1S29A

La autoantigen n-terminal domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
GSHMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDGLMVRRRDPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords La protein
publication title Structure of the La motif: a winged helix domain mediates RNA binding via a conserved aromatic patch.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Rna binding protein
total genus 25
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s29A00
4U88A 2M5WA 1TNTA 2ZMEB 5IT9K 3SXYA 1W7PB 2G9WA 1RZ4A 2EK5A 2FNAA 1E17A 1ONVA 3BPVA 3R61A 4PCQA 3G73A 4M73A 3F23A 4OU0A 4K2EA 2L3DA 2XASA 3RYRA 3EUHA 1XGOA 4A0YA 5CVJA 4L9NA 4WXHA 3BWGA 2V6CA 2IRFG 2K27A 4KT5C 4HBLA 1W5SA 5LRSA 1Z91A 2AXLA 2COMA 4ON0A 5E1ZB 1Y0UA 1YW7A 3FMRA 1FYLA 3U9GA 1AWCA 3GFIA 3REOA 3KZYA 4M6XA 1KYWA 4BAYA 3P9CA 5AIPA 4N9HA 5FLXK 1Q1HA 5K5QA 5HS7A 4PGGA 2HTSA 2P5VA 5CYVA 3Q5FA 3IKTA 5BOXA 4EJUA 3BY6A 2V1XA 1DDNA 1U5TB 2FQ3A 1G6NA 3IC7A 5L3FA 4NQWA 3CUOA 2XKPA 1USSA 1DUXC 5DUKA 2A6EF 5HS8A 4WCGA 5LRRA 3V8KA 4EJOA 1YTYA 5LHHA 3HHGA 3DQVC 3BDDA 3FXQA 1H9TA 2OU2A 4I09A 3E97A 5CVUA 2EV0A 2NNYA 2KIFA 1YO5C 3JW4A 1HXDA 4UVCA 3BJOA 4Q47A 1EV7A 1T39A 3QAHA 4I2OA 5D8LB 2VC1A 2GXBA 3HTSB 4EJWA 1ZLJA 3T5XA 5L3GA 4YIIA 5JHUA 2HZTA 3HSRA 2IW5A 4IXAA 2W24A 3KP4A 1J59A 4Y17A 4IRHA 2XAHA 2Y48A 3V7RA 2FU4A 2LF8A 1ZLKA 3QOPA 2LDUA 4XLNF 5L3BA 5BQTA 1MDMA 5D6EA 2DAOA 1V4RA 2D1HA 1Z6RA 3I59A 1I27A 2Q2EA 3JTGA 3RDIA 4M72A 4OIQF 1G4DA 4KIBA 2ZXJA 2YR2A 2JTVA 4U0WA 1ON1A 2M1BA 2EA2A 2UXXA 1R58A 4UVAA 3EYYA 2OQRA 4RAYA 3R4KA 1S3JA 2F2EA 5LBQA 2M45A 3D5LA 3C1DA 3I54A 2IA1A 3F72A 4JK1X 3H3UA 4M6YA 4WXCA 1TW2A 1LQ1A 3MFKA 2BV6A 3U1DA 5D5VB 4L5IA 2HKXA 3MCZA 4A5NA 5JFRA 3ELKA 3ZMTA 2Y0MA 2O3FA 3RYPA 1UB9A 4LK1F 3RIRA 1P4WA 3KP5A 1MGTA 5BMZA 1TQIA 2XIGA 1LVAA 2XAFA 4KICA 4PDKA 1KU3A 2FE3A 5IT3A 2D2WA 1XMKA 4DQ2A 4IVNA 1FBUA 1L0OC 1OMIA 2ZNZA 2GWRA 4CO8A 1R00A 5H6QA 1W4MA 4FHTA 4H0EA 2VXZA 2IVMA 2NAZA 4HOBA 2FEZA 3HOSA 1U8RA 1QO0D 1ZREA 1EH7A 4XLPF 1ZYRF 1MKMA 2DPDA 2OZUA 4HF2A 5E18F 4LG0A 1MJBA 4P96A 1LNWA 4M9ZA 3J81Z 3MWMA 1AOYA 1J75A 1EH6A 4L0YB 4L0ZB 1FP1D 1G3SA 2ZMEA 3GXOA 1W7PA 1FBQA 1LEAA 4MTEA 1P4AA 1B1BA 1QPMA 3HUGA 3TO9A 4HX8A 2XV4S 3ABTA 4U0YA 3AAFA 2O03A 1REPC 4RS8A 5HDKA 1YLFA 3B73A 3K1MA 4HQMA 2LNBA 3DKWA 3MAJA 1YFHA 2O61A 5J6XA 2VT2A 4OIOF 5A2QK 2CSOA 1QBJA 4EGYA 5LHIA 4CZZA 1WQ2A 2O8XA 3LA7A 1WKMA 3KCCA 5AONA 3E6DA 1BC7C 1HW1A 4JBAA 1SFUA 2KIMA 2G7HA 5ERIA 2BYVE 1XSDA 2RVCA 2RN7A 3T8RA 2L01A 1B4AA 2OBPA 2W84A 2IA0A 2VBXA 2H27A 2RGVA 3ML6A 3L7WA 1K79A 1BJAA 5FD5A 4EGZA 1U5TA 3RJPA 3TO6A 2FF4A 1PDNC 2ESNA 1UHMA 3WTXC 5BS6A 1Z6TA 2ACJA 3SZPA 2QVOA 5HVQC 3MZHA 3KETA 2F5DA 2HR3A 1HSJA 3I4PA 4NB5A 1UCRA 2NS0A 2GA2A 1T6SA 1Z05A 2EFWA 2ZFWA 3WTYC 4YFNF 1XCVA 1XGMA 2MLKA 2ISZA 2XRNA 2O0YA 3KEQA 2FXAA 3RPUA 1BBYA 2GA1A 1T0FA 3TDZC 2XVCA 1JHFA 1SD5A 3HSEA 4AIKA 2Q8KA 2QBYB 3FWEA 2WV0A 2Z9OA 3Q9SA 3LA2A 1ZRFA 4KN4X 1FOKA 2JPCA 3GYHX 5HS9A 1SD6A 1C0WA 4P9UA 4ZYGA 2A69F 3W6KB 1D5VA 4ENKA 4HAMA 4U7DA 4KUMA 5D4RA 4UNOA 2EWNA 3FHZA 1J0RA 1SD7A 1FLIA 1LJ9A 2P6TA 4RGUA 2QQ9A 3SZTA 1SFXA 2IJLA 5F6FA 2Z99A 5ICCA 2DQRA 2OA4A 2FA5A 5HLGA 3VFZA 2PJPA 5L3CA 3F8MA 4ZYEA 2K4BA 1W7PD 2XAQA 5F64A 1PP7U 2VBWA 4EVIA 2P6SA 4KYWA 2DBBA 3MZYA 1HKSA 2YX7A 1ODDA 1SD4A 4B09A 3IKVA 2ZJ2A 2R7FA 1ZH5A 1F1ZA 5CVIA 3KLNA 4HX4A 4PGHA 2JRTA 2YPRA 2BGCA 3V7SA 2PG4A 3WE3A 4AIJA 3F8NA 4OIRF 4OMZA 2CGPA 4HZFA 4M71A 1U3EM 1HW5A 2JT1A 3NRVA 3TOAA 3KP6A 1JHHA 5E20A 2UZKA 4LMYA 5JR3A 1HKTA 1WI9A 2FSWA 1H9GA 3HRUA 4KNYA 1WWXA 1IZ1A 1IAWA 2IT0A 5CLSA 4S05A 2P7CB 1PUEE 2LKPA 4YFKF 2FBKA 5DCFA 4XRFA 1FSEA 2XUBA 3ISPA 5LGTA 2JZYA 3GVAA 2MH9A 5HOOA 2OZ6A 5DCMB 4OINF 3JAMZ 4CHUA 1FBSA 4XSXF 2P7VB 5ICFA 3I71A 3FXRA 5LHGA 5DDGA 2XGXA 4M74A 3GFLA 3GFJA 3M8FA 3F6OA 1ZN2A 2MBFA 2QZ8A 5F1RA 4QWQA 5D5XB 5HDNA 5E8IA 3E6MA 1GXPA 4P55A 4EM0B 3I58A 2RV8A 2RC4A 1Z7UA 2ZNYA 5DUIA 2A5YB 3BOQA 3TGNA 4UUVA 4FT8A 3GW2A 2VE9A 1UHWA 4A12A 1H0MA 2GIVA 2HFHA 2GQQA 1FT9A 3ZMSA 2R7DA 3J7AO 1STZA 3EYIA 1YW8A 4LLLA 3WGGA 2HQRA 3TKYA 2VE8A 1I1SA 2A3SA 3IRRA 2QYOA 3BJ6A 3DXJF 2K02A 4M9XA 3CLOA 1P4XA 3F3XA 4E70A 1RNLA 1IN5A 2QQAA 1P6RA 1KQ8A 3WE2A 5CVRA 1FPQA 1P92A 1ZGJA 5ED4A 2P5LC 3GLXA 2X0LA 3TO7A 4LLGF 3HOTA 3PFIA 1LDJA 2JSCA 3PQKA 3LSTA 3V8JA 1FP2A 4RGSA 1TLHB 1QNTA 4RB2C 1KU2A 4A6DA 3ZP5A 4HX7A 5HLIA 2DTRA 2ESHA 4LFUA 3E6BA 3FXUA 3KFWX 4D0PA 3KZZA 4NHJA 2WWYA 3JSOA 3VB2A 3CO6C 1KQ9A 4HF0A 2STTA 3P7NA 2Q0OA 3VOEA 4WK8F 4O5VA 3L2CA 3WG9A 2DO7A 3J80Z 3ERED 2QBYA 3SFZA 1S6LA 2PEXA 2VBZA 4HV6A 2DW4A 3FZVA 4IHTA 1ZGAA 4GYGA 4RGRA 2YSRA 2EFQA 4WXDA 3LWFA 1EH8A 2QQBA 4WX9A 2PI0A 4S04A 2PMHA 1CGPA 4G94A 3C3WA 4HV5A 2HEOA 1O7FA 1MJAA 4IRIA 1U2WA 4TV7A 3R0AA 4EV0A 3DPTA 5E1WA 5ICGA 1L3LA 3O2PE 4UV9A 3KEOA 2STWA 4HYEA 1GVJA 1S7OA 3F21A 1TTYA 2HS5A 2HYGD 1DP7P 1BN5A 1HW2A 4KMFA 4HDUA 2WTEA 2L4MA 3T1BA 4L5JA 3K69A 3RKYA 2E1NA 5J8FA 4LLNA 2NYXA 4UXNA 2VOPA 2W57A 3KE2A 2GAUA 3T0YA 4PZJA 2K7LA 1QZYA 2FBIA 2NNNA 1IN4A 1O3RA 2HQNA 3GEZA 1XGSA 1A04A 4MNUA 2M8EA 1J9IA 4ZH4F 3ABUA 1MZBA 1XDUA 2J5OA 2CG4A 3LQRA 3GUDA 1HQCA 1R23A 2HKOA 2A6HF 3H3ZA 2M87A 4AVPA 1USTA 2VOOA 2A68F 5IT9Z 2H6CA 4BYYA 1XGNA 1SMTA 3KLOA 3WU0A 5K1YA 3G3ZA 4IPAA 2BEOA 4KIGA 5D6FA 3COAC 4KIFA 3F22A 1FX7A 2Z3YA 4LJZF 3WTTC 1YS7A 4WF2A 5DCMA 4Q48A 4I0AA 4L9JA 5EEHA 3HYIA 3U2RA 3F8BA 1IUYA 3GX4X 5LEJA 4EMSA 2VONA 2KKOA 1J7KA 5K5RA 5DYMA 4I01A 2G7UA 4CGZA 5FLXZ 2MLGA 2HGCA 1HKQA 4I98B 1XSXA 4UV8A 3CDHA 4G7OF 4KA4A 4L9VA 2V9VA 2PLYA 3QPHA 4OIPF 1U78A 2GZWA 1IW7F 3O3KA 2V1DA 3IL2A 1SMYF 3CJNA 3TDUC 4MQVA 4YIFA 3R60A 5E17F 5LLQA 3WODF 4OOIA 3QU6A 2QWWA 1B9MA 1FC3A 3C18A 4LD5A 1B59A 4B8XA 5LGUA 4FX4A 3W6JB 4AD9A 3GF2A 3BZ6A 4UHTA 1YIOA 4QLCU 1T98A 4ESJA 3WGHA 1R1UA 1FNNA 2IP2A 2F5EA 1KQ0A 3KP3A 1XSVA 4IJAA 3RKWA 5J8CA 1ZHFA 4ESBA 2L02A 4O6JA 1QGPA 4G8XA 5D5WB 2DLLA 3FMSA 4I02A 1P2FA 5KVRA 1YG2A 2DK8A 4L9TA 3WTVC 1SFEA 2CFXA 1FSHA 5CVVA 2HTJA 2PMUA 2ZBKA 2UXNA 2XKOA 1G3WA 3I5UA 4IHSA 2QLZA 2ETHA 4AWXB 1TW3A 2JPBA 3LA3A 5JI6A 2PQ8A 3V4GA 1CF7B 3NEUA 3E5QA 5FFZA 4ZZDA 1DPRA 4ZYDA 2KRFA 1R5GA 2PFBA 4M9SA 1Z1DA 1LDKB 2E1CA 4UVBA 4I0BA 3WTSC 1K78B 5BPDA 2P8TA 2DT5A 3E5UA 2M30A 2D45A 4EM1A 4IRGA 3SQNA 2XAJA 4ESFA 1TNSA 3TQNA 3C7JA 1BIAA 1BIBA 1ZG1A 4R8HA 4MQ9F 3DPLC 1V3FA 3PQJA 2UWMA 3CUQC 4G9YA 5D8KB 3EETA 3ULQB 1IRGA 1OYWA 2EFOA 4BHCA 5DD4A 1K7AA 2H6BA 1HSTA 1JGSA 1IRFA 2E7WA 1YW9A 2ZKZA 4BQAA 2B0LA 2X4HA 3KP2A 1K6OA 2OAZA 1SAXA 1F4KA 2ZCWA 1OPCA 2GXGA 3ZQ7A 2NRAC 2XHKA 3BJAA 2BE5F 4GGGA 3D0SA 3HRMA 2LSOA 2R3SA 5DEQA 2Y75A 1IN6A 1YYVA 3IHUA 3J81K 4I7HA 1OYYA 3ZN0A 3B02A 1LB2A 3M7GA 1R7JA 4BHBA 1HBXG 3NQOA 3L00A 1WSUA 3BROA 4LGWA 1T38A 2MH2A 4O3MA 2KJBA 1MJ9A 2QUFA 2DPUA 3WTWC 3MEXA 2FOKA 4N9IA 1IN8A 1VTNC 3IWZA 4RGXA 1FZPB 2EFNA 3JTHA 1O3QA 4KFCA 1I6XA 3FM5A 1WRJA 1BI2A 3BP8A 4ENMA 1KA8A 3OOPA 4G6DA 5A2QZ 3HTUA 1QQIA 1PP8F 2ADUA 3HRSA 4KN7X 3RKXA 4AIHA 1B9NA 3Q9VA 4CDGA 3JSPA 1ZG3A 1TQMA 1RIOH 1BI1A 4HLXA 1FYKA 3FM3A 3RTRA 4ENNA 1ULYA 3P9KA 3HIFA 2FBHA 5TJJA 4CYDA 4HW0A 4A0XA 3R0JA 4A0ZA 2HDCA 2BBYA 2CO5A 1XB4A 2DK5A 3ZMVA 1BOAA 2VC0A 3DEUA 1FY7A 2XAGA 2KJCA 3F8FA 3HHHA 2MC3A 2QM3A 4L18B 1JXSA 4LK0F 3QRFF 1G3TA 3K9TA 4ZZLA 2IPQX 3E3VA 5TRDA 2OD5A 2P4WA 5JVTA 3HRTA 3N97A 3ZMUA 1F5TA 4XSZF 3L09A 6PAXA 1TBXA 1OYIA 3K0LA 1YQAA 2IA2A 1RUNA 5H6RA 4EJVA 3H92A 2P5KA 2TDXA 1R36A 1OR7A 2FNPA 3GFMA 2L4AA 4A6EA 2H09A 4Y13A 1DPUA 3ZMZA 2EJRA 2HYFA 1R1TA 2PN6A 5E8GA 4RB0A 2YU3A 4U7BA 4JQFA 3LFKA 4HDVA 2EFPA 1XMAA 1GXQA 2XROA 4A2UA 2C6YA 5DD8A 3CTAA 1J2XA 3CUQB 1CF7A 2CQKA 1BI3A 2CYYA 1G3YA 3BPXA 3VEPA 2HWVA 2CW0F 1IXRC 1XCBA 4KMUX 1K78A 1MD0A 3DF8A 3IRQA 4BXUA 1D8JA 2EV6A 5FD6A 2A07F 1RI7A 2O6GE 3E5XA 5AIQA 1S29A 4GO1A 1YS6A 4Q5SF 2QENA 4U0VA 3ZMDA 4R1HA 2PBIA 3VODA 2V79A 3V8LA 3TOBA 4EJTA 2RKHA 3GZ6A 3QP5A 5L3DA 4ENJA 3RPQA 1OKRA 3ECHA 3I53A 5KK1A 2EB7A 1R1VA 4MTDA 1S7AA 1XDSA 4XBFA 4Q4ZF 3EQLF 2W25A 2Z33A 3E6CC 1ZARA 3WTUC 4LB6B 3JAMK 3LAPA 3MQ0A 5HDGA 3V7CA 3WTZA 1XD7A 1GHCA 1KU9A 4ETSA 4MEXF 3ZN1A 2ISYA 3IWFA 1O57A 2ZO4A 5HLHA 5H20A 1S8NA 3GWZA 5LEKA 1R22A 4HLYA 1IXCA 4N0BA 5FB2A 3L9FA 1BM9A 4EM2A 4RAZA 1O3TA 4BNCA 2DFIA 4GYIA 3ECOA 3M1EA 3RI4A 4CXFA 1E2XA 2J5PA 4P9FA 1Z9CA 3SHFA 2EA4A 3KP7A 5ILSA 2A61A 4R79A 3F6VA 2KIUA 5ILVA 3I0TA 4DNCA 3I64A 1ZRCA 4FX0A 3ZPLA 2Z5UA 1ZRDA 1IF1A 4BH9A 1FYMA 2F5CA 4G7ZF 3FX3A 5EEGA 1IN7A 4EQQA 1F9NA 3M8EA 1I1GA 2RDPA 2K4JA 1U5TC 4GXOA 4G6QA 1J5YA 4MEYF 3S2WA 5DV5A 4HQEA 4CICA 2YX4A 1O3SA 2VODA 3DFGA 3FF5A 2FMYA 3QP6A 4LB5A 5CJ9A 1BC8C 1NHAA 4RB3C 4Y15A 2LF7A 3WU1B 4MGRA 1TQPA 4WWCA 1KGSA 2MD5A 1R5HA 3K1NA 2FRHA 1O7LA 5E1XA 1W5TA 3K1PA 1MDMB 3QU3A 3GO5A 2VBYA 3I59B 3EDPA 2WC2A 3K2ZA 5FGMA 4F7ZA 2HOEA 3LAJA 2W85A 4HA8A 2DI3A 3DV8A 3J80K 2ELHA 4ZYHA 5LGNA 1JE8A 1T2KA 3T8TA 4A5MA 2V1UA 3DP7A 4MHGA 2AS5F 1IXSB 2FMLA 4P5OA 5ILUA 1X3UA 3QPTA 2H94A 3OV8A 3FMQA 2VT3A 3P9IA 2CWEA 2OQGA 2K86A 3R6SA 4OMYA 1RUOA 3O6BB 3N4MA 4ASNA 3GZ5A 2VN2A 5BPIA 1LEBA 5FO5A 4RB1A 2F5FA 2L54A 4Z2YA 5K5OA 4HF1A 1KU7A 3CUQA 3ROUA 1U6GA 2MA3A 1FWZA 1UFMA 4IF4A 4YFXF 4YG2F 1LDDA 5D4SA 2EV5A 5FFXA 1ZG5A 1D3YA 1ZAOA 5D5UB 1ON2A 1KYZA 3LQQA 4BHPA 2DQLA 3M9AA 5ICEA 1I5ZA 5L3EA 4G7HF 1B6AA 1BI0A 3F8CA 1D8KA 2D1VA 2RQPA 4LG0B 1XN7A 4KDPA 4GCVA 3CO7C 1QZZA 2DU9A 2RNJA 3WGIA 2E7XA 3HSFA
chains in the Genus database with same CATH superfamily
4V2GA 4U88A 2M5WA 1YHQI 1TNTA 2ZMEB 5IT9K 3U1KA 3SXYA 3F9KA 1LVKA 1ORKA 4D9JA 1W7PB 2G9WA 1RZ4A 2EK5A 2FNAA 3QPLA 4ZJZA 4A3FJ 3ESWB 4KT6A 1E17A 1ONVA 3BPVA 2JA8J 3H0DA 3R61A 4PCQA 4C3JJ 2R5YA 3G73A 4M73A 3F23A 2VKEA 4OU0A 4K2EA 2L3DA 3HUGB 2MD0A 4RM2A 2XASA 3RYRA 2DYSH 5FKNA 4S0HB 5IYBJ 3DWLE 1FJLA 2Y2ZA 3H9JA 3EUHA 2ID6A 4AVZA 5E79C 1XGOA 2EZIA 4XRSG 3CCYA 4A0YA 5CVJA 4L9NA 2KP6A 1Y1VJ 4WXHA 3CCQI 4BU2A 2CV1A 3BTJA 3BWGA 2V6CA 2IRFG 2K27A 4KT5C 4YIRX 4HBLA 1W5SA 5LRSA 1Z91A 2AXLA 2FX0A 2COMA 2VJJA 3HEFA 2IS4A 4ON0A 2MG4A 1Y0UA 5E1ZB 1YW7A 3FMRA 1FYLA 2A5WA 3U9GA 1AWCA 3JRIA 4XNFA 3GFIA 1FOXA 3REOA 3PO2J 3KZYA 4M6XA 1KYWA 4BAYA 3P9CA 5AIPA 4N9HA 5FLXK 1IV8A 1Q1HA 5K5QA 2M4GA 5HS7A 1LE8B 2CFOA 4PGGA 1SVOA 3IAS2 2HTSA 2P5VA 5CYVA 2OF7A 1IG7A 3J7AY 3Q5FA 3IKTA 2ME6A 5BOXA 2LLKA 4HNTA 2EPFA 3A03A 2V7FA 3BG5A 2W7NA 1VQ6I 1X1CA 4EJUA 3HOXJ 3BY6A 2V1XA 3NWTA 2ZXHA 1DDNA 1E3HA 2P81A 1U5TB 2FQ3A 4A3EJ 1G6NA 3DKXA 3IC7A 5L3FA 1WGXA 1M1EB 2M8GX 3NWSA 4NQWA 3CUOA 1P9QC 2XKPA 1USSA 4X1EA 2WB1A 1SANA 1DUXC 4C9YA 5DUKA 2A6EF 5HS8A 3OYLA 4WCGA 3S15J 1TL8A 5LRRA 2NVXJ 2I5UA 3V8KA 4EJOA 1POGA 5EG0B 2JK3A 5LHHA 1YTYA 1RKWA 1FMVA 3HHGA 3DQVC 3BDDA 3FXQA 1H9TA 2OU2A 4I09A 3SZGA 3E97A 5CVUA 2E36A 2FUG2 3IP4B 4KITB 2QSGX 4DYRA 1DGRM 1X58A 4QTRA 2EV0A 1NG7A 3CCUI 2HOAA 5J1YA 2TRTA 3OR1C 2NNYA 2KIFA 1YO5C 3JW4A 1K61A 4B44A 1OQYA 2CW7A 3M4OJ 1HXDA 4D1QA 4UVCA 3BTCA 4RAFA 5LD2C 3Q3SA 3BJOA 4Q47A 1EV7A 4BS9A 3S1QJ 1T39A 2ZB9A 1MH4A 3QAHA 5CQEA 5D8LB 4I2OA 3RSNA 4QPOA 3E1SA 1WH7A 3OYKA 2VC1A 3I55I 2GXBA 3TEDA 2F6CA 3CZ6A 3JREA 1T33A 1MH3A 2XGCA 4EJWA 1ZLJA 3HTSB 3T5XA 5L3GA 4YIIA 1TT0A 2R7TA 5JHUA 2HZTA 3HDDA 2ICWG 3GLLA 3HSRA 2IS2A 2E71A 2IW5A 4IXAA 2W24A 4LIUA 3KP4A 3AG2H 3G2BA 4Y17A 1J59A 4IRHA 2XAHA 2K3FA 2Y48A 5B1BH 2BHZA 3V7RA 2FU4A 3L2VA 2LY9A 2LF8A 1ZLKA 3QOPA 1UJ8A 2LDUA 4XLNF 5L3BA 3HOUJ 3AG3H 5BQTA 1PUFA 4PJLA 5EDNA 1MDMA 5D6EA 2DAOA 4II3A 3D5RC 1V4RA 2D1HA 1Z6RA 1MNMC 3C2HA 3DBHB 3I59A 1I27A 2Q2EA 3JTGA 4A3LJ 2KPMA 3RDIA 4M72A 2XB0X 2BY2A 3CP8A 3K4CA 4OIQF 3G4SI 1QVTA 1G4DA 4KIBA 1XX5A 2ZXJA 2YR2A 2JTVA 4U0WA 1OCPA 4BJ6C 1ON1A 4F91B 2R7SA 2M1BA 2EA2A 2UXXA 3OYMA 1R58A 4UVAA 1LUJB 1JKQC 3EYYA 2OQRA 1IRXA 1X1AA 1ZR4A 3Q0UA 4RAYA 3FK7A 3R4KA 1OCTC 1S3JA 4H4KC 3UKGA 2F2EA 5LBQA 2M45A 3HSFA 3D5LA 4UB8C 4XKCA 3C1DA 3I54A 2IA1A 3F72A 4JK1X 3H3UA 4M6YA 5GTIC 4WXCA 1TW2A 3K4JA 5M5YJ 1LQ1A 1WHUA 3MFKA 2BV6A 5IPAA 1J09A 3U1DA 3G1OA 4QIWN 5J1RA 3WHBA 5D5VB 4A69C 4L5IA 3CESA 2HKXA 3MCZA 5JVGF 2DT7B 4A5NA 3H36A 3SJMA 4IHXA 5JFRA 1X1BA 3ELKA 4BXFA 2BXZA 2BW3B 2DJIA 1BOBA 3GCMA 3ZMTA 2CV2A 2Y0MA 2M0CA 2LBFA 4AUXA 3CCEI 4AYBA 3CMMA 3GTKJ 2O3FA 3NAUA 3RYPA 4NC8A 1UB9A 4LK1F 3RIRA 1P4WA 3KP5A 1MGTA 3BTIA 5BMZA 1TQIA 3S3NA 1TC3C 2XIGA 1LVAA 2XAFA 4KICA 2L2OA 4PDKA 1H89C 1KU3A 2FE3A 2O9LA 3OWTA 5IT3A 2D2WA 1XMKA 1D1AA 4DQ2A 2E1OA 1FBUA 1L0OC 4IVNA 1AKHA 1OMIA 2ZNZA 3I4MJ 2GWRA 4CO8A 5EZHA 4A3GJ 3CF2A 4BEHA 1R00A 4HSTA 5H6QA 3S8PA 1FTTA 1W4MA 1S7EA 3ASNH 2COBA 1FIPA 4FHTA 4UUSB 3VDXA 3OYEA 4H0EA 3OYJA 2VXZA 2IVMA 3C2GA 3PNTA 3VWBA 2NAZA 4HOBA 5C4JJ 2FEZA 3BR3A 3HOSA 2X1DA 2X6WA 1U8RA 1QO0D 1A6QA 1ZREA 1EH7A 4XLPF 1ZYRF 1MKMA 3S17J 2DPDA 3S2HJ 3D5SC 2OZUA 4HF2A 1W5CC 5E18F 2EINH 4LG0A 1MJBA 4P96A 1LNWA 4CCOA 1TP4A 4FQGA 4M9ZA 3J81Z 3MWMA 1AOYA 1LPQA 1J75A 2ECBA 1MMGA 2XSJC 5FLMJ 1EH6A 1ETYA 4XIDA 1XG1A 3RZDJ 4L0YB 4L0ZB 3DCFA 3I4NJ 1FP1D 1G3SA 2DYRH 2ZMEA 3GXOA 1NK3P 4GFBA 1IDYA 1VNDA 3H5RA 1K4SA 1DP3A 4C2TA 3PFYA 1W7PA 1FBQA 1LEAA 4DYQA 4MTEA 1P4AA 1B1BA 4L5EA 5KAIC 1QPMA 1IV6A 1F36A 5E3LA 1JKOC 3HUGA 3TO9A 4HX8A 4KJZA 2HVRA 3LSPA 2XV4S 3ABTA 3S1NJ 4U0YA 3AAFA 3MVPA 2O03A 1R6RA 4BE0A 1REPC 4RS8A 5HDKA 3TL4X 1YLFA 3ZR8X 3QPSA 1RR7A 3B73A 3K1MA 4HQMA 3ERMA 1NK2P 2LNBA 3DKWA 3MAJA 1YFHA 2O61A 3DPUA 5J6XA 2VT2A 4DGWB 1RRJA 4OIOF 5A2QK 1GV5A 2CSOA 4AC0A 3PM1A 1QBJA 3HGGA 4EGYA 5LHIA 1MBGA 3B6AA 4CZZA 1WQ2A 3OMYA 2O8XA 3BR5A 3U21A 3LA7A 2KDZA 1WKMA 2VJIA 3AFHA 3KCCA 1VQKI 1N25A 2KHMA 5AONA 3E6DA 3K70D 1BC7C 1HW1A 1JKRC 4JBAA 1SFUA 2KIMA 3ZGKA 2G7HA 5ERIA 2BYVE 1XSDA 2DJNA 1YX3A 2CJJA 3ZOBA 1LE8A 2RNGA 1BA5A 2XPWA 2RVCA 2RN7A 1MMAA 2FD5A 2L01A 3T8RA 4BBRJ 1U8BA 1B4AA 2HOTA 2OBPA 2A6TA 1LFUP 2L0KA 3AL0C 3FXKA 4A3IJ 5J4VA 2W84A 2IA0A 2VBXA 5EF6A 2EIMH 2H27A 2RGVA 3ML6A 3L7WA 3SEZA 1K79A 1BJAA 5FD5A 4EGZA 1U5TA 3RJPA 3TO6A 2EH3A 4CZCA 4EEFG 3G6EI 2FF4A 4N4OB 1JJ8C 1PDNC 2ESNA 1UHMA 2HXOA 3WTXC 5K7HA 5BS6A 1Z6TA 2ACJA 3WG7H 3SZPA 4X6AJ 2QVOA 5HVQC 3MZHA 3KETA 5HNHA 3OS0A 2F5DA 2E34A 2HR3A 1HSJA 3S3OA 3I4PA 4NB5A 1UCRA 3ABMH 5J47A 5EG0A 2NS0A 2E60A 2GA2A 4A3DJ 1T6SA 1Z05A 4DIQA 1NG6A 2EFWA 2OV7A 2R5ZB 4HNUA 2ZFWA 5FRNA 3WTYC 4YFNF 1I3AA 3HKZN 1XCVA 1XGMA 4PK4A 2WY7Q 1NTCA 2R7QA 2MLKA 2M0MA 2ISZA 2HPIA 3S16J 2XRNA 2O0YA 3KEQA 2FXAA 3RPUA 4IKFA 1BBYA 2GA1A 1T0FA 3TDZC 2HOSA 2XVCA 1JHFA 2HPMA 4E7JA 3G1MA 4RBOA 1SD5A 3HSEA 4AIKA 3HC7A 2Q8KA 2QBYB 3FWEA 2WV0A 5K7FA 4LG3A 1MSEC 4Y3OA 2R7RA 3Q9SA 3LA2A 2Z9OA 4YEJA 3TW7A 1ZRFA 4CUGA 4KN4X 1FOKA 2JPCA 3GYHX 4LIVA 5HS9A 3DLLF 3PSIA 1SD6A 3CCMI 1C0WA 1OLTA 4DZJA 4P9UA 1W36D 4ZYGA 2A69F 2KLOA 1MBFA 3W6KB 1D5VA 4ENKA 1IRZA 3FDYA 3KX2A 4XR6A 4HAMA 4U7DA 4KUMA 5D4RA 1Y8QB 4UNOA 1R4NB 4A3KJ 2EWNA 3QOEA 4IHYA 3FHZA 1J0RA 1SD7A 1FLIA 5IY5H 1EJ9A 1VQPI 5E3NA 1BJZA 1LJ9A 5BNGA 4IEJA 4RA2A 2P6TA 4RGUA 2QQ9A 5IOYA 3SZTA 2W82A 4M3GA 2L7KA 2R7XA 1SFXA 1ZKGA 2IJLA 5F6FA 4NNJA 2Z99A 1Y1WJ 2M7AA 5ICCA 2DQRA 1SFOJ 3OS1A 1BW6A 2OA4A 2FA5A 3CMAI 1ETWA 5HLGA 3VFZA 2ZSHB 2PJPA 5GPAA 3PJRA 2LP0A 5L3CA 2R0QC 3F8MA 3L2QA 4ZYEA 3PNYA 2M2EA 2K4BA 3HM5A 1W7PD 4UY8I 1HDDC 2XAQA 1V54H 5F64A 1QHGA 2VBWA 1PP7U 4EVIA 2P6SA 4MO7A 5GPCA 2GIZA 3BR1A 4KYWA 2V26A 2DBBA 3MZYA 1HKSA 2YX7A 1ODDA 4P1WA 1SD4A 4B09A 3IKVA 1TWGJ 2ZJ2A 2R7FA 1ZH5A 1F1ZA 5CVIA 3KLNA 3H9GA 1QU3A 5J1UA 4HX4A 1FEXA 4PGHA 1SVMA 1V5FA 2JRTA 2VB6A 2YPRA 2BGCA 3ABKH 3V7SA 2QGUA 1DU0A 2JN6A 3LNQA 1ITYA 2PG4A 2R7VA 2VLAA 3WE3A 2ME0A 4ZDLA 4JYKA 2F4IA 4AIJA 4PJ0C 3F8NA 4OIRF 4OMZA 2CGPA 2PJRB 1X2NA 4HZFA 4M71A 1U3EM 1HW5A 2JT1A 1JUPA 3NRVA 3TOAA 4XQFA 1WI3A 3KP6A 2YS9A 1JHHA 4OWRB 1YX5A 4E7LA 1X19A 2BW3A 5E20A 3ZQQA 3CJRB 4M3EA 2UZKA 4LMYA 2E2JJ 5JR3A 1HKTA 4HG2A 3M3YJ 2DT6A 4DZPA 1WI9A 1Z77A 2FSWA 1H9GA 3HRUA 4J00A 4KNYA 1EKEA 1WWXA 1IZ1A 1IAWA 4LITA 2IT0A 5CLSA 4S05A 2P7CB 1PUEE 2X1CA 5F0HA 3FIWA 2LKPA 4YFKF 2FBKA 5DCFA 4XRFA 4F3QA 1N77A 1FSEA 2XUBA 1YIJI 5M3FJ 2JJ7A 3ISPA 5LGTA 2CUJA 2JZYA 1D1BA 4BY1J 4UUSA 3GVAA 2MH9A 5HOOA 2OZ6A 5DCMB 3SDBA 1E0EA 4OINF 3JAMZ 2WB1N 4JX4A 4CHUA 1FBSA 4PUSA 4XSXF 2AO9A 2V9KA 1B8IB 2P7VB 4M3BA 5KAFC 1MNEA 1IO2A 5ICFA 1W0TA 3I56I 1ZR2A 1XS9A 3I71A 4E4HA 3FXRA 5LHGA 5DDGA 2KL4A 2XGXA 4IQJA 4ZTJA 4M74A 3GFLA 3GFJA 3M8FA 1AHDP 2K9MA 3E7LA 3F6OA 3KZIC 1ZN2A 2MBFA 2QZ8A 5F1RA 4QWQA 5D5XB 3HL2A 5HDNA 3TW6A 3VYSB 5E8IA 3E6MA 1GXPA 3GTPJ 1VZ0A 4P55A 5FKLA 1W0UA 4EM0B 3I58A 3RPUD 2NVTJ 2RV8A 4D7NA 2RC4A 1X4OA 1WJFA 2DDAA 1Z7UA 2ZNYA 4ZDPA 5DUIA 2R92J 1IC8A 2HU9A 1FTZA 5TGTA 2A5YB 4DYCA 3BOQA 3TGNA 4UUVA 2LMDA 4FT8A 3GW2A 2ZJQF 2EZKA 1Z21A 2VE9A 4AIDA 1VQ9I 3AL0B 1UHWA 4A12A 5FLVA 1RR8C 1H0MA 3WHCA 2GIVA 4Z6YA 2CMPA 2WAQN 1GLNA 2HFHA 2GQQA 1FT9A 3MKLA 3ZMSA 3H3VK 3KIOA 2R7DA 4BXXJ 3J7AO 1STZA 3EYIA 1YW8A 3FHNA 2QA4I 3K4LA 2HQ5A 4LLLA 3WGGA 2HQRA 3TKYA 2VIXA 2VE8A 3K4NA 1I1SA 2A3SA 3IRRA 3OSFA 2CRGA 3OYDA 2AQFA 2QYOA 1LFPA 3BJ6A 5DM6F 1VQ8I 3MZ8A 2EIKH 4RAGA 1WPKA 3DXJF 1XC5A 2K02A 4M9XA 4FCYA 3CLOA 2DOFA 1P4XA 3F3XA 4E70A 1YE9A 1RNLA 1IN5A 2QQAA 1P6RA 4QPQA 2L5QA 1KQ8A 1PVEA 3SYTA 3WE2A 3GTOJ 4CYCA 1Y8RB 5CVRA 1MNDA 1I50J 2L7ZA 1FPQA 3L2WA 1P92A 1ZGJA 1MBHA 3X2QH 5ED4A 5C44J 2P5LC 3GLXA 3LFUA 2X0LA 3TO7A 3LSMA 5IP9J 4LLGF 4BGDA 3HOTA 2E1MC 3M1CA 1T08B 3PFIA 3JRAA 1GDTA 1LDJA 3LSHA 2JSCA 3PQKA 3LSTA 4NC7A 2UUZA 3ZQLA 3V8JA 2QCOA 4GDFA 1FP2A 1YI2I 2VXDA 3CCLI 2AXTC 4RGSA 4AM3A 1TLHB 3OIQA 4E7HA 1QNTA 4RB2C 1KU2A 4A6DA 3ZP5A 5C4XJ 4HX7A 5HLIA 3S14J 2DTRA 2ESHA 4LFUA 1HC8A 3VPRA 2I10A 3M8JA 1WVRA 4F93B 4XICA 2O8KA 5EGOB 3E6BA 2KIQA 2DFFA 2R5ZA 2JSPA 4CSWA 3FXUA 3DLAA 3L2RA 4MFEA 3KFWX 3OSGA 3LSIA 1D1CA 4D0PA 4JX6A 3KZZA 4NHJA 3ZCOA 2WWYA 3JSOA 3MMYB 3CC2I 3VB2A 3CO6C 1KQ9A 2W00A 4HF0A 2STTA 3P7NA 5M5XJ 2Q0OA 3VOEA 4B3AA 4WK8F 4O5VA 4E6KG 3L2CA 1JUSA 3JCUC 3WG9A 1OR7C 1ETKA 4BY7J 2DO7A 2VKVA 3J80Z 3ERED 2QBYA 3GBGA 4RLQA 3RZOJ 3SFZA 1X3WB 5B1AH 1S6LA 5LFAA 1AU7A 2PEXA 2VBZA 3PNVA 3ONQA 2LY1A 4HV6A 2XSDC 2DW4A 3FZVA 2DMUA 3C2BA 4XN0A 4CCNA 2H8RA 1WJDA 4IHTA 1UELB 2NVQJ 2VL8A 3K70C 1ZGAA 3MN2A 1VF9A 4GYGA 2VKHA 4RGRA 2YSRA 2B7EA 2EFQA 4WXDA 2JQ7A 1HOMA 3LWFA 2BY3A 1EH8A 1UHSA 2QQBA 2LH9A 3N05A 4WX9A 2PI0A 1JKPC 4S04A 2EBIA 2PMHA 1CGPA 4G94A 3C3WA 1BR1A 2XPVA 4HV5A 2OPTA 2HEOA 1O7FA 1MJAA 4IRIA 3EUKL 2VQGA 1U2WA 2A05A 4TV7A 5F1JA 3R0AA 4XN3A 4EV0A 3DPTA 2GXAA 4UUTA 2MGQA 3HG9A 5KNLA 5E1WA 5F08A 5ICGA 1L3LA 3O2PE 1A5JA 3JRCA 4UV9A 2X85A 1OISA 1SAUA 4ZTFA 2QF7A 3KEOA 2STWA 4XKVA 1A36A 4HYEA 1GVJA 4FISA 3HOVJ 1U0JA 4IQ4A 1UG0A 1S7OA 3F21A 1TTYA 2HS5A 1T56A 2XGDA 2DA4A 2HYGD 1DP7P 1MBJA 1IUFA 1BN5A 2XGEA 3P5JA 1HW2A 3OY9A 4KMFA 2Y9YA 2HYJA 2WTEA 2L4MA 4HDUA 3T1BA 2D5VA 1YITI 4L5JA 3K69A 3RKYA 3Q0VA 2E1NA 5J8FA 3OYAA 4LLNA 2NYXA 4UXNA 2VOPA 4FE4A 4F55A 2W57A 2DA3A 4A3MJ 3KE2A 2GAUA 3T0YA 4PZJA 2HQAA 2X6OA 2K7LA 1QZYA 2FBIA 2NNNA 2NVUB 1R71A 1GT0C 1IN4A 1O3RA 4B4CA 2HQNA 4XLAA 2O5RA 2CQNA 5M5WJ 3GEZA 1XGSA 1A04A 4MNUA 3G1LA 2M8EA 3PL8A 1J9IA 5EYRA 4ZH4F 3ABUA 2HNHA 1D0ZA 1ZGWA 3CC4I 1JUMA 1Z7LA 1MZBA 1XDUA 2J5OA 1S5LC 3CDIA 3CCRI 2PMZA 3DTEA 2CG4A 2PJRA 3LQRA 3GUDA 2L9SA 1HQCA 1R23A 2HKOA 3FXLA 2LKXA 1FMWA 2A6HF 3H3ZA 2R7UA 4FE7A 2M87A 4AVPA 1W36C 2EQRA 1USTA 5DM7F 2OUMA 4NDLA 3CMYA 2VOOA 3W2AA 2Q1ZB 2A68F 3J7YJ 5IT9Z 2H6CA 2ID3A 2KQRA 4BYYA 1XGNA 1SMTA 2DMPA 3KLOA 3DU6A 3WU0A 5K1YA 2HDDA 3G3ZA 4IPAA 3QYBA 2BEOA 2K9SA 1OCOH 2DA2A 4KIGA 5D6FA 3COAC 2B9SA 1FOWA 3A4CA 2DOAA 2K9QA 4KIFA 3CF5F 5DTDA 2CW8A 3F22A 2K40A 3LOCA 4XM3A 3CJQB 4FETA 5GADJ 1FX7A 2EILH 3W3CA 2Z3YA 2JWTA 4LJZF 2HZDA 3AG4H 3BLYA 3WTTC 2VPLA 1JTYA 2KRHA 2MC4A 3MKZA 1YS7A 4WF2A 2H1KA 5DCMA 5J4YA 4BJTA 4PSXA 4Q48A 3CMEI 1MMDA 2NS8A 2F48A 1B8IA 4I0AA 4L9JA 5EEHA 2LC2A 2RQQA 3FKIJ 3HYIA 3U2RA 3F8BA 1IUYA 4XLFA 3GX4X 5LEJA 5GAEJ 4EMSA 1BL0A 4DW6A 2VONA 2KKOA 1J7KA 1WCMJ 5K5RA 2VJ5A 5DYMA 4I01A 2G7UA 1YRNB 4DJAA 4CGZA 5FLXZ 2CV0A 4X0GA 2MLGA 2HGCA 2K3PA 3K4KA 1JTXA 1HKQA 2CH0A 4I6ZA 2WADA 4I98B 1XSXA 3SEQA 3CCVI 2L7MP 4PFOA 5J3LA 1NH3A 4UV8A 3FBNB 1OCZH 3CC7I 3ZQIA 3V42A 3CDHA 4XK4A 3A2KA 3CLQA 3IAM2 4CYCB 4G7OF 2WA0A 4KA4A 3QODA 1O4XA 4B3XA 3KPHA 4L9VA 4XLCA 1VQ5I 1P7IA 4RMNA 2V9VA 2PLYA 3UNGC 3QPHA 2XF5A 4OIPF 1U78A 2L9NA 2GZWA 1Y56A 1IW7F 3H5NA 3O3KA 2V1DA 2E1MB 3VYUB 3IL2A 1SMYF 3QQAA 3CJNA 3FBIB 3TDUC 2TCTA 2CS3A 4MQVA 4YIFA 2GOMA 3R60A 5E17F 5LLQA 4BL0B 3WODF 4OOIA 3OOUA 3QU6A 1X3ZB 2LK2A 2QWWA 4DOZA 1B9MA 1FC3A 1BW5A 2R7ZJ 3C18A 4LD5A 3JRBA 3DTIA 1B59A 3S3MA 4B8XA 3OR2C 3RKQA 1MBEA 2M7BA 1WH5A 5LGUA 4FX4A 2DA6A 3W6JB 4AD9A 2IGOA 1ETOA 3GF2A 3BZ6A 4UHTA 1YIOA 4QLCU 1QRYA 1R4MB 1T98A 4ESJA 3WGHA 1R1UA 1FNNA 3K4BA 2IP2A 2F5EA 1KQ0A 3OIOA 3KP3A 1XSVA 2Y69H 4RLFA 3BR6A 1ZTRA 4IJAA 3RKWA 5J8CA 2LREA 5JHFA 4XOPA 5HNFA 1ZHFA 2VQHA 2R7OA 4CH7A 1KZHA 5J40A 4ESBA 2L02A 3K4MA 4O6JA 4Y7NJ 1QGPA 4G8XA 4C2UA 5D5WB 2DLLA 3FMSA 4I02A 3GTJJ 1P2FA 2OTLI 2IEKA 2IXSA 3DEEA 2K5CA 3BQYA 2XF6A 3UR3C 2X9DA 5KVRA 1YG2A 3ASOH 2DK8A 1DQUA 5EGOA 4L9TA 3WTVC 2FOWA 1D5YA 1SFEA 1ETXA 1B72B 2CFXA 2CQQA 4YELA 2VQLA 1FSHA 5CVVA 2HTJA 2DMNA 2Y0SA 3OYCA 2PMUA 2ZBKA 2UXNA 2XKOA 3FKJA 1G3WA 3I5UA 4IHSA 2QLZA 2Z1DA 3H9QA 2ETHA 4XOTA 2AHQA 4AWXB 1TW3A 2JPBA 3LA3A 2ZXWH 4II2A 3JRGA 5JI6A 2PQ8A 1Y6IA 3V4GA 2EZHA 1HF0A 2E5ZA 1CF7B 3NEUA 3E5QA 5GP9A 5FFZA 2L9VA 4ZZDA 1DPRA 4ZYDA 2KRFA 1R5GA 2PFBA 4RDUA 4M9SA 1Z1DA 4Y52J 1D0YA 1LDKB 5F0FA 2E1CA 3JRFA 1WJAA 4UVBA 4I0BA 5JLXA 3WTSC 1K78B 3OL3A 5BPDA 2P8TA 2DT5A 4HPQA 3HPHA 3E5UA 4E7SA 2CU7A 3CQZJ 4XKWA 2M30A 2ZFUA 2D45A 4F92B 5DS9A 4EM1A 2ZC2A 4IRGA 3K2AA 4BQOA 3SQNA 2XAJA 1FOYA 4ESFA 1TNSA 3TQNA 3VSLA 3C7JA 1Z67A 1BIAA 1BIBA 3BR0A 3K6GA 1ZG1A 1SC7A 4R8HA 3ZQGA 4I99C 1ERDA 4MQ9F 1I39A 4XONA 3DPLC 3A0BC 1V3FA 3PQJA 3KYLA 4A3BJ 2UWMA 3CUQC 4IOAF 4G9YA 5D8KB 4IOCF 3EETA 3ULQB 1IRGA 2NVYJ 4XRSA 2LVSA 1OYWA 5IP6A 2EFOA 3D1NI 3PSFA 4PJNA 4BHCA 5DD4A 1HCRA 1K7AA 2H6BA 1HSTA 2IAIA 4ZDOA 2MYSA 2VQCA 1JGSA 3OYGA 1IRFA 2E7WA 1YW9A 1PJRA 4IHWA 2ZKZA 5EJCA 4BQAA 1LKXA 2B0LA 1X1DA 4AU7A 5B5EC 5FKMA 3SDGA 2EIJH 2X4HA 5TISC 3KP2A 1K6OA 2OAZA 1VQNI 4BQNA 1SAXA 4YRVA 1F4KA 2ZCWA 1OPCA 2GXGA 2KFDA 2YUSA 3ZQ7A 2NRAC 3LSGA 2MFZA 2XHKA 3BJAA 1PYVA 2HI3A 2BE5F 4ZC3A 1YOVB 4GGGA 3D0SA 1JI8A 2KISA 3HRMA 2LSOA 2R3SA 5DEQA 1X1PA 3GTQJ 2Y75A 1IN6A 1A6IA 3RQ4A 1YYVA 3IHUA 3J81K 2JRMA 4I7HA 3W2VA 4GRIA 1Z0XA 1OYYA 3ZN0A 3B02A 3O8HA 1LB2A 3M7GA 1R7JA 1JJ6C 1SEUA 4BHBA 1R49A 2GM4A 1HBXG 3NQOA 1E3OC 1XTAA 4BJ5C 3L00A 1WSUA 3BROA 4LGWA 1T38A 2MH2A 4O3MA 1RKTA 4DBRA 2KJBA 1U9NA 3EUHC 2BXYA 1S9HA 5FKKA 1MJ9A 2QUFA 2VASA 4OAYA 2DPUA 2ZJRF 3WTWC 3MEXA 3ZQHA 2FOKA 4IHVA 4XLHA 2H8WA 2X6XA 4CCLA 1OFCX 4N9IA 3K7AJ 2DXIA 3W2WA 1IN8A 1VTNC 3IWZA 4RGXA 1P7JA 1FZPB 1VFCA 2EFNA 2OC6A 4N4NB 4V2FA 1GVDA 2L7FP 2R4GA 3JTHA 1O3QA 4KFCA 2LR8A 4BACA 1I6XA 2P0WA 3AG1H 3FM5A 1T95A 1WRJA 1BI2A 3BP8A 4ENMA 1KA8A 3I3LA 2W48A 3B6CA 3OOPA 4G6DA 5A2QZ 2RREA 1Y0NA 3HTUA 5IP7J 5B66C 1JT6A 5EEAA 1QQIA 1I6HJ 1PP8F 2ADUA 2WV1A 3HRSA 2DN0A 4KN7X 3ZRGA 3RKXA 3BCBA 4QSHA 4AIHA 2BOLA 1YRNA 1B9NA 4MFDA 3Q9VA 4CDGA 3JSPA 1ZG3A 4IO9F 1TQMA 3WU2C 2KDOA 3ZQFA 1N78A 5F27A 1YJNI 2XF7A 4PSWA 1XMXA 4KISA 1RIOH 1BI1A 2E2IJ 4HLXA 1FYKA 3FM3A 3LSRA 1UZCA 3IH2A 1YJWI 3RTRA 4ENNA 4CA0A 1ULYA 1QPIA 1X4PA 3P9KA 3HIFA 2MABA 2IGKA 4JX5A 2NS7A 2FBHA 5TJJA 4CYDA 4HW0A 1WFXA 2IS6A 4A0XA 3R0JA 4A0ZA 2HDCA 2BBYA 2CO5A 2CUEA 3BT9A 2Y9ZA 1XB4A 3A01B 2DK5A 3ZMVA 1BOAA 2VC0A 3HXLA 4RM3A 2CQ7A 1JGGA 5FROA 3DEUA 1FY7A 2VKDA 2XAGA 2KJCA 3BG3A 3BQZA 3F8FA 3HHHA 2MC3A 3AKZA 3H5AA 2QM3A 4L18B 2M34A 3SFIA 3TP0A 1JXSA 2ZJPF 4LK0F 3QRFF 1G3TA 2JMWA 2QQ8A 2IPQX 1G8XA 3K9TA 3OL4A 4ZZLA 4HNVA 1EF4A 3E3VA 4IX7A 4D7MA 2L9RA 2BY0A 5TRDA 2OD5A 5E3MA 2P4WA 2LYCA 4BE2A 5JVTA 4NC6A 3HRTA 3K10A 3N97A 2F4MB 3F0CA 4PJJA 3ZMUA 1F5TA 4XSZF 2X51A 3L09A 3LSKA 6PAXA 4C2MJ 2QSHX 2WAQA 3GTGJ 1TBXA 1OYIA 3K0LA 2WY8Q 5JLWA 1VQLI 1YQAA 2LTPA 2IA2A 1RUNA 5H6RA 4EJVA 2K85A 3BR2A 2LG4A 3GTLJ 3H92A 2V4JC 4XKBA 2P5KA 2TDXA 2Z2SB 2FJ1A 1R36A 1OCCH 2ELJA 2R93J 2V9PA 1EA3A 4XORA 1OR7A 2BHYA 2FNPA 3CJTB 4J01A 3GFMA 2L4AA 4A6EA 4AYBN 2H09A 4Y13A 3S1RJ 1HLVA 3HOYJ 3PO3J 1DPUA 4CCKA 1TT5B 3ZMZA 2JUGA 1ZQ3P 1RPWA 2JA6J 1UMQA 4G12A 3S93A 2EJRA 2ZSIB 2M3AA 2HYFA 1R1TA 2X6YA 3DBLB 3OYBA 1K4TA 2PN6A 5E8GA 2YU9J 2KRCA 4RB0A 2YU3A 4NBQA 4U7BA 1I3QJ 3L1PA 3BZCA 2LOOA 4JQFA 2OCEA 1B72A 3LFKA 4HDVA 3LMMA 2EFPA 3M07A 5C3EJ 1XMAA 2PMZN 2LRDA 1OCRH 1GXQA 4B1RA 2H1LA 2FQ4A 2XROA 4DBQA 1MMNA 4JOMA 4A2UA 2KMUA 4F52A 2IGMA 2C6YA 2VUMJ 3W6VA 2N8GA 2W4SA 5DD8A 2E5NA 3CTAA 1J2XA 3BCAA 3QYFA 2JA5J 3S32A 4V19K 2LFBA 3CUQB 5E3OA 5GTHC 2X1EA 1CF7A 2CQKA 2ECCA 2W1OA 3QWLA 1ZK8A 1BI3A 2CYYA 1G3YA 3BPXA 3VEPA 2HWVA 2CW0F 1VQOI 1IXRC 2K9NA 1XCBA 4KMUX 2O7OA 1K78A 1MD0A 2CUFA 3BG9A 3MKYB 3DF8A 1GV2A 4C3IJ 3HZJA 5KHDA 3IH3A 1A31A 3IRQA 1TWCJ 4BDZA 4BXUA 3HB9A 2DFHA 2DDBA 3OS2A 1D8JA 4Y4RA 4ABZA 1D0XA 2M4KA 2EV6A 4A3CJ 4LOCA 3EUAA 2NOGA 5FD6A 2A07F 2QSFX 3KEYA 1RI7A 2Y31A 2O6GE 3IV5A 1ETQA 3E5XA 5HODA 3FXMA 2WAEA 5AIQA 2MW8A 2K9LA 4ITVA 2KZVA 2V1NA 1X2MA 4CCMA 1S29A 4EATA 3ABLH 4GO1A 1YS6A 4Q5SF 2QENA 1ENHA 3GZNB 4U0VA 4R1HA 3ZMDA 2PBIA 2GLOA 3VODA 1K6YA 2V79A 3VYRB 4C3HJ 3V8LA 2GBYA 3TOBA 4EJTA 5CPRB 3OYHA 2DOEA 3TP3A 2RKHA 3BC8A 3GZ6A 2VI6A 3QP5A 3VYTB 5L3DA 3HBLA 4ENJA 4W97A 2XPUA 3RPQA 1OKRA 3ECHA 2R5YB 4IZZA 1MIJA 1IJWC 5IYCJ 4XRMA 3H1CA 3I53A 5KK1A 2EB7A 1R1VA 4MTDA 1S7AA 1XDSA 2XRLA 4XBFA 4XLEA 4Q4ZF 3EQLF 2W25A 2Z33A 3E6CC 1ZARA 5GAHJ 3WTUC 2RAEA 2IGNA 3CD6I 3GTMJ 2DA7A 4LB6B 3JAMK 3ZXSA 3LAPA 1WJBA 3MQ0A 5HDGA 4BUPA 3CCSI 3V7CA 3WTZA 1XD7A 1GHCA 1KU9A 1DGWY 2DMTA 2VJ4A 2XDVA 3OYFA 4ETSA 4MEXF 3ZN1A 3BG7A 2OTJI 2X48A 2DA1A 1ACIA 2ISYA 3IWFA 1O57A 1HA8A 4XL9A 2ZO4A 3JR9A 5HLHA 5H20A 2F4OB 1S8NA 1TWFJ 3GWZA 1APLC 2ZMEC 5FKOA 4E7ZA 5B3SH 3KYDB 4MLOA 5LEKA 1R22A 4HLYA 4M6VA 1IXCA 4N0BA 5FB2A 3L9FA 5FJ8J 2F5VA 3A0HC 2BZTA 2V6EA 1FIAA 2XAUA 5KCMA 2KZGA 5EZGA 5FRMA 3JRHA 1BM9A 5CQGA 3H35A 4EM2A 4RAZA 1O3TA 3Q0WA 4BNCA 1BR4A 3BTLA 1HDPA 2DFIA 4GYIA 3ECOA 3JRDA 1VQ7I 4HEA2 5IOZA 1WJEA 3M1EA 3RI4A 4CXFA 2XB5A 1H88C 1E2XA 4NQWB 2J5PA 4P9FA 3BG6A 3TBIA 2JA2A 1Z9CA 1V5EA 3SHFA 2EA4A 3S2DJ 3KP7A 1RESA 5ILSA 3RCOA 1V5GA 2A61A 1G59A 1E3PA 2JVGA 3I9V2 4R79A 3F6VA 3OYNA 1UG2A 2JUCA 3BZKA 2KIUA 5ILVA 3I0TA 4DNCA 1VI0A 3I64A 1TZLA 4G6TB 1ZRCA 4FX0A 2LKSA 3ZPLA 2E35A 2Z5UA 3PUBA 1ZRDA 2BVLA 1IF1A 4BH9A 1SVLA 5H2FC 4C30A 2CQXA 1RC9A 1V55H 3H0GJ 1FYMA 2F5CA 3CCJI 1WZ2A 4G7ZF 3FX3A 3GMEA 1G2HA 5EEGA 2AQEA 3RQIA 1IN7A 4EQQA 2QKMB 4B48A 1F9NA 3M8EA 3DEWA 3A1YA 3IH4A 1I1GA 2Y0SN 2RDPA 2K4JA 1IDZA 2MSYA 1VQ4I 1TWHJ 2QEXI 1U5TC 4GXOA 2OJED 3DBRB 3PIPF 4G6QA 1J5YA 4MEYF 3S2WA 5DV5A 4HQEA 1MW7A 4CICA 2YX4A 1O3SA 5M3MJ 2VODA 1AA7A 3DFGA 2EZLA 3FF5A 2FMYA 3PUFA 3QP6A 4LB5A 5CJ9A 3FXJA 1BC8C 1NHAA 1QHHD 1DU6A 1QZEA 4RB3C 4Y15A 2LF7A 3WU1B 4HSRA 1U9OA 4CCJA 3A01A 4MGRA 1TQPA 4Y33A 4WWCA 1MMSA 3VSKA 3LSJA 1W1WE 4M3DA 1KGSA 2MD5A 1R5HA 3K1NA 5K7ZA 3MKWB 2FRHA 2PX9A 1O7LA 2G0EA 2IBDA 5E1XA 1W5TA 4D5FA 3K1PA 1PUFB 2KT0A 1WJCA 4PFPA 4BBSJ 1MDMB 3LL7A 4W1UA 3QU3A 1JT0A 3GO5A 2VBYA 4JP0A 1WJ5A 3I59B 3EDPA 1T0FC 2Q2EB 2WC2A 3QYEA 3HJEA 3K2ZA 2LD5A 5FGMA 4F7ZA 3L2UA 1YJ9I 2E2HJ 3HGYA 2HOEA 5IYDJ 1GUUA 2NOJB 2VPRA 3FISA 1T8IA 3LAJA 2W85A 4HA8A 2DI3A 2HDWA 3DV8A 5HLTA 3J80K 4NUBA 2ELHA 2WAFA 4ZYHA 5LGNA 1JE8A 1T2KA 3KYCB 3T8TA 3J7ZI 4A3JJ 4A5MA 1ZELA 1UAAA 1QA6A 2DCEA 2V1UA 4OAZA 3DP7A 3S1MJ 4MHGA 3O8GA 2AS5F 1IXSB 3OIPA 2FMLA 1Z3XA 4P5OA 5ILUA 2QKLB 1X3UA 2HVSA 3QPTA 4J19A 2ELKA 3NARA 2H94A 3MD2A 2I8DA 3OV8A 4I76A 3HOZJ 2HXIA 3PIOF 1TWAJ 3FMQA 2DMQA 3FK6A 2B63J 4BE1A 2VT3A 4M3FA 3P9IA 4FASD 4XMYA 4B47A 1N75A 5GAGJ 2OCCH 3DKYA 1IGNA 4ANJA 4A93J 3HKZA 2E19A 2CWEA 1RETA 4E7IA 2IS1A 4PJMA 2OQGA 1VQMI 3ZQCA 2Y30A 2BVMA 2Z16A 4E7KA 3CP2A 3IUOA 3E0JB 2K86A 3OYIA 4HRIA 4U87A 3HOWJ 1KONA 1H8AC 1SFKA 3R6SA 4OMYA 1RUOA 3O6BB 2DA5A 3HPGA 3N4MA 4MIMA 2WBMA 4ASNA 1Z3YA 3GZ5A 2VN2A 5BPIA 2LBFB 2NXNB 2BY1A 1LEBA 5FO5A 2LY2A 1MBKA 4RB1A 2F5FA 1QVUA 2JVHA 2L54A 1S72I 4Z2YA 1K83J 1Q1VA 5K5OA 1MSFC 4D5CA 4HF1A 1KU7A 3CUQA 3ROUA 5CKTA 1U6GA 2MA3A 4IL6C 1AKHB 1FWZA 1UFMA 5F04A 3TMOA 4IF4A 4YFXF 1Y39A 4BKXA 4YG2F 1A35A 3CDLA 2DODA 4BEHB 1LDDA 2DFEA 3DTKA 5D4SA 2EV5A 2HVQA 2DTZA 5FFXA 1ZG5A 2XC7A 1D3YA 3A02A 1ZAOA 5D5UB 3DU5A 2ZXIA 1ON2A 9ANTA 4BDYA 1KYZA 2R7WA 3LQQA 4BHPA 2CUZA 4UB6C 2GOXB 4FTHA 2JA7J 2DQLA 3M9AA 1BR2A 5ICEA 1I5ZA 4B43A 1ETVA 5L3EA 4G7HF 1B6AA 1XPXA 3G71I 1BI0A 1LFBA 3F8CA 1D8KA 2D1VA 2RQPA 4LG0B 2UV1A 1XN7A 4ZYAA 1CQTA 1OJLA 3FXOA 4BQQA 4KDPA 2M9HA 4GCVA 3CO7C 1QZZA 2DU9A 2RNJA 3WGIA 2E7XA 5F0CA 1R5ID 1R9TJ 1F43A 3EPZA
chains in the Genus database with same CATH topology
4U88A 2M5WA 1TNTA 2ZMEB 5IT9K 3SXYA 1W7PB 2G9WA 1RZ4A 2EK5A 2FNAA 1E17A 1ONVA 3BPVA 3R61A 4PCQA 3G73A 4M73A 3F23A 4OU0A 4K2EA 2L3DA 2XASA 3RYRA 3EUHA 1XGOA 4A0YA 5CVJA 4L9NA 4WXHA 3BWGA 2V6CA 2IRFG 2K27A 4KT5C 4HBLA 1W5SA 5LRSA 1Z91A 2AXLA 2COMA 4ON0A 5E1ZB 1Y0UA 1YW7A 3FMRA 1FYLA 3U9GA 1AWCA 3GFIA 3REOA 3KZYA 4M6XA 1KYWA 4BAYA 3P9CA 5AIPA 4N9HA 5FLXK 1Q1HA 5K5QA 5HS7A 4PGGA 2HTSA 2P5VA 5CYVA 3Q5FA 3IKTA 5BOXA 4EJUA 3BY6A 2V1XA 1DDNA 1U5TB 2FQ3A 1G6NA 3IC7A 5L3FA 4NQWA 3CUOA 2XKPA 1USSA 1DUXC 5DUKA 2A6EF 5HS8A 4WCGA 5LRRA 3V8KA 4EJOA 1YTYA 5LHHA 3HHGA 3DQVC 3BDDA 3FXQA 1H9TA 2OU2A 4I09A 3E97A 5CVUA 2EV0A 2NNYA 2KIFA 1YO5C 3JW4A 1HXDA 4UVCA 3BJOA 4Q47A 1EV7A 1T39A 3QAHA 4I2OA 5D8LB 2VC1A 2GXBA 3HTSB 4EJWA 1ZLJA 3T5XA 5L3GA 4YIIA 5JHUA 2HZTA 3HSRA 2IW5A 4IXAA 2W24A 3KP4A 1J59A 4Y17A 4IRHA 2XAHA 2Y48A 3V7RA 2FU4A 2LF8A 1ZLKA 3QOPA 2LDUA 4XLNF 5L3BA 5BQTA 1MDMA 5D6EA 2DAOA 1V4RA 2D1HA 1Z6RA 3I59A 1I27A 2Q2EA 3JTGA 3RDIA 4M72A 4OIQF 1G4DA 4KIBA 2ZXJA 2YR2A 2JTVA 4U0WA 1ON1A 2M1BA 2EA2A 2UXXA 1R58A 4UVAA 3EYYA 2OQRA 4RAYA 3R4KA 1S3JA 2F2EA 5LBQA 2M45A 3D5LA 3C1DA 3I54A 2IA1A 3F72A 4JK1X 3H3UA 4M6YA 4WXCA 1TW2A 1LQ1A 3MFKA 2BV6A 3U1DA 5D5VB 4L5IA 2HKXA 3MCZA 4A5NA 5JFRA 3ELKA 3ZMTA 2Y0MA 2O3FA 3RYPA 1UB9A 4LK1F 3RIRA 1P4WA 3KP5A 1MGTA 5BMZA 1TQIA 2XIGA 1LVAA 2XAFA 4KICA 4PDKA 1KU3A 2FE3A 5IT3A 2D2WA 1XMKA 4DQ2A 4IVNA 1FBUA 1L0OC 1OMIA 2ZNZA 2GWRA 4CO8A 1R00A 5H6QA 1W4MA 4FHTA 4H0EA 2VXZA 2IVMA 2NAZA 4HOBA 2FEZA 3HOSA 1U8RA 1QO0D 1ZREA 1EH7A 4XLPF 1ZYRF 1MKMA 2DPDA 2OZUA 4HF2A 5E18F 4LG0A 1MJBA 4P96A 1LNWA 4M9ZA 3J81Z 3MWMA 1AOYA 1J75A 1EH6A 4L0YB 4L0ZB 1FP1D 1G3SA 2ZMEA 3GXOA 1W7PA 1FBQA 1LEAA 4MTEA 1P4AA 1B1BA 1QPMA 3HUGA 3TO9A 4HX8A 2XV4S 3ABTA 4U0YA 3AAFA 2O03A 1REPC 4RS8A 5HDKA 1YLFA 3B73A 3K1MA 4HQMA 2LNBA 3DKWA 3MAJA 1YFHA 2O61A 5J6XA 2VT2A 4OIOF 5A2QK 2CSOA 1QBJA 4EGYA 5LHIA 4CZZA 1WQ2A 2O8XA 3LA7A 1WKMA 3KCCA 5AONA 3E6DA 1BC7C 1HW1A 4JBAA 1SFUA 2KIMA 2G7HA 5ERIA 2BYVE 1XSDA 2RVCA 2RN7A 3T8RA 2L01A 1B4AA 2OBPA 2W84A 2IA0A 2VBXA 2H27A 2RGVA 3ML6A 3L7WA 1K79A 1BJAA 5FD5A 4EGZA 1U5TA 3RJPA 3TO6A 2FF4A 1PDNC 2ESNA 1UHMA 3WTXC 5BS6A 1Z6TA 2ACJA 3SZPA 2QVOA 5HVQC 3MZHA 3KETA 2F5DA 2HR3A 1HSJA 3I4PA 4NB5A 1UCRA 2NS0A 2GA2A 1T6SA 1Z05A 2EFWA 2ZFWA 3WTYC 4YFNF 1XCVA 1XGMA 2MLKA 2ISZA 2XRNA 2O0YA 3KEQA 2FXAA 3RPUA 1BBYA 2GA1A 1T0FA 3TDZC 2XVCA 1JHFA 1SD5A 3HSEA 4AIKA 2Q8KA 2QBYB 3FWEA 2WV0A 2Z9OA 3Q9SA 3LA2A 1ZRFA 4KN4X 1FOKA 2JPCA 3GYHX 5HS9A 1SD6A 1C0WA 4P9UA 4ZYGA 2A69F 3W6KB 1D5VA 4ENKA 4HAMA 4U7DA 4KUMA 5D4RA 4UNOA 2EWNA 3FHZA 1J0RA 1SD7A 1FLIA 1LJ9A 2P6TA 4RGUA 2QQ9A 3SZTA 1SFXA 2IJLA 5F6FA 2Z99A 5ICCA 2DQRA 2OA4A 2FA5A 5HLGA 3VFZA 2PJPA 5L3CA 3F8MA 4ZYEA 2K4BA 1W7PD 2XAQA 5F64A 1PP7U 2VBWA 4EVIA 2P6SA 4KYWA 2DBBA 3MZYA 1HKSA 2YX7A 1ODDA 1SD4A 4B09A 3IKVA 2ZJ2A 2R7FA 1ZH5A 1F1ZA 5CVIA 3KLNA 4HX4A 4PGHA 2JRTA 2YPRA 2BGCA 3V7SA 2PG4A 3WE3A 4AIJA 3F8NA 4OIRF 4OMZA 2CGPA 4HZFA 4M71A 1U3EM 1HW5A 2JT1A 3NRVA 3TOAA 3KP6A 1JHHA 5E20A 2UZKA 4LMYA 5JR3A 1HKTA 1WI9A 2FSWA 1H9GA 3HRUA 4KNYA 1WWXA 1IZ1A 1IAWA 2IT0A 5CLSA 4S05A 2P7CB 1PUEE 2LKPA 4YFKF 2FBKA 5DCFA 4XRFA 1FSEA 2XUBA 3ISPA 5LGTA 2JZYA 3GVAA 2MH9A 5HOOA 2OZ6A 5DCMB 4OINF 3JAMZ 4CHUA 1FBSA 4XSXF 2P7VB 5ICFA 3I71A 3FXRA 5LHGA 5DDGA 2XGXA 4M74A 3GFLA 3GFJA 3M8FA 3F6OA 1ZN2A 2MBFA 2QZ8A 5F1RA 4QWQA 5D5XB 5HDNA 5E8IA 3E6MA 1GXPA 4P55A 4EM0B 3I58A 2RV8A 2RC4A 1Z7UA 2ZNYA 5DUIA 2A5YB 3BOQA 3TGNA 4UUVA 4FT8A 3GW2A 2VE9A 1UHWA 4A12A 1H0MA 2GIVA 2HFHA 2GQQA 1FT9A 3ZMSA 2R7DA 3J7AO 1STZA 3EYIA 1YW8A 4LLLA 3WGGA 2HQRA 3TKYA 2VE8A 1I1SA 2A3SA 3IRRA 2QYOA 3BJ6A 3DXJF 2K02A 4M9XA 3CLOA 1P4XA 3F3XA 4E70A 1RNLA 1IN5A 2QQAA 1P6RA 1KQ8A 3WE2A 5CVRA 1FPQA 1P92A 1ZGJA 5ED4A 2P5LC 3GLXA 2X0LA 3TO7A 4LLGF 3HOTA 3PFIA 1LDJA 2JSCA 3PQKA 3LSTA 3V8JA 1FP2A 4RGSA 1TLHB 1QNTA 4RB2C 1KU2A 4A6DA 3ZP5A 4HX7A 5HLIA 2DTRA 2ESHA 4LFUA 3E6BA 3FXUA 3KFWX 4D0PA 3KZZA 4NHJA 2WWYA 3JSOA 3VB2A 3CO6C 1KQ9A 4HF0A 2STTA 3P7NA 2Q0OA 3VOEA 4WK8F 4O5VA 3L2CA 3WG9A 2DO7A 3J80Z 3ERED 2QBYA 3SFZA 1S6LA 2PEXA 2VBZA 4HV6A 2DW4A 3FZVA 4IHTA 1ZGAA 4GYGA 4RGRA 2YSRA 2EFQA 4WXDA 3LWFA 1EH8A 2QQBA 4WX9A 2PI0A 4S04A 2PMHA 1CGPA 4G94A 3C3WA 4HV5A 2HEOA 1O7FA 1MJAA 4IRIA 1U2WA 4TV7A 3R0AA 4EV0A 3DPTA 5E1WA 5ICGA 1L3LA 3O2PE 4UV9A 3KEOA 2STWA 4HYEA 1GVJA 1S7OA 3F21A 1TTYA 2HS5A 2HYGD 1DP7P 1BN5A 1HW2A 4KMFA 4HDUA 2WTEA 2L4MA 3T1BA 4L5JA 3K69A 3RKYA 2E1NA 5J8FA 4LLNA 2NYXA 4UXNA 2VOPA 2W57A 3KE2A 2GAUA 3T0YA 4PZJA 2K7LA 1QZYA 2FBIA 2NNNA 1IN4A 1O3RA 2HQNA 3GEZA 1XGSA 1A04A 4MNUA 2M8EA 1J9IA 4ZH4F 3ABUA 1MZBA 1XDUA 2J5OA 2CG4A 3LQRA 3GUDA 1HQCA 1R23A 2HKOA 2A6HF 3H3ZA 2M87A 4AVPA 1USTA 2VOOA 2A68F 5IT9Z 2H6CA 4BYYA 1XGNA 1SMTA 3KLOA 3WU0A 5K1YA 3G3ZA 4IPAA 2BEOA 4KIGA 5D6FA 3COAC 4KIFA 3F22A 1FX7A 2Z3YA 4LJZF 3WTTC 1YS7A 4WF2A 5DCMA 4Q48A 4I0AA 4L9JA 5EEHA 3HYIA 3U2RA 3F8BA 1IUYA 3GX4X 5LEJA 4EMSA 2VONA 2KKOA 1J7KA 5K5RA 5DYMA 4I01A 2G7UA 4CGZA 5FLXZ 2MLGA 2HGCA 1HKQA 4I98B 1XSXA 4UV8A 3CDHA 4G7OF 4KA4A 4L9VA 2V9VA 2PLYA 3QPHA 4OIPF 1U78A 2GZWA 1IW7F 3O3KA 2V1DA 3IL2A 1SMYF 3CJNA 3TDUC 4MQVA 4YIFA 3R60A 5E17F 5LLQA 3WODF 4OOIA 3QU6A 2QWWA 1B9MA 1FC3A 3C18A 4LD5A 1B59A 4B8XA 5LGUA 4FX4A 3W6JB 4AD9A 3GF2A 3BZ6A 4UHTA 1YIOA 4QLCU 1T98A 4ESJA 3WGHA 1R1UA 1FNNA 2IP2A 2F5EA 1KQ0A 3KP3A 1XSVA 4IJAA 3RKWA 5J8CA 1ZHFA 4ESBA 2L02A 4O6JA 1QGPA 4G8XA 5D5WB 2DLLA 3FMSA 4I02A 1P2FA 5KVRA 1YG2A 2DK8A 4L9TA 3WTVC 1SFEA 2CFXA 1FSHA 5CVVA 2HTJA 2PMUA 2ZBKA 2UXNA 2XKOA 1G3WA 3I5UA 4IHSA 2QLZA 2ETHA 4AWXB 1TW3A 2JPBA 3LA3A 5JI6A 2PQ8A 3V4GA 1CF7B 3NEUA 3E5QA 5FFZA 4ZZDA 1DPRA 4ZYDA 2KRFA 1R5GA 2PFBA 4M9SA 1Z1DA 1LDKB 2E1CA 4UVBA 4I0BA 3WTSC 1K78B 5BPDA 2P8TA 2DT5A 3E5UA 2M30A 2D45A 4EM1A 4IRGA 3SQNA 2XAJA 4ESFA 1TNSA 3TQNA 3C7JA 1BIAA 1BIBA 1ZG1A 4R8HA 4MQ9F 3DPLC 1V3FA 3PQJA 2UWMA 3CUQC 4G9YA 5D8KB 3EETA 3ULQB 1IRGA 1OYWA 2EFOA 4BHCA 5DD4A 1K7AA 2H6BA 1HSTA 1JGSA 1IRFA 2E7WA 1YW9A 2ZKZA 4BQAA 2B0LA 2X4HA 3KP2A 1K6OA 2OAZA 1SAXA 1F4KA 2ZCWA 1OPCA 2GXGA 3ZQ7A 2NRAC 2XHKA 3BJAA 2BE5F 4GGGA 3D0SA 3HRMA 2LSOA 2R3SA 5DEQA 2Y75A 1IN6A 1YYVA 3IHUA 3J81K 4I7HA 1OYYA 3ZN0A 3B02A 1LB2A 3M7GA 1R7JA 4BHBA 1HBXG 3NQOA 3L00A 1WSUA 3BROA 4LGWA 1T38A 2MH2A 4O3MA 2KJBA 1MJ9A 2QUFA 2DPUA 3WTWC 3MEXA 2FOKA 4N9IA 1IN8A 1VTNC 3IWZA 4RGXA 1FZPB 2EFNA 3JTHA 1O3QA 4KFCA 1I6XA 3FM5A 1WRJA 1BI2A 3BP8A 4ENMA 1KA8A 3OOPA 4G6DA 5A2QZ 3HTUA 1QQIA 1PP8F 2ADUA 3HRSA 4KN7X 3RKXA 4AIHA 1B9NA 3Q9VA 4CDGA 3JSPA 1ZG3A 1TQMA 1RIOH 1BI1A 4HLXA 1FYKA 3FM3A 3RTRA 4ENNA 1ULYA 3P9KA 3HIFA 2FBHA 5TJJA 4CYDA 4HW0A 4A0XA 3R0JA 4A0ZA 2HDCA 2BBYA 2CO5A 1XB4A 2DK5A 3ZMVA 1BOAA 2VC0A 3DEUA 1FY7A 2XAGA 2KJCA 3F8FA 3HHHA 2MC3A 2QM3A 4L18B 1JXSA 4LK0F 3QRFF 1G3TA 3K9TA 4ZZLA 2IPQX 3E3VA 5TRDA 2OD5A 2P4WA 5JVTA 3HRTA 3N97A 3ZMUA 1F5TA 4XSZF 3L09A 6PAXA 1TBXA 1OYIA 3K0LA 1YQAA 2IA2A 1RUNA 5H6RA 4EJVA 3H92A 2P5KA 2TDXA 1R36A 1OR7A 2FNPA 3GFMA 2L4AA 4A6EA 2H09A 4Y13A 1DPUA 3ZMZA 2EJRA 2HYFA 1R1TA 2PN6A 5E8GA 4RB0A 2YU3A 4U7BA 4JQFA 3LFKA 4HDVA 2EFPA 1XMAA 1GXQA 2XROA 4A2UA 2C6YA 5DD8A 3CTAA 1J2XA 3CUQB 1CF7A 2CQKA 1BI3A 2CYYA 1G3YA 3BPXA 3VEPA 2HWVA 2CW0F 1IXRC 1XCBA 4KMUX 1K78A 1MD0A 3DF8A 3IRQA 4BXUA 1D8JA 2EV6A 5FD6A 2A07F 1RI7A 2O6GE 3E5XA 5AIQA 1S29A 4GO1A 1YS6A 4Q5SF 2QENA 4U0VA 3ZMDA 4R1HA 2PBIA 3VODA 2V79A 3V8LA 3TOBA 4EJTA 2RKHA 3GZ6A 3QP5A 5L3DA 4ENJA 3RPQA 1OKRA 3ECHA 3I53A 5KK1A 2EB7A 1R1VA 4MTDA 1S7AA 1XDSA 4XBFA 4Q4ZF 3EQLF 2W25A 2Z33A 3E6CC 1ZARA 3WTUC 4LB6B 3JAMK 3LAPA 3MQ0A 5HDGA 3V7CA 3WTZA 1XD7A 1GHCA 1KU9A 4ETSA 4MEXF 3ZN1A 2ISYA 3IWFA 1O57A 2ZO4A 5HLHA 5H20A 1S8NA 3GWZA 5LEKA 1R22A 4HLYA 1IXCA 4N0BA 5FB2A 3L9FA 1BM9A 4EM2A 4RAZA 1O3TA 4BNCA 2DFIA 4GYIA 3ECOA 3M1EA 3RI4A 4CXFA 1E2XA 2J5PA 4P9FA 1Z9CA 3SHFA 2EA4A 3KP7A 5ILSA 2A61A 4R79A 3F6VA 2KIUA 5ILVA 3I0TA 4DNCA 3I64A 1ZRCA 4FX0A 3ZPLA 2Z5UA 1ZRDA 1IF1A 4BH9A 1FYMA 2F5CA 4G7ZF 3FX3A 5EEGA 1IN7A 4EQQA 1F9NA 3M8EA 1I1GA 2RDPA 2K4JA 1U5TC 4GXOA 4G6QA 1J5YA 4MEYF 3S2WA 5DV5A 4HQEA 4CICA 2YX4A 1O3SA 2VODA 3DFGA 3FF5A 2FMYA 3QP6A 4LB5A 5CJ9A 1BC8C 1NHAA 4RB3C 4Y15A 2LF7A 3WU1B 4MGRA 1TQPA 4WWCA 1KGSA 2MD5A 1R5HA 3K1NA 2FRHA 1O7LA 5E1XA 1W5TA 3K1PA 1MDMB 3QU3A 3GO5A 2VBYA 3I59B 3EDPA 2WC2A 3K2ZA 5FGMA 4F7ZA 2HOEA 3LAJA 2W85A 4HA8A 2DI3A 3DV8A 3J80K 2ELHA 4ZYHA 5LGNA 1JE8A 1T2KA 3T8TA 4A5MA 2V1UA 3DP7A 4MHGA 2AS5F 1IXSB 2FMLA 4P5OA 5ILUA 1X3UA 3QPTA 2H94A 3OV8A 3FMQA 2VT3A 3P9IA 2CWEA 2OQGA 2K86A 3R6SA 4OMYA 1RUOA 3O6BB 3N4MA 4ASNA 3GZ5A 2VN2A 5BPIA 1LEBA 5FO5A 4RB1A 2F5FA 2L54A 4Z2YA 5K5OA 4HF1A 1KU7A 3CUQA 3ROUA 1U6GA 2MA3A 1FWZA 1UFMA 4IF4A 4YFXF 4YG2F 1LDDA 5D4SA 2EV5A 5FFXA 1ZG5A 1D3YA 1ZAOA 5D5UB 1ON2A 1KYZA 3LQQA 4BHPA 2DQLA 3M9AA 5ICEA 1I5ZA 5L3EA 4G7HF 1B6AA 1BI0A 3F8CA 1D8KA 2D1VA 2RQPA 4LG0B 1XN7A 4KDPA 4GCVA 3CO7C 1QZZA 2DU9A 2RNJA 3WGIA 2E7XA 3HSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U88 A;  2M5W A;  1TNT A;  2ZME B;  5IT9 K;  3SXY A;  1W7P B;  2G9W A;  1RZ4 A;  2EK5 A;  2FNA A;  1E17 A;  1ONV A;  3BPV A;  3R61 A;  4PCQ A;  3G73 A;  4M73 A;  3F23 A;  4OU0 A;  4K2E A;  2L3D A;  2XAS A;  3RYR A;  3EUH A;  1XGO A;  4A0Y A;  5CVJ A;  4L9N A;  4WXH A;  3BWG A;  2V6C A;  2IRF G;  2K27 A;  4KT5 C;  4HBL A;  1W5S A;  5LRS A;  1Z91 A;  2AXL A;  2COM A;  4ON0 A;  5E1Z B;  1Y0U A;  1YW7 A;  3FMR A;  1FYL A;  3U9G A;  1AWC A;  3GFI A;  3REO A;  3KZY A;  4M6X A;  1KYW A;  4BAY A;  3P9C A;  5AIP A;  4N9H A;  5FLX K;  1Q1H A;  5K5Q A;  5HS7 A;  4PGG A;  2HTS A;  2P5V A;  5CYV A;  3Q5F A;  3IKT A;  5BOX A;  4EJU A;  3BY6 A;  2V1X A;  1DDN A;  1U5T B;  2FQ3 A;  1G6N A;  3IC7 A;  5L3F A;  4NQW A;  3CUO A;  2XKP A;  1USS A;  1DUX C;  5DUK A;  2A6E F;  5HS8 A;  4WCG A;  5LRR A;  3V8K A;  4EJO A;  1YTY A;  5LHH A;  3HHG A;  3DQV C;  3BDD A;  3FXQ A;  1H9T A;  2OU2 A;  4I09 A;  3E97 A;  5CVU A;  2EV0 A;  2NNY A;  2KIF A;  1YO5 C;  3JW4 A;  1HXD A;  4UVC A;  3BJO A;  4Q47 A;  1EV7 A;  1T39 A;  3QAH A;  4I2O A;  5D8L B;  2VC1 A;  2GXB A;  3HTS B;  4EJW A;  1ZLJ A;  3T5X A;  5L3G A;  4YII A;  5JHU A;  2HZT A;  3HSR A;  2IW5 A;  4IXA A;  2W24 A;  3KP4 A;  1J59 A;  4Y17 A;  4IRH A;  2XAH A;  2Y48 A;  3V7R A;  2FU4 A;  2LF8 A;  1ZLK A;  3QOP A;  2LDU A;  4XLN F;  5L3B A;  5BQT A;  1MDM A;  5D6E A;  2DAO A;  1V4R A;  2D1H A;  1Z6R A;  3I59 A;  1I27 A;  2Q2E A;  3JTG A;  3RDI A;  4M72 A;  4OIQ F;  1G4D A;  4KIB A;  2ZXJ A;  2YR2 A;  2JTV A;  4U0W A;  1ON1 A;  2M1B A;  2EA2 A;  2UXX A;  1R58 A;  4UVA A;  3EYY A;  2OQR A;  4RAY A;  3R4K A;  1S3J A;  2F2E A;  5LBQ A;  2M45 A;  3D5L A;  3C1D A;  3I54 A;  2IA1 A;  3F72 A;  4JK1 X;  3H3U A;  4M6Y A;  4WXC A;  1TW2 A;  1LQ1 A;  3MFK A;  2BV6 A;  3U1D A;  5D5V B;  4L5I A;  2HKX A;  3MCZ A;  4A5N A;  5JFR A;  3ELK A;  3ZMT A;  2Y0M A;  2O3F A;  3RYP A;  1UB9 A;  4LK1 F;  3RIR A;  1P4W A;  3KP5 A;  1MGT A;  5BMZ A;  1TQI A;  2XIG A;  1LVA A;  2XAF A;  4KIC A;  4PDK A;  1KU3 A;  2FE3 A;  5IT3 A;  2D2W A;  1XMK A;  4DQ2 A;  4IVN A;  1FBU A;  1L0O C;  1OMI A;  2ZNZ A;  2GWR A;  4CO8 A;  1R00 A;  5H6Q A;  1W4M A;  4FHT A;  4H0E A;  2VXZ A;  2IVM A;  2NAZ A;  4HOB A;  2FEZ A;  3HOS A;  1U8R A;  1QO0 D;  1ZRE A;  1EH7 A;  4XLP F;  1ZYR F;  1MKM A;  2DPD A;  2OZU A;  4HF2 A;  5E18 F;  4LG0 A;  1MJB A;  4P96 A;  1LNW A;  4M9Z A;  3J81 Z;  3MWM A;  1AOY A;  1J75 A;  1EH6 A;  4L0Y B;  4L0Z B;  1FP1 D;  1G3S A;  2ZME A;  3GXO A;  1W7P A;  1FBQ A;  1LEA A;  4MTE A;  1P4A A;  1B1B A;  1QPM A;  3HUG A;  3TO9 A;  4HX8 A;  2XV4 S;  3ABT A;  4U0Y A;  3AAF A;  2O03 A;  1REP C;  4RS8 A;  5HDK A;  1YLF A;  3B73 A;  3K1M A;  4HQM A;  2LNB A;  3DKW A;  3MAJ A;  1YFH A;  2O61 A;  5J6X A;  2VT2 A;  4OIO F;  5A2Q K;  2CSO A;  1QBJ A;  4EGY A;  5LHI A;  4CZZ A;  1WQ2 A;  2O8X A;  3LA7 A;  1WKM A;  3KCC A;  5AON A;  3E6D A;  1BC7 C;  1HW1 A;  4JBA A;  1SFU A;  2KIM A;  2G7H A;  5ERI A;  2BYV E;  1XSD A;  2RVC A;  2RN7 A;  3T8R A;  2L01 A;  1B4A A;  2OBP A;  2W84 A;  2IA0 A;  2VBX A;  2H27 A;  2RGV A;  3ML6 A;  3L7W A;  1K79 A;  1BJA A;  5FD5 A;  4EGZ A;  1U5T A;  3RJP A;  3TO6 A;  2FF4 A;  1PDN C;  2ESN A;  1UHM A;  3WTX C;  5BS6 A;  1Z6T A;  2ACJ A;  3SZP A;  2QVO A;  5HVQ C;  3MZH A;  3KET A;  2F5D A;  2HR3 A;  1HSJ A;  3I4P A;  4NB5 A;  1UCR A;  2NS0 A;  2GA2 A;  1T6S A;  1Z05 A;  2EFW A;  2ZFW A;  3WTY C;  4YFN F;  1XCV A;  1XGM A;  2MLK A;  2ISZ A;  2XRN A;  2O0Y A;  3KEQ A;  2FXA A;  3RPU A;  1BBY A;  2GA1 A;  1T0F A;  3TDZ C;  2XVC A;  1JHF A;  1SD5 A;  3HSE A;  4AIK A;  2Q8K A;  2QBY B;  3FWE A;  2WV0 A;  2Z9O A;  3Q9S A;  3LA2 A;  1ZRF A;  4KN4 X;  1FOK A;  2JPC A;  3GYH X;  5HS9 A;  1SD6 A;  1C0W A;  4P9U A;  4ZYG A;  2A69 F;  3W6K B;  1D5V A;  4ENK A;  4HAM A;  4U7D A;  4KUM A;  5D4R A;  4UNO A;  2EWN A;  3FHZ A;  1J0R A;  1SD7 A;  1FLI A;  1LJ9 A;  2P6T A;  4RGU A;  2QQ9 A;  3SZT A;  1SFX A;  2IJL A;  5F6F A;  2Z99 A;  5ICC A;  2DQR A;  2OA4 A;  2FA5 A;  5HLG A;  3VFZ A;  2PJP A;  5L3C A;  3F8M A;  4ZYE A;  2K4B A;  1W7P D;  2XAQ A;  5F64 A;  1PP7 U;  2VBW A;  4EVI A;  2P6S A;  4KYW A;  2DBB A;  3MZY A;  1HKS A;  2YX7 A;  1ODD A;  1SD4 A;  4B09 A;  3IKV A;  2ZJ2 A;  2R7F A;  1ZH5 A;  1F1Z A;  5CVI A;  3KLN A;  4HX4 A;  4PGH A;  2JRT A;  2YPR A;  2BGC A;  3V7S A;  2PG4 A;  3WE3 A;  4AIJ A;  3F8N A;  4OIR F;  4OMZ A;  2CGP A;  4HZF A;  4M71 A;  1U3E M;  1HW5 A;  2JT1 A;  3NRV A;  3TOA A;  3KP6 A;  1JHH A;  5E20 A;  2UZK A;  4LMY A;  5JR3 A;  1HKT A;  1WI9 A;  2FSW A;  1H9G A;  3HRU A;  4KNY A;  1WWX A;  1IZ1 A;  1IAW A;  2IT0 A;  5CLS A;  4S05 A;  2P7C B;  1PUE E;  2LKP A;  4YFK F;  2FBK A;  5DCF A;  4XRF A;  1FSE A;  2XUB A;  3ISP A;  5LGT A;  2JZY A;  3GVA A;  2MH9 A;  5HOO A;  2OZ6 A;  5DCM B;  4OIN F;  3JAM Z;  4CHU A;  1FBS A;  4XSX F;  2P7V B;  5ICF A;  3I71 A;  3FXR A;  5LHG A;  5DDG A;  2XGX A;  4M74 A;  3GFL A;  3GFJ A;  3M8F A;  3F6O A;  1ZN2 A;  2MBF A;  2QZ8 A;  5F1R A;  4QWQ A;  5D5X B;  5HDN A;  5E8I A;  3E6M A;  1GXP A;  4P55 A;  4EM0 B;  3I58 A;  2RV8 A;  2RC4 A;  1Z7U A;  2ZNY A;  5DUI A;  2A5Y B;  3BOQ A;  3TGN A;  4UUV A;  4FT8 A;  3GW2 A;  2VE9 A;  1UHW A;  4A12 A;  1H0M A;  2GIV A;  2HFH A;  2GQQ A;  1FT9 A;  3ZMS A;  2R7D A;  3J7A O;  1STZ A;  3EYI A;  1YW8 A;  4LLL A;  3WGG A;  2HQR A;  3TKY A;  2VE8 A;  1I1S A;  2A3S A;  3IRR A;  2QYO A;  3BJ6 A;  3DXJ F;  2K02 A;  4M9X A;  3CLO A;  1P4X A;  3F3X A;  4E70 A;  1RNL A;  1IN5 A;  2QQA A;  1P6R A;  1KQ8 A;  3WE2 A;  5CVR A;  1FPQ A;  1P92 A;  1ZGJ A;  5ED4 A;  2P5L C;  3GLX A;  2X0L A;  3TO7 A;  4LLG F;  3HOT A;  3PFI A;  1LDJ A;  2JSC A;  3PQK A;  3LST A;  3V8J A;  1FP2 A;  4RGS A;  1TLH B;  1QNT A;  4RB2 C;  1KU2 A;  4A6D A;  3ZP5 A;  4HX7 A;  5HLI A;  2DTR A;  2ESH A;  4LFU A;  3E6B A;  3FXU A;  3KFW X;  4D0P A;  3KZZ A;  4NHJ A;  2WWY A;  3JSO A;  3VB2 A;  3CO6 C;  1KQ9 A;  4HF0 A;  2STT A;  3P7N A;  2Q0O A;  3VOE A;  4WK8 F;  4O5V A;  3L2C A;  3WG9 A;  2DO7 A;  3J80 Z;  3ERE D;  2QBY A;  3SFZ A;  1S6L A;  2PEX A;  2VBZ A;  4HV6 A;  2DW4 A;  3FZV A;  4IHT A;  1ZGA A;  4GYG A;  4RGR A;  2YSR A;  2EFQ A;  4WXD A;  3LWF A;  1EH8 A;  2QQB A;  4WX9 A;  2PI0 A;  4S04 A;  2PMH A;  1CGP A;  4G94 A;  3C3W A;  4HV5 A;  2HEO A;  1O7F A;  1MJA A;  4IRI A;  1U2W A;  4TV7 A;  3R0A A;  4EV0 A;  3DPT A;  5E1W A;  5ICG A;  1L3L A;  3O2P E;  4UV9 A;  3KEO A;  2STW A;  4HYE A;  1GVJ A;  1S7O A;  3F21 A;  1TTY A;  2HS5 A;  2HYG D;  1DP7 P;  1BN5 A;  1HW2 A;  4KMF A;  4HDU A;  2WTE A;  2L4M A;  3T1B A;  4L5J A;  3K69 A;  3RKY A;  2E1N A;  5J8F A;  4LLN A;  2NYX A;  4UXN A;  2VOP A;  2W57 A;  3KE2 A;  2GAU A;  3T0Y A;  4PZJ A;  2K7L A;  1QZY A;  2FBI A;  2NNN A;  1IN4 A;  1O3R A;  2HQN A;  3GEZ A;  1XGS A;  1A04 A;  4MNU A;  2M8E A;  1J9I A;  4ZH4 F;  3ABU A;  1MZB A;  1XDU A;  2J5O A;  2CG4 A;  3LQR A;  3GUD A;  1HQC A;  1R23 A;  2HKO A;  2A6H F;  3H3Z A;  2M87 A;  4AVP A;  1UST A;  2VOO A;  2A68 F;  5IT9 Z;  2H6C A;  4BYY A;  1XGN A;  1SMT A;  3KLO A;  3WU0 A;  5K1Y A;  3G3Z A;  4IPA A;  2BEO A;  4KIG A;  5D6F A;  3COA C;  4KIF A;  3F22 A;  1FX7 A;  2Z3Y A;  4LJZ F;  3WTT C;  1YS7 A;  4WF2 A;  5DCM A;  4Q48 A;  4I0A A;  4L9J A;  5EEH A;  3HYI A;  3U2R A;  3F8B A;  1IUY A;  3GX4 X;  5LEJ A;  4EMS A;  2VON A;  2KKO A;  1J7K A;  5K5R A;  5DYM A;  4I01 A;  2G7U A;  4CGZ A;  5FLX Z;  2MLG A;  2HGC A;  1HKQ A;  4I98 B;  1XSX A;  4UV8 A;  3CDH A;  4G7O F;  4KA4 A;  4L9V A;  2V9V A;  2PLY A;  3QPH A;  4OIP F;  1U78 A;  2GZW A;  1IW7 F;  3O3K A;  2V1D A;  3IL2 A;  1SMY F;  3CJN A;  3TDU C;  4MQV A;  4YIF A;  3R60 A;  5E17 F;  5LLQ A;  3WOD F;  4OOI A;  3QU6 A;  2QWW A;  1B9M A;  1FC3 A;  3C18 A;  4LD5 A;  1B59 A;  4B8X A;  5LGU A;  4FX4 A;  3W6J B;  4AD9 A;  3GF2 A;  3BZ6 A;  4UHT A;  1YIO A;  4QLC U;  1T98 A;  4ESJ A;  3WGH A;  1R1U A;  1FNN A;  2IP2 A;  2F5E A;  1KQ0 A;  3KP3 A;  1XSV A;  4IJA A;  3RKW A;  5J8C A;  1ZHF A;  4ESB A;  2L02 A;  4O6J A;  1QGP A;  4G8X A;  5D5W B;  2DLL A;  3FMS A;  4I02 A;  1P2F A;  5KVR A;  1YG2 A;  2DK8 A;  4L9T A;  3WTV C;  1SFE A;  2CFX A;  1FSH A;  5CVV A;  2HTJ A;  2PMU A;  2ZBK A;  2UXN A;  2XKO A;  1G3W A;  3I5U A;  4IHS A;  2QLZ A;  2ETH A;  4AWX B;  1TW3 A;  2JPB A;  3LA3 A;  5JI6 A;  2PQ8 A;  3V4G A;  1CF7 B;  3NEU A;  3E5Q A;  5FFZ A;  4ZZD A;  1DPR A;  4ZYD A;  2KRF A;  1R5G A;  2PFB A;  4M9S A;  1Z1D A;  1LDK B;  2E1C A;  4UVB A;  4I0B A;  3WTS C;  1K78 B;  5BPD A;  2P8T A;  2DT5 A;  3E5U A;  2M30 A;  2D45 A;  4EM1 A;  4IRG A;  3SQN A;  2XAJ A;  4ESF A;  1TNS A;  3TQN A;  3C7J A;  1BIA A;  1BIB A;  1ZG1 A;  4R8H A;  4MQ9 F;  3DPL C;  1V3F A;  3PQJ A;  2UWM A;  3CUQ C;  4G9Y A;  5D8K B;  3EET A;  3ULQ B;  1IRG A;  1OYW A;  2EFO A;  4BHC A;  5DD4 A;  1K7A A;  2H6B A;  1HST A;  1JGS A;  1IRF A;  2E7W A;  1YW9 A;  2ZKZ A;  4BQA A;  2B0L A;  2X4H A;  3KP2 A;  1K6O A;  2OAZ A;  1SAX A;  1F4K A;  2ZCW A;  1OPC A;  2GXG A;  3ZQ7 A;  2NRA C;  2XHK A;  3BJA A;  2BE5 F;  4GGG A;  3D0S A;  3HRM A;  2LSO A;  2R3S A;  5DEQ A;  2Y75 A;  1IN6 A;  1YYV A;  3IHU A;  3J81 K;  4I7H A;  1OYY A;  3ZN0 A;  3B02 A;  1LB2 A;  3M7G A;  1R7J A;  4BHB A;  1HBX G;  3NQO A;  3L00 A;  1WSU A;  3BRO A;  4LGW A;  1T38 A;  2MH2 A;  4O3M A;  2KJB A;  1MJ9 A;  2QUF A;  2DPU A;  3WTW C;  3MEX A;  2FOK A;  4N9I A;  1IN8 A;  1VTN C;  3IWZ A;  4RGX A;  1FZP B;  2EFN A;  3JTH A;  1O3Q A;  4KFC A;  1I6X A;  3FM5 A;  1WRJ A;  1BI2 A;  3BP8 A;  4ENM A;  1KA8 A;  3OOP A;  4G6D A;  5A2Q Z;  3HTU A;  1QQI A;  1PP8 F;  2ADU A;  3HRS A;  4KN7 X;  3RKX A;  4AIH A;  1B9N A;  3Q9V A;  4CDG A;  3JSP A;  1ZG3 A;  1TQM A;  1RIO H;  1BI1 A;  4HLX A;  1FYK A;  3FM3 A;  3RTR A;  4ENN A;  1ULY A;  3P9K A;  3HIF A;  2FBH A;  5TJJ A;  4CYD A;  4HW0 A;  4A0X A;  3R0J A;  4A0Z A;  2HDC A;  2BBY A;  2CO5 A;  1XB4 A;  2DK5 A;  3ZMV A;  1BOA A;  2VC0 A;  3DEU A;  1FY7 A;  2XAG A;  2KJC A;  3F8F A;  3HHH A;  2MC3 A;  2QM3 A;  4L18 B;  1JXS A;  4LK0 F;  3QRF F;  1G3T A;  3K9T A;  4ZZL A;  2IPQ X;  3E3V A;  5TRD A;  2OD5 A;  2P4W A;  5JVT A;  3HRT A;  3N97 A;  3ZMU A;  1F5T A;  4XSZ F;  3L09 A;  6PAX A;  1TBX A;  1OYI A;  3K0L A;  1YQA A;  2IA2 A;  1RUN A;  5H6R A;  4EJV A;  3H92 A;  2P5K A;  2TDX A;  1R36 A;  1OR7 A;  2FNP A;  3GFM A;  2L4A A;  4A6E A;  2H09 A;  4Y13 A;  1DPU A;  3ZMZ A;  2EJR A;  2HYF A;  1R1T A;  2PN6 A;  5E8G A;  4RB0 A;  2YU3 A;  4U7B A;  4JQF A;  3LFK A;  4HDV A;  2EFP A;  1XMA A;  1GXQ A;  2XRO A;  4A2U A;  2C6Y A;  5DD8 A;  3CTA A;  1J2X A;  3CUQ B;  1CF7 A;  2CQK A;  1BI3 A;  2CYY A;  1G3Y A;  3BPX A;  3VEP A;  2HWV A;  2CW0 F;  1IXR C;  1XCB A;  4KMU X;  1K78 A;  1MD0 A;  3DF8 A;  3IRQ A;  4BXU A;  1D8J A;  2EV6 A;  5FD6 A;  2A07 F;  1RI7 A;  2O6G E;  3E5X A;  5AIQ A;  1S29 A;  4GO1 A;  1YS6 A;  4Q5S F;  2QEN A;  4U0V A;  3ZMD A;  4R1H A;  2PBI A;  3VOD A;  2V79 A;  3V8L A;  3TOB A;  4EJT A;  2RKH A;  3GZ6 A;  3QP5 A;  5L3D A;  4ENJ A;  3RPQ A;  1OKR A;  3ECH A;  3I53 A;  5KK1 A;  2EB7 A;  1R1V A;  4MTD A;  1S7A A;  1XDS A;  4XBF A;  4Q4Z F;  3EQL F;  2W25 A;  2Z33 A;  3E6C C;  1ZAR A;  3WTU C;  4LB6 B;  3JAM K;  3LAP A;  3MQ0 A;  5HDG A;  3V7C A;  3WTZ A;  1XD7 A;  1GHC A;  1KU9 A;  4ETS A;  4MEX F;  3ZN1 A;  2ISY A;  3IWF A;  1O57 A;  2ZO4 A;  5HLH A;  5H20 A;  1S8N A;  3GWZ A;  5LEK A;  1R22 A;  4HLY A;  1IXC A;  4N0B A;  5FB2 A;  3L9F A;  1BM9 A;  4EM2 A;  4RAZ A;  1O3T A;  4BNC A;  2DFI A;  4GYI A;  3ECO A;  3M1E A;  3RI4 A;  4CXF A;  1E2X A;  2J5P A;  4P9F A;  1Z9C A;  3SHF A;  2EA4 A;  3KP7 A;  5ILS A;  2A61 A;  4R79 A;  3F6V A;  2KIU A;  5ILV A;  3I0T A;  4DNC A;  3I64 A;  1ZRC A;  4FX0 A;  3ZPL A;  2Z5U A;  1ZRD A;  1IF1 A;  4BH9 A;  1FYM A;  2F5C A;  4G7Z F;  3FX3 A;  5EEG A;  1IN7 A;  4EQQ A;  1F9N A;  3M8E A;  1I1G A;  2RDP A;  2K4J A;  1U5T C;  4GXO A;  4G6Q A;  1J5Y A;  4MEY F;  3S2W A;  5DV5 A;  4HQE A;  4CIC A;  2YX4 A;  1O3S A;  2VOD A;  3DFG A;  3FF5 A;  2FMY A;  3QP6 A;  4LB5 A;  5CJ9 A;  1BC8 C;  1NHA A;  4RB3 C;  4Y15 A;  2LF7 A;  3WU1 B;  4MGR A;  1TQP A;  4WWC A;  1KGS A;  2MD5 A;  1R5H A;  3K1N A;  2FRH A;  1O7L A;  5E1X A;  1W5T A;  3K1P A;  1MDM B;  3QU3 A;  3GO5 A;  2VBY A;  3I59 B;  3EDP A;  2WC2 A;  3K2Z A;  5FGM A;  4F7Z A;  2HOE A;  3LAJ A;  2W85 A;  4HA8 A;  2DI3 A;  3DV8 A;  3J80 K;  2ELH A;  4ZYH A;  5LGN A;  1JE8 A;  1T2K A;  3T8T A;  4A5M A;  2V1U A;  3DP7 A;  4MHG A;  2AS5 F;  1IXS B;  2FML A;  4P5O A;  5ILU A;  1X3U A;  3QPT A;  2H94 A;  3OV8 A;  3FMQ A;  2VT3 A;  3P9I A;  2CWE A;  2OQG A;  2K86 A;  3R6S A;  4OMY A;  1RUO A;  3O6B B;  3N4M A;  4ASN A;  3GZ5 A;  2VN2 A;  5BPI A;  1LEB A;  5FO5 A;  4RB1 A;  2F5F A;  2L54 A;  4Z2Y A;  5K5O A;  4HF1 A;  1KU7 A;  3CUQ A;  3ROU A;  1U6G A;  2MA3 A;  1FWZ A;  1UFM A;  4IF4 A;  4YFX F;  4YG2 F;  1LDD A;  5D4S A;  2EV5 A;  5FFX A;  1ZG5 A;  1D3Y A;  1ZAO A;  5D5U B;  1ON2 A;  1KYZ A;  3LQQ A;  4BHP A;  2DQL A;  3M9A A;  5ICE A;  1I5Z A;  5L3E A;  4G7H F;  1B6A A;  1BI0 A;  3F8C A;  1D8K A;  2D1V A;  2RQP A;  4LG0 B;  1XN7 A;  4KDP A;  4GCV A;  3CO7 C;  1QZZ A;  2DU9 A;  2RNJ A;  3WGI A;  2E7X A;  3HSF A; 
#chains in the Genus database with same CATH topology
 4V2G A;  4U88 A;  2M5W A;  1YHQ I;  1TNT A;  2ZME B;  5IT9 K;  3U1K A;  3SXY A;  3F9K A;  1LVK A;  1ORK A;  4D9J A;  1W7P B;  2G9W A;  1RZ4 A;  2EK5 A;  2FNA A;  3QPL A;  4ZJZ A;  4A3F J;  3ESW B;  4KT6 A;  1E17 A;  1ONV A;  3BPV A;  2JA8 J;  3H0D A;  3R61 A;  4PCQ A;  4C3J J;  2R5Y A;  3G73 A;  4M73 A;  3F23 A;  2VKE A;  4OU0 A;  4K2E A;  2L3D A;  3HUG B;  2MD0 A;  4RM2 A;  2XAS A;  3RYR A;  2DYS H;  5FKN A;  4S0H B;  5IYB J;  3DWL E;  1FJL A;  2Y2Z A;  3H9J A;  3EUH A;  2ID6 A;  4AVZ A;  5E79 C;  1XGO A;  2EZI A;  4XRS G;  3CCY A;  4A0Y A;  5CVJ A;  4L9N A;  2KP6 A;  1Y1V J;  4WXH A;  3CCQ I;  4BU2 A;  2CV1 A;  3BTJ A;  3BWG A;  2V6C A;  2IRF G;  2K27 A;  4KT5 C;  4YIR X;  4HBL A;  1W5S A;  5LRS A;  1Z91 A;  2AXL A;  2FX0 A;  2COM A;  2VJJ A;  3HEF A;  2IS4 A;  4ON0 A;  2MG4 A;  1Y0U A;  5E1Z B;  1YW7 A;  3FMR A;  1FYL A;  2A5W A;  3U9G A;  1AWC A;  3JRI A;  4XNF A;  3GFI A;  1FOX A;  3REO A;  3PO2 J;  3KZY A;  4M6X A;  1KYW A;  4BAY A;  3P9C A;  5AIP A;  4N9H A;  5FLX K;  1IV8 A;  1Q1H A;  5K5Q A;  2M4G A;  5HS7 A;  1LE8 B;  2CFO A;  4PGG A;  1SVO A;  3IAS 2;  2HTS A;  2P5V A;  5CYV A;  2OF7 A;  1IG7 A;  3J7A Y;  3Q5F A;  3IKT A;  2ME6 A;  5BOX A;  2LLK A;  4HNT A;  2EPF A;  3A03 A;  2V7F A;  3BG5 A;  2W7N A;  1VQ6 I;  1X1C A;  4EJU A;  3HOX J;  3BY6 A;  2V1X A;  3NWT A;  2ZXH A;  1DDN A;  1E3H A;  2P81 A;  1U5T B;  2FQ3 A;  4A3E J;  1G6N A;  3DKX A;  3IC7 A;  5L3F A;  1WGX A;  1M1E B;  2M8G X;  3NWS A;  4NQW A;  3CUO A;  1P9Q C;  2XKP A;  1USS A;  4X1E A;  2WB1 A;  1SAN A;  1DUX C;  4C9Y A;  5DUK A;  2A6E F;  5HS8 A;  3OYL A;  4WCG A;  3S15 J;  1TL8 A;  5LRR A;  2NVX J;  2I5U A;  3V8K A;  4EJO A;  1POG A;  5EG0 B;  2JK3 A;  5LHH A;  1YTY A;  1RKW A;  1FMV A;  3HHG A;  3DQV C;  3BDD A;  3FXQ A;  1H9T A;  2OU2 A;  4I09 A;  3SZG A;  3E97 A;  5CVU A;  2E36 A;  2FUG 2;  3IP4 B;  4KIT B;  2QSG X;  4DYR A;  1DGR M;  1X58 A;  4QTR A;  2EV0 A;  1NG7 A;  3CCU I;  2HOA A;  5J1Y A;  2TRT A;  3OR1 C;  2NNY A;  2KIF A;  1YO5 C;  3JW4 A;  1K61 A;  4B44 A;  1OQY A;  2CW7 A;  3M4O J;  1HXD A;  4D1Q A;  4UVC A;  3BTC A;  4RAF A;  5LD2 C;  3Q3S A;  3BJO A;  4Q47 A;  1EV7 A;  4BS9 A;  3S1Q J;  1T39 A;  2ZB9 A;  1MH4 A;  3QAH A;  5CQE A;  5D8L B;  4I2O A;  3RSN A;  4QPO A;  3E1S A;  1WH7 A;  3OYK A;  2VC1 A;  3I55 I;  2GXB A;  3TED A;  2F6C A;  3CZ6 A;  3JRE A;  1T33 A;  1MH3 A;  2XGC A;  4EJW A;  1ZLJ A;  3HTS B;  3T5X A;  5L3G A;  4YII A;  1TT0 A;  2R7T A;  5JHU A;  2HZT A;  3HDD A;  2ICW G;  3GLL A;  3HSR A;  2IS2 A;  2E71 A;  2IW5 A;  4IXA A;  2W24 A;  4LIU A;  3KP4 A;  3AG2 H;  3G2B A;  4Y17 A;  1J59 A;  4IRH A;  2XAH A;  2K3F A;  2Y48 A;  5B1B H;  2BHZ A;  3V7R A;  2FU4 A;  3L2V A;  2LY9 A;  2LF8 A;  1ZLK A;  3QOP A;  1UJ8 A;  2LDU A;  4XLN F;  5L3B A;  3HOU J;  3AG3 H;  5BQT A;  1PUF A;  4PJL A;  5EDN A;  1MDM A;  5D6E A;  2DAO A;  4II3 A;  3D5R C;  1V4R A;  2D1H A;  1Z6R A;  1MNM C;  3C2H A;  3DBH B;  3I59 A;  1I27 A;  2Q2E A;  3JTG A;  4A3L J;  2KPM A;  3RDI A;  4M72 A;  2XB0 X;  2BY2 A;  3CP8 A;  3K4C A;  4OIQ F;  3G4S I;  1QVT A;  1G4D A;  4KIB A;  1XX5 A;  2ZXJ A;  2YR2 A;  2JTV A;  4U0W A;  1OCP A;  4BJ6 C;  1ON1 A;  4F91 B;  2R7S A;  2M1B A;  2EA2 A;  2UXX A;  3OYM A;  1R58 A;  4UVA A;  1LUJ B;  1JKQ C;  3EYY A;  2OQR A;  1IRX A;  1X1A A;  1ZR4 A;  3Q0U A;  4RAY A;  3FK7 A;  3R4K A;  1OCT C;  1S3J A;  4H4K C;  3UKG A;  2F2E A;  5LBQ A;  2M45 A;  3HSF A;  3D5L A;  4UB8 C;  4XKC A;  3C1D A;  3I54 A;  2IA1 A;  3F72 A;  4JK1 X;  3H3U A;  4M6Y A;  5GTI C;  4WXC A;  1TW2 A;  3K4J A;  5M5Y J;  1LQ1 A;  1WHU A;  3MFK A;  2BV6 A;  5IPA A;  1J09 A;  3U1D A;  3G1O A;  4QIW N;  5J1R A;  3WHB A;  5D5V B;  4A69 C;  4L5I A;  3CES A;  2HKX A;  3MCZ A;  5JVG F;  2DT7 B;  4A5N A;  3H36 A;  3SJM A;  4IHX A;  5JFR A;  1X1B A;  3ELK A;  4BXF A;  2BXZ A;  2BW3 B;  2DJI A;  1BOB A;  3GCM A;  3ZMT A;  2CV2 A;  2Y0M A;  2M0C A;  2LBF A;  4AUX A;  3CCE I;  4AYB A;  3CMM A;  3GTK J;  2O3F A;  3NAU A;  3RYP A;  4NC8 A;  1UB9 A;  4LK1 F;  3RIR A;  1P4W A;  3KP5 A;  1MGT A;  3BTI A;  5BMZ A;  1TQI A;  3S3N A;  1TC3 C;  2XIG A;  1LVA A;  2XAF A;  4KIC A;  2L2O A;  4PDK A;  1H89 C;  1KU3 A;  2FE3 A;  2O9L A;  3OWT A;  5IT3 A;  2D2W A;  1XMK A;  1D1A A;  4DQ2 A;  2E1O A;  1FBU A;  1L0O C;  4IVN A;  1AKH A;  1OMI A;  2ZNZ A;  3I4M J;  2GWR A;  4CO8 A;  5EZH A;  4A3G J;  3CF2 A;  4BEH A;  1R00 A;  4HST A;  5H6Q A;  3S8P A;  1FTT A;  1W4M A;  1S7E A;  3ASN H;  2COB A;  1FIP A;  4FHT A;  4UUS B;  3VDX A;  3OYE A;  4H0E A;  3OYJ A;  2VXZ A;  2IVM A;  3C2G A;  3PNT A;  3VWB A;  2NAZ A;  4HOB A;  5C4J J;  2FEZ A;  3BR3 A;  3HOS A;  2X1D A;  2X6W A;  1U8R A;  1QO0 D;  1A6Q A;  1ZRE A;  1EH7 A;  4XLP F;  1ZYR F;  1MKM A;  3S17 J;  2DPD A;  3S2H J;  3D5S C;  2OZU A;  4HF2 A;  1W5C C;  5E18 F;  2EIN H;  4LG0 A;  1MJB A;  4P96 A;  1LNW A;  4CCO A;  1TP4 A;  4FQG A;  4M9Z A;  3J81 Z;  3MWM A;  1AOY A;  1LPQ A;  1J75 A;  2ECB A;  1MMG A;  2XSJ C;  5FLM J;  1EH6 A;  1ETY A;  4XID A;  1XG1 A;  3RZD J;  4L0Y B;  4L0Z B;  3DCF A;  3I4N J;  1FP1 D;  1G3S A;  2DYR H;  2ZME A;  3GXO A;  1NK3 P;  4GFB A;  1IDY A;  1VND A;  3H5R A;  1K4S A;  1DP3 A;  4C2T A;  3PFY A;  1W7P A;  1FBQ A;  1LEA A;  4DYQ A;  4MTE A;  1P4A A;  1B1B A;  4L5E A;  5KAI C;  1QPM A;  1IV6 A;  1F36 A;  5E3L A;  1JKO C;  3HUG A;  3TO9 A;  4HX8 A;  4KJZ A;  2HVR A;  3LSP A;  2XV4 S;  3ABT A;  3S1N J;  4U0Y A;  3AAF A;  3MVP A;  2O03 A;  1R6R A;  4BE0 A;  1REP C;  4RS8 A;  5HDK A;  3TL4 X;  1YLF A;  3ZR8 X;  3QPS A;  1RR7 A;  3B73 A;  3K1M A;  4HQM A;  3ERM A;  1NK2 P;  2LNB A;  3DKW A;  3MAJ A;  1YFH A;  2O61 A;  3DPU A;  5J6X A;  2VT2 A;  4DGW B;  1RRJ A;  4OIO F;  5A2Q K;  1GV5 A;  2CSO A;  4AC0 A;  3PM1 A;  1QBJ A;  3HGG A;  4EGY A;  5LHI A;  1MBG A;  3B6A A;  4CZZ A;  1WQ2 A;  3OMY A;  2O8X A;  3BR5 A;  3U21 A;  3LA7 A;  2KDZ A;  1WKM A;  2VJI A;  3AFH A;  3KCC A;  1VQK I;  1N25 A;  2KHM A;  5AON A;  3E6D A;  3K70 D;  1BC7 C;  1HW1 A;  1JKR C;  4JBA A;  1SFU A;  2KIM A;  3ZGK A;  2G7H A;  5ERI A;  2BYV E;  1XSD A;  2DJN A;  1YX3 A;  2CJJ A;  3ZOB A;  1LE8 A;  2RNG A;  1BA5 A;  2XPW A;  2RVC A;  2RN7 A;  1MMA A;  2FD5 A;  2L01 A;  3T8R A;  4BBR J;  1U8B A;  1B4A A;  2HOT A;  2OBP A;  2A6T A;  1LFU P;  2L0K A;  3AL0 C;  3FXK A;  4A3I J;  5J4V A;  2W84 A;  2IA0 A;  2VBX A;  5EF6 A;  2EIM H;  2H27 A;  2RGV A;  3ML6 A;  3L7W A;  3SEZ A;  1K79 A;  1BJA A;  5FD5 A;  4EGZ A;  1U5T A;  3RJP A;  3TO6 A;  2EH3 A;  4CZC A;  4EEF G;  3G6E I;  2FF4 A;  4N4O B;  1JJ8 C;  1PDN C;  2ESN A;  1UHM A;  2HXO A;  3WTX C;  5K7H A;  5BS6 A;  1Z6T A;  2ACJ A;  3WG7 H;  3SZP A;  4X6A J;  2QVO A;  5HVQ C;  3MZH A;  3KET A;  5HNH A;  3OS0 A;  2F5D A;  2E34 A;  2HR3 A;  1HSJ A;  3S3O A;  3I4P A;  4NB5 A;  1UCR A;  3ABM H;  5J47 A;  5EG0 A;  2NS0 A;  2E60 A;  2GA2 A;  4A3D J;  1T6S A;  1Z05 A;  4DIQ A;  1NG6 A;  2EFW A;  2OV7 A;  2R5Z B;  4HNU A;  2ZFW A;  5FRN A;  3WTY C;  4YFN F;  1I3A A;  3HKZ N;  1XCV A;  1XGM A;  4PK4 A;  2WY7 Q;  1NTC A;  2R7Q A;  2MLK A;  2M0M A;  2ISZ A;  2HPI A;  3S16 J;  2XRN A;  2O0Y A;  3KEQ A;  2FXA A;  3RPU A;  4IKF A;  1BBY A;  2GA1 A;  1T0F A;  3TDZ C;  2HOS A;  2XVC A;  1JHF A;  2HPM A;  4E7J A;  3G1M A;  4RBO A;  1SD5 A;  3HSE A;  4AIK A;  3HC7 A;  2Q8K A;  2QBY B;  3FWE A;  2WV0 A;  5K7F A;  4LG3 A;  1MSE C;  4Y3O A;  2R7R A;  3Q9S A;  3LA2 A;  2Z9O A;  4YEJ A;  3TW7 A;  1ZRF A;  4CUG A;  4KN4 X;  1FOK A;  2JPC A;  3GYH X;  4LIV A;  5HS9 A;  3DLL F;  3PSI A;  1SD6 A;  3CCM I;  1C0W A;  1OLT A;  4DZJ A;  4P9U A;  1W36 D;  4ZYG A;  2A69 F;  2KLO A;  1MBF A;  3W6K B;  1D5V A;  4ENK A;  1IRZ A;  3FDY A;  3KX2 A;  4XR6 A;  4HAM A;  4U7D A;  4KUM A;  5D4R A;  1Y8Q B;  4UNO A;  1R4N B;  4A3K J;  2EWN A;  3QOE A;  4IHY A;  3FHZ A;  1J0R A;  1SD7 A;  1FLI A;  5IY5 H;  1EJ9 A;  1VQP I;  5E3N A;  1BJZ A;  1LJ9 A;  5BNG A;  4IEJ A;  4RA2 A;  2P6T A;  4RGU A;  2QQ9 A;  5IOY A;  3SZT A;  2W82 A;  4M3G A;  2L7K A;  2R7X A;  1SFX A;  1ZKG A;  2IJL A;  5F6F A;  4NNJ A;  2Z99 A;  1Y1W J;  2M7A A;  5ICC A;  2DQR A;  1SFO J;  3OS1 A;  1BW6 A;  2OA4 A;  2FA5 A;  3CMA I;  1ETW A;  5HLG A;  3VFZ A;  2ZSH B;  2PJP A;  5GPA A;  3PJR A;  2LP0 A;  5L3C A;  2R0Q C;  3F8M A;  3L2Q A;  4ZYE A;  3PNY A;  2M2E A;  2K4B A;  3HM5 A;  1W7P D;  4UY8 I;  1HDD C;  2XAQ A;  1V54 H;  5F64 A;  1QHG A;  2VBW A;  1PP7 U;  4EVI A;  2P6S A;  4MO7 A;  5GPC A;  2GIZ A;  3BR1 A;  4KYW A;  2V26 A;  2DBB A;  3MZY A;  1HKS A;  2YX7 A;  1ODD A;  4P1W A;  1SD4 A;  4B09 A;  3IKV A;  1TWG J;  2ZJ2 A;  2R7F A;  1ZH5 A;  1F1Z A;  5CVI A;  3KLN A;  3H9G A;  1QU3 A;  5J1U A;  4HX4 A;  1FEX A;  4PGH A;  1SVM A;  1V5F A;  2JRT A;  2VB6 A;  2YPR A;  2BGC A;  3ABK H;  3V7S A;  2QGU A;  1DU0 A;  2JN6 A;  3LNQ A;  1ITY A;  2PG4 A;  2R7V A;  2VLA A;  3WE3 A;  2ME0 A;  4ZDL A;  4JYK A;  2F4I A;  4AIJ A;  4PJ0 C;  3F8N A;  4OIR F;  4OMZ A;  2CGP A;  2PJR B;  1X2N A;  4HZF A;  4M71 A;  1U3E M;  1HW5 A;  2JT1 A;  1JUP A;  3NRV A;  3TOA A;  4XQF A;  1WI3 A;  3KP6 A;  2YS9 A;  1JHH A;  4OWR B;  1YX5 A;  4E7L A;  1X19 A;  2BW3 A;  5E20 A;  3ZQQ A;  3CJR B;  4M3E A;  2UZK A;  4LMY A;  2E2J J;  5JR3 A;  1HKT A;  4HG2 A;  3M3Y J;  2DT6 A;  4DZP A;  1WI9 A;  1Z77 A;  2FSW A;  1H9G A;  3HRU A;  4J00 A;  4KNY A;  1EKE A;  1WWX A;  1IZ1 A;  1IAW A;  4LIT A;  2IT0 A;  5CLS A;  4S05 A;  2P7C B;  1PUE E;  2X1C A;  5F0H A;  3FIW A;  2LKP A;  4YFK F;  2FBK A;  5DCF A;  4XRF A;  4F3Q A;  1N77 A;  1FSE A;  2XUB A;  1YIJ I;  5M3F J;  2JJ7 A;  3ISP A;  5LGT A;  2CUJ A;  2JZY A;  1D1B A;  4BY1 J;  4UUS A;  3GVA A;  2MH9 A;  5HOO A;  2OZ6 A;  5DCM B;  3SDB A;  1E0E A;  4OIN F;  3JAM Z;  2WB1 N;  4JX4 A;  4CHU A;  1FBS A;  4PUS A;  4XSX F;  2AO9 A;  2V9K A;  1B8I B;  2P7V B;  4M3B A;  5KAF C;  1MNE A;  1IO2 A;  5ICF A;  1W0T A;  3I56 I;  1ZR2 A;  1XS9 A;  3I71 A;  4E4H A;  3FXR A;  5LHG A;  5DDG A;  2KL4 A;  2XGX A;  4IQJ A;  4ZTJ A;  4M74 A;  3GFL A;  3GFJ A;  3M8F A;  1AHD P;  2K9M A;  3E7L A;  3F6O A;  3KZI C;  1ZN2 A;  2MBF A;  2QZ8 A;  5F1R A;  4QWQ A;  5D5X B;  3HL2 A;  5HDN A;  3TW6 A;  3VYS B;  5E8I A;  3E6M A;  1GXP A;  3GTP J;  1VZ0 A;  4P55 A;  5FKL A;  1W0U A;  4EM0 B;  3I58 A;  3RPU D;  2NVT J;  2RV8 A;  4D7N A;  2RC4 A;  1X4O A;  1WJF A;  2DDA A;  1Z7U A;  2ZNY A;  4ZDP A;  5DUI A;  2R92 J;  1IC8 A;  2HU9 A;  1FTZ A;  5TGT A;  2A5Y B;  4DYC A;  3BOQ A;  3TGN A;  4UUV A;  2LMD A;  4FT8 A;  3GW2 A;  2ZJQ F;  2EZK A;  1Z21 A;  2VE9 A;  4AID A;  1VQ9 I;  3AL0 B;  1UHW A;  4A12 A;  5FLV A;  1RR8 C;  1H0M A;  3WHC A;  2GIV A;  4Z6Y A;  2CMP A;  2WAQ N;  1GLN A;  2HFH A;  2GQQ A;  1FT9 A;  3MKL A;  3ZMS A;  3H3V K;  3KIO A;  2R7D A;  4BXX J;  3J7A O;  1STZ A;  3EYI A;  1YW8 A;  3FHN A;  2QA4 I;  3K4L A;  2HQ5 A;  4LLL A;  3WGG A;  2HQR A;  3TKY A;  2VIX A;  2VE8 A;  3K4N A;  1I1S A;  2A3S A;  3IRR A;  3OSF A;  2CRG A;  3OYD A;  2AQF A;  2QYO A;  1LFP A;  3BJ6 A;  5DM6 F;  1VQ8 I;  3MZ8 A;  2EIK H;  4RAG A;  1WPK A;  3DXJ F;  1XC5 A;  2K02 A;  4M9X A;  4FCY A;  3CLO A;  2DOF A;  1P4X A;  3F3X A;  4E70 A;  1YE9 A;  1RNL A;  1IN5 A;  2QQA A;  1P6R A;  4QPQ A;  2L5Q A;  1KQ8 A;  1PVE A;  3SYT A;  3WE2 A;  3GTO J;  4CYC A;  1Y8R B;  5CVR A;  1MND A;  1I50 J;  2L7Z A;  1FPQ A;  3L2W A;  1P92 A;  1ZGJ A;  1MBH A;  3X2Q H;  5ED4 A;  5C44 J;  2P5L C;  3GLX A;  3LFU A;  2X0L A;  3TO7 A;  3LSM A;  5IP9 J;  4LLG F;  4BGD A;  3HOT A;  2E1M C;  3M1C A;  1T08 B;  3PFI A;  3JRA A;  1GDT A;  1LDJ A;  3LSH A;  2JSC A;  3PQK A;  3LST A;  4NC7 A;  2UUZ A;  3ZQL A;  3V8J A;  2QCO A;  4GDF A;  1FP2 A;  1YI2 I;  2VXD A;  3CCL I;  2AXT C;  4RGS A;  4AM3 A;  1TLH B;  3OIQ A;  4E7H A;  1QNT A;  4RB2 C;  1KU2 A;  4A6D A;  3ZP5 A;  5C4X J;  4HX7 A;  5HLI A;  3S14 J;  2DTR A;  2ESH A;  4LFU A;  1HC8 A;  3VPR A;  2I10 A;  3M8J A;  1WVR A;  4F93 B;  4XIC A;  2O8K A;  5EGO B;  3E6B A;  2KIQ A;  2DFF A;  2R5Z A;  2JSP A;  4CSW A;  3FXU A;  3DLA A;  3L2R A;  4MFE A;  3KFW X;  3OSG A;  3LSI A;  1D1C A;  4D0P A;  4JX6 A;  3KZZ A;  4NHJ A;  3ZCO A;  2WWY A;  3JSO A;  3MMY B;  3CC2 I;  3VB2 A;  3CO6 C;  1KQ9 A;  2W00 A;  4HF0 A;  2STT A;  3P7N A;  5M5X J;  2Q0O A;  3VOE A;  4B3A A;  4WK8 F;  4O5V A;  4E6K G;  3L2C A;  1JUS A;  3JCU C;  3WG9 A;  1OR7 C;  1ETK A;  4BY7 J;  2DO7 A;  2VKV A;  3J80 Z;  3ERE D;  2QBY A;  3GBG A;  4RLQ A;  3RZO J;  3SFZ A;  1X3W B;  5B1A H;  1S6L A;  5LFA A;  1AU7 A;  2PEX A;  2VBZ A;  3PNV A;  3ONQ A;  2LY1 A;  4HV6 A;  2XSD C;  2DW4 A;  3FZV A;  2DMU A;  3C2B A;  4XN0 A;  4CCN A;  2H8R A;  1WJD A;  4IHT A;  1UEL B;  2NVQ J;  2VL8 A;  3K70 C;  1ZGA A;  3MN2 A;  1VF9 A;  4GYG A;  2VKH A;  4RGR A;  2YSR A;  2B7E A;  2EFQ A;  4WXD A;  2JQ7 A;  1HOM A;  3LWF A;  2BY3 A;  1EH8 A;  1UHS A;  2QQB A;  2LH9 A;  3N05 A;  4WX9 A;  2PI0 A;  1JKP C;  4S04 A;  2EBI A;  2PMH A;  1CGP A;  4G94 A;  3C3W A;  1BR1 A;  2XPV A;  4HV5 A;  2OPT A;  2HEO A;  1O7F A;  1MJA A;  4IRI A;  3EUK L;  2VQG A;  1U2W A;  2A05 A;  4TV7 A;  5F1J A;  3R0A A;  4XN3 A;  4EV0 A;  3DPT A;  2GXA A;  4UUT A;  2MGQ A;  3HG9 A;  5KNL A;  5E1W A;  5F08 A;  5ICG A;  1L3L A;  3O2P E;  1A5J A;  3JRC A;  4UV9 A;  2X85 A;  1OIS A;  1SAU A;  4ZTF A;  2QF7 A;  3KEO A;  2STW A;  4XKV A;  1A36 A;  4HYE A;  1GVJ A;  4FIS A;  3HOV J;  1U0J A;  4IQ4 A;  1UG0 A;  1S7O A;  3F21 A;  1TTY A;  2HS5 A;  1T56 A;  2XGD A;  2DA4 A;  2HYG D;  1DP7 P;  1MBJ A;  1IUF A;  1BN5 A;  2XGE A;  3P5J A;  1HW2 A;  3OY9 A;  4KMF A;  2Y9Y A;  2HYJ A;  2WTE A;  2L4M A;  4HDU A;  3T1B A;  2D5V A;  1YIT I;  4L5J A;  3K69 A;  3RKY A;  3Q0V A;  2E1N A;  5J8F A;  3OYA A;  4LLN A;  2NYX A;  4UXN A;  2VOP A;  4FE4 A;  4F55 A;  2W57 A;  2DA3 A;  4A3M J;  3KE2 A;  2GAU A;  3T0Y A;  4PZJ A;  2HQA A;  2X6O A;  2K7L A;  1QZY A;  2FBI A;  2NNN A;  2NVU B;  1R71 A;  1GT0 C;  1IN4 A;  1O3R A;  4B4C A;  2HQN A;  4XLA A;  2O5R A;  2CQN A;  5M5W J;  3GEZ A;  1XGS A;  1A04 A;  4MNU A;  3G1L A;  2M8E A;  3PL8 A;  1J9I A;  5EYR A;  4ZH4 F;  3ABU A;  2HNH A;  1D0Z A;  1ZGW A;  3CC4 I;  1JUM A;  1Z7L A;  1MZB A;  1XDU A;  2J5O A;  1S5L C;  3CDI A;  3CCR I;  2PMZ A;  3DTE A;  2CG4 A;  2PJR A;  3LQR A;  3GUD A;  2L9S A;  1HQC A;  1R23 A;  2HKO A;  3FXL A;  2LKX A;  1FMW A;  2A6H F;  3H3Z A;  2R7U A;  4FE7 A;  2M87 A;  4AVP A;  1W36 C;  2EQR A;  1UST A;  5DM7 F;  2OUM A;  4NDL A;  3CMY A;  2VOO A;  3W2A A;  2Q1Z B;  2A68 F;  3J7Y J;  5IT9 Z;  2H6C A;  2ID3 A;  2KQR A;  4BYY A;  1XGN A;  1SMT A;  2DMP A;  3KLO A;  3DU6 A;  3WU0 A;  5K1Y A;  2HDD A;  3G3Z A;  4IPA A;  3QYB A;  2BEO A;  2K9S A;  1OCO H;  2DA2 A;  4KIG A;  5D6F A;  3COA C;  2B9S A;  1FOW A;  3A4C A;  2DOA A;  2K9Q A;  4KIF A;  3CF5 F;  5DTD A;  2CW8 A;  3F22 A;  2K40 A;  3LOC A;  4XM3 A;  3CJQ B;  4FET A;  5GAD J;  1FX7 A;  2EIL H;  3W3C A;  2Z3Y A;  2JWT A;  4LJZ F;  2HZD A;  3AG4 H;  3BLY A;  3WTT C;  2VPL A;  1JTY A;  2KRH A;  2MC4 A;  3MKZ A;  1YS7 A;  4WF2 A;  2H1K A;  5DCM A;  5J4Y A;  4BJT A;  4PSX A;  4Q48 A;  3CME I;  1MMD A;  2NS8 A;  2F48 A;  1B8I A;  4I0A A;  4L9J A;  5EEH A;  2LC2 A;  2RQQ A;  3FKI J;  3HYI A;  3U2R A;  3F8B A;  1IUY A;  4XLF A;  3GX4 X;  5LEJ A;  5GAE J;  4EMS A;  1BL0 A;  4DW6 A;  2VON A;  2KKO A;  1J7K A;  1WCM J;  5K5R A;  2VJ5 A;  5DYM A;  4I01 A;  2G7U A;  1YRN B;  4DJA A;  4CGZ A;  5FLX Z;  2CV0 A;  4X0G A;  2MLG A;  2HGC A;  2K3P A;  3K4K A;  1JTX A;  1HKQ A;  2CH0 A;  4I6Z A;  2WAD A;  4I98 B;  1XSX A;  3SEQ A;  3CCV I;  2L7M P;  4PFO A;  5J3L A;  1NH3 A;  4UV8 A;  3FBN B;  1OCZ H;  3CC7 I;  3ZQI A;  3V42 A;  3CDH A;  4XK4 A;  3A2K A;  3CLQ A;  3IAM 2;  4CYC B;  4G7O F;  2WA0 A;  4KA4 A;  3QOD A;  1O4X A;  4B3X A;  3KPH A;  4L9V A;  4XLC A;  1VQ5 I;  1P7I A;  4RMN A;  2V9V A;  2PLY A;  3UNG C;  3QPH A;  2XF5 A;  4OIP F;  1U78 A;  2L9N A;  2GZW A;  1Y56 A;  1IW7 F;  3H5N A;  3O3K A;  2V1D A;  2E1M B;  3VYU B;  3IL2 A;  1SMY F;  3QQA A;  3CJN A;  3FBI B;  3TDU C;  2TCT A;  2CS3 A;  4MQV A;  4YIF A;  2GOM A;  3R60 A;  5E17 F;  5LLQ A;  4BL0 B;  3WOD F;  4OOI A;  3OOU A;  3QU6 A;  1X3Z B;  2LK2 A;  2QWW A;  4DOZ A;  1B9M A;  1FC3 A;  1BW5 A;  2R7Z J;  3C18 A;  4LD5 A;  3JRB A;  3DTI A;  1B59 A;  3S3M A;  4B8X A;  3OR2 C;  3RKQ A;  1MBE A;  2M7B A;  1WH5 A;  5LGU A;  4FX4 A;  2DA6 A;  3W6J B;  4AD9 A;  2IGO A;  1ETO A;  3GF2 A;  3BZ6 A;  4UHT A;  1YIO A;  4QLC U;  1QRY A;  1R4M B;  1T98 A;  4ESJ A;  3WGH A;  1R1U A;  1FNN A;  3K4B A;  2IP2 A;  2F5E A;  1KQ0 A;  3OIO A;  3KP3 A;  1XSV A;  2Y69 H;  4RLF A;  3BR6 A;  1ZTR A;  4IJA A;  3RKW A;  5J8C A;  2LRE A;  5JHF A;  4XOP A;  5HNF A;  1ZHF A;  2VQH A;  2R7O A;  4CH7 A;  1KZH A;  5J40 A;  4ESB A;  2L02 A;  3K4M A;  4O6J A;  4Y7N J;  1QGP A;  4G8X A;  4C2U A;  5D5W B;  2DLL A;  3FMS A;  4I02 A;  3GTJ J;  1P2F A;  2OTL I;  2IEK A;  2IXS A;  3DEE A;  2K5C A;  3BQY A;  2XF6 A;  3UR3 C;  2X9D A;  5KVR A;  1YG2 A;  3ASO H;  2DK8 A;  1DQU A;  5EGO A;  4L9T A;  3WTV C;  2FOW A;  1D5Y A;  1SFE A;  1ETX A;  1B72 B;  2CFX A;  2CQQ A;  4YEL A;  2VQL A;  1FSH A;  5CVV A;  2HTJ A;  2DMN A;  2Y0S A;  3OYC A;  2PMU A;  2ZBK A;  2UXN A;  2XKO A;  3FKJ A;  1G3W A;  3I5U A;  4IHS A;  2QLZ A;  2Z1D A;  3H9Q A;  2ETH A;  4XOT A;  2AHQ A;  4AWX B;  1TW3 A;  2JPB A;  3LA3 A;  2ZXW H;  4II2 A;  3JRG A;  5JI6 A;  2PQ8 A;  1Y6I A;  3V4G A;  2EZH A;  1HF0 A;  2E5Z A;  1CF7 B;  3NEU A;  3E5Q A;  5GP9 A;  5FFZ A;  2L9V A;  4ZZD A;  1DPR A;  4ZYD A;  2KRF A;  1R5G A;  2PFB A;  4RDU A;  4M9S A;  1Z1D A;  4Y52 J;  1D0Y A;  1LDK B;  5F0F A;  2E1C A;  3JRF A;  1WJA A;  4UVB A;  4I0B A;  5JLX A;  3WTS C;  1K78 B;  3OL3 A;  5BPD A;  2P8T A;  2DT5 A;  4HPQ A;  3HPH A;  3E5U A;  4E7S A;  2CU7 A;  3CQZ J;  4XKW A;  2M30 A;  2ZFU A;  2D45 A;  4F92 B;  5DS9 A;  4EM1 A;  2ZC2 A;  4IRG A;  3K2A A;  4BQO A;  3SQN A;  2XAJ A;  1FOY A;  4ESF A;  1TNS A;  3TQN A;  3VSL A;  3C7J A;  1Z67 A;  1BIA A;  1BIB A;  3BR0 A;  3K6G A;  1ZG1 A;  1SC7 A;  4R8H A;  3ZQG A;  4I99 C;  1ERD A;  4MQ9 F;  1I39 A;  4XON A;  3DPL C;  3A0B C;  1V3F A;  3PQJ A;  3KYL A;  4A3B J;  2UWM A;  3CUQ C;  4IOA F;  4G9Y A;  5D8K B;  4IOC F;  3EET A;  3ULQ B;  1IRG A;  2NVY J;  4XRS A;  2LVS A;  1OYW A;  5IP6 A;  2EFO A;  3D1N I;  3PSF A;  4PJN A;  4BHC A;  5DD4 A;  1HCR A;  1K7A A;  2H6B A;  1HST A;  2IAI A;  4ZDO A;  2MYS A;  2VQC A;  1JGS A;  3OYG A;  1IRF A;  2E7W A;  1YW9 A;  1PJR A;  4IHW A;  2ZKZ A;  5EJC A;  4BQA A;  1LKX A;  2B0L A;  1X1D A;  4AU7 A;  5B5E C;  5FKM A;  3SDG A;  2EIJ H;  2X4H A;  5TIS C;  3KP2 A;  1K6O A;  2OAZ A;  1VQN I;  4BQN A;  1SAX A;  4YRV A;  1F4K A;  2ZCW A;  1OPC A;  2GXG A;  2KFD A;  2YUS A;  3ZQ7 A;  2NRA C;  3LSG A;  2MFZ A;  2XHK A;  3BJA A;  1PYV A;  2HI3 A;  2BE5 F;  4ZC3 A;  1YOV B;  4GGG A;  3D0S A;  1JI8 A;  2KIS A;  3HRM A;  2LSO A;  2R3S A;  5DEQ A;  1X1P A;  3GTQ J;  2Y75 A;  1IN6 A;  1A6I A;  3RQ4 A;  1YYV A;  3IHU A;  3J81 K;  2JRM A;  4I7H A;  3W2V A;  4GRI A;  1Z0X A;  1OYY A;  3ZN0 A;  3B02 A;  3O8H A;  1LB2 A;  3M7G A;  1R7J A;  1JJ6 C;  1SEU A;  4BHB A;  1R49 A;  2GM4 A;  1HBX G;  3NQO A;  1E3O C;  1XTA A;  4BJ5 C;  3L00 A;  1WSU A;  3BRO A;  4LGW A;  1T38 A;  2MH2 A;  4O3M A;  1RKT A;  4DBR A;  2KJB A;  1U9N A;  3EUH C;  2BXY A;  1S9H A;  5FKK A;  1MJ9 A;  2QUF A;  2VAS A;  4OAY A;  2DPU A;  2ZJR F;  3WTW C;  3MEX A;  3ZQH A;  2FOK A;  4IHV A;  4XLH A;  2H8W A;  2X6X A;  4CCL A;  1OFC X;  4N9I A;  3K7A J;  2DXI A;  3W2W A;  1IN8 A;  1VTN C;  3IWZ A;  4RGX A;  1P7J A;  1FZP B;  1VFC A;  2EFN A;  2OC6 A;  4N4N B;  4V2F A;  1GVD A;  2L7F P;  2R4G A;  3JTH A;  1O3Q A;  4KFC A;  2LR8 A;  4BAC A;  1I6X A;  2P0W A;  3AG1 H;  3FM5 A;  1T95 A;  1WRJ A;  1BI2 A;  3BP8 A;  4ENM A;  1KA8 A;  3I3L A;  2W48 A;  3B6C A;  3OOP A;  4G6D A;  5A2Q Z;  2RRE A;  1Y0N A;  3HTU A;  5IP7 J;  5B66 C;  1JT6 A;  5EEA A;  1QQI A;  1I6H J;  1PP8 F;  2ADU A;  2WV1 A;  3HRS A;  2DN0 A;  4KN7 X;  3ZRG A;  3RKX A;  3BCB A;  4QSH A;  4AIH A;  2BOL A;  1YRN A;  1B9N A;  4MFD A;  3Q9V A;  4CDG A;  3JSP A;  1ZG3 A;  4IO9 F;  1TQM A;  3WU2 C;  2KDO A;  3ZQF A;  1N78 A;  5F27 A;  1YJN I;  2XF7 A;  4PSW A;  1XMX A;  4KIS A;  1RIO H;  1BI1 A;  2E2I J;  4HLX A;  1FYK A;  3FM3 A;  3LSR A;  1UZC A;  3IH2 A;  1YJW I;  3RTR A;  4ENN A;  4CA0 A;  1ULY A;  1QPI A;  1X4P A;  3P9K A;  3HIF A;  2MAB A;  2IGK A;  4JX5 A;  2NS7 A;  2FBH A;  5TJJ A;  4CYD A;  4HW0 A;  1WFX A;  2IS6 A;  4A0X A;  3R0J A;  4A0Z A;  2HDC A;  2BBY A;  2CO5 A;  2CUE A;  3BT9 A;  2Y9Z A;  1XB4 A;  3A01 B;  2DK5 A;  3ZMV A;  1BOA A;  2VC0 A;  3HXL A;  4RM3 A;  2CQ7 A;  1JGG A;  5FRO A;  3DEU A;  1FY7 A;  2VKD A;  2XAG A;  2KJC A;  3BG3 A;  3BQZ A;  3F8F A;  3HHH A;  2MC3 A;  3AKZ A;  3H5A A;  2QM3 A;  4L18 B;  2M34 A;  3SFI A;  3TP0 A;  1JXS A;  2ZJP F;  4LK0 F;  3QRF F;  1G3T A;  2JMW A;  2QQ8 A;  2IPQ X;  1G8X A;  3K9T A;  3OL4 A;  4ZZL A;  4HNV A;  1EF4 A;  3E3V A;  4IX7 A;  4D7M A;  2L9R A;  2BY0 A;  5TRD A;  2OD5 A;  5E3M A;  2P4W A;  2LYC A;  4BE2 A;  5JVT A;  4NC6 A;  3HRT A;  3K10 A;  3N97 A;  2F4M B;  3F0C A;  4PJJ A;  3ZMU A;  1F5T A;  4XSZ F;  2X51 A;  3L09 A;  3LSK A;  6PAX A;  4C2M J;  2QSH X;  2WAQ A;  3GTG J;  1TBX A;  1OYI A;  3K0L A;  2WY8 Q;  5JLW A;  1VQL I;  1YQA A;  2LTP A;  2IA2 A;  1RUN A;  5H6R A;  4EJV A;  2K85 A;  3BR2 A;  2LG4 A;  3GTL J;  3H92 A;  2V4J C;  4XKB A;  2P5K A;  2TDX A;  2Z2S B;  2FJ1 A;  1R36 A;  1OCC H;  2ELJ A;  2R93 J;  2V9P A;  1EA3 A;  4XOR A;  1OR7 A;  2BHY A;  2FNP A;  3CJT B;  4J01 A;  3GFM A;  2L4A A;  4A6E A;  4AYB N;  2H09 A;  4Y13 A;  3S1R J;  1HLV A;  3HOY J;  3PO3 J;  1DPU A;  4CCK A;  1TT5 B;  3ZMZ A;  2JUG A;  1ZQ3 P;  1RPW A;  2JA6 J;  1UMQ A;  4G12 A;  3S93 A;  2EJR A;  2ZSI B;  2M3A A;  2HYF A;  1R1T A;  2X6Y A;  3DBL B;  3OYB A;  1K4T A;  2PN6 A;  5E8G A;  2YU9 J;  2KRC A;  4RB0 A;  2YU3 A;  4NBQ A;  4U7B A;  1I3Q J;  3L1P A;  3BZC A;  2LOO A;  4JQF A;  2OCE A;  1B72 A;  3LFK A;  4HDV A;  3LMM A;  2EFP A;  3M07 A;  5C3E J;  1XMA A;  2PMZ N;  2LRD A;  1OCR H;  1GXQ A;  4B1R A;  2H1L A;  2FQ4 A;  2XRO A;  4DBQ A;  1MMN A;  4JOM A;  4A2U A;  2KMU A;  4F52 A;  2IGM A;  2C6Y A;  2VUM J;  3W6V A;  2N8G A;  2W4S A;  5DD8 A;  2E5N A;  3CTA A;  1J2X A;  3BCA A;  3QYF A;  2JA5 J;  3S32 A;  4V19 K;  2LFB A;  3CUQ B;  5E3O A;  5GTH C;  2X1E A;  1CF7 A;  2CQK A;  2ECC A;  2W1O A;  3QWL A;  1ZK8 A;  1BI3 A;  2CYY A;  1G3Y A;  3BPX A;  3VEP A;  2HWV A;  2CW0 F;  1VQO I;  1IXR C;  2K9N A;  1XCB A;  4KMU X;  2O7O A;  1K78 A;  1MD0 A;  2CUF A;  3BG9 A;  3MKY B;  3DF8 A;  1GV2 A;  4C3I J;  3HZJ A;  5KHD A;  3IH3 A;  1A31 A;  3IRQ A;  1TWC J;  4BDZ A;  4BXU A;  3HB9 A;  2DFH A;  2DDB A;  3OS2 A;  1D8J A;  4Y4R A;  4ABZ A;  1D0X A;  2M4K A;  2EV6 A;  4A3C J;  4LOC A;  3EUA A;  2NOG A;  5FD6 A;  2A07 F;  2QSF X;  3KEY A;  1RI7 A;  2Y31 A;  2O6G E;  3IV5 A;  1ETQ A;  3E5X A;  5HOD A;  3FXM A;  2WAE A;  5AIQ A;  2MW8 A;  2K9L A;  4ITV A;  2KZV A;  2V1N A;  1X2M A;  4CCM A;  1S29 A;  4EAT A;  3ABL H;  4GO1 A;  1YS6 A;  4Q5S F;  2QEN A;  1ENH A;  3GZN B;  4U0V A;  4R1H A;  3ZMD A;  2PBI A;  2GLO A;  3VOD A;  1K6Y A;  2V79 A;  3VYR B;  4C3H J;  3V8L A;  2GBY A;  3TOB A;  4EJT A;  5CPR B;  3OYH A;  2DOE A;  3TP3 A;  2RKH A;  3BC8 A;  3GZ6 A;  2VI6 A;  3QP5 A;  3VYT B;  5L3D A;  3HBL A;  4ENJ A;  4W97 A;  2XPU A;  3RPQ A;  1OKR A;  3ECH A;  2R5Y B;  4IZZ A;  1MIJ A;  1IJW C;  5IYC J;  4XRM A;  3H1C A;  3I53 A;  5KK1 A;  2EB7 A;  1R1V A;  4MTD A;  1S7A A;  1XDS A;  2XRL A;  4XBF A;  4XLE A;  4Q4Z F;  3EQL F;  2W25 A;  2Z33 A;  3E6C C;  1ZAR A;  5GAH J;  3WTU C;  2RAE A;  2IGN A;  3CD6 I;  3GTM J;  2DA7 A;  4LB6 B;  3JAM K;  3ZXS A;  3LAP A;  1WJB A;  3MQ0 A;  5HDG A;  4BUP A;  3CCS I;  3V7C A;  3WTZ A;  1XD7 A;  1GHC A;  1KU9 A;  1DGW Y;  2DMT A;  2VJ4 A;  2XDV A;  3OYF A;  4ETS A;  4MEX F;  3ZN1 A;  3BG7 A;  2OTJ I;  2X48 A;  2DA1 A;  1ACI A;  2ISY A;  3IWF A;  1O57 A;  1HA8 A;  4XL9 A;  2ZO4 A;  3JR9 A;  5HLH A;  5H20 A;  2F4O B;  1S8N A;  1TWF J;  3GWZ A;  1APL C;  2ZME C;  5FKO A;  4E7Z A;  5B3S H;  3KYD B;  4MLO A;  5LEK A;  1R22 A;  4HLY A;  4M6V A;  1IXC A;  4N0B A;  5FB2 A;  3L9F A;  5FJ8 J;  2F5V A;  3A0H C;  2BZT A;  2V6E A;  1FIA A;  2XAU A;  5KCM A;  2KZG A;  5EZG A;  5FRM A;  3JRH A;  1BM9 A;  5CQG A;  3H35 A;  4EM2 A;  4RAZ A;  1O3T A;  3Q0W A;  4BNC A;  1BR4 A;  3BTL A;  1HDP A;  2DFI A;  4GYI A;  3ECO A;  3JRD A;  1VQ7 I;  4HEA 2;  5IOZ A;  1WJE A;  3M1E A;  3RI4 A;  4CXF A;  2XB5 A;  1H88 C;  1E2X A;  4NQW B;  2J5P A;  4P9F A;  3BG6 A;  3TBI A;  2JA2 A;  1Z9C A;  1V5E A;  3SHF A;  2EA4 A;  3S2D J;  3KP7 A;  1RES A;  5ILS A;  3RCO A;  1V5G A;  2A61 A;  1G59 A;  1E3P A;  2JVG A;  3I9V 2;  4R79 A;  3F6V A;  3OYN A;  1UG2 A;  2JUC A;  3BZK A;  2KIU A;  5ILV A;  3I0T A;  4DNC A;  1VI0 A;  3I64 A;  1TZL A;  4G6T B;  1ZRC A;  4FX0 A;  2LKS A;  3ZPL A;  2E35 A;  2Z5U A;  3PUB A;  1ZRD A;  2BVL A;  1IF1 A;  4BH9 A;  1SVL A;  5H2F C;  4C30 A;  2CQX A;  1RC9 A;  1V55 H;  3H0G J;  1FYM A;  2F5C A;  3CCJ I;  1WZ2 A;  4G7Z F;  3FX3 A;  3GME A;  1G2H A;  5EEG A;  2AQE A;  3RQI A;  1IN7 A;  4EQQ A;  2QKM B;  4B48 A;  1F9N A;  3M8E A;  3DEW A;  3A1Y A;  3IH4 A;  1I1G A;  2Y0S N;  2RDP A;  2K4J A;  1IDZ A;  2MSY A;  1VQ4 I;  1TWH J;  2QEX I;  1U5T C;  4GXO A;  2OJE D;  3DBR B;  3PIP F;  4G6Q A;  1J5Y A;  4MEY F;  3S2W A;  5DV5 A;  4HQE A;  1MW7 A;  4CIC A;  2YX4 A;  1O3S A;  5M3M J;  2VOD A;  1AA7 A;  3DFG A;  2EZL A;  3FF5 A;  2FMY A;  3PUF A;  3QP6 A;  4LB5 A;  5CJ9 A;  3FXJ A;  1BC8 C;  1NHA A;  1QHH D;  1DU6 A;  1QZE A;  4RB3 C;  4Y15 A;  2LF7 A;  3WU1 B;  4HSR A;  1U9O A;  4CCJ A;  3A01 A;  4MGR A;  1TQP A;  4Y33 A;  4WWC A;  1MMS A;  3VSK A;  3LSJ A;  1W1W E;  4M3D A;  1KGS A;  2MD5 A;  1R5H A;  3K1N A;  5K7Z A;  3MKW B;  2FRH A;  2PX9 A;  1O7L A;  2G0E A;  2IBD A;  5E1X A;  1W5T A;  4D5F A;  3K1P A;  1PUF B;  2KT0 A;  1WJC A;  4PFP A;  4BBS J;  1MDM B;  3LL7 A;  4W1U A;  3QU3 A;  1JT0 A;  3GO5 A;  2VBY A;  4JP0 A;  1WJ5 A;  3I59 B;  3EDP A;  1T0F C;  2Q2E B;  2WC2 A;  3QYE A;  3HJE A;  3K2Z A;  2LD5 A;  5FGM A;  4F7Z A;  3L2U A;  1YJ9 I;  2E2H J;  3HGY A;  2HOE A;  5IYD J;  1GUU A;  2NOJ B;  2VPR A;  3FIS A;  1T8I A;  3LAJ A;  2W85 A;  4HA8 A;  2DI3 A;  2HDW A;  3DV8 A;  5HLT A;  3J80 K;  4NUB A;  2ELH A;  2WAF A;  4ZYH A;  5LGN A;  1JE8 A;  1T2K A;  3KYC B;  3T8T A;  3J7Z I;  4A3J J;  4A5M A;  1ZEL A;  1UAA A;  1QA6 A;  2DCE A;  2V1U A;  4OAZ A;  3DP7 A;  3S1M J;  4MHG A;  3O8G A;  2AS5 F;  1IXS B;  3OIP A;  2FML A;  1Z3X A;  4P5O A;  5ILU A;  2QKL B;  1X3U A;  2HVS A;  3QPT A;  4J19 A;  2ELK A;  3NAR A;  2H94 A;  3MD2 A;  2I8D A;  3OV8 A;  4I76 A;  3HOZ J;  2HXI A;  3PIO F;  1TWA J;  3FMQ A;  2DMQ A;  3FK6 A;  2B63 J;  4BE1 A;  2VT3 A;  4M3F A;  3P9I A;  4FAS D;  4XMY A;  4B47 A;  1N75 A;  5GAG J;  2OCC H;  3DKY A;  1IGN A;  4ANJ A;  4A93 J;  3HKZ A;  2E19 A;  2CWE A;  1RET A;  4E7I A;  2IS1 A;  4PJM A;  2OQG A;  1VQM I;  3ZQC A;  2Y30 A;  2BVM A;  2Z16 A;  4E7K A;  3CP2 A;  3IUO A;  3E0J B;  2K86 A;  3OYI A;  4HRI A;  4U87 A;  3HOW J;  1KON A;  1H8A C;  1SFK A;  3R6S A;  4OMY A;  1RUO A;  3O6B B;  2DA5 A;  3HPG A;  3N4M A;  4MIM A;  2WBM A;  4ASN A;  1Z3Y A;  3GZ5 A;  2VN2 A;  5BPI A;  2LBF B;  2NXN B;  2BY1 A;  1LEB A;  5FO5 A;  2LY2 A;  1MBK A;  4RB1 A;  2F5F A;  1QVU A;  2JVH A;  2L54 A;  1S72 I;  4Z2Y A;  1K83 J;  1Q1V A;  5K5O A;  1MSF C;  4D5C A;  4HF1 A;  1KU7 A;  3CUQ A;  3ROU A;  5CKT A;  1U6G A;  2MA3 A;  4IL6 C;  1AKH B;  1FWZ A;  1UFM A;  5F04 A;  3TMO A;  4IF4 A;  4YFX F;  1Y39 A;  4BKX A;  4YG2 F;  1A35 A;  3CDL A;  2DOD A;  4BEH B;  1LDD A;  2DFE A;  3DTK A;  5D4S A;  2EV5 A;  2HVQ A;  2DTZ A;  5FFX A;  1ZG5 A;  2XC7 A;  1D3Y A;  3A02 A;  1ZAO A;  5D5U B;  3DU5 A;  2ZXI A;  1ON2 A;  9ANT A;  4BDY A;  1KYZ A;  2R7W A;  3LQQ A;  4BHP A;  2CUZ A;  4UB6 C;  2GOX B;  4FTH A;  2JA7 J;  2DQL A;  3M9A A;  1BR2 A;  5ICE A;  1I5Z A;  4B43 A;  1ETV A;  5L3E A;  4G7H F;  1B6A A;  1XPX A;  3G71 I;  1BI0 A;  1LFB A;  3F8C A;  1D8K A;  2D1V A;  2RQP A;  4LG0 B;  2UV1 A;  1XN7 A;  4ZYA A;  1CQT A;  1OJL A;  3FXO A;  4BQQ A;  4KDP A;  2M9H A;  4GCV A;  3CO7 C;  1QZZ A;  2DU9 A;  2RNJ A;  3WGI A;  2E7X A;  5F0C A;  1R5I D;  1R9T J;  1F43 A;  3EPZ A; 
#chains in the Genus database with same CATH homology
 4U88 A;  2M5W A;  1TNT A;  2ZME B;  5IT9 K;  3SXY A;  1W7P B;  2G9W A;  1RZ4 A;  2EK5 A;  2FNA A;  1E17 A;  1ONV A;  3BPV A;  3R61 A;  4PCQ A;  3G73 A;  4M73 A;  3F23 A;  4OU0 A;  4K2E A;  2L3D A;  2XAS A;  3RYR A;  3EUH A;  1XGO A;  4A0Y A;  5CVJ A;  4L9N A;  4WXH A;  3BWG A;  2V6C A;  2IRF G;  2K27 A;  4KT5 C;  4HBL A;  1W5S A;  5LRS A;  1Z91 A;  2AXL A;  2COM A;  4ON0 A;  5E1Z B;  1Y0U A;  1YW7 A;  3FMR A;  1FYL A;  3U9G A;  1AWC A;  3GFI A;  3REO A;  3KZY A;  4M6X A;  1KYW A;  4BAY A;  3P9C A;  5AIP A;  4N9H A;  5FLX K;  1Q1H A;  5K5Q A;  5HS7 A;  4PGG A;  2HTS A;  2P5V A;  5CYV A;  3Q5F A;  3IKT A;  5BOX A;  4EJU A;  3BY6 A;  2V1X A;  1DDN A;  1U5T B;  2FQ3 A;  1G6N A;  3IC7 A;  5L3F A;  4NQW A;  3CUO A;  2XKP A;  1USS A;  1DUX C;  5DUK A;  2A6E F;  5HS8 A;  4WCG A;  5LRR A;  3V8K A;  4EJO A;  1YTY A;  5LHH A;  3HHG A;  3DQV C;  3BDD A;  3FXQ A;  1H9T A;  2OU2 A;  4I09 A;  3E97 A;  5CVU A;  2EV0 A;  2NNY A;  2KIF A;  1YO5 C;  3JW4 A;  1HXD A;  4UVC A;  3BJO A;  4Q47 A;  1EV7 A;  1T39 A;  3QAH A;  4I2O A;  5D8L B;  2VC1 A;  2GXB A;  3HTS B;  4EJW A;  1ZLJ A;  3T5X A;  5L3G A;  4YII A;  5JHU A;  2HZT A;  3HSR A;  2IW5 A;  4IXA A;  2W24 A;  3KP4 A;  1J59 A;  4Y17 A;  4IRH A;  2XAH A;  2Y48 A;  3V7R A;  2FU4 A;  2LF8 A;  1ZLK A;  3QOP A;  2LDU A;  4XLN F;  5L3B A;  5BQT A;  1MDM A;  5D6E A;  2DAO A;  1V4R A;  2D1H A;  1Z6R A;  3I59 A;  1I27 A;  2Q2E A;  3JTG A;  3RDI A;  4M72 A;  4OIQ F;  1G4D A;  4KIB A;  2ZXJ A;  2YR2 A;  2JTV A;  4U0W A;  1ON1 A;  2M1B A;  2EA2 A;  2UXX A;  1R58 A;  4UVA A;  3EYY A;  2OQR A;  4RAY A;  3R4K A;  1S3J A;  2F2E A;  5LBQ A;  2M45 A;  3D5L A;  3C1D A;  3I54 A;  2IA1 A;  3F72 A;  4JK1 X;  3H3U A;  4M6Y A;  4WXC A;  1TW2 A;  1LQ1 A;  3MFK A;  2BV6 A;  3U1D A;  5D5V B;  4L5I A;  2HKX A;  3MCZ A;  4A5N A;  5JFR A;  3ELK A;  3ZMT A;  2Y0M A;  2O3F A;  3RYP A;  1UB9 A;  4LK1 F;  3RIR A;  1P4W A;  3KP5 A;  1MGT A;  5BMZ A;  1TQI A;  2XIG A;  1LVA A;  2XAF A;  4KIC A;  4PDK A;  1KU3 A;  2FE3 A;  5IT3 A;  2D2W A;  1XMK A;  4DQ2 A;  4IVN A;  1FBU A;  1L0O C;  1OMI A;  2ZNZ A;  2GWR A;  4CO8 A;  1R00 A;  5H6Q A;  1W4M A;  4FHT A;  4H0E A;  2VXZ A;  2IVM A;  2NAZ A;  4HOB A;  2FEZ A;  3HOS A;  1U8R A;  1QO0 D;  1ZRE A;  1EH7 A;  4XLP F;  1ZYR F;  1MKM A;  2DPD A;  2OZU A;  4HF2 A;  5E18 F;  4LG0 A;  1MJB A;  4P96 A;  1LNW A;  4M9Z A;  3J81 Z;  3MWM A;  1AOY A;  1J75 A;  1EH6 A;  4L0Y B;  4L0Z B;  1FP1 D;  1G3S A;  2ZME A;  3GXO A;  1W7P A;  1FBQ A;  1LEA A;  4MTE A;  1P4A A;  1B1B A;  1QPM A;  3HUG A;  3TO9 A;  4HX8 A;  2XV4 S;  3ABT A;  4U0Y A;  3AAF A;  2O03 A;  1REP C;  4RS8 A;  5HDK A;  1YLF A;  3B73 A;  3K1M A;  4HQM A;  2LNB A;  3DKW A;  3MAJ A;  1YFH A;  2O61 A;  5J6X A;  2VT2 A;  4OIO F;  5A2Q K;  2CSO A;  1QBJ A;  4EGY A;  5LHI A;  4CZZ A;  1WQ2 A;  2O8X A;  3LA7 A;  1WKM A;  3KCC A;  5AON A;  3E6D A;  1BC7 C;  1HW1 A;  4JBA A;  1SFU A;  2KIM A;  2G7H A;  5ERI A;  2BYV E;  1XSD A;  2RVC A;  2RN7 A;  3T8R A;  2L01 A;  1B4A A;  2OBP A;  2W84 A;  2IA0 A;  2VBX A;  2H27 A;  2RGV A;  3ML6 A;  3L7W A;  1K79 A;  1BJA A;  5FD5 A;  4EGZ A;  1U5T A;  3RJP A;  3TO6 A;  2FF4 A;  1PDN C;  2ESN A;  1UHM A;  3WTX C;  5BS6 A;  1Z6T A;  2ACJ A;  3SZP A;  2QVO A;  5HVQ C;  3MZH A;  3KET A;  2F5D A;  2HR3 A;  1HSJ A;  3I4P A;  4NB5 A;  1UCR A;  2NS0 A;  2GA2 A;  1T6S A;  1Z05 A;  2EFW A;  2ZFW A;  3WTY C;  4YFN F;  1XCV A;  1XGM A;  2MLK A;  2ISZ A;  2XRN A;  2O0Y A;  3KEQ A;  2FXA A;  3RPU A;  1BBY A;  2GA1 A;  1T0F A;  3TDZ C;  2XVC A;  1JHF A;  1SD5 A;  3HSE A;  4AIK A;  2Q8K A;  2QBY B;  3FWE A;  2WV0 A;  2Z9O A;  3Q9S A;  3LA2 A;  1ZRF A;  4KN4 X;  1FOK A;  2JPC A;  3GYH X;  5HS9 A;  1SD6 A;  1C0W A;  4P9U A;  4ZYG A;  2A69 F;  3W6K B;  1D5V A;  4ENK A;  4HAM A;  4U7D A;  4KUM A;  5D4R A;  4UNO A;  2EWN A;  3FHZ A;  1J0R A;  1SD7 A;  1FLI A;  1LJ9 A;  2P6T A;  4RGU A;  2QQ9 A;  3SZT A;  1SFX A;  2IJL A;  5F6F A;  2Z99 A;  5ICC A;  2DQR A;  2OA4 A;  2FA5 A;  5HLG A;  3VFZ A;  2PJP A;  5L3C A;  3F8M A;  4ZYE A;  2K4B A;  1W7P D;  2XAQ A;  5F64 A;  1PP7 U;  2VBW A;  4EVI A;  2P6S A;  4KYW A;  2DBB A;  3MZY A;  1HKS A;  2YX7 A;  1ODD A;  1SD4 A;  4B09 A;  3IKV A;  2ZJ2 A;  2R7F A;  1ZH5 A;  1F1Z A;  5CVI A;  3KLN A;  4HX4 A;  4PGH A;  2JRT A;  2YPR A;  2BGC A;  3V7S A;  2PG4 A;  3WE3 A;  4AIJ A;  3F8N A;  4OIR F;  4OMZ A;  2CGP A;  4HZF A;  4M71 A;  1U3E M;  1HW5 A;  2JT1 A;  3NRV A;  3TOA A;  3KP6 A;  1JHH A;  5E20 A;  2UZK A;  4LMY A;  5JR3 A;  1HKT A;  1WI9 A;  2FSW A;  1H9G A;  3HRU A;  4KNY A;  1WWX A;  1IZ1 A;  1IAW A;  2IT0 A;  5CLS A;  4S05 A;  2P7C B;  1PUE E;  2LKP A;  4YFK F;  2FBK A;  5DCF A;  4XRF A;  1FSE A;  2XUB A;  3ISP A;  5LGT A;  2JZY A;  3GVA A;  2MH9 A;  5HOO A;  2OZ6 A;  5DCM B;  4OIN F;  3JAM Z;  4CHU A;  1FBS A;  4XSX F;  2P7V B;  5ICF A;  3I71 A;  3FXR A;  5LHG A;  5DDG A;  2XGX A;  4M74 A;  3GFL A;  3GFJ A;  3M8F A;  3F6O A;  1ZN2 A;  2MBF A;  2QZ8 A;  5F1R A;  4QWQ A;  5D5X B;  5HDN A;  5E8I A;  3E6M A;  1GXP A;  4P55 A;  4EM0 B;  3I58 A;  2RV8 A;  2RC4 A;  1Z7U A;  2ZNY A;  5DUI A;  2A5Y B;  3BOQ A;  3TGN A;  4UUV A;  4FT8 A;  3GW2 A;  2VE9 A;  1UHW A;  4A12 A;  1H0M A;  2GIV A;  2HFH A;  2GQQ A;  1FT9 A;  3ZMS A;  2R7D A;  3J7A O;  1STZ A;  3EYI A;  1YW8 A;  4LLL A;  3WGG A;  2HQR A;  3TKY A;  2VE8 A;  1I1S A;  2A3S A;  3IRR A;  2QYO A;  3BJ6 A;  3DXJ F;  2K02 A;  4M9X A;  3CLO A;  1P4X A;  3F3X A;  4E70 A;  1RNL A;  1IN5 A;  2QQA A;  1P6R A;  1KQ8 A;  3WE2 A;  5CVR A;  1FPQ A;  1P92 A;  1ZGJ A;  5ED4 A;  2P5L C;  3GLX A;  2X0L A;  3TO7 A;  4LLG F;  3HOT A;  3PFI A;  1LDJ A;  2JSC A;  3PQK A;  3LST A;  3V8J A;  1FP2 A;  4RGS A;  1TLH B;  1QNT A;  4RB2 C;  1KU2 A;  4A6D A;  3ZP5 A;  4HX7 A;  5HLI A;  2DTR A;  2ESH A;  4LFU A;  3E6B A;  3FXU A;  3KFW X;  4D0P A;  3KZZ A;  4NHJ A;  2WWY A;  3JSO A;  3VB2 A;  3CO6 C;  1KQ9 A;  4HF0 A;  2STT A;  3P7N A;  2Q0O A;  3VOE A;  4WK8 F;  4O5V A;  3L2C A;  3WG9 A;  2DO7 A;  3J80 Z;  3ERE D;  2QBY A;  3SFZ A;  1S6L A;  2PEX A;  2VBZ A;  4HV6 A;  2DW4 A;  3FZV A;  4IHT A;  1ZGA A;  4GYG A;  4RGR A;  2YSR A;  2EFQ A;  4WXD A;  3LWF A;  1EH8 A;  2QQB A;  4WX9 A;  2PI0 A;  4S04 A;  2PMH A;  1CGP A;  4G94 A;  3C3W A;  4HV5 A;  2HEO A;  1O7F A;  1MJA A;  4IRI A;  1U2W A;  4TV7 A;  3R0A A;  4EV0 A;  3DPT A;  5E1W A;  5ICG A;  1L3L A;  3O2P E;  4UV9 A;  3KEO A;  2STW A;  4HYE A;  1GVJ A;  1S7O A;  3F21 A;  1TTY A;  2HS5 A;  2HYG D;  1DP7 P;  1BN5 A;  1HW2 A;  4KMF A;  4HDU A;  2WTE A;  2L4M A;  3T1B A;  4L5J A;  3K69 A;  3RKY A;  2E1N A;  5J8F A;  4LLN A;  2NYX A;  4UXN A;  2VOP A;  2W57 A;  3KE2 A;  2GAU A;  3T0Y A;  4PZJ A;  2K7L A;  1QZY A;  2FBI A;  2NNN A;  1IN4 A;  1O3R A;  2HQN A;  3GEZ A;  1XGS A;  1A04 A;  4MNU A;  2M8E A;  1J9I A;  4ZH4 F;  3ABU A;  1MZB A;  1XDU A;  2J5O A;  2CG4 A;  3LQR A;  3GUD A;  1HQC A;  1R23 A;  2HKO A;  2A6H F;  3H3Z A;  2M87 A;  4AVP A;  1UST A;  2VOO A;  2A68 F;  5IT9 Z;  2H6C A;  4BYY A;  1XGN A;  1SMT A;  3KLO A;  3WU0 A;  5K1Y A;  3G3Z A;  4IPA A;  2BEO A;  4KIG A;  5D6F A;  3COA C;  4KIF A;  3F22 A;  1FX7 A;  2Z3Y A;  4LJZ F;  3WTT C;  1YS7 A;  4WF2 A;  5DCM A;  4Q48 A;  4I0A A;  4L9J A;  5EEH A;  3HYI A;  3U2R A;  3F8B A;  1IUY A;  3GX4 X;  5LEJ A;  4EMS A;  2VON A;  2KKO A;  1J7K A;  5K5R A;  5DYM A;  4I01 A;  2G7U A;  4CGZ A;  5FLX Z;  2MLG A;  2HGC A;  1HKQ A;  4I98 B;  1XSX A;  4UV8 A;  3CDH A;  4G7O F;  4KA4 A;  4L9V A;  2V9V A;  2PLY A;  3QPH A;  4OIP F;  1U78 A;  2GZW A;  1IW7 F;  3O3K A;  2V1D A;  3IL2 A;  1SMY F;  3CJN A;  3TDU C;  4MQV A;  4YIF A;  3R60 A;  5E17 F;  5LLQ A;  3WOD F;  4OOI A;  3QU6 A;  2QWW A;  1B9M A;  1FC3 A;  3C18 A;  4LD5 A;  1B59 A;  4B8X A;  5LGU A;  4FX4 A;  3W6J B;  4AD9 A;  3GF2 A;  3BZ6 A;  4UHT A;  1YIO A;  4QLC U;  1T98 A;  4ESJ A;  3WGH A;  1R1U A;  1FNN A;  2IP2 A;  2F5E A;  1KQ0 A;  3KP3 A;  1XSV A;  4IJA A;  3RKW A;  5J8C A;  1ZHF A;  4ESB A;  2L02 A;  4O6J A;  1QGP A;  4G8X A;  5D5W B;  2DLL A;  3FMS A;  4I02 A;  1P2F A;  5KVR A;  1YG2 A;  2DK8 A;  4L9T A;  3WTV C;  1SFE A;  2CFX A;  1FSH A;  5CVV A;  2HTJ A;  2PMU A;  2ZBK A;  2UXN A;  2XKO A;  1G3W A;  3I5U A;  4IHS A;  2QLZ A;  2ETH A;  4AWX B;  1TW3 A;  2JPB A;  3LA3 A;  5JI6 A;  2PQ8 A;  3V4G A;  1CF7 B;  3NEU A;  3E5Q A;  5FFZ A;  4ZZD A;  1DPR A;  4ZYD A;  2KRF A;  1R5G A;  2PFB A;  4M9S A;  1Z1D A;  1LDK B;  2E1C A;  4UVB A;  4I0B A;  3WTS C;  1K78 B;  5BPD A;  2P8T A;  2DT5 A;  3E5U A;  2M30 A;  2D45 A;  4EM1 A;  4IRG A;  3SQN A;  2XAJ A;  4ESF A;  1TNS A;  3TQN A;  3C7J A;  1BIA A;  1BIB A;  1ZG1 A;  4R8H A;  4MQ9 F;  3DPL C;  1V3F A;  3PQJ A;  2UWM A;  3CUQ C;  4G9Y A;  5D8K B;  3EET A;  3ULQ B;  1IRG A;  1OYW A;  2EFO A;  4BHC A;  5DD4 A;  1K7A A;  2H6B A;  1HST A;  1JGS A;  1IRF A;  2E7W A;  1YW9 A;  2ZKZ A;  4BQA A;  2B0L A;  2X4H A;  3KP2 A;  1K6O A;  2OAZ A;  1SAX A;  1F4K A;  2ZCW A;  1OPC A;  2GXG A;  3ZQ7 A;  2NRA C;  2XHK A;  3BJA A;  2BE5 F;  4GGG A;  3D0S A;  3HRM A;  2LSO A;  2R3S A;  5DEQ A;  2Y75 A;  1IN6 A;  1YYV A;  3IHU A;  3J81 K;  4I7H A;  1OYY A;  3ZN0 A;  3B02 A;  1LB2 A;  3M7G A;  1R7J A;  4BHB A;  1HBX G;  3NQO A;  3L00 A;  1WSU A;  3BRO A;  4LGW A;  1T38 A;  2MH2 A;  4O3M A;  2KJB A;  1MJ9 A;  2QUF A;  2DPU A;  3WTW C;  3MEX A;  2FOK A;  4N9I A;  1IN8 A;  1VTN C;  3IWZ A;  4RGX A;  1FZP B;  2EFN A;  3JTH A;  1O3Q A;  4KFC A;  1I6X A;  3FM5 A;  1WRJ A;  1BI2 A;  3BP8 A;  4ENM A;  1KA8 A;  3OOP A;  4G6D A;  5A2Q Z;  3HTU A;  1QQI A;  1PP8 F;  2ADU A;  3HRS A;  4KN7 X;  3RKX A;  4AIH A;  1B9N A;  3Q9V A;  4CDG A;  3JSP A;  1ZG3 A;  1TQM A;  1RIO H;  1BI1 A;  4HLX A;  1FYK A;  3FM3 A;  3RTR A;  4ENN A;  1ULY A;  3P9K A;  3HIF A;  2FBH A;  5TJJ A;  4CYD A;  4HW0 A;  4A0X A;  3R0J A;  4A0Z A;  2HDC A;  2BBY A;  2CO5 A;  1XB4 A;  2DK5 A;  3ZMV A;  1BOA A;  2VC0 A;  3DEU A;  1FY7 A;  2XAG A;  2KJC A;  3F8F A;  3HHH A;  2MC3 A;  2QM3 A;  4L18 B;  1JXS A;  4LK0 F;  3QRF F;  1G3T A;  3K9T A;  4ZZL A;  2IPQ X;  3E3V A;  5TRD A;  2OD5 A;  2P4W A;  5JVT A;  3HRT A;  3N97 A;  3ZMU A;  1F5T A;  4XSZ F;  3L09 A;  6PAX A;  1TBX A;  1OYI A;  3K0L A;  1YQA A;  2IA2 A;  1RUN A;  5H6R A;  4EJV A;  3H92 A;  2P5K A;  2TDX A;  1R36 A;  1OR7 A;  2FNP A;  3GFM A;  2L4A A;  4A6E A;  2H09 A;  4Y13 A;  1DPU A;  3ZMZ A;  2EJR A;  2HYF A;  1R1T A;  2PN6 A;  5E8G A;  4RB0 A;  2YU3 A;  4U7B A;  4JQF A;  3LFK A;  4HDV A;  2EFP A;  1XMA A;  1GXQ A;  2XRO A;  4A2U A;  2C6Y A;  5DD8 A;  3CTA A;  1J2X A;  3CUQ B;  1CF7 A;  2CQK A;  1BI3 A;  2CYY A;  1G3Y A;  3BPX A;  3VEP A;  2HWV A;  2CW0 F;  1IXR C;  1XCB A;  4KMU X;  1K78 A;  1MD0 A;  3DF8 A;  3IRQ A;  4BXU A;  1D8J A;  2EV6 A;  5FD6 A;  2A07 F;  1RI7 A;  2O6G E;  3E5X A;  5AIQ A;  1S29 A;  4GO1 A;  1YS6 A;  4Q5S F;  2QEN A;  4U0V A;  3ZMD A;  4R1H A;  2PBI A;  3VOD A;  2V79 A;  3V8L A;  3TOB A;  4EJT A;  2RKH A;  3GZ6 A;  3QP5 A;  5L3D A;  4ENJ A;  3RPQ A;  1OKR A;  3ECH A;  3I53 A;  5KK1 A;  2EB7 A;  1R1V A;  4MTD A;  1S7A A;  1XDS A;  4XBF A;  4Q4Z F;  3EQL F;  2W25 A;  2Z33 A;  3E6C C;  1ZAR A;  3WTU C;  4LB6 B;  3JAM K;  3LAP A;  3MQ0 A;  5HDG A;  3V7C A;  3WTZ A;  1XD7 A;  1GHC A;  1KU9 A;  4ETS A;  4MEX F;  3ZN1 A;  2ISY A;  3IWF A;  1O57 A;  2ZO4 A;  5HLH A;  5H20 A;  1S8N A;  3GWZ A;  5LEK A;  1R22 A;  4HLY A;  1IXC A;  4N0B A;  5FB2 A;  3L9F A;  1BM9 A;  4EM2 A;  4RAZ A;  1O3T A;  4BNC A;  2DFI A;  4GYI A;  3ECO A;  3M1E A;  3RI4 A;  4CXF A;  1E2X A;  2J5P A;  4P9F A;  1Z9C A;  3SHF A;  2EA4 A;  3KP7 A;  5ILS A;  2A61 A;  4R79 A;  3F6V A;  2KIU A;  5ILV A;  3I0T A;  4DNC A;  3I64 A;  1ZRC A;  4FX0 A;  3ZPL A;  2Z5U A;  1ZRD A;  1IF1 A;  4BH9 A;  1FYM A;  2F5C A;  4G7Z F;  3FX3 A;  5EEG A;  1IN7 A;  4EQQ A;  1F9N A;  3M8E A;  1I1G A;  2RDP A;  2K4J A;  1U5T C;  4GXO A;  4G6Q A;  1J5Y A;  4MEY F;  3S2W A;  5DV5 A;  4HQE A;  4CIC A;  2YX4 A;  1O3S A;  2VOD A;  3DFG A;  3FF5 A;  2FMY A;  3QP6 A;  4LB5 A;  5CJ9 A;  1BC8 C;  1NHA A;  4RB3 C;  4Y15 A;  2LF7 A;  3WU1 B;  4MGR A;  1TQP A;  4WWC A;  1KGS A;  2MD5 A;  1R5H A;  3K1N A;  2FRH A;  1O7L A;  5E1X A;  1W5T A;  3K1P A;  1MDM B;  3QU3 A;  3GO5 A;  2VBY A;  3I59 B;  3EDP A;  2WC2 A;  3K2Z A;  5FGM A;  4F7Z A;  2HOE A;  3LAJ A;  2W85 A;  4HA8 A;  2DI3 A;  3DV8 A;  3J80 K;  2ELH A;  4ZYH A;  5LGN A;  1JE8 A;  1T2K A;  3T8T A;  4A5M A;  2V1U A;  3DP7 A;  4MHG A;  2AS5 F;  1IXS B;  2FML A;  4P5O A;  5ILU A;  1X3U A;  3QPT A;  2H94 A;  3OV8 A;  3FMQ A;  2VT3 A;  3P9I A;  2CWE A;  2OQG A;  2K86 A;  3R6S A;  4OMY A;  1RUO A;  3O6B B;  3N4M A;  4ASN A;  3GZ5 A;  2VN2 A;  5BPI A;  1LEB A;  5FO5 A;  4RB1 A;  2F5F A;  2L54 A;  4Z2Y A;  5K5O A;  4HF1 A;  1KU7 A;  3CUQ A;  3ROU A;  1U6G A;  2MA3 A;  1FWZ A;  1UFM A;  4IF4 A;  4YFX F;  4YG2 F;  1LDD A;  5D4S A;  2EV5 A;  5FFX A;  1ZG5 A;  1D3Y A;  1ZAO A;  5D5U B;  1ON2 A;  1KYZ A;  3LQQ A;  4BHP A;  2DQL A;  3M9A A;  5ICE A;  1I5Z A;  5L3E A;  4G7H F;  1B6A A;  1BI0 A;  3F8C A;  1D8K A;  2D1V A;  2RQP A;  4LG0 B;  1XN7 A;  4KDP A;  4GCV A;  3CO7 C;  1QZZ A;  2DU9 A;  2RNJ A;  3WGI A;  2E7X A;  3HSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...