1S29A

La autoantigen n-terminal domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
92
Chain Sequence
GSHMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDGLMVRRRDPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the La motif: a winged helix domain mediates RNA binding via a conserved aromatic patch.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Rna binding protein
molecule keywords La protein
total genus 25
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s29A00
1ZGAA 2ELHA 3CUQB 4ZZLA 4RB1A 1WWXA 1D3YA 1X3UA 3KZZA 4Q48A 1WI9A 1G3SA 5HOOA 3RPUA 3F8BA 3H92A 2R3SA 1XD7A 1RUOA 4IJAA 3WTSC 1FBUA 4BYYA 1O3QA 4E70A 2VOOA 1HXDA 2VC1A 2BBYA 2R7FA 2GZWA 1LQ1A 1DPRA 2ETHA 2VBZA 3SZPA 3COAC 4YFXF 3I59A 3NQOA 3LFKA 2MH9A 2DQRA 2PLYA 3FM3A 5H6RA 2ZFWA 3I64A 5ICEA 2RDPA 4QLCU 4U7BA 5DEQA 1MZBA 4YIFA 1FYLA 2W57A 4GYIA 1TNTA 4KIGA 4PZJA 4CXFA 1JE8A 2YX4A 3QP6A 1IXSB 3ABTA 1TBXA 4WF2A 3TO6A 4UV9A 4I02A 3RI4A 1MJ9A 2QYOA 4UVBA 3O6BB 2OBPA 4CHUA 2L4MA 3IWZA 4R79A 5LBQA 3C1DA 2DPDA 3GF2A 1WSUA 2IT0A 4OU0A 3R4KA 4EJVA 2YSRA 3VOEA 2H09A 3TQNA 3WGHA 2J5OA 5D5UB 2Z5UA 1QGPA 2FEZA 2ESNA 5CYVA 5DCMA 1GHCA 3ISPA 4IF4A 2QVOA 1F4KA 2RKHA 2FA5A 1RNLA 4G8XA 4ENJA 2EFPA 4KNYA 2Y48A 3F8MA 1F5TA 4PGHA 3BJOA 4PCQA 1SD5A 3IKVA 2GIVA 5D5WB 2QLZA 1T0FA 5D5XB 3U9GA 2VOPA 3KP3A 5A2QZ 3RPQA 4M72A 3J81Z 2DT5A 5H6QA 5E20A 2PG4A 4GO1A 3KLNA 5ERIA 1ZRFA 5E8IA 2QENA 1P4AA 2CO5A 2V79A 3GYHX 5D8KB 4L9JA 3GO5A 4P5OA 1B4AA 2F5DA 1SAXA 4A0ZA 4KYWA 3W6KB 2VC0A 2L54A 2O8XA 3EYIA 3RJPA 3R0JA 2VN2A 2F5EA 2C6YA 2HGCA 3G73A 2ZMEA 4CGZA 3B02A 3KP5A 3FXRA 1J75A 1ZREA 2O6GE 2STTA 4M9ZA 4M9XA 2FSWA 4S04A 1P92A 2V6CA 3FXUA 2P6TA 1LEAA 4EJTA 1H0MA 5E18F 2DTRA 3BDDA 5H20A 1I5ZA 1T2KA 3EUHA 3ZQ7A 3ZN1A 3J81K 1Z7UA 2VONA 1S7AA 4LG0B 1ON2A 1XMAA 2CFXA 2FE3A 1J9IA 5CJ9A 1Z6RA 4MTDA 4IRIA 2W85A 3LA3A 2FNAA 3ABUA 4A0XA 2KIUA 3BPXA 3WGIA 4M71A 1J7KA 1YO5C 1BJAA 3WTTC 2M30A 5CLSA 4KA4A 3BOQA 4HQEA 5E1ZB 1U2WA 1QNTA 1OPCA 2DQLA 1DP7P 4I7HA 1W4MA 3K1PA 1J0RA 1FPQA 1LNWA 1B59A 3OOPA 4NHJA 1UB9A 3RYRA 4P9UA 2EFOA 1IUYA 2ZKZA 2XIGA 3I54A 5J8FA 1IN5A 3CUOA 5LHIA 3R60A 4ZZDA 1K6OA 5CVJA 5HDGA 3T1BA 4KIFA 1IXCA 2D1HA 3GX4X 2HTJA 4HX8A 3R0AA 3HRUA 1L0OC 3L09A 5JHUA 1OYIA 2JZYA 3P7NA 4ZYHA 1S6LA 5DCMB 3WTZA 3LAJA 1ZYRF 2UWMA 1KQ8A 1Z91A 3PQJA 2A6EF 4ESBA 4M6YA 1JXSA 3RIRA 3RKYA 3JW4A 1L3LA 3GZ5A 1FWZA 2EV6A 4ZYGA 3IWFA 4MEXF 4YFNF 3RDIA 4HLYA 1U78A 3H3ZA 3WTVC 4I98B 3V7SA 2STWA 4HAMA 1KQ9A 4U0WA 4I0BA 2DU9A 4FX0A 1WQ2A 2COMA 2RV8A 1SFEA 3E5UA 1R1TA 2QQBA 3LA2A 1UHWA 1KU3A 3GW2A 4HYEA 2FF4A 3WU0A 3GFLA 2LKPA 2GAUA 1ZRCA 4G7OF 2FBIA 4TV7A 2P7VB 1TLHB 3PFIA 1XSXA 1ZRDA 2VT2A 1XCVA 5JI6A 1TNSA 2BEOA 1XGMA 4FX4A 4Y13A 2ZNZA 4WCGA 5EEGA 4ENKA 2E1NA 3K0LA 3TO7A 4KDPA 1O57A 2X0LA 2XHKA 1W7PA 2CSOA 4HF2A 3HSEA 1FY7A 2PMUA 5D5VB 3I53A 1ZH5A 3ZMZA 4EGYA 4FHTA 1XMKA 5L3GA 4FT8A 4HQMA 1IW7F 5F1RA 3E6CC 6PAXA 2VE9A 3T5XA 3T0YA 1B9MA 2Y0MA 2BV6A 4AVPA 4ASNA 1U3EM 5L3EA 4AIHA 2KKOA 4XSXF 1QZYA 3RTRA 3EQLF 2BYVE 3WODF 4AIKA 4HDVA 2OA4A 1EH7A 3M8EA 1BIAA 4XLPF 1BI1A 4OIPF 2UXXA 4BHCA 1AOYA 4PGGA 3QU6A 5DUKA 4CDGA 1HW2A 4MQ9F 1BC7C 2HEOA 3GXOA 3TOBA 3I59B 1VTNC 5K5OA 1KU7A 2IRFG 3I4PA 2E1CA 5FLXK 2DAOA 4YFKF 1BI3A 4ESFA 3LQQA 4IVNA 5DCFA 1BC8C 3WU1B 3GFMA 4A12A 2OQGA 4EQQA 1DDNA 3HUGA 2O3FA 1R23A 1T6SA 5E1WA 2WV0A 2YU3A 3ZPLA 2EA4A 3PQKA 5L3CA 3MZYA 1W7PB 2A6HF 4M9SA 4EJOA 1UFMA 2RN7A 3KFWX 3TO9A 1J59A 3NRVA 1FYMA 1MJBA 5KK1A 4U0YA 1ZHFA 5ICFA 2IPQX 5LHGA 3FZVA 2G7UA 3I58A 1H9TA 4L18B 2RC4A 3HRMA 4H0EA 2Q2EA 2IW5A 4O5VA 2P8TA 3IRQA 2FBKA 1KA8A 3AAFA 3DEUA 1ZAOA 4UNOA 4EM1A 4G7HF 5E8GA 4LLLA 4UV8A 4HZFA 4LMYA 3D0SA 2AS5F 2IJLA 2LSOA 2GXBA 3IC7A 1S29A 4M73A 3KZYA 4R1HA 5DDGA 3F8CA 2DI3A 5CVRA 5DD4A 3JTHA 3LAPA 4UUVA 4L0YB 4L5IA 3O2PE 1KYWA 2ZNYA 3TDZC 4EV0A 2K02A 2VE8A 5HVQC 2V1DA 2Q0OA 4EM2A 4IRHA 2JPBA 1GVJA 1FLIA 5K5QA 1B9NA 3V4GA 1G3YA 1ZG3A 1I1GA 2K7LA 2QBYB 1Q1HA 4NB5A 1JHHA 2IVMA 2MC3A 4RB3C 5IT3A 4JQFA 1FNNA 4GXOA 2PQ8A 3F6OA 3CO6C 2CG4A 2CW0F 4CYDA 4GGGA 2F5CA 4LFUA 3J80Z 2EFNA 3CLOA 2HZTA 5AIPA 4WWCA 1HW5A 3HYIA 2MLGA 4XLNF 3J7AO 2P6SA 3KETA 2K86A 1Z9CA 1BBYA 3KP2A 3HOSA 2GWRA 3HTUA 1HBXG 1FOKA 5HDKA 5ILSA 3ROUA 5ED4A 5FB2A 2CQKA 3FXQA 1HKSA 3P9KA 3K9TA 1Z05A 2EJRA 5DYMA 4OMYA 2PJPA 3Q5FA 2EK5A 5CVIA 3WTUC 2XRNA 1UHMA 3RKWA 1YLFA 4F7ZA 1OKRA 3FHZA 1DUXC 1ZARA 2W25A 3M8FA 3QPHA 2XKPA 4M6XA 2LF7A 1HW1A 1MKMA 4IHSA 2P5LC 4WK8F 3WTYC 2PEXA 4WX9A 4LJZF 5LLQA 2OZUA 2XROA 4ZYEA 4KICA 1PP8F 1C0WA 1ZG1A 1OMIA 3WG9A 3KP4A 1FBQA 1LVAA 4ZYDA 1V4RA 4HV6A 2ZJ2A 3QP5A 2FRHA 1ZN2A 3WTXC 5J8CA 3NEUA 1XN7A 2A68F 2EV0A 4CZZA 4G6DA 4HBLA 3QPTA 4JBAA 2JT1A 1QZZA 1TQMA 3IHUA 3V7RA 4HF1A 4XSZF 4A6DA 1CGPA 3KEOA 1P2FA 4ENNA 3CTAA 3HSFA 3KLOA 2Z3YA 3M1EA 2QZ8A 5E1XA 3HRTA 2ADUA 5BOXA 1K78B 4P96A 5CVUA 1YG2A 2ZCWA 2F2EA 3ECHA 1LB2A 2YR2A 4ON0A 1HKTA 1GXPA 1YYVA 2LDUA 3V8JA 2HDCA 1RI7A 2NS0A 1XDUA 4BXUA 2HQRA 3G3ZA 2P5KA 2MBFA 1W7PD 2QM3A 3TOAA 1O3SA 5FD6A 2KJCA 4L5JA 3R6SA 2Z9OA 2D45A 3HRSA 3I71A 3GVAA 2H6BA 3WGGA 5AIQA 4A0YA 5L3BA 1IRFA 2KIFA 1EV7A 1BIBA 3K2ZA 1R5HA 2ISZA 2NNNA 1IZ1A 2LNBA 3RKXA 2A07F 3CUQA 2DLLA 1KU2A 1TTYA 4HLXA 5A2QK 4IHTA 5FD5A 5HS7A 4EJUA 4GCVA 2PMHA 2FQ3A 1B1BA 2VBWA 3ML6A 1HSJA 2VBXA 3BP8A 4MHGA 2XUBA 1TQPA 4MQVA 1J5YA 1IN7A 1D5VA 3M7GA 2DPUA 2QQ9A 3DF8A 3R61A 4B09A 1D8KA 1R22A 3L2CA 1XGOA 3MQ0A 2K4JA 5DD8A 3MCZA 2AXLA 4L9VA 2HOEA 2HKOA 4MTEA 1YIOA 2OQRA 2F5FA 2L4AA 4L0ZB 1ZLKA 4HX7A 4UVCA 1CF7B 4LB5A 4IXAA 1YW8A 3D5LA 2OZ6A 3C3WA 5TJJA 4Q4ZF 3RYPA 4A5MA 3WE2A 4RGUA 2PN6A 4ENMA 1IN6A 1USTA 2K27A 3DFGA 1BN5A 2MD5A 4OINF 3E5QA 5LHHA 1MD0A 4WXCA 2PBIA 3VFZA 2IA0A 4NQWA 4KMUX 4LGWA 3O3KA 1WRJA 3HSRA 4Q47A 3K1NA 5L3DA 2EA2A 4LG0A 4XBFA 3V8LA 1U8RA 3QAHA 1LDKB 2FMLA 3FMRA 1YQAA 3I0TA 4EJWA 1PUEE 4Z2YA 2GA2A 3KEQA 2ZO4A 3GEZA 2PI0A 1AWCA 4AIJA 2HYFA 3LSTA 1IRGA 3K69A 5D4RA 1RUNA 1T38A 2HKXA 2Z99A 1I6XA 1Y0UA 2DW4A 4LD5A 2GQQA 4BHBA 3VEPA 3ZP5A 1KGSA 3F21A 1RIOH 1KU9A 2ISYA 4LLGF 3GZ6A 1Z6TA 2RQPA 1IN4A 1FP1D 2YPRA 1PDNC 1JHFA 2H6CA 5FLXZ 1UCRA 5KVRA 4N9IA 1CF7A 1FBSA 2QBYA 3E6BA 2UXNA 4MGRA 1BM9A 3BY6A 2D1VA 1LJ9A 3HHHA 3L7WA 2VBYA 3ERED 4RAZA 4HA8A 1QQIA 1ZG5A 1FC3A 1P6RA 3W6JB 4D0PA 2HFHA 2ZXJA 1BI2A 5K5RA 3DQVC 2ACJA 1S7OA 1XCBA 3E6MA 3FF5A 4MEYF 2JSCA 2KIMA 4Y15A 3SXYA 3JAMZ 4Q5SF 1V3FA 4A2UA 1SD6A 5HLIA 2XGXA 1S3JA 1O3RA 1P4XA 2FU4A 4A6EA 2E7WA 2O0YA 2OAZA 3BJAA 2DO7A 5LRSA 1I1SA 2H27A 3E3VA 3HOTA 1QPMA 3DXJF 5K1YA 2UZKA 4Y17A 5L3FA 2HQNA 2M87A 4OMZA 1STZA 4LLNA 3E6DA 3L9FA 2A61A 3FM5A 4BH9A 1HQCA 4OIQF 3ZMUA 1T98A 3V7CA 4KT5C 4PDKA 1TQIA 5HDNA 1H9GA 4YIIA 2JPCA 2ZBKA 4KN7X 2J5PA 3P9IA 5JR3A 3T8RA 3MZHA 1U6GA 1G3WA 3C7JA 1SFUA 3REOA 3BZ6A 1R36A 1G6NA 2FNPA 4CO8A 3LQRA 1S8NA 2G9WA 1IAWA 2GXGA 2ZMEB 3U1DA 5E17F 2R7DA 5D6FA 2E7XA 2KRFA 1LDJA 1MDMB 1KQ0A 1XSVA 1QBJA 1YW9A 3EDPA 1U5TC 1DPUA 4UVAA 1A04A 2RVCA 5FO5A 4JK1X 2HWVA 4WXDA 4A5NA 2P7CB 1LEBA 4EGZA 4KMFA 3P9CA 4IPAA 4S05A 4HX4A 3FX3A 1U5TA 3GWZA 3C18A 2CGPA 1XDSA 2HYGD 4I01A 2WTEA 4P55A 3QU3A 1MJAA 1I27A 2Q8KA 1FZPB 4G7ZF 4XRFA 2XASA 1FSEA 1FT9A 1YFHA 5LEJA 1SD4A 2DFIA 3ZMVA 2QUFA 2NAZA 1O3TA 5DUIA 4BQAA 2XKOA 5F64A 2MA3A 4RB0A 2PFBA 4G6QA 1W5SA 1G4DA 4U88A 3J80K 5FGMA 2OU2A 2V1UA 2NYXA 3SQNA 2NNYA 2YX7A 4RAYA 1YS7A 4WXHA 3JSPA 3Q9SA 2XAJA 3I5UA 3IRRA 1OYYA 5LGTA 3HIFA 3T8TA 4HF0A 1E17A 4L9TA 1XSDA 3FMQA 2JRTA 2QWWA 5F6FA 3HHGA 1ON1A 4HDUA 5D8LB 2P5VA 4L9NA 1FSHA 3F8NA 4KUMA 2IA2A 4ETSA 1F9NA 3DPTA 1Z1DA 2VXZA 3ZMDA 4OIRF 3F22A 1GXQA 3V8KA 5IT9K 4RGRA 4CICA 4N9HA 3LWFA 4BNCA 2P4WA 3JSOA 3ELKA 1FX7A 4P9FA 4BAYA 1SMYF 2EV5A 3MEXA 1YS6A 3JTGA 1MDMA 1R58A 5LGUA 3CJNA 2X4HA 2FXAA 2O03A 1FP2A 2K4BA 2HTSA 2Y75A 1OR7A 3OV8A 2MLKA 3DPLC 1R7JA 5HLGA 3DV8A 1FYKA 2B0LA 1U5TB 3F23A 1EH6A 1R00A 3ULQB 2M8EA 5LRRA 2BE5F 1YTYA 2V9VA 1ZLJA 4AD9A 2O61A 4ESJA 2TDXA 5AONA 3BPVA 4DNCA 2DK5A 4HW0A 1J2XA 1HKQA 3CUQC 3N4MA 4KFCA 5BPIA 5FFXA 2FMYA 3KP7A 5BMZA 1R5GA 3JAMK 1XB4A 5IT9Z 3K1MA 4N0BA 2WWYA 1IF1A 4EVIA 4R8HA 1E2XA 4OIOF 5BPDA 5ICCA 1P4WA 2WC2A 3ZMSA 3BJ6A 2XAHA 2FBHA 3SZTA 3Q9VA 2M5WA 4YG2F 2L01A 4G94A 3ZN0A 3WTWC 4I09A 2L3DA 1YW7A 2NRAC 1USSA 3FMSA 4OOIA 2M1BA 3E5XA 1EH8A 1K7AA 5LGNA 2GA1A 3FWEA 2MH2A 5HLHA 2EFWA 5DV5A 1BI0A 5D6EA 5BQTA 3HTSB 2XV4S 1K78A 4I0AA 1B6AA 5HS8A 2CWEA 3GUDA 3CO7C 2EWNA 2RGVA 1TW3A 1PP7U 3L00A 3ZMTA 3ECOA 1REPC 1IXRC 3F6VA 1KYZA 2G7HA 4U0VA 1ULYA 1ZGJA 2VT3A 5ICGA 4IRGA 3U2RA 3VODA 1BOAA 2IP2A 1NHAA 4I2OA 2M45A 3TDUC 4LB6B 5J6XA 2XAGA 2DK8A 4U7DA 4G9YA 5HS9A 2A5YB 2V1XA 1RZ4A 4M74A 3H3UA 1IN8A 4HV5A 3LA7A 5JVTA 3MFKA 1OYWA 3BROA 3GLXA 4KN4X 1T39A 2EFQA 3DP7A 2XAQA 3CDHA 3QRFF 4QWQA 2OD5A 5CVVA 2Z33A 2XVCA 4DQ2A 3TKYA 2FOKA 3N97A 3VB2A 3F72A 3DKWA 3GFJA 1W5TA 2RNJA 3MAJA 4KIBA 3WE3A 3F8FA 1JGSA 3SHFA 1ODDA 4HOBA 4RB2C 1O7LA 2A3SA 4AWXB 2KJBA 4O6JA 3KCCA 2XAFA 4O3MA 1O7FA 4MNUA 3IKTA 3B73A 3QOPA 2HR3A 2DBBA 1LDDA 3MWMA 3IL2A 5BS6A 3BWGA 3TGNA 5TRDA 3E97A 4B8XA 1K79A 4UXNA 4UHTA 2BGCA 3F3XA 3KP6A 1WKMA 3S2WA 1TW2A 2CYYA 4ZH4F 1XGSA 2HS5A 1SD7A 2ESHA 5EEHA 4LK0F 3KE2A 4EM0B 1ONVA 2LF8A 2EB7A 4GYGA 5ILUA 1D8JA 2QQAA 5LEKA 1HSTA 5ILVA 1F1ZA 2W84A 4LK1F 1R1UA 5FFZA 2A69F 3EETA 2IA1A 4RGSA 4RGXA 2H94A 5JFRA 1SMTA 1R1VA 2VODA 2D2WA 2JTVA 5D4SA 2L02A 3M9AA 4EMSA 2W24A 4BHPA 1QO0D 3GFIA 4RS8A 1G3TA 3EYYA 3SFZA 1MGTA 1SFXA 1XGNA 4K2EA
chains in the Genus database with same CATH superfamily
1ZGAA 3BTLA 4BBSJ 2ELHA 3CF2A 3CUQB 4ZZLA 2VJ4A 5TGTA 2CQXA 4RB1A 1WWXA 1D3YA 1X3UA 3KZZA 4Q48A 1WI9A 1UHSA 3E7LA 3RZOJ 1G3SA 5HOOA 2OPTA 1A35A 3OYBA 2V1NA 3RPUA 3F8BA 1X2NA 3H92A 4M3FA 4LIUA 2R5ZB 2KDOA 2R3SA 4IHYA 1P9QC 2LH9A 3ABKH 3DEEA 1XD7A 3CCLI 4PJMA 4RBOA 4IJAA 3WTSC 1FBUA 1RUOA 2WY7Q 4BYYA 1SFKA 3BG5A 2FX0A 1O3QA 4E70A 2GBYA 2V9PA 3Q0UA 3DKYA 1I3QJ 2VOOA 1FIAA 1HXDA 2VC1A 1QU3A 2HOTA 2BBYA 2NOGA 2GZWA 2R7FA 1LQ1A 1DPRA 2ETHA 2VBZA 3SZPA 3COAC 5F0FA 1D0YA 4YFXF 1ZR2A 1XPXA 1VZ0A 3RCOA 2IS6A 3I59A 3NQOA 3D1NI 3LFKA 2MH9A 1MMSA 2DQRA 4XKVA 2K85A 2PLYA 4E4HA 3FM3A 5H6RA 1A6IA 5FRNA 1MMDA 2DTZA 3NWSA 1FMVA 2ZFWA 3I64A 4NC6A 5ICEA 2RDPA 4QLCU 1HF0A 4U7BA 2EZIA 5DEQA 1RETA 2M8GX 1MZBA 1WJAA 4YIFA 1E3PA 2KMUA 1Z3XA 1FYLA 2W57A 4GYIA 2DXIA 1FTZA 1TNTA 4KIGA 4PZJA 4CXFA 1JE8A 3S15J 1D1AA 2YX4A 1EJ9A 3HOVJ 3QP6A 2JSPA 1IXSB 2AHQA 3ABTA 1TBXA 1APLC 4KISA 4WF2A 3TO6A 2DJNA 4I02A 4UV9A 4NBQA 4XLFA 1MJ9A 2QYOA 3HGYA 5J1RA 1VQMI 4UVBA 3O6BB 2IXSA 2OBPA 4CHUA 2L4MA 3IWZA 4R79A 1ACIA 5M5XJ 3GBGA 3GTPJ 5LBQA 3B6AA 3OIOA 3C1DA 1V55H 2DPDA 3GF2A 5FJ8J 2BOLA 1W0TA 4BDYA 2DYSH 1WSUA 1DGRM 2IT0A 1RPWA 4XL9A 1OCTC 4OU0A 3SZGA 5J40A 2KHMA 3OSFA 3R4KA 3DU6A 4EJVA 2YSRA 1NG6A 3VOEA 2H09A 3BR1A 3TQNA 3WGHA 2IS2A 4A93J 2J5OA 5D5UB 2CJJA 1QGPA 2FEZA 2Z5UA 2ESNA 5CYVA 2AQFA 4UUSA 4RA2A 1HOMA 5DCMA 2H1KA 1GHCA 1N25A 3OS1A 2IEKA 2O5RA 4E7HA 3K6GA 3ISPA 3K4LA 4IF4A 1ITYA 2QVOA 1F4KA 3S8PA 2CV2A 3TL4X 2RKHA 1JTYA 2FA5A 1RNLA 4IOAF 3CCYA 4ITVA 4G8XA 4BQNA 4ENJA 2EFPA 4KNYA 2Y48A 3F8MA 4B43A 1S9HA 2E34A 2ZJQF 2HPIA 1F5TA 4PGHA 3BJOA 2KLOA 1D1BA 4PCQA 1SD5A 2RNGA 3IKVA 5EYRA 2GIVA 3CMAI 3GCMA 2MW8A 5D5WB 2QLZA 3HOYJ 1T0FA 1K4TA 2QKMB 5D5XB 1OCCH 1SVOA 5GADJ 3U9GA 2VOPA 3CCMI 3KP3A 1Y0NA 2WAFA 5A2QZ 3RPQA 4M72A 3J81Z 2DT5A 1GVDA 3KZIC 2LD5A 4A3GJ 3OYJA 1B8IA 5H6QA 3C2HA 5E20A 2GOXB 2PG4A 4GO1A 3OYLA 4N4NB 3H9QA 2FQ4A 3KLNA 4Y33A 5ERIA 2R0QC 2QSHX 1ZRFA 3CCJI 4M3GA 5E8IA 1S5LC 2QENA 1P4AA 2CO5A 2V79A 1YJNI 3GYHX 3PJRA 5D8KB 2CV0A 5J47A 4L9JA 2L7ZA 1TL8A 4J19A 3CJQB 3GO5A 3W3CA 4P5OA 1OCPA 1B4AA 2F5DA 1SAXA 1YHQI 4ANJA 1TWHJ 1T95A 1GLNA 4A0ZA 3U21A 2LLKA 1Y8QB 5EG0A 1MBKA 3K2AA 3S3MA 2HOAA 4KYWA 3W6KB 2VC0A 2L54A 1QA6A 2IAIA 2WBMA 3PNYA 4XK4A 1A36A 4Y3OA 2O8XA 1XG1A 3OYMA 2AQEA 5GAHJ 3EYIA 3PNTA 3RJPA 2Q1ZB 3LFUA 3R0JA 2VN2A 3LSMA 5EG0B 2F5EA 3G6EI 4CCLA 2C6YA 1X4PA 1G8XA 1FIPA 1POGA 2HGCA 3G73A 2ZMEA 4CGZA 4X6AJ 4AVZA 2A5WA 3B02A 2DA5A 3KP5A 3FXRA 3M07A 1MBEA 4DJAA 1J75A 2A6TA 1ZREA 2O6GE 2STTA 4M9ZA 4M9XA 2FSWA 3HOUJ 4S04A 1P92A 2V6CA 1TP4A 3FXUA 2P6TA 1LEAA 4EJTA 3JRCA 3H9JA 1GDTA 1H0MA 5E18F 2DTRA 3BDDA 1W5CC 1WHUA 3IP4B 5H20A 1IRZA 1I5ZA 1T2KA 2ID3A 3EUHA 3G1LA 2HOSA 3ZQ7A 3ZN1A 3J81K 2HU9A 1Z7UA 2VONA 1S7AA 1ZTRA 4LG0B 1ON2A 1IRXA 1XMAA 2CFXA 2FE3A 1J9IA 3BCAA 5CJ9A 1N75A 1Z6RA 2JUGA 3FDYA 4MTDA 3MKZA 2MSYA 2VUMJ 2K3FA 4IRIA 2W85A 3LA3A 5KAIC 1WJ5A 2FNAA 4OAYA 3ABUA 5F0CA 3CC4I 4A0XA 5F1JA 2KRHA 4FTHA 2FJ1A 2KIUA 1BW5A 3FIWA 3W6VA 3BPXA 3AG3H 3WGIA 1QPIA 4M71A 2CQQA 1J7KA 1I39A 1YO5C 1BJAA 2Y0SN 1YI2I 3WTTC 1RC9A 2VJIA 4DW6A 2M30A 2LY9A 1W1WE 5CLSA 1X1PA 3UR3C 1D0ZA 4KA4A 3BOQA 4HQEA 5E1ZB 1U2WA 1QNTA 4AM3A 2VKDA 3ZQCA 2LG4A 1OPCA 2DQLA 1DP7P 4I7HA 5M3FJ 2XGCA 1YJ9I 1W4MA 3K1PA 5B1BH 1J0RA 1FPQA 1LNWA 2X6YA 2XPVA 4XOPA 4JYKA 1B59A 3OOPA 4NHJA 1UB9A 3RYRA 1NK3P 3LOCA 3W2AA 4BL0B 3FKJA 4P9UA 2EFOA 1XMXA 5CQGA 3VYSB 1IUYA 2ZKZA 2XIGA 1GV2A 4HPQA 1JKRC 4BEHA 3PNVA 1MW7A 3M4OJ 4JOMA 2NVXJ 3I54A 1Z21A 5J8FA 2Y0SA 4U87A 1IN5A 3CUOA 5LHIA 2BY1A 3R60A 5EDNA 1IO2A 4ZZDA 1K6OA 3EUHC 3OYNA 5CVJA 5HDGA 3T1BA 3L2UA 4KIFA 3ZQHA 3BTCA 1IXCA 2D1HA 3FBIB 5IP6A 3GX4X 2LY1A 3CP8A 3HRUA 2HTJA 3R0AA 4HX8A 1L0OC 3ZXSA 2R93J 3BTIA 3L09A 4N4OB 5JHUA 1OYIA 2JZYA 3P7NA 4ZYHA 1S6LA 2IGMA 5GTHC 5DCMB 1VI0A 3WTZA 4H4KC 3LAJA 2VPRA 2IGKA 4XORA 5HNFA 2ID6A 3C2GA 3MN2A 1ZYRF 2UWMA 1KQ8A 1QHHD 1Z91A 3PQJA 1OCOH 3K70C 2A6EF 4ESBA 2CMPA 3BQYA 4M6YA 3ZQGA 2ZMEC 5BNGA 2VKEA 1JXSA 3RIRA 4BQQA 1R5ID 2R7OA 3RKYA 4X0GA 2E5ZA 3JW4A 2ME6A 3H36A 3HPGA 4PJ0C 1L3LA 3GZ5A 1JI8A 2BXZA 1BOBA 4CA0A 3OYIA 1FWZA 5B3SH 2EV6A 4ZYGA 3IWFA 4MEXF 4YFNF 2ZC2A 2KRCA 4RMNA 3RDIA 3SEQA 4B3AA 4HLYA 2DN0A 2KT0A 1U78A 3H3ZA 3WTVC 4I98B 3V7SA 2STWA 2G0EA 4HAMA 3WHCA 3G71I 3KEYA 1SANA 3I56I 4PFPA 1KQ9A 3OSGA 3PUFA 2DFFA 3K4BA 4U0WA 4I0BA 3G1OA 2DU9A 4FX0A 1WQ2A 4I99C 4RM2A 2COMA 4HNVA 1X3WB 2RV8A 4B3XA 5FLMJ 1RESA 2JA7J 1SFEA 3E5UA 3ERMA 5FROA 1R1TA 2QQBA 4FISA 3LA2A 1UHWA 1KU3A 1VQLI 3GW2A 4HYEA 1JKQC 2FF4A 3BG6A 3H9GA 3DTEA 3WU0A 3NARA 4RAGA 1V5EA 3MKLA 3GFLA 2LKPA 2GAUA 2E35A 1T56A 1ZRCA 4G7OF 5FRMA 2FBIA 4TV7A 2P7VB 2E19A 1TLHB 2EPFA 2WY8Q 2LBFA 3PFIA 2O7OA 3UNGC 4XONA 1XSXA 4FQGA 4BJ6C 3SFIA 1ZRDA 5M5WJ 2KZVA 2VT2A 1R4NB 1XCVA 5JI6A 1G59A 1TNSA 3DEWA 2BEOA 3FK6A 5IP9J 1XGMA 1VF9A 3Q0VA 4Y13A 2ZSHB 4FX4A 2R7VA 2ZNZA 4YEJA 4QSHA 3OYDA 4WCGA 5EEGA 4ENKA 2E1NA 2I10A 3AG1H 5IYBJ 2L2OA 3K0LA 3TO7A 3PIOF 2M2EA 3TW6A 2VQCA 4KDPA 1O57A 2X0LA 5C4JJ 2XHKA 4A3MJ 1PJRA 1W7PA 4A69C 2CSOA 4HF2A 3HSEA 1FY7A 2PMUA 3OMYA 5D5VB 3CCSI 2JVHA 3PM1A 3I53A 3H5NA 1ZH5A 2K9MA 3ZMZA 5F27A 2GIZA 4EGYA 3FHNA 2VKVA 4FHTA 4F3QA 5TISC 1XMKA 3JRHA 5L3GA 1JKOC 4FT8A 4HQMA 1IW7F 2CUFA 5JLWA 5F1RA 4LIVA 3E6CC 5K7FA 1WPKA 4KT6A 6PAXA 2VE9A 1MIJA 3T5XA 2Q2EB 4J00A 3T0YA 2AO9A 1B9MA 4B44A 4RLQA 2Y0MA 3F9KA 4CCJA 2BV6A 4GDFA 4AVPA 4ASNA 1MSEC 1U3EM 2R7QA 5L3EA 4AIHA 3TMOA 3HZJA 3LSGA 4F55A 2KKOA 2GOMA 2E1MB 3HXLA 4XSXF 2X6WA 1QZYA 1X1DA 2ICWG 4HRIA 3OYGA 4BACA 2JWTA 3SDBA 3RTRA 3EQLF 4IL6C 2BYVE 4NQWB 3WODF 4AIKA 2CUJA 4HDVA 2OA4A 2VI6A 1LVKA 3TW7A 4E6KG 1EH7A 4LG3A 3M8EA 2R92J 2E5NA 1BIAA 1X19A 2V9KA 4XLPF 1BI1A 1X3ZB 4OIPF 2UXXA 4BHCA 1AOYA 4D1QA 4PGGA 1WGXA 4CSWA 3QU6A 4CZCA 1BL0A 5DUKA 4CDGA 1HW2A 2IBDA 1EA3A 4MQ9F 1FTTA 1RKTA 2JRMA 4G6TB 1BC7C 2HEOA 2DA7A 3GXOA 4RDUA 3TOBA 3I59B 4E7ZA 2RQQA 1VTNC 5K5OA 1T33A 2EIKH 1LFUP 3S1QJ 1KU7A 2IRFG 3I4PA 4AC0A 2E1CA 5FLXK 4XLEA 3HKZA 1MH3A 1QZEA 4IO9F 2DAOA 1Q1VA 4YFKF 1H88C 1BI3A 4ESFA 2Y9YA 3LQQA 1WJDA 3OL4A 4IVNA 5DCFA 1BC8C 3WU1B 3GFMA 4NUBA 4IQ4A 1CQTA 4A12A 3S16J 2OQGA 2LREA 4EQQA 2CUZA 1W36C 1DDNA 4JX4A 3HUGA 1WJFA 1MMNA 2RAEA 1D5YA 2O3FA 1UELB 3PO3J 2ECCA 1R23A 1T6SA 4BE2A 1Z0XA 5E1WA 2WV0A 2YU3A 2N8GA 3ZPLA 2MC4A 3HGGA 2V6EA 2EA4A 3PQKA 5L3CA 1U9NA 3HOZJ 3MZYA 1W7PB 2A6HF 5EGOB 4M9SA 4EJOA 3Q3SA 3O8HA 2NS7A 1UFMA 2XRLA 2RN7A 1E3HA 3KFWX 2JA6J 1DU6A 3PSFA 1LE8B 3TO9A 5F0HA 3VYTB 1J59A 3NRVA 4XIDA 1FYMA 4A3BJ 1WJBA 1MJBA 5KK1A 4U0YA 1ZHFA 3RPUD 5ICFA 2IPQX 5LHGA 3FZVA 2G7UA 3ONQA 3BG7A 2ECBA 5JHFA 1RR7A 3ZR8X 3I58A 3RKQA 1H9TA 4L18B 3CLQA 1WJCA 2RC4A 3HRMA 4H0EA 5J1YA 3HC7A 4AUXA 2YS9A 4QPQA 2Q2EA 2IW5A 3ZCOA 4O5VA 2P8TA 4PSXA 3IRQA 4UUSB 2FBKA 5IYDJ 4C30A 1EKEA 1KA8A 5IPAA 3AAFA 3GTQJ 3DEUA 1ETXA 4XLHA 1F36A 4GFBA 1ZAOA 4UNOA 4EM1A 4G7HF 5E8GA 4LLLA 2QA4I 2OF7A 4UV8A 4HZFA 1WH5A 2BHZA 2XC7A 4LMYA 3D0SA 2AS5F 2X1CA 4P1WA 1ETYA 2IJLA 1ZKGA 4E7IA 3OYCA 3DU5A 2LSOA 2BZTA 1IG7A 2GXBA 3IC7A 1S29A 4M73A 3VDXA 1V5FA 1WH7A 3KZYA 4R1HA 3KYCB 1QVTA 3DKXA 1OFCX 5DDGA 3LNQA 3F8CA 2DI3A 2F48A 5CVRA 1O4XA 3A1YA 2Z2SB 3JRBA 2B63J 2K40A 1BW6A 5DD4A 3WU2C 3JTHA 3LAPA 4UUVA 4L0YB 4L5IA 3A0HC 3GZNB 1EF4A 3O2PE 3UKGA 1KYWA 3OIPA 2ZNYA 3TDZC 2F4IA 4EV0A 4IEJA 3ZQQA 2K02A 2VE8A 5HVQC 2V1DA 4PJNA 2Q0OA 4XICA 4EM2A 1X1AA 4IRHA 4NC8A 2L7MP 3X2QH 3FKIJ 2JPBA 1FOYA 4UB6C 1GVJA 3KPHA 4M6VA 1NK2P 2CRGA 3MKYB 4AYBA 5K5QA 1FLIA 1B9NA 5FKNA 3V4GA 1G3YA 1ZG3A 2LC2A 4KJZA 1I1GA 2K7LA 2QBYB 1Q1HA 4NB5A 1JHHA 2IVMA 2MC3A 4RB3C 1E0EA 2W4SA 4A3FJ 2CW7A 3RZDJ 5IT3A 3CCQI 4JQFA 1FNNA 5F04A 5B66C 4GXOA 1G2HA 3K4CA 2DDBA 1YE9A 2PQ8A 3H1CA 1T0FC 3F6OA 3CO6C 3ABMH 3BR6A 2CG4A 2COBA 3JRGA 1LUJB 2CW0F 4CYDA 1JUMA 4MFEA 4GGGA 3CESA 3ZQIA 1ETVA 1AA7A 1AHDP 5C4XJ 2KIQA 2F5CA 1Y1VJ 3A01A 2R7XA 1J09A 4LFUA 2K9QA 2Y30A 3AG2H 2XB0X 3DBLB 3J80Z 1WZ2A 2EFNA 1BR4A 2HZTA 3CLOA 5AIPA 4WWCA 5GPCA 1HW5A 3HYIA 2MLGA 4XLNF 3PIPF 3J7AO 2P6SA 3KETA 2K86A 1Z9CA 1BBYA 2ZFUA 3KP2A 1DGWY 3GMEA 3HOSA 2GWRA 2M34A 5E3LA 3DCFA 3HTUA 3JRAA 1HBXG 1FOKA 5HDKA 5ILSA 3BZKA 3HJEA 3GTKJ 3ROUA 2GLOA 5ED4A 3KX2A 3AG4H 2CH0A 2CQKA 2LYCA 5FB2A 3FXQA 2P0WA 1S72I 1HKSA 2W7NA 2DT6A 3P9KA 1VQOI 1IV6A 3I4NJ 3OYHA 3K10A 3K9TA 1Z05A 3KYLA 2EJRA 2I8DA 1N77A 5DYMA 4OMYA 2JA8J 1PYVA 3Q5FA 3S3NA 2PJPA 2EK5A 1IGNA 5CVIA 2BW3A 3MVPA 3WTUC 2XRNA 2HQAA 1UHMA 3A02A 1YRNA 3RKWA 1YLFA 4F7ZA 1OKRA 3FHZA 2W48A 4DBQA 4BGDA 1ZARA 2W25A 3M8FA 1H89C 1OISA 3QPHA 1DUXC 2XKPA 3H5RA 4M6XA 3A4CA 2LF7A 3D5RC 2R7SA 2DA3A 4F91B 1HW1A 1MKMA 2XAUA 3SJMA 1IUFA 1HC8A 4IHSA 2CQ7A 2IGOA 1VQ4I 4DOZA 3L2WA 2HI3A 2LR8A 4A3CJ 2P5LC 4WK8F 1OCZH 2KZGA 3Q0WA 3WTYC 2PEXA 4WX9A 4JP0A 4LJZF 5LLQA 2OZUA 2O9LA 2XROA 4ZYEA 3I9V2 1Y39A 2XPWA 2D5VA 4KICA 3OL3A 1PP8F 1C0WA 3HL2A 1ZG1A 1OMIA 5K7ZA 3WG9A 3B6CA 3KP4A 2HNHA 2R5YA 2DJIA 1FBQA 1LVAA 3FXMA 3IH3A 4ZYDA 4II3A 1V4RA 2BXYA 5H2FC 4HV6A 2ZJ2A 4DGWB 4E7KA 3QP5A 1IDYA 4ZDLA 3HBLA 2FRHA 1ZN2A 3VWBA 4F92B 3WTXC 4BS9A 5JVGF 4ZDOA 5J8CA 3NEUA 2HZDA 1XN7A 2A68F 2E1OA 2M4KA 3O8GA 4XRSA 2EV0A 2F6CA 4CZZA 3HEFA 3J7YJ 1D1CA 3OR2C 4G6DA 1UG0A 1TT0A 3BQZA 1FJLA 4HBLA 3QPTA 4JBAA 2L9SA 2JT1A 1AKHB 1MBJA 4HNUA 1M1EB 1QZZA 1OCRH 2VASA 1TQMA 3IHUA 3V7RA 4HF1A 4XSZF 1A31A 1R49A 3GTJJ 4A6DA 3WG7H 2ZJPF 3ZRGA 5IYCJ 1CGPA 3KEOA 4BJTA 4DZJA 1P2FA 4ENNA 3CTAA 2I5UA 2ZXIA 3HSFA 3KLOA 2Z3YA 4CYCB 3DTKA 4X1EA 3M1EA 2L9NA 3EUKL 2QZ8A 5M5YJ 2HVSA 3CCEI 5C44J 5E1XA 3ABLH 5B1AH 3HRTA 2ADUA 5BOXA 3BR2A 1K78B 3U1KA 4P96A 1VQ7I 2E60A 1IC8A 5CVUA 1YG2A 1Z67A 2ZCWA 2F2EA 2H1LA 3VYUB 2KPMA 3H0DA 3ECHA 4LOCA 1LB2A 2YR2A 4ON0A 1HKTA 2W1OA 4YIRX 1GXPA 1YYVA 3PSIA 2LDUA 3V8JA 2HDCA 1RI7A 2NS0A 2DOAA 1XDUA 2F4OB 1H8AC 2MGQA 3E1SA 3CMYA 4BXUA 5FKMA 2HQRA 3G3ZA 2P5KA 5CPRB 2MBFA 1W7PD 3OS0A 2QM3A 3TOAA 1O3SA 2ZXWH 5FD6A 4YRVA 1D0XA 2R7TA 4XKWA 2R7UA 2KJCA 4L5JA 3R6SA 2Z9OA 2D45A 4BXFA 2L0KA 3HRSA 3I71A 5LFAA 3GVAA 3K70D 3I4MJ 4IOCF 4BUPA 2H6BA 1WCMJ 3WGGA 4UUTA 1MNEA 3M3YJ 5AIQA 1ETKA 1KZHA 1NH3A 4A0YA 5L3BA 4AIDA 3OY9A 1IRFA 2KIFA 4HSTA 1ZK8A 2WAQN 1EV7A 1BIBA 5C3EJ 2JJ7A 3K2ZA 1R5HA 2L7FP 4IKFA 2ISZA 3D5SC 2NNNA 1IZ1A 2LNBA 2QGUA 3RKXA 2A07F 3CUQA 3K4JA 3L2VA 2MYSA 1R71A 2DLLA 1KU2A 1AU7A 1TTYA 2Y69H 4HLXA 1HLVA 2HVRA 5A2QK 4IHTA 5FD5A 3BT9A 2KFDA 5HS7A 1ZQ3P 4EJUA 4GCVA 2DT7B 2PMHA 2FQ3A 1B1BA 2VBWA 3ML6A 5J1UA 1HSJA 2VBXA 3OIQA 3BP8A 1UAAA 1SC7A 1W36D 1TZLA 2X48A 4MHGA 1QHGA 2JQ7A 2XUBA 1TQPA 4MQVA 1J5YA 2WAQA 4CCKA 1IN7A 2IGNA 4RAFA 1D5VA 3M7GA 2DPUA 2QQ9A 2K9NA 3HG9A 3DF8A 4YELA 2MG4A 2VB6A 3R61A 3RQ4A 4B09A 1D8KA 3DLAA 1JT0A 3OR1C 1R22A 1W0UA 3MMYB 3L2CA 4ZC3A 2HQ5A 1XGOA 3MQ0A 2QQ8A 2K4JA 5DD8A 3MCZA 4C3HJ 2AXLA 4L9VA 2LKSA 2HOEA 2HKOA 4MTEA 1YIOA 2OQRA 1JUSA 3TBIA 5J3LA 2LTPA 2TRTA 2F5FA 1R6RA 2L4AA 1TWCJ 1ZLKA 4HX7A 4L0ZB 3IAM2 4UVCA 5IY5H 1ZR4A 1CF7B 3GTOJ 1QRYA 4LB5A 1DP3A 4PFOA 4IXAA 2M7BA 1YW8A 4AYBN 3OOUA 3D5LA 2WB1N 3AKZA 2DCEA 2VL8A 2OZ6A 3C3WA 1R4MB 1MBGA 5TJJA 1XX5A 4Q4ZF 2BW3B 4XKBA 3RYPA 4A5MA 3WE2A 4Y7NJ 2ELJA 4RGUA 2PN6A 4ENMA 1IN6A 1USTA 2K27A 3DFGA 1BN5A 4RLFA 2MD5A 2LVSA 3E5QA 4OINF 4BY7J 5LHHA 1BA5A 1MD0A 4WXCA 2PBIA 2JVGA 3QOEA 2IA0A 3VFZA 4IHXA 4NQWA 4KMUX 4LGWA 3O3KA 1WRJA 3HSRA 2DOFA 4Q47A 3K1NA 5L3DA 2EA2A 2BY3A 2MABA 2OCCH 4LG0A 4XBFA 3JR9A 3V8LA 2PJRB 4B1RA 4MLOA 1U8RA 3QAHA 5EGOA 1LDKB 2LOOA 2FMLA 3FMRA 1YQAA 3BTJA 3I0TA 4EJWA 1PUEE 1OR7C 4Z2YA 2CV1A 2GA2A 1FEXA 1YJWI 3KEQA 3CCUI 2ZO4A 4FE4A 1DQUA 3GEZA 1HDDC 5GP9A 2DMUA 2PI0A 3HUGB 4F52A 3EPZA 1AWCA 4AIJA 1VQ8I 4DZPA 2HYFA 4ZJZA 3LSTA 1IRGA 1VQKI 3G1MA 3K69A 5D4RA 1RUNA 4FETA 1UMQA 1T38A 5DTDA 2HKXA 2Z99A 4D5FA 1I6XA 2EILH 4D5CA 1MBHA 1Y0UA 3S93A 5K7HA 2IS4A 2DW4A 2RREA 4LD5A 2QKLB 2GQQA 1A5JA 4CCOA 4BHBA 2K5CA 3VEPA 3QPSA 3I3LA 1KGSA 3ZP5A 2XF6A 3TEDA 2Y2ZA 3F21A 1RIOH 1KU9A 2ISYA 4LLGF 4CH7A 2VQGA 2NVYJ 3LSKA 5KNLA 3GZ6A 1WFXA 1Z6TA 3K4KA 1Z7LA 2RQPA 1IN4A 1FP1D 2YPRA 3K4MA 5JLXA 3CF5F 1PDNC 4A3LJ 1JHFA 1U0JA 4C2MJ 2H6CA 5FLXZ 1UCRA 5KVRA 4N9IA 1CF7A 2XF5A 1FBSA 4D7MA 1JTXA 1XTAA 2QBYA 2KISA 3E6BA 2UXNA 3BLYA 4C2TA 4MGRA 3BY6A 1BM9A 2D1VA 1LJ9A 1X1CA 3HHHA 3L7WA 4M3BA 1GT0C 2VBYA 3ERED 4PK4A 1VQ5I 3ZGKA 4XM3A 2B7EA 4RAZA 4HSRA 3G2BA 3ESWB 4HA8A 3WHBA 1QQIA 4BJ5C 5M3MJ 1ZG5A 2LK2A 2FUG2 1FC3A 2CQNA 2X51A 3VYRB 1P6RA 4QPOA 2CU7A 1F43A 3W6JB 4D0PA 1Y56A 3MD2A 2HFHA 2ZXJA 1ETQA 1BI2A 5K5RA 2E2JJ 3DQVC 3CCVI 2ACJA 1S7OA 1XCBA 3E6MA 3FF5A 3GTGJ 3S3OA 2DMPA 4MEYF 1X1BA 2JSCA 2KIMA 4Y15A 2M7AA 4XNFA 3SXYA 3JAMZ 1UZCA 2EIJH 4Q5SF 1V3FA 4A2UA 4W1UA 5FLVA 1SD6A 4A3DJ 2O8KA 5HLIA 2XGXA 2WV1A 1S3JA 1O3RA 1E3OC 1P4XA 2FU4A 4GRIA 4A6EA 2DOEA 3A01B 3L2RA 1HCRA 2E7WA 4XRSG 2O0YA 2OAZA 3BJAA 1K4SA 2DO7A 1N78A 2LRDA 4JX5A 5LRSA 3IH2A 1I1SA 2H27A 3BG3A 1RKWA 2X1DA 1WVRA 2HPMA 3HM5A 3JRDA 3E3VA 2NVUB 3HOTA 1QPMA 3CC7I 4ABZA 3DXJF 5GAEJ 3QYFA 2E1MC 2LBFB 5K1YA 3S17J 2DA1A 4FASD 2QCOA 2UZKA 4IZZA 4Y17A 5L3FA 3OYFA 3DBHB 2HQNA 2VPLA 2M87A 4OMZA 1ETWA 1ORKA 5DS9A 1MNDA 1STZA 4MIMA 4LLNA 1LFBA 3E6DA 2BY0A 3L9FA 2A61A 1SVMA 1FOWA 3CMEI 3CP2A 4M3DA 3FM5A 4BH9A 2DYRH 1HQCA 5HODA 4PSWA 2EIMH 2PJRA 4OIQF 1OQYA 3ZMUA 1NG7A 1P7JA 1T98A 4EATA 3V7CA 4KT5C 4PDKA 3SEZA 1TQIA 1VQNI 5HDNA 1UJ8A 1H9GA 4YIIA 3FBNB 1YX3A 1R9TJ 2JPCA 1K61A 2ZBKA 4KN7X 2J5PA 3P9IA 3P5JA 5JR3A 1IJWC 2M0CA 3M8JA 4E7LA 3SYTA 3T8RA 4B47A 4IHVA 3AL0C 3LSIA 3MZHA 2L9RA 1U6GA 1G3WA 3C7JA 4BY1J 1SFUA 3REOA 1ETOA 4B48A 2HDDA 3AL0B 1V5GA 3BZ6A 3IV5A 3CDLA 1R36A 2PMZN 1G6NA 2FNPA 3H35A 4CO8A 2EZKA 3LQRA 2DMTA 3S32A 1S8NA 2G9WA 1IAWA 3CD6I 2GXGA 3V42A 4CCMA 2ZMEB 3U1DA 3CC2I 2R7DA 1TWAJ 5E17F 5D6FA 4A3JJ 2E7XA 4Z6YA 2KRFA 1LDJA 2DMQA 1IV8A 4MFDA 4XMYA 4XLCA 2HVQA 5E3NA 2DA4A 1MDMB 2QSGX 1KQ0A 1XSVA 3BR3A 2LP0A 3FXKA 1I3AA 1QBJA 2E2IJ 1I50J 1YW9A 3EDPA 1U5TC 1DPUA 4UVAA 1A04A 2JN6A 2EH3A 2RVCA 5FO5A 4JK1X 1VNDA 2HWVA 4WXDA 4A5NA 5E3OA 2P7CB 1LEBA 5CQEA 2X6OA 4EGZA 3ASNH 4QTRA 4KMFA 4RM3A 1TWFJ 3P9CA 1YIJI 4IPAA 4C3JJ 4S05A 4HX4A 3PFYA 3FX3A 4F93B 3GWZA 1U5TA 3KIOA 1P7IA 3C18A 3I55I 2E71A 3DLLF 2YUSA 4DYCA 2CGPA 1XDSA 3AFHA 1YITI 2HYGD 3FXOA 4I01A 2EZHA 2WTEA 2ZB9A 4CYCA 4P55A 3S1MJ 4FCYA 3QU3A 3A2KA 2OCEA 3ASOH 2CFOA 2K9LA 1MJAA 2HDWA 1I27A 2Q8KA 3S1RJ 1FZPB 2XSJC 1OJLA 4Y4RA 4G7ZF 1HA8A 3J7AY 2EQRA 4XRFA 5IOYA 1JT6A 2XASA 1FSEA 4A3KJ 1FT9A 2VQLA 3BR5A 1YFHA 1HDPA 5LEJA 4DBRA 1SD4A 2DFIA 2W82A 3NWTA 3ZMVA 3BC8A 1KONA 2QUFA 2NAZA 1O3TA 1YOVB 2M4GA 5DUIA 5J4VA 1JUPA 4BQAA 3N05A 2XKOA 5F64A 1UG2A 2MA3A 3QQAA 4RB0A 1T8IA 3OS2A 5FKLA 3M1CA 4JX6A 2PFBA 4G6QA 1W5SA 1G4DA 4U88A 3IH4A 3J80K 5FGMA 2OU2A 1BR1A 3LSPA 2V1UA 4NDLA 4A3IJ 2NYXA 3SQNA 2NNYA 1FOXA 3OYEA 2R5YB 2YX7A 4RAYA 2LMDA 1YS7A 4WXHA 3JSPA 3CZ6A 3Q9SA 3OYAA 1NTCA 4ZYAA 4HEA2 2XAJA 2JA2A 3I5UA 1OYYA 2EZLA 2CS3A 3IRRA 2VLAA 2BVMA 5LGTA 3HIFA 1QVUA 3PUBA 3GLLA 2NXNB 2Y9ZA 3T8TA 2VJ5A 4HF0A 3ZOBA 1E17A 1TC3C 2Z1DA 4L9TA 1XSDA 4AU7A 1ENHA 3FMQA 3G4SI 4V2FA 5DM7F 2JRTA 2QWWA 5F6FA 3HHGA 1ON1A 3GTMJ 3JREA 2KQRA 4HDUA 5D8LB 2P5VA 2VQHA 1LPQA 3K7AJ 4L9NA 1FSHA 2CW8A 2UUZA 3H5AA 1T08B 1JJ8C 2DA6A 2L7KA 3F8NA 4XN3A 4KUMA 4BXXJ 2IA2A 4ETSA 1F9NA 4IHWA 3DPTA 1Z1DA 1GUUA 2VXZA 3ZMDA 4OIRF 3A03A 3HDDA 1X2MA 1VQPI 1ZELA 3QYEA 2HYJA 3F22A 3HOWJ 1GXQA 3V8KA 4B4CA 5IT9K 4RGRA 4CICA 2M0MA 1Z77A 3LWFA 4N9HA 5J4YA 4BNCA 2PX9A 2P4WA 3DTIA 3ELKA 1FX7A 4P9FA 3JSOA 2JA5J 3S2DJ 9ANTA 4XLAA 2R7WA 4BAYA 1SMYF 2EV5A 1Y6IA 2QEXI 3MEXA 1MMGA 3VPRA 1YS6A 4XKCA 3JTGA 1MDMA 3MZ8A 1R58A 3E0JB 5LGUA 3CJNA 4C2UA 2X4HA 4G12A 4ZTJA 1SFOJ 2FXAA 2O03A 1FP2A 2K4BA 4OAZA 2HTSA 4E7SA 2Y75A 1OR7A 2FD5A 4HG2A 1WI3A 3OV8A 3PO2J 3OWTA 2MLKA 3DPLC 2F4MB 4FE7A 3CQZJ 1R7JA 4M3EA 1Z3YA 5HLGA 1FMWA 3FISA 3DV8A 3CCRI 2B0LA 1FYKA 3CMMA 1B8IB 2VXDA 3CJRB 4C9YA 3BG9A 1MSFC 5CKTA 1U5TB 3F23A 1EH6A 1R00A 2LFBA 3ULQB 4CUGA 2M8EA 3BCBA 5LRRA 2BE5F 1YTYA 2V9VA 1ZLJA 2HXIA 3C2BA 3LMMA 4AD9A 2QF7A 4OWRB 2O61A 4ESJA 1BR2A 2TDXA 2BVLA 2OJED 5IP7J 3BZCA 3A0BC 5AONA 3BPVA 4DNCA 4E7JA 3QYBA 1U8BA 4BEHB 2DK5A 4HW0A 1LFPA 4MO7A 2XPUA 2DMNA 4J01A 1J2XA 1HKQA 2P81A 3CUQC 3H3VK 3N4MA 2WB1A 5DM6F 2OTLI 4KFCA 4Y52J 5E3MA 1A6QA 2LY2A 3ZQFA 1IDZA 5BPIA 2DODA 5FFXA 2FMYA 3KP7A 5BMZA 4LITA 5GPAA 3KYDB 1R5GA 3JAMK 2PMZA 3W2WA 4DYRA 3FK7A 2XF7A 5EZHA 1WJEA 2R7ZJ 1XB4A 5GAGJ 5IT9Z 3K1MA 2X85A 4N0BA 2WWYA 4IX7A 1IF1A 4EVIA 4R8HA 5HLTA 1E2XA 4OIOF 5BPDA 5ICCA 1P4WA 2WC2A 3ZMSA 4HNTA 3BJ6A 4W97A 2XAHA 2FBHA 3SZTA 3IUOA 3Q9VA 4XRMA 1PUFB 2M5WA 4YG2F 2L01A 4BE0A 2L5QA 4PJLA 4D7NA 1Y1WJ 4G94A 3ZN0A 3WTWC 4I09A 2L3DA 1SAUA 1YW7A 2NRAC 1USSA 3FMSA 2W00A 4OOIA 2M1BA 2VIXA 1EH8A 3E5XA 5LGNA 1K7AA 2GA1A 3LSRA 2B9SA 3FWEA 2EINH 2MH2A 4UB8C 4V2GA 5HLHA 2EFWA 2KDZA 5DV5A 3RQIA 2MD0A 2WAEA 3HPHA 1BI0A 1S7EA 5D6EA 5LD2C 2DFEA 3FXJA 5BQTA 5FKKA 3HTSB 4C3IJ 1PVEA 2XV4S 3OYKA 1K78A 3DBRB 1B72A 3LSHA 4I0AA 1B6AA 5HS8A 1VQ6I 2NVTJ 2CWEA 3GUDA 3CO7C 4BU2A 2EWNA 3ZQLA 4L5EA 4BQOA 5EF6A 2RGVA 1TW3A 2WA0A 1PP7U 3L00A 3ZMTA 3ECOA 1REPC 1IXRC 3QPLA 3F6VA 3IAS2 1KYZA 3NAUA 5F08A 2G7HA 4U0VA 3GTLJ 1ULYA 1ZGJA 2EBIA 2VT3A 5ICGA 1K83J 2GM4A 2XB5A 5EZGA 1YX5A 2A05A 1MH4A 2Y31A 4IRGA 3S14J 3U2RA 3VODA 1BOAA 3MKWB 2DDAA 2BY2A 2IP2A 3VSLA 3CDIA 2Z16A 4BKXA 1VFCA 1NHAA 4NC7A 4I2OA 1Y8RB 2M45A 3TDUC 2XGDA 3RSNA 4LB6B 4XOTA 2R7RA 1X58A 5J6XA 2XAGA 2DK8A 2ZSIB 4U7DA 2XSDC 4G9YA 2WADA 5HS9A 2A5YB 5KHDA 5IOZA 3L2QA 2V1XA 2F5VA 2TCTA 2ELKA 1RZ4A 5KCMA 4M74A 4BDZA 3H3UA 4V19K 2ZXHA 1PUFA 1IN8A 4HV5A 1DU0A 3LA7A 2FOWA 2MFZA 2XDVA 5JVTA 1AKHA 1LKXA 4II2A 3MFKA 2X1EA 3RI4A 4NNJA 3DPUA 1U9OA 1OYWA 3BROA 4KITB 3GLXA 3JRIA 2H8RA 3QODA 4KN4X 2K3PA 2VKHA 1T39A 2BHYA 2L9VA 2EFQA 3DP7A 2ZJRF 1XS9A 2XAQA 3CDHA 5B5EC 2CUEA 3QRFF 2JUCA 1RR8C 4DIQA 4QWQA 2OD5A 3EUAA 4DYQA 5CVVA 2Z33A 2XVCA 3F0CA 4DQ2A 4XQFA 3TKYA 2FOKA 3N97A 3TP0A 1B72B 3VB2A 2X6XA 3F72A 4EEFG 2KP6A 1MNMC 3DKWA 3GFJA 1W5TA 4BBRJ 5GTIC 1TT5B 2RNJA 3L1PA 3H0GJ 3MAJA 2IS1A 2OTJI 4KIBA 1OLTA 3WE3A 2H8WA 2YU9J 3DWLE 3F8FA 4XR6A 4ZDPA 3HB9A 1ERDA 1JGSA 3SHFA 3JCUC 1JGGA 1XC5A 1ODDA 4IQJA 4HOBA 4RB2C 1O7LA 2A3SA 1RRJA 4AWXB 2KJBA 2JMWA 4O6JA 4UY8I 4S0HB 3KCCA 2XAFA 2R5ZA 4I6ZA 1MBFA 2E36A 2X9DA 2XGEA 1ZGWA 5FKOA 4O3MA 1O7FA 2KL4A 2HXOA 4MNUA 3S2HJ 3IKTA 3B73A 3QOPA 2HR3A 2DBBA 5HNHA 1LDDA 3PL8A 3MWMA 3IL2A 1K6YA 3S1NJ 5BS6A 1JKPC 3BWGA 3TGNA 2ME0A 5TRDA 3BR0A 2V4JC 3E97A 1X4OA 3J7ZI 1BJZA 3LL7A 4B8XA 2K9SA 2OC6A 2OV7A 1MMAA 2JK3A 1K79A 4UXNA 4UHTA 2BGCA 2LKXA 5EEAA 3F3XA 3KP6A 1WKMA 1SEUA 3S2WA 1TW2A 2DA2A 5KAFC 2CYYA 4BE1A 3FXLA 4QIWN 4ZH4F 1XGSA 2HS5A 1SD7A 2ESHA 5EEHA 3W2VA 2M3AA 3KE2A 4LK0F 4EM0B 1JJ6C 1ONVA 2QSFX 2LF8A 3HKZN 2OUMA 1YRNB 2EB7A 4GYGA 3LSJA 5ILUA 3JRFA 1D8JA 2QQAA 2R4GA 5LEKA 2V7FA 2GXAA 1HSTA 2DFHA 5ILVA 3SDGA 4I76A 1F1ZA 3HOXJ 4A3EJ 5EJCA 2NS8A 4ZTFA 2W84A 4XN0A 4LK1F 1R1UA 4D9JA 5FFZA 1GV5A 2A69F 3EETA 2IA1A 3K4NA 4RGSA 4RGXA 2H94A 5E79C 2M9HA 5JFRA 2NVQJ 1SMTA 3CJTB 1R1VA 2NOJB 2VODA 2D2WA 4CCNA 2JTVA 5D4SA 3VSKA 1I6HJ 1VQ9I 2L02A 2E2HJ 2AXTC 3M9AA 4EMSA 2W24A 1SVLA 1TWGJ 4BHPA 1QO0D 3GFIA 4RS8A 2UV1A 1G3TA 4PJJA 1LE8A 3EYYA 3SFZA 1V54H 3QWLA 4PUSA 1MGTA 1SFXA 1XGNA 2V26A 4K2EA 2VJJA 3TP3A
chains in the Genus database with same CATH topology
1ZGAA 2ELHA 3CUQB 4ZZLA 4RB1A 1WWXA 1D3YA 1X3UA 3KZZA 4Q48A 1WI9A 1G3SA 5HOOA 3RPUA 3F8BA 3H92A 2R3SA 1XD7A 1RUOA 4IJAA 3WTSC 1FBUA 4BYYA 1O3QA 4E70A 2VOOA 1HXDA 2VC1A 2BBYA 2R7FA 2GZWA 1LQ1A 1DPRA 2ETHA 2VBZA 3SZPA 3COAC 4YFXF 3I59A 3NQOA 3LFKA 2MH9A 2DQRA 2PLYA 3FM3A 5H6RA 2ZFWA 3I64A 5ICEA 2RDPA 4QLCU 4U7BA 5DEQA 1MZBA 4YIFA 1FYLA 2W57A 4GYIA 1TNTA 4KIGA 4PZJA 4CXFA 1JE8A 2YX4A 3QP6A 1IXSB 3ABTA 1TBXA 4WF2A 3TO6A 4UV9A 4I02A 3RI4A 1MJ9A 2QYOA 4UVBA 3O6BB 2OBPA 4CHUA 2L4MA 3IWZA 4R79A 5LBQA 3C1DA 2DPDA 3GF2A 1WSUA 2IT0A 4OU0A 3R4KA 4EJVA 2YSRA 3VOEA 2H09A 3TQNA 3WGHA 2J5OA 5D5UB 2Z5UA 1QGPA 2FEZA 2ESNA 5CYVA 5DCMA 1GHCA 3ISPA 4IF4A 2QVOA 1F4KA 2RKHA 2FA5A 1RNLA 4G8XA 4ENJA 2EFPA 4KNYA 2Y48A 3F8MA 1F5TA 4PGHA 3BJOA 4PCQA 1SD5A 3IKVA 2GIVA 5D5WB 2QLZA 1T0FA 5D5XB 3U9GA 2VOPA 3KP3A 5A2QZ 3RPQA 4M72A 3J81Z 2DT5A 5H6QA 5E20A 2PG4A 4GO1A 3KLNA 5ERIA 1ZRFA 5E8IA 2QENA 1P4AA 2CO5A 2V79A 3GYHX 5D8KB 4L9JA 3GO5A 4P5OA 1B4AA 2F5DA 1SAXA 4A0ZA 4KYWA 3W6KB 2VC0A 2L54A 2O8XA 3EYIA 3RJPA 3R0JA 2VN2A 2F5EA 2C6YA 2HGCA 3G73A 2ZMEA 4CGZA 3B02A 3KP5A 3FXRA 1J75A 1ZREA 2O6GE 2STTA 4M9ZA 4M9XA 2FSWA 4S04A 1P92A 2V6CA 3FXUA 2P6TA 1LEAA 4EJTA 1H0MA 5E18F 2DTRA 3BDDA 5H20A 1I5ZA 1T2KA 3EUHA 3ZQ7A 3ZN1A 3J81K 1Z7UA 2VONA 1S7AA 4LG0B 1ON2A 1XMAA 2CFXA 2FE3A 1J9IA 5CJ9A 1Z6RA 4MTDA 4IRIA 2W85A 3LA3A 2FNAA 3ABUA 4A0XA 2KIUA 3BPXA 3WGIA 4M71A 1J7KA 1YO5C 1BJAA 3WTTC 2M30A 5CLSA 4KA4A 3BOQA 4HQEA 5E1ZB 1U2WA 1QNTA 1OPCA 2DQLA 1DP7P 4I7HA 1W4MA 3K1PA 1J0RA 1FPQA 1LNWA 1B59A 3OOPA 4NHJA 1UB9A 3RYRA 4P9UA 2EFOA 1IUYA 2ZKZA 2XIGA 3I54A 5J8FA 1IN5A 3CUOA 5LHIA 3R60A 4ZZDA 1K6OA 5CVJA 5HDGA 3T1BA 4KIFA 1IXCA 2D1HA 3GX4X 2HTJA 4HX8A 3R0AA 3HRUA 1L0OC 3L09A 5JHUA 1OYIA 2JZYA 3P7NA 4ZYHA 1S6LA 5DCMB 3WTZA 3LAJA 1ZYRF 2UWMA 1KQ8A 1Z91A 3PQJA 2A6EF 4ESBA 4M6YA 1JXSA 3RIRA 3RKYA 3JW4A 1L3LA 3GZ5A 1FWZA 2EV6A 4ZYGA 3IWFA 4MEXF 4YFNF 3RDIA 4HLYA 1U78A 3H3ZA 3WTVC 4I98B 3V7SA 2STWA 4HAMA 1KQ9A 4U0WA 4I0BA 2DU9A 4FX0A 1WQ2A 2COMA 2RV8A 1SFEA 3E5UA 1R1TA 2QQBA 3LA2A 1UHWA 1KU3A 3GW2A 4HYEA 2FF4A 3WU0A 3GFLA 2LKPA 2GAUA 1ZRCA 4G7OF 2FBIA 4TV7A 2P7VB 1TLHB 3PFIA 1XSXA 1ZRDA 2VT2A 1XCVA 5JI6A 1TNSA 2BEOA 1XGMA 4FX4A 4Y13A 2ZNZA 4WCGA 5EEGA 4ENKA 2E1NA 3K0LA 3TO7A 4KDPA 1O57A 2X0LA 2XHKA 1W7PA 2CSOA 4HF2A 3HSEA 1FY7A 2PMUA 5D5VB 3I53A 1ZH5A 3ZMZA 4EGYA 4FHTA 1XMKA 5L3GA 4FT8A 4HQMA 1IW7F 5F1RA 3E6CC 6PAXA 2VE9A 3T5XA 3T0YA 1B9MA 2Y0MA 2BV6A 4AVPA 4ASNA 1U3EM 5L3EA 4AIHA 2KKOA 4XSXF 1QZYA 3RTRA 3EQLF 2BYVE 3WODF 4AIKA 4HDVA 2OA4A 1EH7A 3M8EA 1BIAA 4XLPF 1BI1A 4OIPF 2UXXA 4BHCA 1AOYA 4PGGA 3QU6A 5DUKA 4CDGA 1HW2A 4MQ9F 1BC7C 2HEOA 3GXOA 3TOBA 3I59B 1VTNC 5K5OA 1KU7A 2IRFG 3I4PA 2E1CA 5FLXK 2DAOA 4YFKF 1BI3A 4ESFA 3LQQA 4IVNA 5DCFA 1BC8C 3WU1B 3GFMA 4A12A 2OQGA 4EQQA 1DDNA 3HUGA 2O3FA 1R23A 1T6SA 5E1WA 2WV0A 2YU3A 3ZPLA 2EA4A 3PQKA 5L3CA 3MZYA 1W7PB 2A6HF 4M9SA 4EJOA 1UFMA 2RN7A 3KFWX 3TO9A 1J59A 3NRVA 1FYMA 1MJBA 5KK1A 4U0YA 1ZHFA 5ICFA 2IPQX 5LHGA 3FZVA 2G7UA 3I58A 1H9TA 4L18B 2RC4A 3HRMA 4H0EA 2Q2EA 2IW5A 4O5VA 2P8TA 3IRQA 2FBKA 1KA8A 3AAFA 3DEUA 1ZAOA 4UNOA 4EM1A 4G7HF 5E8GA 4LLLA 4UV8A 4HZFA 4LMYA 3D0SA 2AS5F 2IJLA 2LSOA 2GXBA 3IC7A 1S29A 4M73A 3KZYA 4R1HA 5DDGA 3F8CA 2DI3A 5CVRA 5DD4A 3JTHA 3LAPA 4UUVA 4L0YB 4L5IA 3O2PE 1KYWA 2ZNYA 3TDZC 4EV0A 2K02A 2VE8A 5HVQC 2V1DA 2Q0OA 4EM2A 4IRHA 2JPBA 1GVJA 1FLIA 5K5QA 1B9NA 3V4GA 1G3YA 1ZG3A 1I1GA 2K7LA 2QBYB 1Q1HA 4NB5A 1JHHA 2IVMA 2MC3A 4RB3C 5IT3A 4JQFA 1FNNA 4GXOA 2PQ8A 3F6OA 3CO6C 2CG4A 2CW0F 4CYDA 4GGGA 2F5CA 4LFUA 3J80Z 2EFNA 3CLOA 2HZTA 5AIPA 4WWCA 1HW5A 3HYIA 2MLGA 4XLNF 3J7AO 2P6SA 3KETA 2K86A 1Z9CA 1BBYA 3KP2A 3HOSA 2GWRA 3HTUA 1HBXG 1FOKA 5HDKA 5ILSA 3ROUA 5ED4A 5FB2A 2CQKA 3FXQA 1HKSA 3P9KA 3K9TA 1Z05A 2EJRA 5DYMA 4OMYA 2PJPA 3Q5FA 2EK5A 5CVIA 3WTUC 2XRNA 1UHMA 3RKWA 1YLFA 4F7ZA 1OKRA 3FHZA 1DUXC 1ZARA 2W25A 3M8FA 3QPHA 2XKPA 4M6XA 2LF7A 1HW1A 1MKMA 4IHSA 2P5LC 4WK8F 3WTYC 2PEXA 4WX9A 4LJZF 5LLQA 2OZUA 2XROA 4ZYEA 4KICA 1PP8F 1C0WA 1ZG1A 1OMIA 3WG9A 3KP4A 1FBQA 1LVAA 4ZYDA 1V4RA 4HV6A 2ZJ2A 3QP5A 2FRHA 1ZN2A 3WTXC 5J8CA 3NEUA 1XN7A 2A68F 2EV0A 4CZZA 4G6DA 4HBLA 3QPTA 4JBAA 2JT1A 1QZZA 1TQMA 3IHUA 3V7RA 4HF1A 4XSZF 4A6DA 1CGPA 3KEOA 1P2FA 4ENNA 3CTAA 3HSFA 3KLOA 2Z3YA 3M1EA 2QZ8A 5E1XA 3HRTA 2ADUA 5BOXA 1K78B 4P96A 5CVUA 1YG2A 2ZCWA 2F2EA 3ECHA 1LB2A 2YR2A 4ON0A 1HKTA 1GXPA 1YYVA 2LDUA 3V8JA 2HDCA 1RI7A 2NS0A 1XDUA 4BXUA 2HQRA 3G3ZA 2P5KA 2MBFA 1W7PD 2QM3A 3TOAA 1O3SA 5FD6A 2KJCA 4L5JA 3R6SA 2Z9OA 2D45A 3HRSA 3I71A 3GVAA 2H6BA 3WGGA 5AIQA 4A0YA 5L3BA 1IRFA 2KIFA 1EV7A 1BIBA 3K2ZA 1R5HA 2ISZA 2NNNA 1IZ1A 2LNBA 3RKXA 2A07F 3CUQA 2DLLA 1KU2A 1TTYA 4HLXA 5A2QK 4IHTA 5FD5A 5HS7A 4EJUA 4GCVA 2PMHA 2FQ3A 1B1BA 2VBWA 3ML6A 1HSJA 2VBXA 3BP8A 4MHGA 2XUBA 1TQPA 4MQVA 1J5YA 1IN7A 1D5VA 3M7GA 2DPUA 2QQ9A 3DF8A 3R61A 4B09A 1D8KA 1R22A 3L2CA 1XGOA 3MQ0A 2K4JA 5DD8A 3MCZA 2AXLA 4L9VA 2HOEA 2HKOA 4MTEA 1YIOA 2OQRA 2F5FA 2L4AA 4L0ZB 1ZLKA 4HX7A 4UVCA 1CF7B 4LB5A 4IXAA 1YW8A 3D5LA 2OZ6A 3C3WA 5TJJA 4Q4ZF 3RYPA 4A5MA 3WE2A 4RGUA 2PN6A 4ENMA 1IN6A 1USTA 2K27A 3DFGA 1BN5A 2MD5A 4OINF 3E5QA 5LHHA 1MD0A 4WXCA 2PBIA 3VFZA 2IA0A 4NQWA 4KMUX 4LGWA 3O3KA 1WRJA 3HSRA 4Q47A 3K1NA 5L3DA 2EA2A 4LG0A 4XBFA 3V8LA 1U8RA 3QAHA 1LDKB 2FMLA 3FMRA 1YQAA 3I0TA 4EJWA 1PUEE 4Z2YA 2GA2A 3KEQA 2ZO4A 3GEZA 2PI0A 1AWCA 4AIJA 2HYFA 3LSTA 1IRGA 3K69A 5D4RA 1RUNA 1T38A 2HKXA 2Z99A 1I6XA 1Y0UA 2DW4A 4LD5A 2GQQA 4BHBA 3VEPA 3ZP5A 1KGSA 3F21A 1RIOH 1KU9A 2ISYA 4LLGF 3GZ6A 1Z6TA 2RQPA 1IN4A 1FP1D 2YPRA 1PDNC 1JHFA 2H6CA 5FLXZ 1UCRA 5KVRA 4N9IA 1CF7A 1FBSA 2QBYA 3E6BA 2UXNA 4MGRA 1BM9A 3BY6A 2D1VA 1LJ9A 3HHHA 3L7WA 2VBYA 3ERED 4RAZA 4HA8A 1QQIA 1ZG5A 1FC3A 1P6RA 3W6JB 4D0PA 2HFHA 2ZXJA 1BI2A 5K5RA 3DQVC 2ACJA 1S7OA 1XCBA 3E6MA 3FF5A 4MEYF 2JSCA 2KIMA 4Y15A 3SXYA 3JAMZ 4Q5SF 1V3FA 4A2UA 1SD6A 5HLIA 2XGXA 1S3JA 1O3RA 1P4XA 2FU4A 4A6EA 2E7WA 2O0YA 2OAZA 3BJAA 2DO7A 5LRSA 1I1SA 2H27A 3E3VA 3HOTA 1QPMA 3DXJF 5K1YA 2UZKA 4Y17A 5L3FA 2HQNA 2M87A 4OMZA 1STZA 4LLNA 3E6DA 3L9FA 2A61A 3FM5A 4BH9A 1HQCA 4OIQF 3ZMUA 1T98A 3V7CA 4KT5C 4PDKA 1TQIA 5HDNA 1H9GA 4YIIA 2JPCA 2ZBKA 4KN7X 2J5PA 3P9IA 5JR3A 3T8RA 3MZHA 1U6GA 1G3WA 3C7JA 1SFUA 3REOA 3BZ6A 1R36A 1G6NA 2FNPA 4CO8A 3LQRA 1S8NA 2G9WA 1IAWA 2GXGA 2ZMEB 3U1DA 5E17F 2R7DA 5D6FA 2E7XA 2KRFA 1LDJA 1MDMB 1KQ0A 1XSVA 1QBJA 1YW9A 3EDPA 1U5TC 1DPUA 4UVAA 1A04A 2RVCA 5FO5A 4JK1X 2HWVA 4WXDA 4A5NA 2P7CB 1LEBA 4EGZA 4KMFA 3P9CA 4IPAA 4S05A 4HX4A 3FX3A 1U5TA 3GWZA 3C18A 2CGPA 1XDSA 2HYGD 4I01A 2WTEA 4P55A 3QU3A 1MJAA 1I27A 2Q8KA 1FZPB 4G7ZF 4XRFA 2XASA 1FSEA 1FT9A 1YFHA 5LEJA 1SD4A 2DFIA 3ZMVA 2QUFA 2NAZA 1O3TA 5DUIA 4BQAA 2XKOA 5F64A 2MA3A 4RB0A 2PFBA 4G6QA 1W5SA 1G4DA 4U88A 3J80K 5FGMA 2OU2A 2V1UA 2NYXA 3SQNA 2NNYA 2YX7A 4RAYA 1YS7A 4WXHA 3JSPA 3Q9SA 2XAJA 3I5UA 3IRRA 1OYYA 5LGTA 3HIFA 3T8TA 4HF0A 1E17A 4L9TA 1XSDA 3FMQA 2JRTA 2QWWA 5F6FA 3HHGA 1ON1A 4HDUA 5D8LB 2P5VA 4L9NA 1FSHA 3F8NA 4KUMA 2IA2A 4ETSA 1F9NA 3DPTA 1Z1DA 2VXZA 3ZMDA 4OIRF 3F22A 1GXQA 3V8KA 5IT9K 4RGRA 4CICA 4N9HA 3LWFA 4BNCA 2P4WA 3JSOA 3ELKA 1FX7A 4P9FA 4BAYA 1SMYF 2EV5A 3MEXA 1YS6A 3JTGA 1MDMA 1R58A 5LGUA 3CJNA 2X4HA 2FXAA 2O03A 1FP2A 2K4BA 2HTSA 2Y75A 1OR7A 3OV8A 2MLKA 3DPLC 1R7JA 5HLGA 3DV8A 1FYKA 2B0LA 1U5TB 3F23A 1EH6A 1R00A 3ULQB 2M8EA 5LRRA 2BE5F 1YTYA 2V9VA 1ZLJA 4AD9A 2O61A 4ESJA 2TDXA 5AONA 3BPVA 4DNCA 2DK5A 4HW0A 1J2XA 1HKQA 3CUQC 3N4MA 4KFCA 5BPIA 5FFXA 2FMYA 3KP7A 5BMZA 1R5GA 3JAMK 1XB4A 5IT9Z 3K1MA 4N0BA 2WWYA 1IF1A 4EVIA 4R8HA 1E2XA 4OIOF 5BPDA 5ICCA 1P4WA 2WC2A 3ZMSA 3BJ6A 2XAHA 2FBHA 3SZTA 3Q9VA 2M5WA 4YG2F 2L01A 4G94A 3ZN0A 3WTWC 4I09A 2L3DA 1YW7A 2NRAC 1USSA 3FMSA 4OOIA 2M1BA 3E5XA 1EH8A 1K7AA 5LGNA 2GA1A 3FWEA 2MH2A 5HLHA 2EFWA 5DV5A 1BI0A 5D6EA 5BQTA 3HTSB 2XV4S 1K78A 4I0AA 1B6AA 5HS8A 2CWEA 3GUDA 3CO7C 2EWNA 2RGVA 1TW3A 1PP7U 3L00A 3ZMTA 3ECOA 1REPC 1IXRC 3F6VA 1KYZA 2G7HA 4U0VA 1ULYA 1ZGJA 2VT3A 5ICGA 4IRGA 3U2RA 3VODA 1BOAA 2IP2A 1NHAA 4I2OA 2M45A 3TDUC 4LB6B 5J6XA 2XAGA 2DK8A 4U7DA 4G9YA 5HS9A 2A5YB 2V1XA 1RZ4A 4M74A 3H3UA 1IN8A 4HV5A 3LA7A 5JVTA 3MFKA 1OYWA 3BROA 3GLXA 4KN4X 1T39A 2EFQA 3DP7A 2XAQA 3CDHA 3QRFF 4QWQA 2OD5A 5CVVA 2Z33A 2XVCA 4DQ2A 3TKYA 2FOKA 3N97A 3VB2A 3F72A 3DKWA 3GFJA 1W5TA 2RNJA 3MAJA 4KIBA 3WE3A 3F8FA 1JGSA 3SHFA 1ODDA 4HOBA 4RB2C 1O7LA 2A3SA 4AWXB 2KJBA 4O6JA 3KCCA 2XAFA 4O3MA 1O7FA 4MNUA 3IKTA 3B73A 3QOPA 2HR3A 2DBBA 1LDDA 3MWMA 3IL2A 5BS6A 3BWGA 3TGNA 5TRDA 3E97A 4B8XA 1K79A 4UXNA 4UHTA 2BGCA 3F3XA 3KP6A 1WKMA 3S2WA 1TW2A 2CYYA 4ZH4F 1XGSA 2HS5A 1SD7A 2ESHA 5EEHA 4LK0F 3KE2A 4EM0B 1ONVA 2LF8A 2EB7A 4GYGA 5ILUA 1D8JA 2QQAA 5LEKA 1HSTA 5ILVA 1F1ZA 2W84A 4LK1F 1R1UA 5FFZA 2A69F 3EETA 2IA1A 4RGSA 4RGXA 2H94A 5JFRA 1SMTA 1R1VA 2VODA 2D2WA 2JTVA 5D4SA 2L02A 3M9AA 4EMSA 2W24A 4BHPA 1QO0D 3GFIA 4RS8A 1G3TA 3EYYA 3SFZA 1MGTA 1SFXA 1XGNA 4K2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGA A;  2ELH A;  3CUQ B;  4ZZL A;  4RB1 A;  1WWX A;  1D3Y A;  1X3U A;  3KZZ A;  4Q48 A;  1WI9 A;  1G3S A;  5HOO A;  3RPU A;  3F8B A;  3H92 A;  2R3S A;  1XD7 A;  1RUO A;  4IJA A;  3WTS C;  1FBU A;  4BYY A;  1O3Q A;  4E70 A;  2VOO A;  1HXD A;  2VC1 A;  2BBY A;  2R7F A;  2GZW A;  1LQ1 A;  1DPR A;  2ETH A;  2VBZ A;  3SZP A;  3COA C;  4YFX F;  3I59 A;  3NQO A;  3LFK A;  2MH9 A;  2DQR A;  2PLY A;  3FM3 A;  5H6R A;  2ZFW A;  3I64 A;  5ICE A;  2RDP A;  4QLC U;  4U7B A;  5DEQ A;  1MZB A;  4YIF A;  1FYL A;  2W57 A;  4GYI A;  1TNT A;  4KIG A;  4PZJ A;  4CXF A;  1JE8 A;  2YX4 A;  3QP6 A;  1IXS B;  3ABT A;  1TBX A;  4WF2 A;  3TO6 A;  4UV9 A;  4I02 A;  3RI4 A;  1MJ9 A;  2QYO A;  4UVB A;  3O6B B;  2OBP A;  4CHU A;  2L4M A;  3IWZ A;  4R79 A;  5LBQ A;  3C1D A;  2DPD A;  3GF2 A;  1WSU A;  2IT0 A;  4OU0 A;  3R4K A;  4EJV A;  2YSR A;  3VOE A;  2H09 A;  3TQN A;  3WGH A;  2J5O A;  5D5U B;  2Z5U A;  1QGP A;  2FEZ A;  2ESN A;  5CYV A;  5DCM A;  1GHC A;  3ISP A;  4IF4 A;  2QVO A;  1F4K A;  2RKH A;  2FA5 A;  1RNL A;  4G8X A;  4ENJ A;  2EFP A;  4KNY A;  2Y48 A;  3F8M A;  1F5T A;  4PGH A;  3BJO A;  4PCQ A;  1SD5 A;  3IKV A;  2GIV A;  5D5W B;  2QLZ A;  1T0F A;  5D5X B;  3U9G A;  2VOP A;  3KP3 A;  5A2Q Z;  3RPQ A;  4M72 A;  3J81 Z;  2DT5 A;  5H6Q A;  5E20 A;  2PG4 A;  4GO1 A;  3KLN A;  5ERI A;  1ZRF A;  5E8I A;  2QEN A;  1P4A A;  2CO5 A;  2V79 A;  3GYH X;  5D8K B;  4L9J A;  3GO5 A;  4P5O A;  1B4A A;  2F5D A;  1SAX A;  4A0Z A;  4KYW A;  3W6K B;  2VC0 A;  2L54 A;  2O8X A;  3EYI A;  3RJP A;  3R0J A;  2VN2 A;  2F5E A;  2C6Y A;  2HGC A;  3G73 A;  2ZME A;  4CGZ A;  3B02 A;  3KP5 A;  3FXR A;  1J75 A;  1ZRE A;  2O6G E;  2STT A;  4M9Z A;  4M9X A;  2FSW A;  4S04 A;  1P92 A;  2V6C A;  3FXU A;  2P6T A;  1LEA A;  4EJT A;  1H0M A;  5E18 F;  2DTR A;  3BDD A;  5H20 A;  1I5Z A;  1T2K A;  3EUH A;  3ZQ7 A;  3ZN1 A;  3J81 K;  1Z7U A;  2VON A;  1S7A A;  4LG0 B;  1ON2 A;  1XMA A;  2CFX A;  2FE3 A;  1J9I A;  5CJ9 A;  1Z6R A;  4MTD A;  4IRI A;  2W85 A;  3LA3 A;  2FNA A;  3ABU A;  4A0X A;  2KIU A;  3BPX A;  3WGI A;  4M71 A;  1J7K A;  1YO5 C;  1BJA A;  3WTT C;  2M30 A;  5CLS A;  4KA4 A;  3BOQ A;  4HQE A;  5E1Z B;  1U2W A;  1QNT A;  1OPC A;  2DQL A;  1DP7 P;  4I7H A;  1W4M A;  3K1P A;  1J0R A;  1FPQ A;  1LNW A;  1B59 A;  3OOP A;  4NHJ A;  1UB9 A;  3RYR A;  4P9U A;  2EFO A;  1IUY A;  2ZKZ A;  2XIG A;  3I54 A;  5J8F A;  1IN5 A;  3CUO A;  5LHI A;  3R60 A;  4ZZD A;  1K6O A;  5CVJ A;  5HDG A;  3T1B A;  4KIF A;  1IXC A;  2D1H A;  3GX4 X;  2HTJ A;  4HX8 A;  3R0A A;  3HRU A;  1L0O C;  3L09 A;  5JHU A;  1OYI A;  2JZY A;  3P7N A;  4ZYH A;  1S6L A;  5DCM B;  3WTZ A;  3LAJ A;  1ZYR F;  2UWM A;  1KQ8 A;  1Z91 A;  3PQJ A;  2A6E F;  4ESB A;  4M6Y A;  1JXS A;  3RIR A;  3RKY A;  3JW4 A;  1L3L A;  3GZ5 A;  1FWZ A;  2EV6 A;  4ZYG A;  3IWF A;  4MEX F;  4YFN F;  3RDI A;  4HLY A;  1U78 A;  3H3Z A;  3WTV C;  4I98 B;  3V7S A;  2STW A;  4HAM A;  1KQ9 A;  4U0W A;  4I0B A;  2DU9 A;  4FX0 A;  1WQ2 A;  2COM A;  2RV8 A;  1SFE A;  3E5U A;  1R1T A;  2QQB A;  3LA2 A;  1UHW A;  1KU3 A;  3GW2 A;  4HYE A;  2FF4 A;  3WU0 A;  3GFL A;  2LKP A;  2GAU A;  1ZRC A;  4G7O F;  2FBI A;  4TV7 A;  2P7V B;  1TLH B;  3PFI A;  1XSX A;  1ZRD A;  2VT2 A;  1XCV A;  5JI6 A;  1TNS A;  2BEO A;  1XGM A;  4FX4 A;  4Y13 A;  2ZNZ A;  4WCG A;  5EEG A;  4ENK A;  2E1N A;  3K0L A;  3TO7 A;  4KDP A;  1O57 A;  2X0L A;  2XHK A;  1W7P A;  2CSO A;  4HF2 A;  3HSE A;  1FY7 A;  2PMU A;  5D5V B;  3I53 A;  1ZH5 A;  3ZMZ A;  4EGY A;  4FHT A;  1XMK A;  5L3G A;  4FT8 A;  4HQM A;  1IW7 F;  5F1R A;  3E6C C;  6PAX A;  2VE9 A;  3T5X A;  3T0Y A;  1B9M A;  2Y0M A;  2BV6 A;  4AVP A;  4ASN A;  1U3E M;  5L3E A;  4AIH A;  2KKO A;  4XSX F;  1QZY A;  3RTR A;  3EQL F;  2BYV E;  3WOD F;  4AIK A;  4HDV A;  2OA4 A;  1EH7 A;  3M8E A;  1BIA A;  4XLP F;  1BI1 A;  4OIP F;  2UXX A;  4BHC A;  1AOY A;  4PGG A;  3QU6 A;  5DUK A;  4CDG A;  1HW2 A;  4MQ9 F;  1BC7 C;  2HEO A;  3GXO A;  3TOB A;  3I59 B;  1VTN C;  5K5O A;  1KU7 A;  2IRF G;  3I4P A;  2E1C A;  5FLX K;  2DAO A;  4YFK F;  1BI3 A;  4ESF A;  3LQQ A;  4IVN A;  5DCF A;  1BC8 C;  3WU1 B;  3GFM A;  4A12 A;  2OQG A;  4EQQ A;  1DDN A;  3HUG A;  2O3F A;  1R23 A;  1T6S A;  5E1W A;  2WV0 A;  2YU3 A;  3ZPL A;  2EA4 A;  3PQK A;  5L3C A;  3MZY A;  1W7P B;  2A6H F;  4M9S A;  4EJO A;  1UFM A;  2RN7 A;  3KFW X;  3TO9 A;  1J59 A;  3NRV A;  1FYM A;  1MJB A;  5KK1 A;  4U0Y A;  1ZHF A;  5ICF A;  2IPQ X;  5LHG A;  3FZV A;  2G7U A;  3I58 A;  1H9T A;  4L18 B;  2RC4 A;  3HRM A;  4H0E A;  2Q2E A;  2IW5 A;  4O5V A;  2P8T A;  3IRQ A;  2FBK A;  1KA8 A;  3AAF A;  3DEU A;  1ZAO A;  4UNO A;  4EM1 A;  4G7H F;  5E8G A;  4LLL A;  4UV8 A;  4HZF A;  4LMY A;  3D0S A;  2AS5 F;  2IJL A;  2LSO A;  2GXB A;  3IC7 A;  1S29 A;  4M73 A;  3KZY A;  4R1H A;  5DDG A;  3F8C A;  2DI3 A;  5CVR A;  5DD4 A;  3JTH A;  3LAP A;  4UUV A;  4L0Y B;  4L5I A;  3O2P E;  1KYW A;  2ZNY A;  3TDZ C;  4EV0 A;  2K02 A;  2VE8 A;  5HVQ C;  2V1D A;  2Q0O A;  4EM2 A;  4IRH A;  2JPB A;  1GVJ A;  1FLI A;  5K5Q A;  1B9N A;  3V4G A;  1G3Y A;  1ZG3 A;  1I1G A;  2K7L A;  2QBY B;  1Q1H A;  4NB5 A;  1JHH A;  2IVM A;  2MC3 A;  4RB3 C;  5IT3 A;  4JQF A;  1FNN A;  4GXO A;  2PQ8 A;  3F6O A;  3CO6 C;  2CG4 A;  2CW0 F;  4CYD A;  4GGG A;  2F5C A;  4LFU A;  3J80 Z;  2EFN A;  3CLO A;  2HZT A;  5AIP A;  4WWC A;  1HW5 A;  3HYI A;  2MLG A;  4XLN F;  3J7A O;  2P6S A;  3KET A;  2K86 A;  1Z9C A;  1BBY A;  3KP2 A;  3HOS A;  2GWR A;  3HTU A;  1HBX G;  1FOK A;  5HDK A;  5ILS A;  3ROU A;  5ED4 A;  5FB2 A;  2CQK A;  3FXQ A;  1HKS A;  3P9K A;  3K9T A;  1Z05 A;  2EJR A;  5DYM A;  4OMY A;  2PJP A;  3Q5F A;  2EK5 A;  5CVI A;  3WTU C;  2XRN A;  1UHM A;  3RKW A;  1YLF A;  4F7Z A;  1OKR A;  3FHZ A;  1DUX C;  1ZAR A;  2W25 A;  3M8F A;  3QPH A;  2XKP A;  4M6X A;  2LF7 A;  1HW1 A;  1MKM A;  4IHS A;  2P5L C;  4WK8 F;  3WTY C;  2PEX A;  4WX9 A;  4LJZ F;  5LLQ A;  2OZU A;  2XRO A;  4ZYE A;  4KIC A;  1PP8 F;  1C0W A;  1ZG1 A;  1OMI A;  3WG9 A;  3KP4 A;  1FBQ A;  1LVA A;  4ZYD A;  1V4R A;  4HV6 A;  2ZJ2 A;  3QP5 A;  2FRH A;  1ZN2 A;  3WTX C;  5J8C A;  3NEU A;  1XN7 A;  2A68 F;  2EV0 A;  4CZZ A;  4G6D A;  4HBL A;  3QPT A;  4JBA A;  2JT1 A;  1QZZ A;  1TQM A;  3IHU A;  3V7R A;  4HF1 A;  4XSZ F;  4A6D A;  1CGP A;  3KEO A;  1P2F A;  4ENN A;  3CTA A;  3HSF A;  3KLO A;  2Z3Y A;  3M1E A;  2QZ8 A;  5E1X A;  3HRT A;  2ADU A;  5BOX A;  1K78 B;  4P96 A;  5CVU A;  1YG2 A;  2ZCW A;  2F2E A;  3ECH A;  1LB2 A;  2YR2 A;  4ON0 A;  1HKT A;  1GXP A;  1YYV A;  2LDU A;  3V8J A;  2HDC A;  1RI7 A;  2NS0 A;  1XDU A;  4BXU A;  2HQR A;  3G3Z A;  2P5K A;  2MBF A;  1W7P D;  2QM3 A;  3TOA A;  1O3S A;  5FD6 A;  2KJC A;  4L5J A;  3R6S A;  2Z9O A;  2D45 A;  3HRS A;  3I71 A;  3GVA A;  2H6B A;  3WGG A;  5AIQ A;  4A0Y A;  5L3B A;  1IRF A;  2KIF A;  1EV7 A;  1BIB A;  3K2Z A;  1R5H A;  2ISZ A;  2NNN A;  1IZ1 A;  2LNB A;  3RKX A;  2A07 F;  3CUQ A;  2DLL A;  1KU2 A;  1TTY A;  4HLX A;  5A2Q K;  4IHT A;  5FD5 A;  5HS7 A;  4EJU A;  4GCV A;  2PMH A;  2FQ3 A;  1B1B A;  2VBW A;  3ML6 A;  1HSJ A;  2VBX A;  3BP8 A;  4MHG A;  2XUB A;  1TQP A;  4MQV A;  1J5Y A;  1IN7 A;  1D5V A;  3M7G A;  2DPU A;  2QQ9 A;  3DF8 A;  3R61 A;  4B09 A;  1D8K A;  1R22 A;  3L2C A;  1XGO A;  3MQ0 A;  2K4J A;  5DD8 A;  3MCZ A;  2AXL A;  4L9V A;  2HOE A;  2HKO A;  4MTE A;  1YIO A;  2OQR A;  2F5F A;  2L4A A;  4L0Z B;  1ZLK A;  4HX7 A;  4UVC A;  1CF7 B;  4LB5 A;  4IXA A;  1YW8 A;  3D5L A;  2OZ6 A;  3C3W A;  5TJJ A;  4Q4Z F;  3RYP A;  4A5M A;  3WE2 A;  4RGU A;  2PN6 A;  4ENM A;  1IN6 A;  1UST A;  2K27 A;  3DFG A;  1BN5 A;  2MD5 A;  4OIN F;  3E5Q A;  5LHH A;  1MD0 A;  4WXC A;  2PBI A;  3VFZ A;  2IA0 A;  4NQW A;  4KMU X;  4LGW A;  3O3K A;  1WRJ A;  3HSR A;  4Q47 A;  3K1N A;  5L3D A;  2EA2 A;  4LG0 A;  4XBF A;  3V8L A;  1U8R A;  3QAH A;  1LDK B;  2FML A;  3FMR A;  1YQA A;  3I0T A;  4EJW A;  1PUE E;  4Z2Y A;  2GA2 A;  3KEQ A;  2ZO4 A;  3GEZ A;  2PI0 A;  1AWC A;  4AIJ A;  2HYF A;  3LST A;  1IRG A;  3K69 A;  5D4R A;  1RUN A;  1T38 A;  2HKX A;  2Z99 A;  1I6X A;  1Y0U A;  2DW4 A;  4LD5 A;  2GQQ A;  4BHB A;  3VEP A;  3ZP5 A;  1KGS A;  3F21 A;  1RIO H;  1KU9 A;  2ISY A;  4LLG F;  3GZ6 A;  1Z6T A;  2RQP A;  1IN4 A;  1FP1 D;  2YPR A;  1PDN C;  1JHF A;  2H6C A;  5FLX Z;  1UCR A;  5KVR A;  4N9I A;  1CF7 A;  1FBS A;  2QBY A;  3E6B A;  2UXN A;  4MGR A;  1BM9 A;  3BY6 A;  2D1V A;  1LJ9 A;  3HHH A;  3L7W A;  2VBY A;  3ERE D;  4RAZ A;  4HA8 A;  1QQI A;  1ZG5 A;  1FC3 A;  1P6R A;  3W6J B;  4D0P A;  2HFH A;  2ZXJ A;  1BI2 A;  5K5R A;  3DQV C;  2ACJ A;  1S7O A;  1XCB A;  3E6M A;  3FF5 A;  4MEY F;  2JSC A;  2KIM A;  4Y15 A;  3SXY A;  3JAM Z;  4Q5S F;  1V3F A;  4A2U A;  1SD6 A;  5HLI A;  2XGX A;  1S3J A;  1O3R A;  1P4X A;  2FU4 A;  4A6E A;  2E7W A;  2O0Y A;  2OAZ A;  3BJA A;  2DO7 A;  5LRS A;  1I1S A;  2H27 A;  3E3V A;  3HOT A;  1QPM A;  3DXJ F;  5K1Y A;  2UZK A;  4Y17 A;  5L3F A;  2HQN A;  2M87 A;  4OMZ A;  1STZ A;  4LLN A;  3E6D A;  3L9F A;  2A61 A;  3FM5 A;  4BH9 A;  1HQC A;  4OIQ F;  3ZMU A;  1T98 A;  3V7C A;  4KT5 C;  4PDK A;  1TQI A;  5HDN A;  1H9G A;  4YII A;  2JPC A;  2ZBK A;  4KN7 X;  2J5P A;  3P9I A;  5JR3 A;  3T8R A;  3MZH A;  1U6G A;  1G3W A;  3C7J A;  1SFU A;  3REO A;  3BZ6 A;  1R36 A;  1G6N A;  2FNP A;  4CO8 A;  3LQR A;  1S8N A;  2G9W A;  1IAW A;  2GXG A;  2ZME B;  3U1D A;  5E17 F;  2R7D A;  5D6F A;  2E7X A;  2KRF A;  1LDJ A;  1MDM B;  1KQ0 A;  1XSV A;  1QBJ A;  1YW9 A;  3EDP A;  1U5T C;  1DPU A;  4UVA A;  1A04 A;  2RVC A;  5FO5 A;  4JK1 X;  2HWV A;  4WXD A;  4A5N A;  2P7C B;  1LEB A;  4EGZ A;  4KMF A;  3P9C A;  4IPA A;  4S05 A;  4HX4 A;  3FX3 A;  1U5T A;  3GWZ A;  3C18 A;  2CGP A;  1XDS A;  2HYG D;  4I01 A;  2WTE A;  4P55 A;  3QU3 A;  1MJA A;  1I27 A;  2Q8K A;  1FZP B;  4G7Z F;  4XRF A;  2XAS A;  1FSE A;  1FT9 A;  1YFH A;  5LEJ A;  1SD4 A;  2DFI A;  3ZMV A;  2QUF A;  2NAZ A;  1O3T A;  5DUI A;  4BQA A;  2XKO A;  5F64 A;  2MA3 A;  4RB0 A;  2PFB A;  4G6Q A;  1W5S A;  1G4D A;  4U88 A;  3J80 K;  5FGM A;  2OU2 A;  2V1U A;  2NYX A;  3SQN A;  2NNY A;  2YX7 A;  4RAY A;  1YS7 A;  4WXH A;  3JSP A;  3Q9S A;  2XAJ A;  3I5U A;  3IRR A;  1OYY A;  5LGT A;  3HIF A;  3T8T A;  4HF0 A;  1E17 A;  4L9T A;  1XSD A;  3FMQ A;  2JRT A;  2QWW A;  5F6F A;  3HHG A;  1ON1 A;  4HDU A;  5D8L B;  2P5V A;  4L9N A;  1FSH A;  3F8N A;  4KUM A;  2IA2 A;  4ETS A;  1F9N A;  3DPT A;  1Z1D A;  2VXZ A;  3ZMD A;  4OIR F;  3F22 A;  1GXQ A;  3V8K A;  5IT9 K;  4RGR A;  4CIC A;  4N9H A;  3LWF A;  4BNC A;  2P4W A;  3JSO A;  3ELK A;  1FX7 A;  4P9F A;  4BAY A;  1SMY F;  2EV5 A;  3MEX A;  1YS6 A;  3JTG A;  1MDM A;  1R58 A;  5LGU A;  3CJN A;  2X4H A;  2FXA A;  2O03 A;  1FP2 A;  2K4B A;  2HTS A;  2Y75 A;  1OR7 A;  3OV8 A;  2MLK A;  3DPL C;  1R7J A;  5HLG A;  3DV8 A;  1FYK A;  2B0L A;  1U5T B;  3F23 A;  1EH6 A;  1R00 A;  3ULQ B;  2M8E A;  5LRR A;  2BE5 F;  1YTY A;  2V9V A;  1ZLJ A;  4AD9 A;  2O61 A;  4ESJ A;  2TDX A;  5AON A;  3BPV A;  4DNC A;  2DK5 A;  4HW0 A;  1J2X A;  1HKQ A;  3CUQ C;  3N4M A;  4KFC A;  5BPI A;  5FFX A;  2FMY A;  3KP7 A;  5BMZ A;  1R5G A;  3JAM K;  1XB4 A;  5IT9 Z;  3K1M A;  4N0B A;  2WWY A;  1IF1 A;  4EVI A;  4R8H A;  1E2X A;  4OIO F;  5BPD A;  5ICC A;  1P4W A;  2WC2 A;  3ZMS A;  3BJ6 A;  2XAH A;  2FBH A;  3SZT A;  3Q9V A;  2M5W A;  4YG2 F;  2L01 A;  4G94 A;  3ZN0 A;  3WTW C;  4I09 A;  2L3D A;  1YW7 A;  2NRA C;  1USS A;  3FMS A;  4OOI A;  2M1B A;  3E5X A;  1EH8 A;  1K7A A;  5LGN A;  2GA1 A;  3FWE A;  2MH2 A;  5HLH A;  2EFW A;  5DV5 A;  1BI0 A;  5D6E A;  5BQT A;  3HTS B;  2XV4 S;  1K78 A;  4I0A A;  1B6A A;  5HS8 A;  2CWE A;  3GUD A;  3CO7 C;  2EWN A;  2RGV A;  1TW3 A;  1PP7 U;  3L00 A;  3ZMT A;  3ECO A;  1REP C;  1IXR C;  3F6V A;  1KYZ A;  2G7H A;  4U0V A;  1ULY A;  1ZGJ A;  2VT3 A;  5ICG A;  4IRG A;  3U2R A;  3VOD A;  1BOA A;  2IP2 A;  1NHA A;  4I2O A;  2M45 A;  3TDU C;  4LB6 B;  5J6X A;  2XAG A;  2DK8 A;  4U7D A;  4G9Y A;  5HS9 A;  2A5Y B;  2V1X A;  1RZ4 A;  4M74 A;  3H3U A;  1IN8 A;  4HV5 A;  3LA7 A;  5JVT A;  3MFK A;  1OYW A;  3BRO A;  3GLX A;  4KN4 X;  1T39 A;  2EFQ A;  3DP7 A;  2XAQ A;  3CDH A;  3QRF F;  4QWQ A;  2OD5 A;  5CVV A;  2Z33 A;  2XVC A;  4DQ2 A;  3TKY A;  2FOK A;  3N97 A;  3VB2 A;  3F72 A;  3DKW A;  3GFJ A;  1W5T A;  2RNJ A;  3MAJ A;  4KIB A;  3WE3 A;  3F8F A;  1JGS A;  3SHF A;  1ODD A;  4HOB A;  4RB2 C;  1O7L A;  2A3S A;  4AWX B;  2KJB A;  4O6J A;  3KCC A;  2XAF A;  4O3M A;  1O7F A;  4MNU A;  3IKT A;  3B73 A;  3QOP A;  2HR3 A;  2DBB A;  1LDD A;  3MWM A;  3IL2 A;  5BS6 A;  3BWG A;  3TGN A;  5TRD A;  3E97 A;  4B8X A;  1K79 A;  4UXN A;  4UHT A;  2BGC A;  3F3X A;  3KP6 A;  1WKM A;  3S2W A;  1TW2 A;  2CYY A;  4ZH4 F;  1XGS A;  2HS5 A;  1SD7 A;  2ESH A;  5EEH A;  4LK0 F;  3KE2 A;  4EM0 B;  1ONV A;  2LF8 A;  2EB7 A;  4GYG A;  5ILU A;  1D8J A;  2QQA A;  5LEK A;  1HST A;  5ILV A;  1F1Z A;  2W84 A;  4LK1 F;  1R1U A;  5FFZ A;  2A69 F;  3EET A;  2IA1 A;  4RGS A;  4RGX A;  2H94 A;  5JFR A;  1SMT A;  1R1V A;  2VOD A;  2D2W A;  2JTV A;  5D4S A;  2L02 A;  3M9A A;  4EMS A;  2W24 A;  4BHP A;  1QO0 D;  3GFI A;  4RS8 A;  1G3T A;  3EYY A;  3SFZ A;  1MGT A;  1SFX A;  1XGN A;  4K2E A; 
#chains in the Genus database with same CATH topology
 1ZGA A;  3BTL A;  4BBS J;  2ELH A;  3CF2 A;  3CUQ B;  4ZZL A;  2VJ4 A;  5TGT A;  2CQX A;  4RB1 A;  1WWX A;  1D3Y A;  1X3U A;  3KZZ A;  4Q48 A;  1WI9 A;  1UHS A;  3E7L A;  3RZO J;  1G3S A;  5HOO A;  2OPT A;  1A35 A;  3OYB A;  2V1N A;  3RPU A;  3F8B A;  1X2N A;  3H92 A;  4M3F A;  4LIU A;  2R5Z B;  2KDO A;  2R3S A;  4IHY A;  1P9Q C;  2LH9 A;  3ABK H;  3DEE A;  1XD7 A;  3CCL I;  4PJM A;  4RBO A;  4IJA A;  3WTS C;  1FBU A;  1RUO A;  2WY7 Q;  4BYY A;  1SFK A;  3BG5 A;  2FX0 A;  1O3Q A;  4E70 A;  2GBY A;  2V9P A;  3Q0U A;  3DKY A;  1I3Q J;  2VOO A;  1FIA A;  1HXD A;  2VC1 A;  1QU3 A;  2HOT A;  2BBY A;  2NOG A;  2GZW A;  2R7F A;  1LQ1 A;  1DPR A;  2ETH A;  2VBZ A;  3SZP A;  3COA C;  5F0F A;  1D0Y A;  4YFX F;  1ZR2 A;  1XPX A;  1VZ0 A;  3RCO A;  2IS6 A;  3I59 A;  3NQO A;  3D1N I;  3LFK A;  2MH9 A;  1MMS A;  2DQR A;  4XKV A;  2K85 A;  2PLY A;  4E4H A;  3FM3 A;  5H6R A;  1A6I A;  5FRN A;  1MMD A;  2DTZ A;  3NWS A;  1FMV A;  2ZFW A;  3I64 A;  4NC6 A;  5ICE A;  2RDP A;  4QLC U;  1HF0 A;  4U7B A;  2EZI A;  5DEQ A;  1RET A;  2M8G X;  1MZB A;  1WJA A;  4YIF A;  1E3P A;  2KMU A;  1Z3X A;  1FYL A;  2W57 A;  4GYI A;  2DXI A;  1FTZ A;  1TNT A;  4KIG A;  4PZJ A;  4CXF A;  1JE8 A;  3S15 J;  1D1A A;  2YX4 A;  1EJ9 A;  3HOV J;  3QP6 A;  2JSP A;  1IXS B;  2AHQ A;  3ABT A;  1TBX A;  1APL C;  4KIS A;  4WF2 A;  3TO6 A;  2DJN A;  4I02 A;  4UV9 A;  4NBQ A;  4XLF A;  1MJ9 A;  2QYO A;  3HGY A;  5J1R A;  1VQM I;  4UVB A;  3O6B B;  2IXS A;  2OBP A;  4CHU A;  2L4M A;  3IWZ A;  4R79 A;  1ACI A;  5M5X J;  3GBG A;  3GTP J;  5LBQ A;  3B6A A;  3OIO A;  3C1D A;  1V55 H;  2DPD A;  3GF2 A;  5FJ8 J;  2BOL A;  1W0T A;  4BDY A;  2DYS H;  1WSU A;  1DGR M;  2IT0 A;  1RPW A;  4XL9 A;  1OCT C;  4OU0 A;  3SZG A;  5J40 A;  2KHM A;  3OSF A;  3R4K A;  3DU6 A;  4EJV A;  2YSR A;  1NG6 A;  3VOE A;  2H09 A;  3BR1 A;  3TQN A;  3WGH A;  2IS2 A;  4A93 J;  2J5O A;  5D5U B;  2CJJ A;  1QGP A;  2FEZ A;  2Z5U A;  2ESN A;  5CYV A;  2AQF A;  4UUS A;  4RA2 A;  1HOM A;  5DCM A;  2H1K A;  1GHC A;  1N25 A;  3OS1 A;  2IEK A;  2O5R A;  4E7H A;  3K6G A;  3ISP A;  3K4L A;  4IF4 A;  1ITY A;  2QVO A;  1F4K A;  3S8P A;  2CV2 A;  3TL4 X;  2RKH A;  1JTY A;  2FA5 A;  1RNL A;  4IOA F;  3CCY A;  4ITV A;  4G8X A;  4BQN A;  4ENJ A;  2EFP A;  4KNY A;  2Y48 A;  3F8M A;  4B43 A;  1S9H A;  2E34 A;  2ZJQ F;  2HPI A;  1F5T A;  4PGH A;  3BJO A;  2KLO A;  1D1B A;  4PCQ A;  1SD5 A;  2RNG A;  3IKV A;  5EYR A;  2GIV A;  3CMA I;  3GCM A;  2MW8 A;  5D5W B;  2QLZ A;  3HOY J;  1T0F A;  1K4T A;  2QKM B;  5D5X B;  1OCC H;  1SVO A;  5GAD J;  3U9G A;  2VOP A;  3CCM I;  3KP3 A;  1Y0N A;  2WAF A;  5A2Q Z;  3RPQ A;  4M72 A;  3J81 Z;  2DT5 A;  1GVD A;  3KZI C;  2LD5 A;  4A3G J;  3OYJ A;  1B8I A;  5H6Q A;  3C2H A;  5E20 A;  2GOX B;  2PG4 A;  4GO1 A;  3OYL A;  4N4N B;  3H9Q A;  2FQ4 A;  3KLN A;  4Y33 A;  5ERI A;  2R0Q C;  2QSH X;  1ZRF A;  3CCJ I;  4M3G A;  5E8I A;  1S5L C;  2QEN A;  1P4A A;  2CO5 A;  2V79 A;  1YJN I;  3GYH X;  3PJR A;  5D8K B;  2CV0 A;  5J47 A;  4L9J A;  2L7Z A;  1TL8 A;  4J19 A;  3CJQ B;  3GO5 A;  3W3C A;  4P5O A;  1OCP A;  1B4A A;  2F5D A;  1SAX A;  1YHQ I;  4ANJ A;  1TWH J;  1T95 A;  1GLN A;  4A0Z A;  3U21 A;  2LLK A;  1Y8Q B;  5EG0 A;  1MBK A;  3K2A A;  3S3M A;  2HOA A;  4KYW A;  3W6K B;  2VC0 A;  2L54 A;  1QA6 A;  2IAI A;  2WBM A;  3PNY A;  4XK4 A;  1A36 A;  4Y3O A;  2O8X A;  1XG1 A;  3OYM A;  2AQE A;  5GAH J;  3EYI A;  3PNT A;  3RJP A;  2Q1Z B;  3LFU A;  3R0J A;  2VN2 A;  3LSM A;  5EG0 B;  2F5E A;  3G6E I;  4CCL A;  2C6Y A;  1X4P A;  1G8X A;  1FIP A;  1POG A;  2HGC A;  3G73 A;  2ZME A;  4CGZ A;  4X6A J;  4AVZ A;  2A5W A;  3B02 A;  2DA5 A;  3KP5 A;  3FXR A;  3M07 A;  1MBE A;  4DJA A;  1J75 A;  2A6T A;  1ZRE A;  2O6G E;  2STT A;  4M9Z A;  4M9X A;  2FSW A;  3HOU J;  4S04 A;  1P92 A;  2V6C A;  1TP4 A;  3FXU A;  2P6T A;  1LEA A;  4EJT A;  3JRC A;  3H9J A;  1GDT A;  1H0M A;  5E18 F;  2DTR A;  3BDD A;  1W5C C;  1WHU A;  3IP4 B;  5H20 A;  1IRZ A;  1I5Z A;  1T2K A;  2ID3 A;  3EUH A;  3G1L A;  2HOS A;  3ZQ7 A;  3ZN1 A;  3J81 K;  2HU9 A;  1Z7U A;  2VON A;  1S7A A;  1ZTR A;  4LG0 B;  1ON2 A;  1IRX A;  1XMA A;  2CFX A;  2FE3 A;  1J9I A;  3BCA A;  5CJ9 A;  1N75 A;  1Z6R A;  2JUG A;  3FDY A;  4MTD A;  3MKZ A;  2MSY A;  2VUM J;  2K3F A;  4IRI A;  2W85 A;  3LA3 A;  5KAI C;  1WJ5 A;  2FNA A;  4OAY A;  3ABU A;  5F0C A;  3CC4 I;  4A0X A;  5F1J A;  2KRH A;  4FTH A;  2FJ1 A;  2KIU A;  1BW5 A;  3FIW A;  3W6V A;  3BPX A;  3AG3 H;  3WGI A;  1QPI A;  4M71 A;  2CQQ A;  1J7K A;  1I39 A;  1YO5 C;  1BJA A;  2Y0S N;  1YI2 I;  3WTT C;  1RC9 A;  2VJI A;  4DW6 A;  2M30 A;  2LY9 A;  1W1W E;  5CLS A;  1X1P A;  3UR3 C;  1D0Z A;  4KA4 A;  3BOQ A;  4HQE A;  5E1Z B;  1U2W A;  1QNT A;  4AM3 A;  2VKD A;  3ZQC A;  2LG4 A;  1OPC A;  2DQL A;  1DP7 P;  4I7H A;  5M3F J;  2XGC A;  1YJ9 I;  1W4M A;  3K1P A;  5B1B H;  1J0R A;  1FPQ A;  1LNW A;  2X6Y A;  2XPV A;  4XOP A;  4JYK A;  1B59 A;  3OOP A;  4NHJ A;  1UB9 A;  3RYR A;  1NK3 P;  3LOC A;  3W2A A;  4BL0 B;  3FKJ A;  4P9U A;  2EFO A;  1XMX A;  5CQG A;  3VYS B;  1IUY A;  2ZKZ A;  2XIG A;  1GV2 A;  4HPQ A;  1JKR C;  4BEH A;  3PNV A;  1MW7 A;  3M4O J;  4JOM A;  2NVX J;  3I54 A;  1Z21 A;  5J8F A;  2Y0S A;  4U87 A;  1IN5 A;  3CUO A;  5LHI A;  2BY1 A;  3R60 A;  5EDN A;  1IO2 A;  4ZZD A;  1K6O A;  3EUH C;  3OYN A;  5CVJ A;  5HDG A;  3T1B A;  3L2U A;  4KIF A;  3ZQH A;  3BTC A;  1IXC A;  2D1H A;  3FBI B;  5IP6 A;  3GX4 X;  2LY1 A;  3CP8 A;  3HRU A;  2HTJ A;  3R0A A;  4HX8 A;  1L0O C;  3ZXS A;  2R93 J;  3BTI A;  3L09 A;  4N4O B;  5JHU A;  1OYI A;  2JZY A;  3P7N A;  4ZYH A;  1S6L A;  2IGM A;  5GTH C;  5DCM B;  1VI0 A;  3WTZ A;  4H4K C;  3LAJ A;  2VPR A;  2IGK A;  4XOR A;  5HNF A;  2ID6 A;  3C2G A;  3MN2 A;  1ZYR F;  2UWM A;  1KQ8 A;  1QHH D;  1Z91 A;  3PQJ A;  1OCO H;  3K70 C;  2A6E F;  4ESB A;  2CMP A;  3BQY A;  4M6Y A;  3ZQG A;  2ZME C;  5BNG A;  2VKE A;  1JXS A;  3RIR A;  4BQQ A;  1R5I D;  2R7O A;  3RKY A;  4X0G A;  2E5Z A;  3JW4 A;  2ME6 A;  3H36 A;  3HPG A;  4PJ0 C;  1L3L A;  3GZ5 A;  1JI8 A;  2BXZ A;  1BOB A;  4CA0 A;  3OYI A;  1FWZ A;  5B3S H;  2EV6 A;  4ZYG A;  3IWF A;  4MEX F;  4YFN F;  2ZC2 A;  2KRC A;  4RMN A;  3RDI A;  3SEQ A;  4B3A A;  4HLY A;  2DN0 A;  2KT0 A;  1U78 A;  3H3Z A;  3WTV C;  4I98 B;  3V7S A;  2STW A;  2G0E A;  4HAM A;  3WHC A;  3G71 I;  3KEY A;  1SAN A;  3I56 I;  4PFP A;  1KQ9 A;  3OSG A;  3PUF A;  2DFF A;  3K4B A;  4U0W A;  4I0B A;  3G1O A;  2DU9 A;  4FX0 A;  1WQ2 A;  4I99 C;  4RM2 A;  2COM A;  4HNV A;  1X3W B;  2RV8 A;  4B3X A;  5FLM J;  1RES A;  2JA7 J;  1SFE A;  3E5U A;  3ERM A;  5FRO A;  1R1T A;  2QQB A;  4FIS A;  3LA2 A;  1UHW A;  1KU3 A;  1VQL I;  3GW2 A;  4HYE A;  1JKQ C;  2FF4 A;  3BG6 A;  3H9G A;  3DTE A;  3WU0 A;  3NAR A;  4RAG A;  1V5E A;  3MKL A;  3GFL A;  2LKP A;  2GAU A;  2E35 A;  1T56 A;  1ZRC A;  4G7O F;  5FRM A;  2FBI A;  4TV7 A;  2P7V B;  2E19 A;  1TLH B;  2EPF A;  2WY8 Q;  2LBF A;  3PFI A;  2O7O A;  3UNG C;  4XON A;  1XSX A;  4FQG A;  4BJ6 C;  3SFI A;  1ZRD A;  5M5W J;  2KZV A;  2VT2 A;  1R4N B;  1XCV A;  5JI6 A;  1G59 A;  1TNS A;  3DEW A;  2BEO A;  3FK6 A;  5IP9 J;  1XGM A;  1VF9 A;  3Q0V A;  4Y13 A;  2ZSH B;  4FX4 A;  2R7V A;  2ZNZ A;  4YEJ A;  4QSH A;  3OYD A;  4WCG A;  5EEG A;  4ENK A;  2E1N A;  2I10 A;  3AG1 H;  5IYB J;  2L2O A;  3K0L A;  3TO7 A;  3PIO F;  2M2E A;  3TW6 A;  2VQC A;  4KDP A;  1O57 A;  2X0L A;  5C4J J;  2XHK A;  4A3M J;  1PJR A;  1W7P A;  4A69 C;  2CSO A;  4HF2 A;  3HSE A;  1FY7 A;  2PMU A;  3OMY A;  5D5V B;  3CCS I;  2JVH A;  3PM1 A;  3I53 A;  3H5N A;  1ZH5 A;  2K9M A;  3ZMZ A;  5F27 A;  2GIZ A;  4EGY A;  3FHN A;  2VKV A;  4FHT A;  4F3Q A;  5TIS C;  1XMK A;  3JRH A;  5L3G A;  1JKO C;  4FT8 A;  4HQM A;  1IW7 F;  2CUF A;  5JLW A;  5F1R A;  4LIV A;  3E6C C;  5K7F A;  1WPK A;  4KT6 A;  6PAX A;  2VE9 A;  1MIJ A;  3T5X A;  2Q2E B;  4J00 A;  3T0Y A;  2AO9 A;  1B9M A;  4B44 A;  4RLQ A;  2Y0M A;  3F9K A;  4CCJ A;  2BV6 A;  4GDF A;  4AVP A;  4ASN A;  1MSE C;  1U3E M;  2R7Q A;  5L3E A;  4AIH A;  3TMO A;  3HZJ A;  3LSG A;  4F55 A;  2KKO A;  2GOM A;  2E1M B;  3HXL A;  4XSX F;  2X6W A;  1QZY A;  1X1D A;  2ICW G;  4HRI A;  3OYG A;  4BAC A;  2JWT A;  3SDB A;  3RTR A;  3EQL F;  4IL6 C;  2BYV E;  4NQW B;  3WOD F;  4AIK A;  2CUJ A;  4HDV A;  2OA4 A;  2VI6 A;  1LVK A;  3TW7 A;  4E6K G;  1EH7 A;  4LG3 A;  3M8E A;  2R92 J;  2E5N A;  1BIA A;  1X19 A;  2V9K A;  4XLP F;  1BI1 A;  1X3Z B;  4OIP F;  2UXX A;  4BHC A;  1AOY A;  4D1Q A;  4PGG A;  1WGX A;  4CSW A;  3QU6 A;  4CZC A;  1BL0 A;  5DUK A;  4CDG A;  1HW2 A;  2IBD A;  1EA3 A;  4MQ9 F;  1FTT A;  1RKT A;  2JRM A;  4G6T B;  1BC7 C;  2HEO A;  2DA7 A;  3GXO A;  4RDU A;  3TOB A;  3I59 B;  4E7Z A;  2RQQ A;  1VTN C;  5K5O A;  1T33 A;  2EIK H;  1LFU P;  3S1Q J;  1KU7 A;  2IRF G;  3I4P A;  4AC0 A;  2E1C A;  5FLX K;  4XLE A;  3HKZ A;  1MH3 A;  1QZE A;  4IO9 F;  2DAO A;  1Q1V A;  4YFK F;  1H88 C;  1BI3 A;  4ESF A;  2Y9Y A;  3LQQ A;  1WJD A;  3OL4 A;  4IVN A;  5DCF A;  1BC8 C;  3WU1 B;  3GFM A;  4NUB A;  4IQ4 A;  1CQT A;  4A12 A;  3S16 J;  2OQG A;  2LRE A;  4EQQ A;  2CUZ A;  1W36 C;  1DDN A;  4JX4 A;  3HUG A;  1WJF A;  1MMN A;  2RAE A;  1D5Y A;  2O3F A;  1UEL B;  3PO3 J;  2ECC A;  1R23 A;  1T6S A;  4BE2 A;  1Z0X A;  5E1W A;  2WV0 A;  2YU3 A;  2N8G A;  3ZPL A;  2MC4 A;  3HGG A;  2V6E A;  2EA4 A;  3PQK A;  5L3C A;  1U9N A;  3HOZ J;  3MZY A;  1W7P B;  2A6H F;  5EGO B;  4M9S A;  4EJO A;  3Q3S A;  3O8H A;  2NS7 A;  1UFM A;  2XRL A;  2RN7 A;  1E3H A;  3KFW X;  2JA6 J;  1DU6 A;  3PSF A;  1LE8 B;  3TO9 A;  5F0H A;  3VYT B;  1J59 A;  3NRV A;  4XID A;  1FYM A;  4A3B J;  1WJB A;  1MJB A;  5KK1 A;  4U0Y A;  1ZHF A;  3RPU D;  5ICF A;  2IPQ X;  5LHG A;  3FZV A;  2G7U A;  3ONQ A;  3BG7 A;  2ECB A;  5JHF A;  1RR7 A;  3ZR8 X;  3I58 A;  3RKQ A;  1H9T A;  4L18 B;  3CLQ A;  1WJC A;  2RC4 A;  3HRM A;  4H0E A;  5J1Y A;  3HC7 A;  4AUX A;  2YS9 A;  4QPQ A;  2Q2E A;  2IW5 A;  3ZCO A;  4O5V A;  2P8T A;  4PSX A;  3IRQ A;  4UUS B;  2FBK A;  5IYD J;  4C30 A;  1EKE A;  1KA8 A;  5IPA A;  3AAF A;  3GTQ J;  3DEU A;  1ETX A;  4XLH A;  1F36 A;  4GFB A;  1ZAO A;  4UNO A;  4EM1 A;  4G7H F;  5E8G A;  4LLL A;  2QA4 I;  2OF7 A;  4UV8 A;  4HZF A;  1WH5 A;  2BHZ A;  2XC7 A;  4LMY A;  3D0S A;  2AS5 F;  2X1C A;  4P1W A;  1ETY A;  2IJL A;  1ZKG A;  4E7I A;  3OYC A;  3DU5 A;  2LSO A;  2BZT A;  1IG7 A;  2GXB A;  3IC7 A;  1S29 A;  4M73 A;  3VDX A;  1V5F A;  1WH7 A;  3KZY A;  4R1H A;  3KYC B;  1QVT A;  3DKX A;  1OFC X;  5DDG A;  3LNQ A;  3F8C A;  2DI3 A;  2F48 A;  5CVR A;  1O4X A;  3A1Y A;  2Z2S B;  3JRB A;  2B63 J;  2K40 A;  1BW6 A;  5DD4 A;  3WU2 C;  3JTH A;  3LAP A;  4UUV A;  4L0Y B;  4L5I A;  3A0H C;  3GZN B;  1EF4 A;  3O2P E;  3UKG A;  1KYW A;  3OIP A;  2ZNY A;  3TDZ C;  2F4I A;  4EV0 A;  4IEJ A;  3ZQQ A;  2K02 A;  2VE8 A;  5HVQ C;  2V1D A;  4PJN A;  2Q0O A;  4XIC A;  4EM2 A;  1X1A A;  4IRH A;  4NC8 A;  2L7M P;  3X2Q H;  3FKI J;  2JPB A;  1FOY A;  4UB6 C;  1GVJ A;  3KPH A;  4M6V A;  1NK2 P;  2CRG A;  3MKY B;  4AYB A;  5K5Q A;  1FLI A;  1B9N A;  5FKN A;  3V4G A;  1G3Y A;  1ZG3 A;  2LC2 A;  4KJZ A;  1I1G A;  2K7L A;  2QBY B;  1Q1H A;  4NB5 A;  1JHH A;  2IVM A;  2MC3 A;  4RB3 C;  1E0E A;  2W4S A;  4A3F J;  2CW7 A;  3RZD J;  5IT3 A;  3CCQ I;  4JQF A;  1FNN A;  5F04 A;  5B66 C;  4GXO A;  1G2H A;  3K4C A;  2DDB A;  1YE9 A;  2PQ8 A;  3H1C A;  1T0F C;  3F6O A;  3CO6 C;  3ABM H;  3BR6 A;  2CG4 A;  2COB A;  3JRG A;  1LUJ B;  2CW0 F;  4CYD A;  1JUM A;  4MFE A;  4GGG A;  3CES A;  3ZQI A;  1ETV A;  1AA7 A;  1AHD P;  5C4X J;  2KIQ A;  2F5C A;  1Y1V J;  3A01 A;  2R7X A;  1J09 A;  4LFU A;  2K9Q A;  2Y30 A;  3AG2 H;  2XB0 X;  3DBL B;  3J80 Z;  1WZ2 A;  2EFN A;  1BR4 A;  2HZT A;  3CLO A;  5AIP A;  4WWC A;  5GPC A;  1HW5 A;  3HYI A;  2MLG A;  4XLN F;  3PIP F;  3J7A O;  2P6S A;  3KET A;  2K86 A;  1Z9C A;  1BBY A;  2ZFU A;  3KP2 A;  1DGW Y;  3GME A;  3HOS A;  2GWR A;  2M34 A;  5E3L A;  3DCF A;  3HTU A;  3JRA A;  1HBX G;  1FOK A;  5HDK A;  5ILS A;  3BZK A;  3HJE A;  3GTK J;  3ROU A;  2GLO A;  5ED4 A;  3KX2 A;  3AG4 H;  2CH0 A;  2CQK A;  2LYC A;  5FB2 A;  3FXQ A;  2P0W A;  1S72 I;  1HKS A;  2W7N A;  2DT6 A;  3P9K A;  1VQO I;  1IV6 A;  3I4N J;  3OYH A;  3K10 A;  3K9T A;  1Z05 A;  3KYL A;  2EJR A;  2I8D A;  1N77 A;  5DYM A;  4OMY A;  2JA8 J;  1PYV A;  3Q5F A;  3S3N A;  2PJP A;  2EK5 A;  1IGN A;  5CVI A;  2BW3 A;  3MVP A;  3WTU C;  2XRN A;  2HQA A;  1UHM A;  3A02 A;  1YRN A;  3RKW A;  1YLF A;  4F7Z A;  1OKR A;  3FHZ A;  2W48 A;  4DBQ A;  4BGD A;  1ZAR A;  2W25 A;  3M8F A;  1H89 C;  1OIS A;  3QPH A;  1DUX C;  2XKP A;  3H5R A;  4M6X A;  3A4C A;  2LF7 A;  3D5R C;  2R7S A;  2DA3 A;  4F91 B;  1HW1 A;  1MKM A;  2XAU A;  3SJM A;  1IUF A;  1HC8 A;  4IHS A;  2CQ7 A;  2IGO A;  1VQ4 I;  4DOZ A;  3L2W A;  2HI3 A;  2LR8 A;  4A3C J;  2P5L C;  4WK8 F;  1OCZ H;  2KZG A;  3Q0W A;  3WTY C;  2PEX A;  4WX9 A;  4JP0 A;  4LJZ F;  5LLQ A;  2OZU A;  2O9L A;  2XRO A;  4ZYE A;  3I9V 2;  1Y39 A;  2XPW A;  2D5V A;  4KIC A;  3OL3 A;  1PP8 F;  1C0W A;  3HL2 A;  1ZG1 A;  1OMI A;  5K7Z A;  3WG9 A;  3B6C A;  3KP4 A;  2HNH A;  2R5Y A;  2DJI A;  1FBQ A;  1LVA A;  3FXM A;  3IH3 A;  4ZYD A;  4II3 A;  1V4R A;  2BXY A;  5H2F C;  4HV6 A;  2ZJ2 A;  4DGW B;  4E7K A;  3QP5 A;  1IDY A;  4ZDL A;  3HBL A;  2FRH A;  1ZN2 A;  3VWB A;  4F92 B;  3WTX C;  4BS9 A;  5JVG F;  4ZDO A;  5J8C A;  3NEU A;  2HZD A;  1XN7 A;  2A68 F;  2E1O A;  2M4K A;  3O8G A;  4XRS A;  2EV0 A;  2F6C A;  4CZZ A;  3HEF A;  3J7Y J;  1D1C A;  3OR2 C;  4G6D A;  1UG0 A;  1TT0 A;  3BQZ A;  1FJL A;  4HBL A;  3QPT A;  4JBA A;  2L9S A;  2JT1 A;  1AKH B;  1MBJ A;  4HNU A;  1M1E B;  1QZZ A;  1OCR H;  2VAS A;  1TQM A;  3IHU A;  3V7R A;  4HF1 A;  4XSZ F;  1A31 A;  1R49 A;  3GTJ J;  4A6D A;  3WG7 H;  2ZJP F;  3ZRG A;  5IYC J;  1CGP A;  3KEO A;  4BJT A;  4DZJ A;  1P2F A;  4ENN A;  3CTA A;  2I5U A;  2ZXI A;  3HSF A;  3KLO A;  2Z3Y A;  4CYC B;  3DTK A;  4X1E A;  3M1E A;  2L9N A;  3EUK L;  2QZ8 A;  5M5Y J;  2HVS A;  3CCE I;  5C44 J;  5E1X A;  3ABL H;  5B1A H;  3HRT A;  2ADU A;  5BOX A;  3BR2 A;  1K78 B;  3U1K A;  4P96 A;  1VQ7 I;  2E60 A;  1IC8 A;  5CVU A;  1YG2 A;  1Z67 A;  2ZCW A;  2F2E A;  2H1L A;  3VYU B;  2KPM A;  3H0D A;  3ECH A;  4LOC A;  1LB2 A;  2YR2 A;  4ON0 A;  1HKT A;  2W1O A;  4YIR X;  1GXP A;  1YYV A;  3PSI A;  2LDU A;  3V8J A;  2HDC A;  1RI7 A;  2NS0 A;  2DOA A;  1XDU A;  2F4O B;  1H8A C;  2MGQ A;  3E1S A;  3CMY A;  4BXU A;  5FKM A;  2HQR A;  3G3Z A;  2P5K A;  5CPR B;  2MBF A;  1W7P D;  3OS0 A;  2QM3 A;  3TOA A;  1O3S A;  2ZXW H;  5FD6 A;  4YRV A;  1D0X A;  2R7T A;  4XKW A;  2R7U A;  2KJC A;  4L5J A;  3R6S A;  2Z9O A;  2D45 A;  4BXF A;  2L0K A;  3HRS A;  3I71 A;  5LFA A;  3GVA A;  3K70 D;  3I4M J;  4IOC F;  4BUP A;  2H6B A;  1WCM J;  3WGG A;  4UUT A;  1MNE A;  3M3Y J;  5AIQ A;  1ETK A;  1KZH A;  1NH3 A;  4A0Y A;  5L3B A;  4AID A;  3OY9 A;  1IRF A;  2KIF A;  4HST A;  1ZK8 A;  2WAQ N;  1EV7 A;  1BIB A;  5C3E J;  2JJ7 A;  3K2Z A;  1R5H A;  2L7F P;  4IKF A;  2ISZ A;  3D5S C;  2NNN A;  1IZ1 A;  2LNB A;  2QGU A;  3RKX A;  2A07 F;  3CUQ A;  3K4J A;  3L2V A;  2MYS A;  1R71 A;  2DLL A;  1KU2 A;  1AU7 A;  1TTY A;  2Y69 H;  4HLX A;  1HLV A;  2HVR A;  5A2Q K;  4IHT A;  5FD5 A;  3BT9 A;  2KFD A;  5HS7 A;  1ZQ3 P;  4EJU A;  4GCV A;  2DT7 B;  2PMH A;  2FQ3 A;  1B1B A;  2VBW A;  3ML6 A;  5J1U A;  1HSJ A;  2VBX A;  3OIQ A;  3BP8 A;  1UAA A;  1SC7 A;  1W36 D;  1TZL A;  2X48 A;  4MHG A;  1QHG A;  2JQ7 A;  2XUB A;  1TQP A;  4MQV A;  1J5Y A;  2WAQ A;  4CCK A;  1IN7 A;  2IGN A;  4RAF A;  1D5V A;  3M7G A;  2DPU A;  2QQ9 A;  2K9N A;  3HG9 A;  3DF8 A;  4YEL A;  2MG4 A;  2VB6 A;  3R61 A;  3RQ4 A;  4B09 A;  1D8K A;  3DLA A;  1JT0 A;  3OR1 C;  1R22 A;  1W0U A;  3MMY B;  3L2C A;  4ZC3 A;  2HQ5 A;  1XGO A;  3MQ0 A;  2QQ8 A;  2K4J A;  5DD8 A;  3MCZ A;  4C3H J;  2AXL A;  4L9V A;  2LKS A;  2HOE A;  2HKO A;  4MTE A;  1YIO A;  2OQR A;  1JUS A;  3TBI A;  5J3L A;  2LTP A;  2TRT A;  2F5F A;  1R6R A;  2L4A A;  1TWC J;  1ZLK A;  4HX7 A;  4L0Z B;  3IAM 2;  4UVC A;  5IY5 H;  1ZR4 A;  1CF7 B;  3GTO J;  1QRY A;  4LB5 A;  1DP3 A;  4PFO A;  4IXA A;  2M7B A;  1YW8 A;  4AYB N;  3OOU A;  3D5L A;  2WB1 N;  3AKZ A;  2DCE A;  2VL8 A;  2OZ6 A;  3C3W A;  1R4M B;  1MBG A;  5TJJ A;  1XX5 A;  4Q4Z F;  2BW3 B;  4XKB A;  3RYP A;  4A5M A;  3WE2 A;  4Y7N J;  2ELJ A;  4RGU A;  2PN6 A;  4ENM A;  1IN6 A;  1UST A;  2K27 A;  3DFG A;  1BN5 A;  4RLF A;  2MD5 A;  2LVS A;  3E5Q A;  4OIN F;  4BY7 J;  5LHH A;  1BA5 A;  1MD0 A;  4WXC A;  2PBI A;  2JVG A;  3QOE A;  2IA0 A;  3VFZ A;  4IHX A;  4NQW A;  4KMU X;  4LGW A;  3O3K A;  1WRJ A;  3HSR A;  2DOF A;  4Q47 A;  3K1N A;  5L3D A;  2EA2 A;  2BY3 A;  2MAB A;  2OCC H;  4LG0 A;  4XBF A;  3JR9 A;  3V8L A;  2PJR B;  4B1R A;  4MLO A;  1U8R A;  3QAH A;  5EGO A;  1LDK B;  2LOO A;  2FML A;  3FMR A;  1YQA A;  3BTJ A;  3I0T A;  4EJW A;  1PUE E;  1OR7 C;  4Z2Y A;  2CV1 A;  2GA2 A;  1FEX A;  1YJW I;  3KEQ A;  3CCU I;  2ZO4 A;  4FE4 A;  1DQU A;  3GEZ A;  1HDD C;  5GP9 A;  2DMU A;  2PI0 A;  3HUG B;  4F52 A;  3EPZ A;  1AWC A;  4AIJ A;  1VQ8 I;  4DZP A;  2HYF A;  4ZJZ A;  3LST A;  1IRG A;  1VQK I;  3G1M A;  3K69 A;  5D4R A;  1RUN A;  4FET A;  1UMQ A;  1T38 A;  5DTD A;  2HKX A;  2Z99 A;  4D5F A;  1I6X A;  2EIL H;  4D5C A;  1MBH A;  1Y0U A;  3S93 A;  5K7H A;  2IS4 A;  2DW4 A;  2RRE A;  4LD5 A;  2QKL B;  2GQQ A;  1A5J A;  4CCO A;  4BHB A;  2K5C A;  3VEP A;  3QPS A;  3I3L A;  1KGS A;  3ZP5 A;  2XF6 A;  3TED A;  2Y2Z A;  3F21 A;  1RIO H;  1KU9 A;  2ISY A;  4LLG F;  4CH7 A;  2VQG A;  2NVY J;  3LSK A;  5KNL A;  3GZ6 A;  1WFX A;  1Z6T A;  3K4K A;  1Z7L A;  2RQP A;  1IN4 A;  1FP1 D;  2YPR A;  3K4M A;  5JLX A;  3CF5 F;  1PDN C;  4A3L J;  1JHF A;  1U0J A;  4C2M J;  2H6C A;  5FLX Z;  1UCR A;  5KVR A;  4N9I A;  1CF7 A;  2XF5 A;  1FBS A;  4D7M A;  1JTX A;  1XTA A;  2QBY A;  2KIS A;  3E6B A;  2UXN A;  3BLY A;  4C2T A;  4MGR A;  3BY6 A;  1BM9 A;  2D1V A;  1LJ9 A;  1X1C A;  3HHH A;  3L7W A;  4M3B A;  1GT0 C;  2VBY A;  3ERE D;  4PK4 A;  1VQ5 I;  3ZGK A;  4XM3 A;  2B7E A;  4RAZ A;  4HSR A;  3G2B A;  3ESW B;  4HA8 A;  3WHB A;  1QQI A;  4BJ5 C;  5M3M J;  1ZG5 A;  2LK2 A;  2FUG 2;  1FC3 A;  2CQN A;  2X51 A;  3VYR B;  1P6R A;  4QPO A;  2CU7 A;  1F43 A;  3W6J B;  4D0P A;  1Y56 A;  3MD2 A;  2HFH A;  2ZXJ A;  1ETQ A;  1BI2 A;  5K5R A;  2E2J J;  3DQV C;  3CCV I;  2ACJ A;  1S7O A;  1XCB A;  3E6M A;  3FF5 A;  3GTG J;  3S3O A;  2DMP A;  4MEY F;  1X1B A;  2JSC A;  2KIM A;  4Y15 A;  2M7A A;  4XNF A;  3SXY A;  3JAM Z;  1UZC A;  2EIJ H;  4Q5S F;  1V3F A;  4A2U A;  4W1U A;  5FLV A;  1SD6 A;  4A3D J;  2O8K A;  5HLI A;  2XGX A;  2WV1 A;  1S3J A;  1O3R A;  1E3O C;  1P4X A;  2FU4 A;  4GRI A;  4A6E A;  2DOE A;  3A01 B;  3L2R A;  1HCR A;  2E7W A;  4XRS G;  2O0Y A;  2OAZ A;  3BJA A;  1K4S A;  2DO7 A;  1N78 A;  2LRD A;  4JX5 A;  5LRS A;  3IH2 A;  1I1S A;  2H27 A;  3BG3 A;  1RKW A;  2X1D A;  1WVR A;  2HPM A;  3HM5 A;  3JRD A;  3E3V A;  2NVU B;  3HOT A;  1QPM A;  3CC7 I;  4ABZ A;  3DXJ F;  5GAE J;  3QYF A;  2E1M C;  2LBF B;  5K1Y A;  3S17 J;  2DA1 A;  4FAS D;  2QCO A;  2UZK A;  4IZZ A;  4Y17 A;  5L3F A;  3OYF A;  3DBH B;  2HQN A;  2VPL A;  2M87 A;  4OMZ A;  1ETW A;  1ORK A;  5DS9 A;  1MND A;  1STZ A;  4MIM A;  4LLN A;  1LFB A;  3E6D A;  2BY0 A;  3L9F A;  2A61 A;  1SVM A;  1FOW A;  3CME I;  3CP2 A;  4M3D A;  3FM5 A;  4BH9 A;  2DYR H;  1HQC A;  5HOD A;  4PSW A;  2EIM H;  2PJR A;  4OIQ F;  1OQY A;  3ZMU A;  1NG7 A;  1P7J A;  1T98 A;  4EAT A;  3V7C A;  4KT5 C;  4PDK A;  3SEZ A;  1TQI A;  1VQN I;  5HDN A;  1UJ8 A;  1H9G A;  4YII A;  3FBN B;  1YX3 A;  1R9T J;  2JPC A;  1K61 A;  2ZBK A;  4KN7 X;  2J5P A;  3P9I A;  3P5J A;  5JR3 A;  1IJW C;  2M0C A;  3M8J A;  4E7L A;  3SYT A;  3T8R A;  4B47 A;  4IHV A;  3AL0 C;  3LSI A;  3MZH A;  2L9R A;  1U6G A;  1G3W A;  3C7J A;  4BY1 J;  1SFU A;  3REO A;  1ETO A;  4B48 A;  2HDD A;  3AL0 B;  1V5G A;  3BZ6 A;  3IV5 A;  3CDL A;  1R36 A;  2PMZ N;  1G6N A;  2FNP A;  3H35 A;  4CO8 A;  2EZK A;  3LQR A;  2DMT A;  3S32 A;  1S8N A;  2G9W A;  1IAW A;  3CD6 I;  2GXG A;  3V42 A;  4CCM A;  2ZME B;  3U1D A;  3CC2 I;  2R7D A;  1TWA J;  5E17 F;  5D6F A;  4A3J J;  2E7X A;  4Z6Y A;  2KRF A;  1LDJ A;  2DMQ A;  1IV8 A;  4MFD A;  4XMY A;  4XLC A;  2HVQ A;  5E3N A;  2DA4 A;  1MDM B;  2QSG X;  1KQ0 A;  1XSV A;  3BR3 A;  2LP0 A;  3FXK A;  1I3A A;  1QBJ A;  2E2I J;  1I50 J;  1YW9 A;  3EDP A;  1U5T C;  1DPU A;  4UVA A;  1A04 A;  2JN6 A;  2EH3 A;  2RVC A;  5FO5 A;  4JK1 X;  1VND A;  2HWV A;  4WXD A;  4A5N A;  5E3O A;  2P7C B;  1LEB A;  5CQE A;  2X6O A;  4EGZ A;  3ASN H;  4QTR A;  4KMF A;  4RM3 A;  1TWF J;  3P9C A;  1YIJ I;  4IPA A;  4C3J J;  4S05 A;  4HX4 A;  3PFY A;  3FX3 A;  4F93 B;  3GWZ A;  1U5T A;  3KIO A;  1P7I A;  3C18 A;  3I55 I;  2E71 A;  3DLL F;  2YUS A;  4DYC A;  2CGP A;  1XDS A;  3AFH A;  1YIT I;  2HYG D;  3FXO A;  4I01 A;  2EZH A;  2WTE A;  2ZB9 A;  4CYC A;  4P55 A;  3S1M J;  4FCY A;  3QU3 A;  3A2K A;  2OCE A;  3ASO H;  2CFO A;  2K9L A;  1MJA A;  2HDW A;  1I27 A;  2Q8K A;  3S1R J;  1FZP B;  2XSJ C;  1OJL A;  4Y4R A;  4G7Z F;  1HA8 A;  3J7A Y;  2EQR A;  4XRF A;  5IOY A;  1JT6 A;  2XAS A;  1FSE A;  4A3K J;  1FT9 A;  2VQL A;  3BR5 A;  1YFH A;  1HDP A;  5LEJ A;  4DBR A;  1SD4 A;  2DFI A;  2W82 A;  3NWT A;  3ZMV A;  3BC8 A;  1KON A;  2QUF A;  2NAZ A;  1O3T A;  1YOV B;  2M4G A;  5DUI A;  5J4V A;  1JUP A;  4BQA A;  3N05 A;  2XKO A;  5F64 A;  1UG2 A;  2MA3 A;  3QQA A;  4RB0 A;  1T8I A;  3OS2 A;  5FKL A;  3M1C A;  4JX6 A;  2PFB A;  4G6Q A;  1W5S A;  1G4D A;  4U88 A;  3IH4 A;  3J80 K;  5FGM A;  2OU2 A;  1BR1 A;  3LSP A;  2V1U A;  4NDL A;  4A3I J;  2NYX A;  3SQN A;  2NNY A;  1FOX A;  3OYE A;  2R5Y B;  2YX7 A;  4RAY A;  2LMD A;  1YS7 A;  4WXH A;  3JSP A;  3CZ6 A;  3Q9S A;  3OYA A;  1NTC A;  4ZYA A;  4HEA 2;  2XAJ A;  2JA2 A;  3I5U A;  1OYY A;  2EZL A;  2CS3 A;  3IRR A;  2VLA A;  2BVM A;  5LGT A;  3HIF A;  1QVU A;  3PUB A;  3GLL A;  2NXN B;  2Y9Z A;  3T8T A;  2VJ5 A;  4HF0 A;  3ZOB A;  1E17 A;  1TC3 C;  2Z1D A;  4L9T A;  1XSD A;  4AU7 A;  1ENH A;  3FMQ A;  3G4S I;  4V2F A;  5DM7 F;  2JRT A;  2QWW A;  5F6F A;  3HHG A;  1ON1 A;  3GTM J;  3JRE A;  2KQR A;  4HDU A;  5D8L B;  2P5V A;  2VQH A;  1LPQ A;  3K7A J;  4L9N A;  1FSH A;  2CW8 A;  2UUZ A;  3H5A A;  1T08 B;  1JJ8 C;  2DA6 A;  2L7K A;  3F8N A;  4XN3 A;  4KUM A;  4BXX J;  2IA2 A;  4ETS A;  1F9N A;  4IHW A;  3DPT A;  1Z1D A;  1GUU A;  2VXZ A;  3ZMD A;  4OIR F;  3A03 A;  3HDD A;  1X2M A;  1VQP I;  1ZEL A;  3QYE A;  2HYJ A;  3F22 A;  3HOW J;  1GXQ A;  3V8K A;  4B4C A;  5IT9 K;  4RGR A;  4CIC A;  2M0M A;  1Z77 A;  3LWF A;  4N9H A;  5J4Y A;  4BNC A;  2PX9 A;  2P4W A;  3DTI A;  3ELK A;  1FX7 A;  4P9F A;  3JSO A;  2JA5 J;  3S2D J;  9ANT A;  4XLA A;  2R7W A;  4BAY A;  1SMY F;  2EV5 A;  1Y6I A;  2QEX I;  3MEX A;  1MMG A;  3VPR A;  1YS6 A;  4XKC A;  3JTG A;  1MDM A;  3MZ8 A;  1R58 A;  3E0J B;  5LGU A;  3CJN A;  4C2U A;  2X4H A;  4G12 A;  4ZTJ A;  1SFO J;  2FXA A;  2O03 A;  1FP2 A;  2K4B A;  4OAZ A;  2HTS A;  4E7S A;  2Y75 A;  1OR7 A;  2FD5 A;  4HG2 A;  1WI3 A;  3OV8 A;  3PO2 J;  3OWT A;  2MLK A;  3DPL C;  2F4M B;  4FE7 A;  3CQZ J;  1R7J A;  4M3E A;  1Z3Y A;  5HLG A;  1FMW A;  3FIS A;  3DV8 A;  3CCR I;  2B0L A;  1FYK A;  3CMM A;  1B8I B;  2VXD A;  3CJR B;  4C9Y A;  3BG9 A;  1MSF C;  5CKT A;  1U5T B;  3F23 A;  1EH6 A;  1R00 A;  2LFB A;  3ULQ B;  4CUG A;  2M8E A;  3BCB A;  5LRR A;  2BE5 F;  1YTY A;  2V9V A;  1ZLJ A;  2HXI A;  3C2B A;  3LMM A;  4AD9 A;  2QF7 A;  4OWR B;  2O61 A;  4ESJ A;  1BR2 A;  2TDX A;  2BVL A;  2OJE D;  5IP7 J;  3BZC A;  3A0B C;  5AON A;  3BPV A;  4DNC A;  4E7J A;  3QYB A;  1U8B A;  4BEH B;  2DK5 A;  4HW0 A;  1LFP A;  4MO7 A;  2XPU A;  2DMN A;  4J01 A;  1J2X A;  1HKQ A;  2P81 A;  3CUQ C;  3H3V K;  3N4M A;  2WB1 A;  5DM6 F;  2OTL I;  4KFC A;  4Y52 J;  5E3M A;  1A6Q A;  2LY2 A;  3ZQF A;  1IDZ A;  5BPI A;  2DOD A;  5FFX A;  2FMY A;  3KP7 A;  5BMZ A;  4LIT A;  5GPA A;  3KYD B;  1R5G A;  3JAM K;  2PMZ A;  3W2W A;  4DYR A;  3FK7 A;  2XF7 A;  5EZH A;  1WJE A;  2R7Z J;  1XB4 A;  5GAG J;  5IT9 Z;  3K1M A;  2X85 A;  4N0B A;  2WWY A;  4IX7 A;  1IF1 A;  4EVI A;  4R8H A;  5HLT A;  1E2X A;  4OIO F;  5BPD A;  5ICC A;  1P4W A;  2WC2 A;  3ZMS A;  4HNT A;  3BJ6 A;  4W97 A;  2XAH A;  2FBH A;  3SZT A;  3IUO A;  3Q9V A;  4XRM A;  1PUF B;  2M5W A;  4YG2 F;  2L01 A;  4BE0 A;  2L5Q A;  4PJL A;  4D7N A;  1Y1W J;  4G94 A;  3ZN0 A;  3WTW C;  4I09 A;  2L3D A;  1SAU A;  1YW7 A;  2NRA C;  1USS A;  3FMS A;  2W00 A;  4OOI A;  2M1B A;  2VIX A;  1EH8 A;  3E5X A;  5LGN A;  1K7A A;  2GA1 A;  3LSR A;  2B9S A;  3FWE A;  2EIN H;  2MH2 A;  4UB8 C;  4V2G A;  5HLH A;  2EFW A;  2KDZ A;  5DV5 A;  3RQI A;  2MD0 A;  2WAE A;  3HPH A;  1BI0 A;  1S7E A;  5D6E A;  5LD2 C;  2DFE A;  3FXJ A;  5BQT A;  5FKK A;  3HTS B;  4C3I J;  1PVE A;  2XV4 S;  3OYK A;  1K78 A;  3DBR B;  1B72 A;  3LSH A;  4I0A A;  1B6A A;  5HS8 A;  1VQ6 I;  2NVT J;  2CWE A;  3GUD A;  3CO7 C;  4BU2 A;  2EWN A;  3ZQL A;  4L5E A;  4BQO A;  5EF6 A;  2RGV A;  1TW3 A;  2WA0 A;  1PP7 U;  3L00 A;  3ZMT A;  3ECO A;  1REP C;  1IXR C;  3QPL A;  3F6V A;  3IAS 2;  1KYZ A;  3NAU A;  5F08 A;  2G7H A;  4U0V A;  3GTL J;  1ULY A;  1ZGJ A;  2EBI A;  2VT3 A;  5ICG A;  1K83 J;  2GM4 A;  2XB5 A;  5EZG A;  1YX5 A;  2A05 A;  1MH4 A;  2Y31 A;  4IRG A;  3S14 J;  3U2R A;  3VOD A;  1BOA A;  3MKW B;  2DDA A;  2BY2 A;  2IP2 A;  3VSL A;  3CDI A;  2Z16 A;  4BKX A;  1VFC A;  1NHA A;  4NC7 A;  4I2O A;  1Y8R B;  2M45 A;  3TDU C;  2XGD A;  3RSN A;  4LB6 B;  4XOT A;  2R7R A;  1X58 A;  5J6X A;  2XAG A;  2DK8 A;  2ZSI B;  4U7D A;  2XSD C;  4G9Y A;  2WAD A;  5HS9 A;  2A5Y B;  5KHD A;  5IOZ A;  3L2Q A;  2V1X A;  2F5V A;  2TCT A;  2ELK A;  1RZ4 A;  5KCM A;  4M74 A;  4BDZ A;  3H3U A;  4V19 K;  2ZXH A;  1PUF A;  1IN8 A;  4HV5 A;  1DU0 A;  3LA7 A;  2FOW A;  2MFZ A;  2XDV A;  5JVT A;  1AKH A;  1LKX A;  4II2 A;  3MFK A;  2X1E A;  3RI4 A;  4NNJ A;  3DPU A;  1U9O A;  1OYW A;  3BRO A;  4KIT B;  3GLX A;  3JRI A;  2H8R A;  3QOD A;  4KN4 X;  2K3P A;  2VKH A;  1T39 A;  2BHY A;  2L9V A;  2EFQ A;  3DP7 A;  2ZJR F;  1XS9 A;  2XAQ A;  3CDH A;  5B5E C;  2CUE A;  3QRF F;  2JUC A;  1RR8 C;  4DIQ A;  4QWQ A;  2OD5 A;  3EUA A;  4DYQ A;  5CVV A;  2Z33 A;  2XVC A;  3F0C A;  4DQ2 A;  4XQF A;  3TKY A;  2FOK A;  3N97 A;  3TP0 A;  1B72 B;  3VB2 A;  2X6X A;  3F72 A;  4EEF G;  2KP6 A;  1MNM C;  3DKW A;  3GFJ A;  1W5T A;  4BBR J;  5GTI C;  1TT5 B;  2RNJ A;  3L1P A;  3H0G J;  3MAJ A;  2IS1 A;  2OTJ I;  4KIB A;  1OLT A;  3WE3 A;  2H8W A;  2YU9 J;  3DWL E;  3F8F A;  4XR6 A;  4ZDP A;  3HB9 A;  1ERD A;  1JGS A;  3SHF A;  3JCU C;  1JGG A;  1XC5 A;  1ODD A;  4IQJ A;  4HOB A;  4RB2 C;  1O7L A;  2A3S A;  1RRJ A;  4AWX B;  2KJB A;  2JMW A;  4O6J A;  4UY8 I;  4S0H B;  3KCC A;  2XAF A;  2R5Z A;  4I6Z A;  1MBF A;  2E36 A;  2X9D A;  2XGE A;  1ZGW A;  5FKO A;  4O3M A;  1O7F A;  2KL4 A;  2HXO A;  4MNU A;  3S2H J;  3IKT A;  3B73 A;  3QOP A;  2HR3 A;  2DBB A;  5HNH A;  1LDD A;  3PL8 A;  3MWM A;  3IL2 A;  1K6Y A;  3S1N J;  5BS6 A;  1JKP C;  3BWG A;  3TGN A;  2ME0 A;  5TRD A;  3BR0 A;  2V4J C;  3E97 A;  1X4O A;  3J7Z I;  1BJZ A;  3LL7 A;  4B8X A;  2K9S A;  2OC6 A;  2OV7 A;  1MMA A;  2JK3 A;  1K79 A;  4UXN A;  4UHT A;  2BGC A;  2LKX A;  5EEA A;  3F3X A;  3KP6 A;  1WKM A;  1SEU A;  3S2W A;  1TW2 A;  2DA2 A;  5KAF C;  2CYY A;  4BE1 A;  3FXL A;  4QIW N;  4ZH4 F;  1XGS A;  2HS5 A;  1SD7 A;  2ESH A;  5EEH A;  3W2V A;  2M3A A;  3KE2 A;  4LK0 F;  4EM0 B;  1JJ6 C;  1ONV A;  2QSF X;  2LF8 A;  3HKZ N;  2OUM A;  1YRN B;  2EB7 A;  4GYG A;  3LSJ A;  5ILU A;  3JRF A;  1D8J A;  2QQA A;  2R4G A;  5LEK A;  2V7F A;  2GXA A;  1HST A;  2DFH A;  5ILV A;  3SDG A;  4I76 A;  1F1Z A;  3HOX J;  4A3E J;  5EJC A;  2NS8 A;  4ZTF A;  2W84 A;  4XN0 A;  4LK1 F;  1R1U A;  4D9J A;  5FFZ A;  1GV5 A;  2A69 F;  3EET A;  2IA1 A;  3K4N A;  4RGS A;  4RGX A;  2H94 A;  5E79 C;  2M9H A;  5JFR A;  2NVQ J;  1SMT A;  3CJT B;  1R1V A;  2NOJ B;  2VOD A;  2D2W A;  4CCN A;  2JTV A;  5D4S A;  3VSK A;  1I6H J;  1VQ9 I;  2L02 A;  2E2H J;  2AXT C;  3M9A A;  4EMS A;  2W24 A;  1SVL A;  1TWG J;  4BHP A;  1QO0 D;  3GFI A;  4RS8 A;  2UV1 A;  1G3T A;  4PJJ A;  1LE8 A;  3EYY A;  3SFZ A;  1V54 H;  3QWL A;  4PUS A;  1MGT A;  1SFX A;  1XGN A;  2V26 A;  4K2E A;  2VJJ A;  3TP3 A; 
#chains in the Genus database with same CATH homology
 1ZGA A;  2ELH A;  3CUQ B;  4ZZL A;  4RB1 A;  1WWX A;  1D3Y A;  1X3U A;  3KZZ A;  4Q48 A;  1WI9 A;  1G3S A;  5HOO A;  3RPU A;  3F8B A;  3H92 A;  2R3S A;  1XD7 A;  1RUO A;  4IJA A;  3WTS C;  1FBU A;  4BYY A;  1O3Q A;  4E70 A;  2VOO A;  1HXD A;  2VC1 A;  2BBY A;  2R7F A;  2GZW A;  1LQ1 A;  1DPR A;  2ETH A;  2VBZ A;  3SZP A;  3COA C;  4YFX F;  3I59 A;  3NQO A;  3LFK A;  2MH9 A;  2DQR A;  2PLY A;  3FM3 A;  5H6R A;  2ZFW A;  3I64 A;  5ICE A;  2RDP A;  4QLC U;  4U7B A;  5DEQ A;  1MZB A;  4YIF A;  1FYL A;  2W57 A;  4GYI A;  1TNT A;  4KIG A;  4PZJ A;  4CXF A;  1JE8 A;  2YX4 A;  3QP6 A;  1IXS B;  3ABT A;  1TBX A;  4WF2 A;  3TO6 A;  4UV9 A;  4I02 A;  3RI4 A;  1MJ9 A;  2QYO A;  4UVB A;  3O6B B;  2OBP A;  4CHU A;  2L4M A;  3IWZ A;  4R79 A;  5LBQ A;  3C1D A;  2DPD A;  3GF2 A;  1WSU A;  2IT0 A;  4OU0 A;  3R4K A;  4EJV A;  2YSR A;  3VOE A;  2H09 A;  3TQN A;  3WGH A;  2J5O A;  5D5U B;  2Z5U A;  1QGP A;  2FEZ A;  2ESN A;  5CYV A;  5DCM A;  1GHC A;  3ISP A;  4IF4 A;  2QVO A;  1F4K A;  2RKH A;  2FA5 A;  1RNL A;  4G8X A;  4ENJ A;  2EFP A;  4KNY A;  2Y48 A;  3F8M A;  1F5T A;  4PGH A;  3BJO A;  4PCQ A;  1SD5 A;  3IKV A;  2GIV A;  5D5W B;  2QLZ A;  1T0F A;  5D5X B;  3U9G A;  2VOP A;  3KP3 A;  5A2Q Z;  3RPQ A;  4M72 A;  3J81 Z;  2DT5 A;  5H6Q A;  5E20 A;  2PG4 A;  4GO1 A;  3KLN A;  5ERI A;  1ZRF A;  5E8I A;  2QEN A;  1P4A A;  2CO5 A;  2V79 A;  3GYH X;  5D8K B;  4L9J A;  3GO5 A;  4P5O A;  1B4A A;  2F5D A;  1SAX A;  4A0Z A;  4KYW A;  3W6K B;  2VC0 A;  2L54 A;  2O8X A;  3EYI A;  3RJP A;  3R0J A;  2VN2 A;  2F5E A;  2C6Y A;  2HGC A;  3G73 A;  2ZME A;  4CGZ A;  3B02 A;  3KP5 A;  3FXR A;  1J75 A;  1ZRE A;  2O6G E;  2STT A;  4M9Z A;  4M9X A;  2FSW A;  4S04 A;  1P92 A;  2V6C A;  3FXU A;  2P6T A;  1LEA A;  4EJT A;  1H0M A;  5E18 F;  2DTR A;  3BDD A;  5H20 A;  1I5Z A;  1T2K A;  3EUH A;  3ZQ7 A;  3ZN1 A;  3J81 K;  1Z7U A;  2VON A;  1S7A A;  4LG0 B;  1ON2 A;  1XMA A;  2CFX A;  2FE3 A;  1J9I A;  5CJ9 A;  1Z6R A;  4MTD A;  4IRI A;  2W85 A;  3LA3 A;  2FNA A;  3ABU A;  4A0X A;  2KIU A;  3BPX A;  3WGI A;  4M71 A;  1J7K A;  1YO5 C;  1BJA A;  3WTT C;  2M30 A;  5CLS A;  4KA4 A;  3BOQ A;  4HQE A;  5E1Z B;  1U2W A;  1QNT A;  1OPC A;  2DQL A;  1DP7 P;  4I7H A;  1W4M A;  3K1P A;  1J0R A;  1FPQ A;  1LNW A;  1B59 A;  3OOP A;  4NHJ A;  1UB9 A;  3RYR A;  4P9U A;  2EFO A;  1IUY A;  2ZKZ A;  2XIG A;  3I54 A;  5J8F A;  1IN5 A;  3CUO A;  5LHI A;  3R60 A;  4ZZD A;  1K6O A;  5CVJ A;  5HDG A;  3T1B A;  4KIF A;  1IXC A;  2D1H A;  3GX4 X;  2HTJ A;  4HX8 A;  3R0A A;  3HRU A;  1L0O C;  3L09 A;  5JHU A;  1OYI A;  2JZY A;  3P7N A;  4ZYH A;  1S6L A;  5DCM B;  3WTZ A;  3LAJ A;  1ZYR F;  2UWM A;  1KQ8 A;  1Z91 A;  3PQJ A;  2A6E F;  4ESB A;  4M6Y A;  1JXS A;  3RIR A;  3RKY A;  3JW4 A;  1L3L A;  3GZ5 A;  1FWZ A;  2EV6 A;  4ZYG A;  3IWF A;  4MEX F;  4YFN F;  3RDI A;  4HLY A;  1U78 A;  3H3Z A;  3WTV C;  4I98 B;  3V7S A;  2STW A;  4HAM A;  1KQ9 A;  4U0W A;  4I0B A;  2DU9 A;  4FX0 A;  1WQ2 A;  2COM A;  2RV8 A;  1SFE A;  3E5U A;  1R1T A;  2QQB A;  3LA2 A;  1UHW A;  1KU3 A;  3GW2 A;  4HYE A;  2FF4 A;  3WU0 A;  3GFL A;  2LKP A;  2GAU A;  1ZRC A;  4G7O F;  2FBI A;  4TV7 A;  2P7V B;  1TLH B;  3PFI A;  1XSX A;  1ZRD A;  2VT2 A;  1XCV A;  5JI6 A;  1TNS A;  2BEO A;  1XGM A;  4FX4 A;  4Y13 A;  2ZNZ A;  4WCG A;  5EEG A;  4ENK A;  2E1N A;  3K0L A;  3TO7 A;  4KDP A;  1O57 A;  2X0L A;  2XHK A;  1W7P A;  2CSO A;  4HF2 A;  3HSE A;  1FY7 A;  2PMU A;  5D5V B;  3I53 A;  1ZH5 A;  3ZMZ A;  4EGY A;  4FHT A;  1XMK A;  5L3G A;  4FT8 A;  4HQM A;  1IW7 F;  5F1R A;  3E6C C;  6PAX A;  2VE9 A;  3T5X A;  3T0Y A;  1B9M A;  2Y0M A;  2BV6 A;  4AVP A;  4ASN A;  1U3E M;  5L3E A;  4AIH A;  2KKO A;  4XSX F;  1QZY A;  3RTR A;  3EQL F;  2BYV E;  3WOD F;  4AIK A;  4HDV A;  2OA4 A;  1EH7 A;  3M8E A;  1BIA A;  4XLP F;  1BI1 A;  4OIP F;  2UXX A;  4BHC A;  1AOY A;  4PGG A;  3QU6 A;  5DUK A;  4CDG A;  1HW2 A;  4MQ9 F;  1BC7 C;  2HEO A;  3GXO A;  3TOB A;  3I59 B;  1VTN C;  5K5O A;  1KU7 A;  2IRF G;  3I4P A;  2E1C A;  5FLX K;  2DAO A;  4YFK F;  1BI3 A;  4ESF A;  3LQQ A;  4IVN A;  5DCF A;  1BC8 C;  3WU1 B;  3GFM A;  4A12 A;  2OQG A;  4EQQ A;  1DDN A;  3HUG A;  2O3F A;  1R23 A;  1T6S A;  5E1W A;  2WV0 A;  2YU3 A;  3ZPL A;  2EA4 A;  3PQK A;  5L3C A;  3MZY A;  1W7P B;  2A6H F;  4M9S A;  4EJO A;  1UFM A;  2RN7 A;  3KFW X;  3TO9 A;  1J59 A;  3NRV A;  1FYM A;  1MJB A;  5KK1 A;  4U0Y A;  1ZHF A;  5ICF A;  2IPQ X;  5LHG A;  3FZV A;  2G7U A;  3I58 A;  1H9T A;  4L18 B;  2RC4 A;  3HRM A;  4H0E A;  2Q2E A;  2IW5 A;  4O5V A;  2P8T A;  3IRQ A;  2FBK A;  1KA8 A;  3AAF A;  3DEU A;  1ZAO A;  4UNO A;  4EM1 A;  4G7H F;  5E8G A;  4LLL A;  4UV8 A;  4HZF A;  4LMY A;  3D0S A;  2AS5 F;  2IJL A;  2LSO A;  2GXB A;  3IC7 A;  1S29 A;  4M73 A;  3KZY A;  4R1H A;  5DDG A;  3F8C A;  2DI3 A;  5CVR A;  5DD4 A;  3JTH A;  3LAP A;  4UUV A;  4L0Y B;  4L5I A;  3O2P E;  1KYW A;  2ZNY A;  3TDZ C;  4EV0 A;  2K02 A;  2VE8 A;  5HVQ C;  2V1D A;  2Q0O A;  4EM2 A;  4IRH A;  2JPB A;  1GVJ A;  1FLI A;  5K5Q A;  1B9N A;  3V4G A;  1G3Y A;  1ZG3 A;  1I1G A;  2K7L A;  2QBY B;  1Q1H A;  4NB5 A;  1JHH A;  2IVM A;  2MC3 A;  4RB3 C;  5IT3 A;  4JQF A;  1FNN A;  4GXO A;  2PQ8 A;  3F6O A;  3CO6 C;  2CG4 A;  2CW0 F;  4CYD A;  4GGG A;  2F5C A;  4LFU A;  3J80 Z;  2EFN A;  3CLO A;  2HZT A;  5AIP A;  4WWC A;  1HW5 A;  3HYI A;  2MLG A;  4XLN F;  3J7A O;  2P6S A;  3KET A;  2K86 A;  1Z9C A;  1BBY A;  3KP2 A;  3HOS A;  2GWR A;  3HTU A;  1HBX G;  1FOK A;  5HDK A;  5ILS A;  3ROU A;  5ED4 A;  5FB2 A;  2CQK A;  3FXQ A;  1HKS A;  3P9K A;  3K9T A;  1Z05 A;  2EJR A;  5DYM A;  4OMY A;  2PJP A;  3Q5F A;  2EK5 A;  5CVI A;  3WTU C;  2XRN A;  1UHM A;  3RKW A;  1YLF A;  4F7Z A;  1OKR A;  3FHZ A;  1DUX C;  1ZAR A;  2W25 A;  3M8F A;  3QPH A;  2XKP A;  4M6X A;  2LF7 A;  1HW1 A;  1MKM A;  4IHS A;  2P5L C;  4WK8 F;  3WTY C;  2PEX A;  4WX9 A;  4LJZ F;  5LLQ A;  2OZU A;  2XRO A;  4ZYE A;  4KIC A;  1PP8 F;  1C0W A;  1ZG1 A;  1OMI A;  3WG9 A;  3KP4 A;  1FBQ A;  1LVA A;  4ZYD A;  1V4R A;  4HV6 A;  2ZJ2 A;  3QP5 A;  2FRH A;  1ZN2 A;  3WTX C;  5J8C A;  3NEU A;  1XN7 A;  2A68 F;  2EV0 A;  4CZZ A;  4G6D A;  4HBL A;  3QPT A;  4JBA A;  2JT1 A;  1QZZ A;  1TQM A;  3IHU A;  3V7R A;  4HF1 A;  4XSZ F;  4A6D A;  1CGP A;  3KEO A;  1P2F A;  4ENN A;  3CTA A;  3HSF A;  3KLO A;  2Z3Y A;  3M1E A;  2QZ8 A;  5E1X A;  3HRT A;  2ADU A;  5BOX A;  1K78 B;  4P96 A;  5CVU A;  1YG2 A;  2ZCW A;  2F2E A;  3ECH A;  1LB2 A;  2YR2 A;  4ON0 A;  1HKT A;  1GXP A;  1YYV A;  2LDU A;  3V8J A;  2HDC A;  1RI7 A;  2NS0 A;  1XDU A;  4BXU A;  2HQR A;  3G3Z A;  2P5K A;  2MBF A;  1W7P D;  2QM3 A;  3TOA A;  1O3S A;  5FD6 A;  2KJC A;  4L5J A;  3R6S A;  2Z9O A;  2D45 A;  3HRS A;  3I71 A;  3GVA A;  2H6B A;  3WGG A;  5AIQ A;  4A0Y A;  5L3B A;  1IRF A;  2KIF A;  1EV7 A;  1BIB A;  3K2Z A;  1R5H A;  2ISZ A;  2NNN A;  1IZ1 A;  2LNB A;  3RKX A;  2A07 F;  3CUQ A;  2DLL A;  1KU2 A;  1TTY A;  4HLX A;  5A2Q K;  4IHT A;  5FD5 A;  5HS7 A;  4EJU A;  4GCV A;  2PMH A;  2FQ3 A;  1B1B A;  2VBW A;  3ML6 A;  1HSJ A;  2VBX A;  3BP8 A;  4MHG A;  2XUB A;  1TQP A;  4MQV A;  1J5Y A;  1IN7 A;  1D5V A;  3M7G A;  2DPU A;  2QQ9 A;  3DF8 A;  3R61 A;  4B09 A;  1D8K A;  1R22 A;  3L2C A;  1XGO A;  3MQ0 A;  2K4J A;  5DD8 A;  3MCZ A;  2AXL A;  4L9V A;  2HOE A;  2HKO A;  4MTE A;  1YIO A;  2OQR A;  2F5F A;  2L4A A;  4L0Z B;  1ZLK A;  4HX7 A;  4UVC A;  1CF7 B;  4LB5 A;  4IXA A;  1YW8 A;  3D5L A;  2OZ6 A;  3C3W A;  5TJJ A;  4Q4Z F;  3RYP A;  4A5M A;  3WE2 A;  4RGU A;  2PN6 A;  4ENM A;  1IN6 A;  1UST A;  2K27 A;  3DFG A;  1BN5 A;  2MD5 A;  4OIN F;  3E5Q A;  5LHH A;  1MD0 A;  4WXC A;  2PBI A;  3VFZ A;  2IA0 A;  4NQW A;  4KMU X;  4LGW A;  3O3K A;  1WRJ A;  3HSR A;  4Q47 A;  3K1N A;  5L3D A;  2EA2 A;  4LG0 A;  4XBF A;  3V8L A;  1U8R A;  3QAH A;  1LDK B;  2FML A;  3FMR A;  1YQA A;  3I0T A;  4EJW A;  1PUE E;  4Z2Y A;  2GA2 A;  3KEQ A;  2ZO4 A;  3GEZ A;  2PI0 A;  1AWC A;  4AIJ A;  2HYF A;  3LST A;  1IRG A;  3K69 A;  5D4R A;  1RUN A;  1T38 A;  2HKX A;  2Z99 A;  1I6X A;  1Y0U A;  2DW4 A;  4LD5 A;  2GQQ A;  4BHB A;  3VEP A;  3ZP5 A;  1KGS A;  3F21 A;  1RIO H;  1KU9 A;  2ISY A;  4LLG F;  3GZ6 A;  1Z6T A;  2RQP A;  1IN4 A;  1FP1 D;  2YPR A;  1PDN C;  1JHF A;  2H6C A;  5FLX Z;  1UCR A;  5KVR A;  4N9I A;  1CF7 A;  1FBS A;  2QBY A;  3E6B A;  2UXN A;  4MGR A;  1BM9 A;  3BY6 A;  2D1V A;  1LJ9 A;  3HHH A;  3L7W A;  2VBY A;  3ERE D;  4RAZ A;  4HA8 A;  1QQI A;  1ZG5 A;  1FC3 A;  1P6R A;  3W6J B;  4D0P A;  2HFH A;  2ZXJ A;  1BI2 A;  5K5R A;  3DQV C;  2ACJ A;  1S7O A;  1XCB A;  3E6M A;  3FF5 A;  4MEY F;  2JSC A;  2KIM A;  4Y15 A;  3SXY A;  3JAM Z;  4Q5S F;  1V3F A;  4A2U A;  1SD6 A;  5HLI A;  2XGX A;  1S3J A;  1O3R A;  1P4X A;  2FU4 A;  4A6E A;  2E7W A;  2O0Y A;  2OAZ A;  3BJA A;  2DO7 A;  5LRS A;  1I1S A;  2H27 A;  3E3V A;  3HOT A;  1QPM A;  3DXJ F;  5K1Y A;  2UZK A;  4Y17 A;  5L3F A;  2HQN A;  2M87 A;  4OMZ A;  1STZ A;  4LLN A;  3E6D A;  3L9F A;  2A61 A;  3FM5 A;  4BH9 A;  1HQC A;  4OIQ F;  3ZMU A;  1T98 A;  3V7C A;  4KT5 C;  4PDK A;  1TQI A;  5HDN A;  1H9G A;  4YII A;  2JPC A;  2ZBK A;  4KN7 X;  2J5P A;  3P9I A;  5JR3 A;  3T8R A;  3MZH A;  1U6G A;  1G3W A;  3C7J A;  1SFU A;  3REO A;  3BZ6 A;  1R36 A;  1G6N A;  2FNP A;  4CO8 A;  3LQR A;  1S8N A;  2G9W A;  1IAW A;  2GXG A;  2ZME B;  3U1D A;  5E17 F;  2R7D A;  5D6F A;  2E7X A;  2KRF A;  1LDJ A;  1MDM B;  1KQ0 A;  1XSV A;  1QBJ A;  1YW9 A;  3EDP A;  1U5T C;  1DPU A;  4UVA A;  1A04 A;  2RVC A;  5FO5 A;  4JK1 X;  2HWV A;  4WXD A;  4A5N A;  2P7C B;  1LEB A;  4EGZ A;  4KMF A;  3P9C A;  4IPA A;  4S05 A;  4HX4 A;  3FX3 A;  1U5T A;  3GWZ A;  3C18 A;  2CGP A;  1XDS A;  2HYG D;  4I01 A;  2WTE A;  4P55 A;  3QU3 A;  1MJA A;  1I27 A;  2Q8K A;  1FZP B;  4G7Z F;  4XRF A;  2XAS A;  1FSE A;  1FT9 A;  1YFH A;  5LEJ A;  1SD4 A;  2DFI A;  3ZMV A;  2QUF A;  2NAZ A;  1O3T A;  5DUI A;  4BQA A;  2XKO A;  5F64 A;  2MA3 A;  4RB0 A;  2PFB A;  4G6Q A;  1W5S A;  1G4D A;  4U88 A;  3J80 K;  5FGM A;  2OU2 A;  2V1U A;  2NYX A;  3SQN A;  2NNY A;  2YX7 A;  4RAY A;  1YS7 A;  4WXH A;  3JSP A;  3Q9S A;  2XAJ A;  3I5U A;  3IRR A;  1OYY A;  5LGT A;  3HIF A;  3T8T A;  4HF0 A;  1E17 A;  4L9T A;  1XSD A;  3FMQ A;  2JRT A;  2QWW A;  5F6F A;  3HHG A;  1ON1 A;  4HDU A;  5D8L B;  2P5V A;  4L9N A;  1FSH A;  3F8N A;  4KUM A;  2IA2 A;  4ETS A;  1F9N A;  3DPT A;  1Z1D A;  2VXZ A;  3ZMD A;  4OIR F;  3F22 A;  1GXQ A;  3V8K A;  5IT9 K;  4RGR A;  4CIC A;  4N9H A;  3LWF A;  4BNC A;  2P4W A;  3JSO A;  3ELK A;  1FX7 A;  4P9F A;  4BAY A;  1SMY F;  2EV5 A;  3MEX A;  1YS6 A;  3JTG A;  1MDM A;  1R58 A;  5LGU A;  3CJN A;  2X4H A;  2FXA A;  2O03 A;  1FP2 A;  2K4B A;  2HTS A;  2Y75 A;  1OR7 A;  3OV8 A;  2MLK A;  3DPL C;  1R7J A;  5HLG A;  3DV8 A;  1FYK A;  2B0L A;  1U5T B;  3F23 A;  1EH6 A;  1R00 A;  3ULQ B;  2M8E A;  5LRR A;  2BE5 F;  1YTY A;  2V9V A;  1ZLJ A;  4AD9 A;  2O61 A;  4ESJ A;  2TDX A;  5AON A;  3BPV A;  4DNC A;  2DK5 A;  4HW0 A;  1J2X A;  1HKQ A;  3CUQ C;  3N4M A;  4KFC A;  5BPI A;  5FFX A;  2FMY A;  3KP7 A;  5BMZ A;  1R5G A;  3JAM K;  1XB4 A;  5IT9 Z;  3K1M A;  4N0B A;  2WWY A;  1IF1 A;  4EVI A;  4R8H A;  1E2X A;  4OIO F;  5BPD A;  5ICC A;  1P4W A;  2WC2 A;  3ZMS A;  3BJ6 A;  2XAH A;  2FBH A;  3SZT A;  3Q9V A;  2M5W A;  4YG2 F;  2L01 A;  4G94 A;  3ZN0 A;  3WTW C;  4I09 A;  2L3D A;  1YW7 A;  2NRA C;  1USS A;  3FMS A;  4OOI A;  2M1B A;  3E5X A;  1EH8 A;  1K7A A;  5LGN A;  2GA1 A;  3FWE A;  2MH2 A;  5HLH A;  2EFW A;  5DV5 A;  1BI0 A;  5D6E A;  5BQT A;  3HTS B;  2XV4 S;  1K78 A;  4I0A A;  1B6A A;  5HS8 A;  2CWE A;  3GUD A;  3CO7 C;  2EWN A;  2RGV A;  1TW3 A;  1PP7 U;  3L00 A;  3ZMT A;  3ECO A;  1REP C;  1IXR C;  3F6V A;  1KYZ A;  2G7H A;  4U0V A;  1ULY A;  1ZGJ A;  2VT3 A;  5ICG A;  4IRG A;  3U2R A;  3VOD A;  1BOA A;  2IP2 A;  1NHA A;  4I2O A;  2M45 A;  3TDU C;  4LB6 B;  5J6X A;  2XAG A;  2DK8 A;  4U7D A;  4G9Y A;  5HS9 A;  2A5Y B;  2V1X A;  1RZ4 A;  4M74 A;  3H3U A;  1IN8 A;  4HV5 A;  3LA7 A;  5JVT A;  3MFK A;  1OYW A;  3BRO A;  3GLX A;  4KN4 X;  1T39 A;  2EFQ A;  3DP7 A;  2XAQ A;  3CDH A;  3QRF F;  4QWQ A;  2OD5 A;  5CVV A;  2Z33 A;  2XVC A;  4DQ2 A;  3TKY A;  2FOK A;  3N97 A;  3VB2 A;  3F72 A;  3DKW A;  3GFJ A;  1W5T A;  2RNJ A;  3MAJ A;  4KIB A;  3WE3 A;  3F8F A;  1JGS A;  3SHF A;  1ODD A;  4HOB A;  4RB2 C;  1O7L A;  2A3S A;  4AWX B;  2KJB A;  4O6J A;  3KCC A;  2XAF A;  4O3M A;  1O7F A;  4MNU A;  3IKT A;  3B73 A;  3QOP A;  2HR3 A;  2DBB A;  1LDD A;  3MWM A;  3IL2 A;  5BS6 A;  3BWG A;  3TGN A;  5TRD A;  3E97 A;  4B8X A;  1K79 A;  4UXN A;  4UHT A;  2BGC A;  3F3X A;  3KP6 A;  1WKM A;  3S2W A;  1TW2 A;  2CYY A;  4ZH4 F;  1XGS A;  2HS5 A;  1SD7 A;  2ESH A;  5EEH A;  4LK0 F;  3KE2 A;  4EM0 B;  1ONV A;  2LF8 A;  2EB7 A;  4GYG A;  5ILU A;  1D8J A;  2QQA A;  5LEK A;  1HST A;  5ILV A;  1F1Z A;  2W84 A;  4LK1 F;  1R1U A;  5FFZ A;  2A69 F;  3EET A;  2IA1 A;  4RGS A;  4RGX A;  2H94 A;  5JFR A;  1SMT A;  1R1V A;  2VOD A;  2D2W A;  2JTV A;  5D4S A;  2L02 A;  3M9A A;  4EMS A;  2W24 A;  4BHP A;  1QO0 D;  3GFI A;  4RS8 A;  1G3T A;  3EYY A;  3SFZ A;  1MGT A;  1SFX A;  1XGN A;  4K2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...