3BGRB 1FX4A 2R7UA 4DV2F 2VFUA 1X5TA 1U1OA 1PKUA 1C0UA 4MK8A 1L5UA 2M0GB 3FBFA 4JYAJ 4DN0A 2HHHJ 4WYLA 2XMKA 4ETXA 2R7SA 3KUGA 3R5BA 3HVTA 3H25A 2ZZTA 3JSRA 1CJUB 2KH9A 2KFYA 4PAAA 1KD1T 3DM2B 2M70A 3CCQS 2E9RX 3V6KA 3CMAS 4MKYA 3IWNC 4IDKB 2KYZA 1Z2ZA 2RU3A 1K47A 2D3O1 3NBPB 5E0OA 3KLGA 3M6XA 1QE1B 3G82A 1DRZA 2MGZA 3VAGA 1Q0NA 4LBPA 2YWGA 3KHLA 2CPDA 2F7VA 3MEGB 1TUWA 4V19J 3GIIA 5EWGA 1E6YB 4I6AA 3T1HJ 4X64F 1HR0J 1SKWA 2KB2A 3D9BA 5L1LA 2Y3YA 1JQGA 2YWFA 3ELHA 1RUSA 1NPKA 2J6TA 2V2QA 4YMEA 2D3UA 4IO9Q 4DFPA 3IAS9 1NKEA 3VVTA 2Q6BA 3M9NB 2QA4G 2XMJA 4Q8EA 3Q83A 2F3JA 4OJ1A 2J0WA 1ELOA 1KVJA 1NXIA 3CJQA 4OZLA 1S7HA 2C2RA 2IM0A 2KVQE 5B0EA 4WKRA 3TRGA 4NXNF 3AH6A 2YKNB 3QT6A 5FDLA 2R7TA 1VI7A 2ZD1A 4CLSA 1R89A 1QAJA 1RISA 3I31A 4ZN1A 3CMES 1RJJA 4U8YA 2UZAA 4ZLNA 2LU2A 3BDPA 1UCNA 1UETA 3OTOF 4WTOB 1JLEA 3JQKA 3A3NB 4OJHA 3H98A 2VH7A 3X3UA 4DJBA 2VBZA 4PCQA 5KFZA 2CYYA 3VGSA 2YNGB 1Q5YA 2I6WA 2FY1A 1U2RA 4P52A 1F6TA 5D4OA 1UVMA 5EWFA 4FP9A 5EWEA 1YJNS 2DNHA 5HMZA 4F36A 1XMQJ 1U2FA 2JLGA 2LXUA 5GMDA 4LRCA 1KHVA 1PBAA 2XGQA 3PRVA 1TFWA 2ZJQQ 5L9NA 4QQBA 5H9FK 3QRPA 2AYGA 2XY5A 3LPEA 4BWJA 4P7TA 4ECWA 2IHR1 2C42A 1NO8A 4X65J 1IUJA 3PEHA 3TUJC 2H4YB 2HK2A 2V50A 1ZZNA 2GFFA 3HM9A 2EC2A 3OFGA 5KT2A 2HFNA 2LEAA 1IVZA 2FJEB 1RB0A 3UW1A 2HNDB 3Q8YA 3IG1A 2R7XA 2DIVA 2PE8A 2R3VA 2ZM6F 1ZETA 1EAYC 2FIUA 3EZUA 2HWIA 3CC4S 4CDIA 3MPYA 1FWLA 3LUYA 2ABYA 1FKPB 1IQZA 2DIUA 2XWXA 2BW2A 4WZMA 1GMUA 4ED4A 1HBOA 4G65A 2X1BA 3R8YA 5A0YB 3PNIA 2FD2A 2NS1B 4X4SA 4ECSA 1EJ7L 1QTNB 3GFYA 3OHBA 4JI6F 1LWEB 3QGPA 3KMSA 1IKYA 3VQSA 2OPSB 2GHVC 3MM6B 3FQKA 1WF0A 3OW2R 5K20B 3KWMA 3AD7C 3WQPA 1FERA 1B70B 2GIRA 3J7YU 3ADAC 2RS2A 2YTCA 5CQGA 3DLJA 2HBRB 2FLPA 2ACMA 3CJRA 2BJDA 3FBEA 3WIVA 2W9CA 2H5EA 4A46A 3MCMA 2OI2A 3H7HB 1NB2A 3AA9A 4YY3J 1IBLJ 4PG4A 3L95X 2GAGC 3DOMA 2HFSA 1TL5A 3TAMA 2NPFA 4KY3A 1A9NB 3GR1A 2EKNA 2ZFHA 3UI3A 1TV6A 1H6KX 3TP2A 4DFJA 5IXUA 1GQEA 2UU9F 1WC4A 3V2UC 2DH8A 1UEVA 3MAHA 2OFHX 2MMYA 4ID8A 3DDKA 4Q0BB 3EJMA 3LF0A 4N76A 2IA6A 4ALZA 2C22A 4N77A 4KHRA 2VKZG 3AHPA 4IFYA 4MH8A 3G2XA 3W61A 2CQDA 4OZ3A 4LJMA 5KG7A 1JLCB 3NS6A 2L9NA 2K2PA 5ETVA 4DX6A 4FN5A 1HBUA 2HVZA 4C97A 3SSQA 3K17A 4EI2A 1Z4UA 5CH7B 2VIHA 1S1XA 3LGHA 2MKKA 3BDEA 2W7AA 1DFDA 3TA0A 4JI3F 3P4UB 4ZP9A 1IR1A 1YQHA 3Q24A 3Q86A 5AJ3F 2YPYA 1IR2A 4H4OA 4IR1A 2GQ2A 1YIJS 1VDHA 4EZ6A 3VCDA 1TK0A 1HWLA 2NQPA 1KTVA 3DXBA 1VQOS 3HPOA 1UJ6A 2EC0A 3BQ2A 4CIOA 3GTYX 3IWLA 5LMNJ 3KLFA 5ETPA 4A8QA 2B4PA 1LWFA 4K4ZA 1T03B 1S0NA 3GSDA 3NRBA 3A1YG 3VAJA 2QJ3A 4R0EA 2BJ3A 1JLBB 5GAEU 4C8KA 5CYMA 4DSEA 2HHTA 1J2VA 4I2PB 3VGTA 4Y2CA 2VUGA 4F4AA 5BYRA 3TA1A 3J7Z5 3SCLE 4DX7A 3Q8SB 2MHNA 4F3OA 4WXWA 5GAGU 1RTDA 3W3SA 5DRKA 1N8RT 2FVQA 1LEOA 4PYDA 4XK8C 2D9OA 3MCNA 3PW7A 3KMQA 2XCAA 2VF3A 3QLHA 2QIFA 2ASJA 2JFKA 2LEBA 3H0PA 3OHAA 2RIJA 4ID5A 2E5JA 1OO0B 1FRLA 1R0AA 1RYSA 1S6OA 1U6BA 2FGOA 3H5SA 3HFKA 4TNOA 3CTRA 1HNWJ 5HJXA 3I96A 4KKOA 3NNHA 3PM9A 3PW4A 4NLDA 1N33F 2DB1A 4PUOA 3M8PB 1KLMB 1H7XA 1K73T 1G3OA 3KFWX 1KTQA 4RW4B 4OV1A 1TFYA 5AT1B 1S1TB 4ECYA 3UN3A 3BO2A 3WC2A 1WSRA 5IT9U 3W60A 4ZMMA 3PO5A 3CCMS 3DI6B 1FT8A 1RKIA 3MR3A 2C3MA 3PY8A 4M5JA 4NI2B 3GR0A 2CJBA 3TZYA 2OAUA 2W7PA 1NJWA 3SEOA 4CLPA 2R9LA 1AB8A 1U6FA 3MEKA 2AZ3A 2A3JA 1WC0A 2DNLA 3HVAA 4KGKA 4EMDA 5IV3A 2Z4PA 3CT9A 1BUXA 4A47A 4HH0A 2WSCC 4N56A 2W4PA 1K44A 4UZCA 4KIAA 5D8HB 4I4BA 2KFNA 3MF5A 1GX5A 2IDEA 4K4VA 2B51A 2UUAJ 1NB7A 1YKWA 1WDDA 2CJXB 3MWBA 3RB4A 2P9CA 1UL3A 1UKUA 4N8NA 1I5OB 5H9EJ 1OWXA 4FF4A 3KXDA 3MCOA 2A6OA 4LF9F 2CPXA 4DCOB 2FC8A 3ZO7A 4K4XA 4TQRA 3NBPA 3MAQA 1QE1A 2G1DA 2AF6A 1CULB 2DNNA 1V5IB 2ILZA 3MI7X 4IH6A 2ZE2A 5F8LA 2DT9A 5A6WA 3NOCA 2U2FA 2Z58B 4BDPA 4JV1A 4USJC 3FCHA 3U02A 4HT7A 2E7XA 1R0BG 5HMWA 4FYDA 2B7CB 1R27B 2RKIA 2QG9B 1R43A 2OPQB 5DQHA 3I5BA 1OJ4A 5DQIA 1S1VA 2CWXA 3I9V9 2IVFB 2H5JB 3NXZA 3TYTA 4DR3J 1ZAXA 3M2VB 2ZHBA 2DHHA 1XIQA 4M5HA 1D9DA 3LP1A 1JX4A 1F3VA 3D0HE 1BQXA 1T94A 3I0RB 4KJIA 2VQFF 3PACA 1QSSA 5KFWA 4X65F 5A8RA 1JXLA 4PXBA 3KJVB 1FO1A 3HLUA 4DR4F 1Q1KA 3D1QA 1XNRJ 4F25A 4QZVB 2JH3A 3TQ1A 2I1RA 2CNLB 1LWCA 4ZJLA 3PIPQ 1T9XA 4NMLA 2Z57B 1RADB 2MKCA 4I6YA 2UUWA 1WHWA 5B08A 4ED2A 2ZH6A 3G71S 4EO6A 4ZCLA 3JYTA 3D66A 5G4DA 1JJ2R 4CLUA 1LV5A 2VB6A 1DQ9A 3SYZA 1SPBP 4DV3J 1Q16B 1D09B 2MZRA 3QZ7A 1FFGB 4UOCA 2MB0B 1HI1A 4QOTA 3CD5A 3GMGA 5CD4H 2NUUG 1VS3A 1WOPA 4IO1A 2B7BB 3DU6A 1S9EB 2EK6A 3IP0A 5B0AA 4UOHA 4WFNQ 2RD5C 1WEXA 4LF4F 1UFLA 2IRUA 3MAAB 1WNEA 1UP1A 3ENWA 2ROGA 3LOUA 4OLPA 2OMOA 3CJKA 4AXIA 1I3OB 2QA2A 3DLGB 5D78A 5KFDA 1SCJB 5J2NB 3SCIE 1XR5A 1YTYA 3T19A 1IWGA 4PRFA 1KSPA 2RVJA 2ALZA 1L3SA 1MNEA 4IRDA 1D8YA 2ZZMA 5HROA 1FWKA 4GVBB 2LQ5A 2MHEA 2D9PA 5C2GA 1KFDA 2BJ1A 1DY3A 1UFKA 4GC6A 3V6DA 3UR0A 4OMFG 1X9MA 1S99A 2XNRA 4DN9A 3T9ZA 2WB4A 4TYAA 1QSYA 5KFBA 1SKRA 3K58A 1RT3B 1LWEA 1LXJA 2FJBB 4AL7A 2ZH5A 3VVUA 3LPYA 4J9QA 1N4LA 1GTEA 4YR2A 4NX9A 3HXMA 4NMXA 2ZVIA 4WF9Q 4USUA 1LW2A 3Q23A 1B7YB 1S9GA 2VOOA 4GO5X 2YXLA 3M30B 1KOHA 3KLEA 5A8WB 4UTGA 1SXLA 3DGPB 3OFFA 3MEEB 2O66A 1KQSR 1UZDA 5A8KA 4AYBD 5HBMB 3W2WB 2DNPA 1R6YA 1HQEA 2WONB 2N4CA 1WORA 1RTJA 2ZHAA 1FJGJ 3RG6A 1RWXB 5KT6A 4YQWA 5JXSA 4CH7A 5J2PA 5IFMA 1X9SA 4RW6B 3Q8PB 1U1PA 2HPUA 3FFIA 2NZCA 1T95A 1WG4A 2N7CA 4YUDA 2YH0A 2H9ZA 3SCJE 4RBTA 4C9DA 4Q0BA 4KPYA 3QGHA 1M0SA 4F4YA 5K5MA 1D0EA 1QLNA 2MKYA 2A2DA 2KZMA 1AA1B 2XULA 4IRCA 2XSJB 4ZJQA 2RHSB 2EVZA 3Q0AA 1SC4B 1O8BA 2HHUA 2CVIA 2OSQA 3VR1A 5E3AA 1VHIA 4ILLA 1U0SA 3DCAA 2KG1A 2GHWA 4PXDA 5D0HA 5ADZA 3AOAA 3ZZTA 4J9OA 1X31C 3G6VA 4MKBA 2J0XA 2RILA 5LL6d 2W8LA 4P74A 2AGOA 1KEKA 1JK9B 1MN9A 4MYTA 1HNXJ 2SXLA 3H59A 1NK0A 2GA7A 4OYPA 3BREA 3KK3A 4KH0B 1U48A 2JFDA 1V3SA 1I51B 2B9YA 1T03A 3P96A 1SH0A 2WVDA 4TQSA 2X3GA 4KHPF 3FVYA 1HPZA 1VQSA 4BLGA 3DRPA 3I82A 3FC9A 1NDLA 3D7SB 1CVJA 3CDBA 1JJ4A 3UDLA 4RKUC 1ZM9A 4RO0A 1GXTA 3N6NA 1REGX 2ZUGA 1UEKA 4ECTA 3KUHA 1NPRA 3M32B 2VFTA 2MDAA 1VRUA 2KKHA 3KG4A 4AT1B 4LR8A 4Y6IA 2VZ9A 1MMDA 3N0VA 3IM9A 2JC0A 1AT1B 1NH7A 5K8OA 1TZ0A 4ZDNA 4ANEA 3FCWA 1LKZA 2UVWA 3MR2A 4CT9A 4R5PB 2G4BA 4DUYJ 3K5OA 2I5JB 4LSNB 3W9JA 5I3UA 5J1EA 4U67Q 1XEZA 4DR7J 5HI7A 3TVZA 4L73A 1BE4A 3QQCD 1CQNA 1IJEB 1SUQA 3S6EA 3V81B 2HZVA 2HQDA 1RHJB 4C8MA 5JMNA 3NGSA 2X1AA 1JXVA 1U45A 2CQPA 2DK2A 1C1BA 3TX0A 1FDDA 4DPXA 1RXOB 1WI8A 3C19A 4ZVRB 1FE4A 4F0MA 2UUAF 4WK1A 1S1TA 3LWLA 4B3SF 2N82B 3N6LA 4J37A 1J27A 1EZZB 3ILOA 1H38A 1QJHA 4W92B 4O3SA 3M2UB 4DL5A 1IM6A 4RUBA 1FEHA 2KYXA 5DS7A 2LCWA 1IKXA 1RT6B 5HQMA 2YX4A 4JB8B 3EWGA 3DI6A 1CG2A 1GK8A 5IM0A 5HANA 3TZZA 2XMWA 3RRKA 3UPFA 2M9KA 3ETOA 4B9MA 4B9NA 1FRHA 4XDDA 1BQNB 3PJWA 2XCPA 1FJEB 2YNFB 4ZPWR 2IMWP 1RA7A 2BA9A 1YI2S 5KFSA 2WAQD 3R5AA 3PKMA 1TL7A 2CADA 2UUTA 1WKKA 1ZM2A 4ICLA 2PT0A 3NY0A 2NLWA 3VALA 1HIYA 3ISND 5HLFA 3N5BA 4DR3F 1I94J 2JSXA 4LF8F 3WIUA 2R7WA 2MZJA 2HHPA 2J9DE 3DRSA 3OTCA 4L74A 1CQMA 3RJMB 4OQJA 4DS4A 1NHUA 2G0CA 1D8ZA 2E1CA 2Y1IA 1FKAF 2E1RA 4YB1P 2AV5A 3NCQA 1NJZA 1FXRA 1IM4A 3QAEA 2J8AA 1Q4RA 4QWDA 1VYAA 5HQ8A 1XNRF 3KG0A 5A2QU 2R8JA 1NJYA 1YHQS 1V9OA 3CE8A 4F2SA 2IBOA 2MKHA 3KLHB 2QMUB 2R42A 4TY9A 1RT1B 2J7UA 3I5CA 3T9NA 3KNGA 1AXQA 4LF7F 2WVFA 4ERDA 2NXJA 1ZPWX 4DR5J 3FRYA 3P8BB 2MJUA 1U1QA 4ZCMA 2IYGA 2ZBRA 3K5PA 1AZSB 1OQ3A 5ETSA 2HQIA 2D74B 1BY9A 5HJYA 1RWVB 2W8KA 5BYSA 4R0JA 3RBEA 5AXLA 5THWA 1BD6A 2OP5A 1NUEA 4UQTA 4RWXA 1XQIA 2HQFA 5B09A 1Y5LB 2XC9A 2CG4A 3DLBA 3CO0P 4EBEA 5KG3A 3KJVA 2OO4A 2HNZB 1C0TB 3AB2B 4C6AA 2V2KA 5MAOA 2MQQA 3BSAA 3FNNA 2XI2A 1X4FA 3DHXA 2PGCA 2V8HA 4AUKA 2R7OA 2OFGX 1XWLA 2WW4A 1EKSA 1JNZB 4IG3A 2C2OB 2MQNA 1JLAB 3L9ZA 5C24B 4BHQA 1FXDA 4JI4J 5J1NA 3RW7A 2FJVA 2Q79A 3GILA 2DVIA 2PA8D 2LECA 2PMWA 4FBTA 3C15B 4WK3A 4NLXA 1D1UA 3HKWA 1AUDA 3MUVP 2VPXB 3DXSX 3D6HB 5D0GA 2IM3A 4OL8A 3DRXA 1WG1A 1S9EA 3OLBA 5D3GA 3HT3A 3BZQA 4B3OB 2HGMA 4GKJJ 2DHXA 3EVOA 5T7LB 3BKTA 2XLJA 1M5HA 2BX6A 2DGTA 3OR2B 1HQ2A 2ZBCA 3AD8C 1Y11A 3LW5C 3DLGA 4LFCF 5CD4A 3AXKA 5J2NA 1V3ZA 3J80U 2RRNA 2JWNA 4RL1A 4FF1A 4QWBA 5EUHA 2DH9A 2EXUA 2G2ZA 2YNIA 1F5CA 1D3WA 5L8RC 4IOBA 4RWWA 3OVSA 4I7FB 4DBQA 2DGSA 1VBYA 1KS2A 2VC1A 3H8YA 1WDTA 2P6SA 2VQEJ 3TI0A 2JVRA 3CF5Q 4DSFA 1QUVA 1WC1A 1SV5B 3DLEB 5K14B 3QIPB 2ZBIA 1RHRB 2MLYA 3K7RA 3DRRB 1U49A 4FVMA 2YWWA 3MTJA 2FDNA 4P72A 2C2NA 3ZFVA 2WOMA 1YJVA 1Q86T 1HBNA 3HO1A 3MMBB 4K0KJ 3EGVA 4ER8A 4ZPVR 1RKJA 4CO0A 1UVLA 1WC6A 4FPIA 3OUYA 1UWBA 2W2PP 1CJTB 3EGNA 1MLAA 4USTA 2GMJA 3RAXA 1GMWD 2ZITA 3EM1A 2W1BA 3CNQP 3MEEA 3H42A 5H1SV 3VV2B 2O01C 1S4EA 2CQ2A 1AUSL 2ZOFA 1SL1A 1PAUB 2D7SA 2DNRA 2HRTA 4TU7A 3O44A 5FJ4A 3RYLA 2R4FA 4NLPA 1C1CB 1YRUA 1XTZA 5F8NA 2MLXA 4HEA9 3MMAA 2B5JB 5B0CA 2L9WA 1JLFB 2XY7A 4Q44A 4PG7A 2M7SA 3BKUA 1RI7A 2F40A 4L75A 1HFEL 1Y3JA 1VK3A 2UV8A 1YDLA 2ZWOA 3PTWA 2I8EA 4NLQA 2CQIA 1A7GE 3G6ES 4USIA 5ETNA 4KC5A 3AQPA 2G0IA 4C2MA 3ZZOA 2HVHA 1IBMJ 4PYAA 3A8KA 4CLZA 2AJ1A 3CDUA 1H0HB 1JLQA 2CVEA 3PRDA 2P2CB 5ETOA 4DUYF 3GFHA 2BKNA 2RRAA 4DR7F 3VAHA 1F9HA 1ICEB 3R97A 2VG6B 4HYKA 3QMQA 1B7FA 3M9OB 2K8GA 4Y00A 2PI5A 2CPEA 1CSJA 5B7WA 5CCMA 2KXNB 3B8HA 4IG0B 1KP6A 4LIWA 3SZ2A 3MUMP 2XBPA 4CI0B 2DD8S 4DX5A 1FE0A 2ZNYA 4LRFA 4G6VB 2GO8A 3D67A 4JI8F 4B3RF 2RS8A 1SC3B 3MPVA 1FRXA 4B08A 3QSIA 3I5AA 3M32A 2OD4A 1ZTTA 2YKMB 5DZ7A 3MMCB 3HHNB 4HTJA 3UFCX 3J81U 5C25B 3KHRA 3K5NA 3OJUA 1ZM4A 3N9UC 3CPWR 4ZITA 3T3FA 3OL8A 2EG1A 4K50A 3M8RA 3C6UA 2HQGA 3ITHA 3DHWC 4R5PA 4PWUA 1FKOB 3H5XA 4NCAA 2ROPA 1X5SA 3OQ2A 2MY8A 4O0NA 2NXNA 3R7SB 4GC7A 2ZWPA 3UD5A 4HACA 4RNOA 4I2QB 2V4JA 4C3KA 4PXCA 5IS2A 3B82A 3A8EA 2AEFA 5B0FA 3DRYA 4C4WA 4QU6A 3MECB 2OPRB 5G0RA 3V6HA 1MG7A 2CUYA 1BLUA 2OEJA 4R8UB 5LJ5Y 3TJ9A 2IBKA 2QV6A 3W9IA 4ILMA 4LREA 4NCGA 1VIOA 1Y7PA 1DLOA 4DV7F 3GU0A 1VQNS 5DGAA 4HR2A 2Z2ZA 3KLIA 4UZBA 1QAXA 2IY5B 3R2DJ 1T9VA 3MFHA 4DR6F 1BGXT 3QRRA 3BPDA 1UJ4A 4LUBA 4JBCA 3A12A 1UW9A 4J9KA 4KPCA 4A8XA 2DGUA 1UFWA 1BMQB 3UVJB 2BQRA 1RT7A 2J6SA 3OVBA 1N6QB 2OPPA 3K57A 1X4DA 1MROB 4I1TA 3MDFA 2O5DA 4WFAQ 1VQ6S 4OHXA 3LALA 3UDVA 5ITHA 2G13A 5KFMA 3UNGC 4I6WA 4DV0J 1P6TA 3GIMA 4NE9C 5EDWA 4WYWA 3JAMU 4X62J 2F8HA 3NOGA 4PKDB 3M8YA 4WBFA 2IC3B 4JI2J 1F1BB 2KJVA 2PFDA 5IQ6A 1DARA 1GX6A 2B56A 2L41A 4K4YA 3MR7A 4F4ZA 5IT9Y 1B0VA 3BSCA 3N79A 1FTCA 2BV3A 4DPTA 1UVNA 1CJVA 3QAUA 1FK9B 2D69A 4LMZA 2YPZA 5F9NA 3QZ8A 2E66A 3VAFA 1TKZB 4DV5F 1K1SA 2BM1A 3HT0A 1HWKA 4IYQA 4XTTA 4KH1B 4HL9A 3OV7A 2Z30B 1WKLA 3CD7A 2NXCA 3HHKA 2MQLA 2ZOGA 2RUGA 1MU2B 4RBVA 3T1AA 4QCLA 1HBMA 2L3MA 3FKBA 3THTA 2VKRA 4KGZB 3ZC4A 2HMIB 2EKYA 3IR7B 2V9WA 4DR2J 2DR9A 1RT5B 2OEKA 1WC3A 2DNOA 4PPZA 1G1XA 2E7WA 3DLKA 1NM2A 4EUVA 2RUSA 1ZAVA 3W8GA 1XR6A 3BO4A 4FXDA 2R7QA 2YNHA 1YGYA 4K59A 4DSLA 4NOHA 3UN2A 1HNZJ 5ETRA 2V6AA 4OI0A 3RU0A 4MK9A 1SH2A 2WRMA 1YLXA 2G0JA 3U1LA 1U7LA 2E5LJ 2Y8WA 3C8YA 4ZN3A 3EVMA 2J0QD 2RDDA 4F04B 2JEFA 4DEZA 5DO2A 2WBRA 5F8HA 2B6AB 1Y10A 1T0TV 3D3CJ 1VQKS 2AKWB 3HHLD 1Q78A 2F9JA 5JUMA 2VC0A 2D3ZA 3O1LA 3BYPA 3ZZPA 3T6JA 3DOKB 2H5IB 2FJXA 5ETQA 4UOGA 2DHGA 2GVDA 2XYPB 1RTHA 2YWEA 4RNNA 1LW0A 4P2FA 3RRHA 2O67A 1DTTB 3IMQJ 2V8GA 4L76A 4KV8A 1P8GA 4BCAA 2JJ4D 1E6VB 1NDPA 2QRRA 1UMJA 2BJ8A 2IVMA 3DMJA 2CPJA 1U02A 3AJ2A 2CQHA 1Y9OA 4WP9A 3NAIA 1ZYQA 4OX9J 1SJRA 3SIPB 2WW8A 4ZVQB 3J7A1 4ZVSB 2MJNA 4OYAA 3UO0A 1HARA 1VRTB 3W9HA 3AXMA 3H20A 1J5OB 4TY8A 2IAJB 4TLRA 3P5BP 3W65A 2ERRA 4JI1J 1SVDA 2AP6A 1RP5A 3CJ3A 1Q81T 2GIFA 2YQ3A 3W62A 5IT0A 2BE2B 2FJWA 4LBIA 1PJ6A 2XYGB 3M8ZA 2IM2A 1Q82T 4DQPA 4GKKJ 2Y1LB 3MURP 4AQYJ 1Q8IA 1SJQA 2GW8A 4O3NA 3TNVA 1H2UX 2HSEB 2LFVA 2RB7A 4PXEA 5M2RA 2A1BA 1B64A 5F8IA 4IQMA 3F56A 3T1YF 1EP4B 3HHLB 2IIHA 4LFBF 3V4IB 1VFJA 2BUNA 4J9VA 2LQJA 3RR8A
chains in the Genus database with same CATH topology
4KFBB 1JJHA 1LWCB 3DOKA 1DHMA 2QLWA 1NU4A 3FZ2A 3R27A 5KFXA 4RLEA 4ZPAA 2KHCA 5CA5A 4K4VA 2D1CA 2B51A 1RA6A 2ZKUA 4YDDB 4NLRA 1NB7A 4DHVA 2M2BA 2OH2A 2WTFA 3O8WA 3V4MA 5AXKA 4OHZA 1XC9A 3GIKA 3VTIA 3MWBA 3QIPA 3PV8A 4GKKF 3RB4A 1RTIB 1W2BR 1DTTA 2P9CA 3D1HA 1UL3A 4AQYF 3JYTB 1UKUA 5KFAA 4N8NA 3HVRA 1I1GA 3RAQA 2IYIA 4NYPA 5H9EJ 1OWXA 4FF4A 3DOLB 2HHQA 5LJ3Y 4LF9F 2CPXA 2I38A 1NK7A 2COLA 4AL5A 3CD0A 3O3LA 2FC8A 2MQMA 4X84A 4K4XA 1CLFA 4TQRA 4ED1A 4X4QA 3FEYB 1HNVB 3NBPA 4MTPA 3M8PA 3PRBA 3MMBA 1KLMA 3MAQA 2DR7A 1QE1A 2WK4A 2G1DA 2AF6A 5E3RA 3K59A 2DNNA 3OR1A 2ILZA 3MI7X 3NGKA 4IH6A 2ZE2A 2DGQA 2DT9A 5F8LA 5A6WA 2POKA 2RJZA 2PO4A 2U2FA 2ZH8A 4JV1A 4BDPA 2DNZA 4USJC 4RW4A 2NXUA 3FCHA 3U02A 4F3MA 2W9BB 2AJQA 4HT7A 1PILA 2E7XA 1MWZA 3JTOA 2EI5A 4C8LA 4PPDA 1RT4B 5HMWA 4ECZA 3QYYA 2VFVA 4FYDA 4AE5A 2BBEA 2JOQA 3MFIA 3UD3P 3HJFA 3BR8A 2YKOA 4OHVA 2B7CB 2BDPA 1VRTA 3TX8A 1R27B 4KT0C 1AFJA 2Q3PA 2RKIA 3OSNA 3CXCR 4DQIA 1J5OA 1JIHA 1R43A 2Y1JA 3D0GE 3SXLA 2OPQB 2GC8A 3G6XA 2RE1A 3FMBA 2JC1A 5DQHA 1K0TA 4FPRA 1O5JA 3H5YA 5AXNA 1VLYA 3CJKB 3I5BA 2Z0GA 2V9KA 5DQIA 4EYIB 1PSDA 2C3PA 1S1VA 3MOJB 2QE5A 3CSKA 2YVSA 2PIIA 2VOPA 4IFVB 3I9V9 4Q43A 3PKYA 2JEGA 2IVFB 1EETB 3E01A 3WZ0A 4J9NA 3UDCA 3ZZ0A 3DDNA 3TYTA 2BE2A 2JRSA 5F3ZA 3T5KA 1ZAXA 5LSLA 2XSFA 3EPIA 2VBWA 3M2VB 2ZHBA 3VAKA 4ELTA 1YG0A 1J5EF 1BQMB 2QMXA 1S1WB 3E2EA 1D9DA 1K1QA 4CH0S 3LP1A 1JX4A 2ILYA 4NCBA 4K4UA 3D0HE 4ATNA 1BQXA 2YX7A 3K2YA 1T94A 3I0RB 5HROB 4CTAB 1NZAA 5MLCV 4KJIA 1YRTA 2V94A 4M5DB 2E44A 3TAPA 2VQFF 3PACA 3BB5A 3UCUP 3HP6A 1QSSA 2HZCA 4XIUA 2QSFA 5KFWA 4X4VA 4X65F 1B0TA 1SJ3P 3V6DB 5A8RA 2RQCA 1NRKA 6FD1A 3DLHA 3PFEA 5KOWA 3BSNA 1T8EA 1DURA 1JXLA 3AAWB 5EGYA 3IFEA 4RBUA 1HWIA 4X66F 4PXBA 3KJVB 5E3CA 2PDAA 3CCZA 4LSLB 1FO1A 4ZPDA 3K5LA 1QY7A 2XB2D 3HLUA 4DR4F 1EP4A 1Q1KA 3HHLA 2HGLA 3CWJA