1S2BA

Structure of scp-b the first member of the eqolisin family of peptidases to have its structure determined
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
206
structure length
199
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWEVSITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scytalidopepsin B
publication title The molecular structure and catalytic mechanism of a novel carboxyl peptidase from Scytalidium lignicolum
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase
total genus 42
structure length 199
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1s2bA00
1S2BA 3TRSB 2IFWA 1Y43B 1S2KA 2IFRA
chains in the Genus database with same CATH superfamily
5FZ7A 1K45A 4RN5A 3CEWA 4MADA 3M70A 2XJVA 3ZXGA 3UKTA 1COV2 5FLHA 3E6DA 1DF0A 3VV1A 5JAXA 5IAXA 5EJ3A 3EMRA 4IV1C 4E2SA 1F15A 5A33B 5CBLA 4WM7A 5KHIA 2JE9A 1KJLA 4P9XA 1FV2A 1OLQA 3ZSEA 4AEDA 4AVTA 3N7KA 4LBQB 4P5YA 5CU1A 5F7UA 1E5SA 1IKQA 2Q8DA 4DUVA 1IS3A 2XJTA 5FMCA 3OBRA 1K5MB 3MUZ1 3VD9A 1D4M2 5FMBA 5E89A 3B02A 1CIYA 2Q0AA 2X8KA 4D94A 4RFRB 1BK0A 5GLTA 3MEPA 1LOFA 3MV01 5F1RA 3RPQA 1W8HA 3I2GA 2LTNA 5LEKA 1JZ7A 2GC0A 2D43A 3QH7A 1NLRA 3H0OA 3KVBA 4OZOA 3ZYIB 3V0AA 1W6QB 5JMCA 2X09A 5FFOC 1NXMA 2WN3A 3T2QA 4D7YA 2R30A 5IWFA 1W8TA 1DGWX 5FYBA 5GZGA 2WZ8A 3WHUA 3FMGA 2GU9A 3FLRA 1QJU2 1XQNA 2QQOA 3K48A 5C3RA 4IGQA 4D69A 2WSUA 2WZR3 3GF6A 3PDQA 4LKDA 2QQLA 2DYCA 3AFKA 4D6SA 4Q0VA 4RA0A 2C9KA 4LO6B 3T2TA 3N3HA 1W9TA 1SQ4A 4M3CB 4XABA 2W46A 5FZMA 2OA2A 2ZHMA 4R9CA 4LHNA 1UIKA 4MO3M 5T50A 5JCTA 5FUPA 3WW2A 3WT3A 5IVJA 1WCUA 1QJX1 4QX0A 2Q8OA 5I8TA 4Q4W3 2VMCA 4R4ZA 1NE4A 2RR12 2WABA 5ABJA 5FR3A 1OA2A 1FX5A 2FCUA 3EBRA 2WNVB 4NIGA 3BGAA 4AAXA 4FTSA 2ZGTA 5DG2A 4QQLA 4I3PA 5EWSA 1HRV2 1JUHA 1MR5A 2JDUA 2WIIB 3KCXA 1QU0A 3TNPB 3RI8A 4NOTA 2DF7A 4YW2A 1MS8A 4CDQC 5IYYA 2GN3A 3B7MA 2EIGA 3VDDB 1K12A 2DVDA 2PLV3 3O1TA 1GP6A 3AM2A 5LA9A 1RMU3 2VOVA 1AYM2 4XTMA 2ZBJA 4ZONA 2WQ4A 3VBUA 1W6OB 3ACFA 3UL2A 1DFQA 4BK5A 2D98A 2KD7A 2JDPA 3O1PA 3HNBM 3IMNA 4EWAA 1JYTA 4LIUA 1RJ7A 1I6XA 2IFWA 3S30A 5BY5A 3I3MA 2BOJA 5C7GA 1N1SA 4Q4X1 2ZX3A 4H3WA 2PHDA 4CUGA 1MVQA 1OOPC 1ZBE1 1YI7A 3C7EA 3JB8A 3P5BA 4HKWA 4Q4Y2 4UI9L 4WZFA 4YG0A 4LT5A 5FZ1A 2B9UA 2JG9B 3R05A 1QQP3 2R063 2EF6A 1YJKA 2W08A 1RUH2 5CFCB 4M01A 4JTNA 3FN9A 3A0NA 2K2SA 1UKGA 1ULDA 1RUF3 4A7KA 4QPGC 1H1MA 2B7YA 3ZXKA 5FXXA 4OCTA 5HCAA 2Y6GA 1TVGA 2PTMA 3OSDA 1A78A 2VMDA 2VW0A 3IDAA 3WDXA 2MEV3 2GN7A 2XDVA 1QOTA 5IW0A 4Q8LA 4OULA 1W9FA 1KD7A 2ZXQA 3VZKA 5FXWA 1N3PA 2EXKA 4YYOA 1F9KA 1QF3A 3R0RA 2NN8A 4FPFA 4JGYB 4YVSB 3DN7A 4XXPA 4WBBA 2WS92 2HBUA 2VVDA 2Q5TA 3POBA 2A3XA 3LEGA 3ZMNA 3ZPYA 3HQUA 3HEIA 1GWMA 1KITA 1QH7A 2GMEA 3J7NA 3U75A 4YM1A 4E4HA 5HBAA 1OVSA 3W9AA 3FBYA 5E1RA 1EAH2 2P34A 3H3UA 3OGJA 4ASKA 3DF0A 3AYDA 3B01A 1GNYA 3DECA 2Q1ZB 4W50A 3LGRA 4LA3A 1TEIA 1Z0HA 4M0HA 1VR3A 2EIBA 2JX9A 3BYWA 3NJXA 4ZU4A 5FP4A 5KXCA 1FNYA 4BJ0A 3ZFGC 4DXSA 3C7HA 2X5IA 5FZLA 1PK6C 1YXWA 4CCCA 3K4ZA 1M4WA 1WW7A 1AR63 1ZZ9A 3E97A 4YM0A 4ZU7A 1QXRA 1W9SA 1KXGA 2ORZA 5C4WB 1HB3A 2WLQA 4A6SA 5FQ0A 5JXJA 2ZX0A 3WQ1A 3SHRA 1G9CA 4PDWB 4N53B 1ULOA 2J22A 3WNXA 1W2TA 2VVFA 4BE3A 4HONA 2DURA 4MV2A 1WW4A 1JZ2A 1H0BA 1ZNPA 3DGTA 3V0BB 1PGL2 2IXCA 3VBOB 2YZ4A 1PM7A 3AMMA 3V56A 4BK4A 4N9HA 4SBVA 2H6BA 1OH3A 1QEXA 4PF1A 3WP5A 2VD7A 3URFA 4KWUA 4LKFA 2A70A 2XBO1 3W21A 2XWBB 3WNOA 2ATFA 2VOXA 4PLOA 3ZSMA 1DG6A 3VKFC 3ZDVA 1H6YA 5KC6A 5J96B 2P5BA 4NIHA 3ZR5A 1GP5A 1BYHA 2J1TA 2N7GA 4QPYA 4ZU5A 4F7ZA 1WD3A 1YQ2A 4GXLA 4ZXEA 3DYPA 3GHNA 4NIDA 4LORA 4Q0UA 5JUVA 3DXTA 1ZBA2 3Q8EA 4FVVA 2ZGMA 5FZDA 3T3YA 3POSA 1NA1A 1W6PB 2MPFA 1FPN1 1PZ9A 3SITA 1R083 5A6ZA 2BYVE 5GZDA 1GQPA 4OFGA 1QJY2 1BMV2 1RUI3 2QFEA 2HWB1 1DZQA 3MLJA 4EQVA 5BNOC 5C8CC 2WRAA 3ASIA 3S7IA 1E5HA 1UX6A 5JXIA 1JYNA 1NOVA 3OGRA 4R52A 4RR3A 3DPRC 3APBA 4AGRA 3B9CA 5F9TA 4BOWA 1E5IA 5CFDC 1C8NA 1RHI2 1MQTC 3ILRA 1CPMA 2BUKA 5K0UA 4CUCA 2ZGSA 1JZ5A 2GH8A 4BQ3A 3AYEA 4IV1B 4LR4A 3WF2A 1EY2A 3KF5A 3TB0A 2EICA 3ZX7A 4QKBA 3WDYA 1K42A 1O6UA 2W68A 4QM8A 4CDXC 4TLFA 4B3NA 3O1RA 2ZGKA 3AXDA 1H8TB 3GCWA 3OGSA 2OKXA 1RUD2 3TWIA 4I0BA 1CGPA 1CAWB 2XLGA 3H3ZA 3U10A 3JD71 4QU1A 1ZZBA 1WZXA 3ORJA 1UYYA 2R1DA 2GNDA 5F5QA 4YW5A 2D40A 5FMDA 4COWA 4CCJA 2WNEA 5FWEA 4LHKA 1ZRRA 4FBFA 5A6YA 1MEC1 5DUXA 2WZEA 1PX4A 3DUIA 3U14A 3GZEA 5L36A 2D5FA 2LS6A 2VVEA 4K8RB 1VBB3 2DBIA 1GLHA 1XE8A 5FP3A 1ZA4A 2P1BA 4IL7A 4OHVA 3SCHA 2BVVA 3VL8A 4QX5A 4ITCA 4A7ZA 4HK9A 5BPXA 2JE7A 1WMXA 3NNMA 1OA4A 1Y43B 4EN6B 2HYXA 3HJRA 3JBG1 5A7QA 2DCJA 3HNYM 4TXWA 5B4XA 5FKCA 4CP9A 2R041 1AVBA 1EPZA 2RDRA 1QXPA 1OURA 1DQ6A 1N3OA 2DU1A 1X9PA 3ETPA 3LE0A 1SFYA 4QU2A 2D6KA 1AR91 4KG8A 4CEWA 1RUJ3 5FY5A 3VZNA 1IS6A 3UESA 5F3IA 1OLMA 2J7MA 3SEPA 1WLDA 3RZZA 1TQ5A 3KT1A 3K75B 1W06A 1HB2A 3S5AA 2Y33A 3BTZA 1BHGA 4URTA 2HWD2 1PM4A 3HBZA 3R4DB 5FLJA 3KSCA 5BNQA 4AHXA 1LOEA 1LOGA 1ULEA 2VOKA 3LPGA 5I0TA 5L7OC 3MFAA 5JZGC 1UY4A 1LULA 1AL22 2I07B 4CDQB 3H8RA 3AL5A 4LE3A 2PHUA 3MW4A 3NJVA 4LKSA 4QPIC 4UXAA 1AL0G 2WT2A 4V1PA 3WVJA 2QTWB 4YZ5A 1JODA 3RVHA 2VAUA 4XJZA 3ZSJA 2V5DA 4M3CE 4QD2A 3NWKA 1GBGA 5LZ6A 4C1WA 1EUTA 2E33A 3MLLA 1H2KA 3PNAA 3LOIA 2BWAA 1W0NA 2D44A 3LSEA 2XKOA 4W6WA 4JGZC 5DDJ1 2B5HA 2ZMKA 1WW6A 4FXKB 4CDWC 2MNGA 1L3JA 4DRRA 4FPGA 3USUA 5A6QA 1TME2 3ACIA 4XEZA 1JYVA 1OPOA 1GMMA 4HK8A 1GUIA 4QHZA 4GIQA 4LUKA 3GBFA 3OPWA 4QPGB 1VBD1 4Y26A 4DRVA 1FMD3 1MZEA 4B29A 5HCHA 4YG6A 2VZRA 5A3TA 3N36A 1CAUA 4FPHA 1SBDA 4PLNA 4N90A 4A2UA 4INDA 1PO21 4ARXA 3SNMA 3ATGA 5AFBA 1URXA 3B69A 3NV4A 1AYN1 3AMPA 4LE4A 2GNTA 1BZWA 3HQXA 1OHFA 3IT8A 1HDKA 1N1YA 2IXLA 3MI8A 2GMMA 1S0CA 5LRRA 5SV8A 3ZO0B 5LWBA 1UOFA 1CAVB 1EV12 1VBA2 3SH3A 4YARA 2DTWA 1VP6A 2E31A 4PQ9A 4D0QA 2EXIA 2R7EB 1AXYA 4HPKB 1IS5A 4IV3A 4E9KA 1HV1A 3EXUA 4B4QA 5K7PA 3KT4A 5FYUA 3UYJA 4A3ZA 5C6CA 5FYTA 2CNAA 1W8WA 1AR72 3U4XA 5I0SA 3GM8A 4BH9A 3WG2A 1AX2A 1OFSA 3B5LB 4XF1A 4O9EA 5F3GA 2ARXA 4KMQA 2QBXA 2Y38A 4XCBA 1APNA 3Q9OA 2LUWA 1BLZA 1JHNA 3NAPC 5DXDA 5KHGA 4HVOA 1NG0A 1HQNA 2RM21 2YBPA 1XXNA 1YIPA 1RYYA 3CLPA 2IXJA 3CL1A 2RMU1 4LO4B 4Y3OA 1PK6B 1XNBA 2ZZQA 3IMMA 3T1MA 4V2WA 3AP4A 3LIGA 4WM8C 2PHRA 2CDOA 5J09A 2A75A 3AK0A 2EXJA 4NN0A 4X8PA 4G9SB 5C33A 5J37A 4Y20B 3N7LA 4BLIA 2L9LA 2P6HA 3ZVXA 5FZ9A 2CY6A 4Z2AA 2VCAA 4HETA 1GICA 3IB3A 4YGEA 1MS4A 2Y6HA 1BVVA 3SH5A 4CSWA 3J26N 1AXZA 4HSJA 1Z7S2 4GD4A 4WM7C 1YYNA 2R073 1ODMA 2BP6A 1NX9A 1HRI3 4J1WA 4N43B 2DV9A 4LMFA 4Q26A 1PNFA 2DU0A 1PMIA 2BNNA 4L9BA 2GZWA 1QJX2 1YUDA 2R0FA 3CQOA 4AF9A 4Z2WA 2DCKA 2RDNA 3N9NA 3PLQA 1ZZ8A 1GU3A 1RC6A 5FO7B 3GGLA 4DMIA 2TBVA 1ND2B 1U5IA 4P02B 1R1ZA 1X7NA 3HT1A 4YGCA 4AHZA 2DVBA 2B8MA 4IW3A 3KS7A 4Y1VA 4ZS2A 3WEZA 3PMSA 1LECA 2Y26A 3PIGA 5IJRA 1CVNA 1ND3C 1C3HA 3LA3A 1GYKA 3VBFA 4JRLA 4BB3A 4YFZA 3O0WA 3U78A 4AYUA 4UW6A 1IZ3A 2Q4SA 1LHOA 1SLIA 4WZCA 5EHDA 5KHKA 2XQXA 1G86A 2AC1A 2ID4A 5LA1A 1Q8QA 1PVC3 3GBWA 1W6MB 1WLWA 3DKQA 4AGVA 4CE8A 4IUGA 1VRH2 2E63A 1VAVA 1R092 4Q4X2 2YYOA 4COZA 4UAPA 2WZR1 4YZ4A 5A3MA 2VW1A 1ZBE2 1SLCA 4JZRA 4Y1YA 2WNUA 5A70A 2V72A 5BNOB 5C8CB 1H9WA 4EN9B 4MHUA 1UWWA 1UQXA 3FFQA 1QDOA 4EROA 1LKNA 3THPA 2A6WA 5ABJC 5JLVA 4NPRA 4XJ9A 2ZEXA 5LY2A 1CAXB 2XMLA 5FZ4A 3RJ2X 4RL7A 4Q4W1 2DTYA 3LIHA 5CFDB 1RITA 2R6QA 4GULA 1ZA7A 1KJRA 4Q0QA 1PMHX 3O14A 1O59A 2Q8EA 1VMFA 3E1F1 1PIV2 4JV4A 5EJ1B 4X6RB 5EQUA 5FYIA 1WWYA 4LEJA 3I4IA 3AZXA 2FDHA 3RYKA 1H1IA 1AXKA 1SFPA 2PHTA 2YU2A 4QQOA 3UKVA 2ZMLA 2WYFA 4GH4B 4WVVA 2JDYA 2A3YA 5FZEA 2PLV1 3SCGA 5T55A 4CDXB 4E4DX 4CDUA 5LRSA 5F8PA 1RMU1 4Z1VA 2QZ2A 5FZOA 2FDKA 4KGQA 4CCOA 2O0OA 4IETA 2RDSA 2RS33 1C8M1 1AX1A 5LW9A 5CYYA 1DZRA 2WAOA 3LA7A 2VZ3A 3FHIB 3NW4A 3BUCA 3S7EA 2WDBA 4FPYA 1VAKA 4PI2A 4DEVA 3H8OA 3I59B 3OYWB 4CEYA 4DUXA 4XETA 1PGW1 5GLZA 2ETEA 2WWSA 3M3OA 4LPLA 3ZIWA 1H9PA 1QQP1 2IC1A 2R061 4DFSA 1LOBA 2JKBA 1VALA 4RQPC 5AC93 1RUF1 3VHRA 4BXSV 3IWZA 2C9AA 5FZFA 3D0JA 1OKQA 5A7WB 3AXEA 4XILA 4YFWA 2MEV1 2WFF3 2QCSB 3HAGA 4XZUG 2V73A 1OT5A 1Q3EA 3C8XA 3POYA 5GLUA 3EYPA 4IEZA 3CJIA 5IVVA 1JZ6A 2NMOA 1SLTA 4MUVA 1UAIA 2LM3A 3ST7A 3G7DA 1OF3A 2RHPA 5HCFA 4CU8A 1UU4A 3HN3A 1P8JA 4IGOA 1ULFA 3D0SA 3J8F3 1NUKA 1FNZA 4KNCA 4AWDA 1XNDA 2XBO2 2Z69A 3NL1A 1JYIA 2JDKA 5L7OB 1NKGA 4HG6B 4LK7A 4MXWA 3T09A 3VKOA 5JZGB 1IHMA 3ZIXA 4P08A 5IVEA 3KQRA 3ABZA 4QPIB 2W39A 2LALA 3CMGA 4IEXA 1NYWA 2OPWA 3WNPA 4D7TA 3LD8A 4IE0A 1CN1A 1XYPA 1SLAA 3V65A 5FYHA 5D8AC 3T2OA 2VPVA 1O5UA 4YZ2A 1AR61 2VCCA 1Z78A 4EWEA 2XR4A 1SACA 2C0ZA 5FY1A 2VZUA 1FPN2 2ORXA 5C3QA 3VBHC 4JGZB 1RXGA 2EVXA 4CDWB 3PU3A 4PHZA 4Y5TA 3CF6E 4JKLA 3AKTA 4DIQA 4KWLA 1H2NA 2VCMA 1DQ1A 1OBNA 1LGNA 1ZZCA 3U11A 1IKPA 1GWLA 4KBZA 5CB7A 3WW3A 3ES4A 4AFCA 5FPUA 1FXZA 3HR9A 2HWB2 4BQ2A 4AQ2A 1VMJA 2D3RA 3LCPA 4QX2A 5KHHA 5A3LA 3U4SA 1AHSA 4N9IA 4B1LA 4A44A 2P4EA 2VZVA 4ISQA 4FOVA 4RYDA 5IT6A 1ASJ2 3HT2A 4GJYA 2SBAA 4Y4RA 5HV0A 5CKMA 4I01A 5F3EA 3HIFA 3BPSA 1AR83 1YFYA 1W9WA 3ACHA 3TN93 4MGTA 2EA7A 1WCQA 3IPVA 1W0OA 2EIEA 1ZX5A 3BOPA 3DL3A 2Y64A 3WG4A 1AYM3 1PZ8A 1CZTA 1W2UA 4PI0A 1JI6A 4LOTA 2GP5A 5EJZB 3UGFA 4GJZA 3J7HA 5IK4A 3GNEA 4ZZ8A 1S0EA 2WWJA 4B7EA 4CCLA 2D93A 1UZVA 3ZKYA 4DEQA 4CU9A 1Y3TA 1IPSA 3MICA 2Q8CA 5J7MA 5A32B 3T4VA 2WFPA 3P3PA 5T3NA 1R081 2ES3A 3JD72 4L92A 2RE9A 1W99A 4FPJA 1NCRA 3S6PA 3LFIA 2SLIA 2W2IA 2NZ9A 1AF9A 3NAPB 2DCZA 2W1UA 1FV3A 2JD9A 4LO7A 1RUI1 4P00B 1MEC2 1UOGA 5GLWA 1JBCA 3R4SA 5IK7A 3KMHA 3KLSA 4AVSA 3VBSB 1GWKA 2DCTA 4CXYA 4WM8B 2F6BA 1K5JA 4Y1XA 4NE9A 1O8PA 2P3YA 3VZJA 5JIAA 3QD6A 4O65A 4DXRA 2UYAA 1ENQA 1QH6A 1JN2P 4GAZA 2R0HA 1DQ0A 3JBG2 4TWTA 1HQLA 1MS1A 2QDNA 2WYSA 3HPNA 4AR2A 2R042 2ADEA 2VZSA 2WC2A 1OVPA 4A4AA 4EZ4A 1SPPA 5FWJA 4QPWA 1KDKA 4YM3A 5A33A 2C26A 1AR92 4G4FA 3ZXJA 1LGBA 5FZ0A 1QJZA 4QGNA 2PQSA 2RS13 2ZHLA 3AZWA 3MV11 4P5HA 1XRUA 2VMHA 3O1VA 1UPIA 1CQ9A 5FPBA 1X33A 2HWF3 2NYYA 5ERLA 2YV8A 2JB4A 4XFHA 3C7GA 2PAKA 3O1OA 5JSOA 4NROA 1K5MA 4I30A 3TRSB 1V00A 5BNPB 5ACA3 2NP0A 5E88A 1XSQA 1ND3B 4QKFA 1WD4A 1DQ2A 4BQYA 5IVCA 4E8DA 5F5CA 4TTGA 2YU1A 4BYYA 3ETQA 3NV3A 5DABA 1SBEA 2Y34A 1FI2A 1VBB1 1W6QA 5FY0A 4LBNA 4J6GA 1WMEA 1W2NA 3MF6A 5LK5A 2A6ZA 3K77A 2VBPA 4OMCA 3ZN4A 5FYVA 1N1TA 2H0BA 3MHZA 4XXAA 3BKZA 3OPZA 4FT8A 1LU1A 5APAA 3Q8FA 1WCSA 2W0XA 2GC1A 4CEWC 1W8UA 3M3EA 2UYBA 2BEOA 3N7MA 1SLLA 1CJDA 3HN1A 1WLCA 1UIJA 4HT1T 1RUJ1 4QKNA 2R32A 2XUEA 2JEMA 1F31A 1ZRIA 5ABJB 2UWAA 1E57A 3P3NA 1VBD2 1SBFA 5FPXA 3MW3A 2ZZJA 2C5DA 4JRAA 2WNVA 1SHWB 2VG9A 2VNGA 4GZ9A 3E6CC 5A1LA 4MGKE 2JIJA 4MG2A 1UZYA 1A3KA 4R9BA 1C8M3 1AYN2 2EIDA 2JJ6A 3AP5A 1Q5OA 4WV8A 3X29B 3ZXLA 1WA6X 4AQTA 1BXHA 3CO2A 1AX0A 4N7IA 2PA7A 4H14A 3NO8A 4XF9A 3OUJA 3VDDA 4DOUA 2XHKA 2YROA 1VB2A 4EYUA 4L97A 3BODA 3LAGA 4A41A 5F5IA 1W6OA 4ATFA 5LA0A 1IS4A 3TOJA 3ZXEA 1CZSA 3OPTA 3AZVA 4UFKA 5EIYB 1WCKA 2D6LX 3RRDA 5EFUA 1UL9A 3S0MA 3G6JB 4GMP0 1UN1A 5FP8A 2C6SA 2O8OA 4S2FA 5FYZA 2Y6KA 5DQ0A 5A3WA 3H8UA 4XQDA 2JG9A 2IXKA 2WT0A 2DWRA 1WMDA 5CFCA 1LHNA 2D6MA 3AMHA 2QVSB 3OBZA 4RQPB 1V6KA 2ZTNA 2G9FA 1OXCA 3WF4A 3D8CA 1Q8PA 1FMD1 4LXLA 3WOGA 3VUOA 1F4HA 3CZUA 4OUSA 5L9RA 4AQ6A 3MIGA 1UZZA 1NLSA 1RUC3 2E7AA 3HD8B 2B4KA 3NJZA 2CGNA 2XG3A 2BWCA 4UF0A 2QQPA 4B4RA 2VQTA 5GM0A 3UJQA 1YEWA 3DV8A 5FYCA 2IUWA 1UO9A 2VZ1A 1PHMA 4W6YA 4F8AA 4XUNA 4AI0A 1KFXL 4JGYA 4YVSA 3ZFEC 1W3VA 4C1XA 3ACLA 1Y9GA 3IDEA 4IV3C 1O4ZA 4OHZA 4MSVA 5GZFA 2BGCA 1JTZX 2OW4A 2W92A 2HWC3 3KV6A 2UURA 4PJYA 1W8FA 2H0VA 4AI1A 3FE5A 4ZPIA 4XF4A 4WVMB 4J25A 1JHJA 4JVAA 4UFJA 2ET7A 4NMIA 3OUHA 4FQ4A 2FCVA 1JYWA 1GOHA 4JHZA 3WDWA 5JSPA 1ULCA 3Q8CA 5A7SA 5CZKA 4B7KA 5JOWA 2XVLA 4MXVA 1RL3A 5I91A 2BRTA 3IDCB 1VRBA 1JOBA 2D6PA 5D8AB 5H9SA 4QHBA 2B45X 3ZYRA 1UMHA 4BHPA 4DUWA 4Q1RA 4DXTA 1IPKA 2XQRA 5C4WA 3ITQA 1S0FA 2YMZA 3BVCA 3HOBA 1C5IA 4UW4A 3VBHB 1O4YA 3KV9A 4TSVA 5FREA 3PUQA 4KWJA 3TNQA 5GJ6A 4RGGA 3DCQA 2WZR2 1LR5A 3LQCA 3W59A 2HJIA 3WNMA 4PDWA 4N53A 2UY9A 4I2OA 2BFUL 2JE8A 2R071 3N9LA 4AEJA 5EZWA 3OF1A 5HXVA 3I49A 1HRI1 3V0BA 2WUHA 2E7QA 5D1IA 3MPBA 5BV6A 3VD4A 2Y60A 2HWD3 1HW5A 4Z82A 3POIA 3Q8BA 2JG8B 2ZPXA 4Q4W2 4DPNA 2BU9A 2BTVC 2JDHA 4JAAA 2XJUA 2WN2A 3ZSKA 3T0DA 3Q8AA 3BI3A 2QE3A 3WG3A 2ZS6B 4DB5A 4R4XA 2WZPP 3H50A 5BNNB 4COVA 2E9QA 1LJ7A 1T6GC 2I45A 2WLPA 4IEPA 2XB6C 4YW1A 4WVWA 3WR0A 3JB4C 1IQDC 2PLV2 1RMU2 5JPMB 2GMPA 2YDEA 2D3PA 3AVRA 4IEUA 3TAYA 1G6NA 4COYA 1PVC1 1W6PA 1NY71 1WCDJ 2WKKA 5C5TA 2CYFA 4BM8A 1TME3 4CCKA 3J7LA 2VUAA 5T5JA 2AZ5A 1D2SA 4XAEA 1XJAA 5GLVA 1PGW2 3ACGA 4GA9A 5DG1A 2UY8A 3WSOA 3KVAA 1QQP2 1VBE3 2R062 2OQ7A 2VZOA 4YZ3A 3THCA 1US3A 4IEVA 3USUB 5EV7A 4FPOB 3RMXA 1ENRA 1ZYBA 4XFAA 3OB8A 3ZN6B 1RUF2 1WA4A 4PIZA 4BQ1A 5F32A 4LO8A 4YVWC 5KC5A 1YRZA 3K3NA 3AB0A 2MEV2 1QY4A 4BZ4A 1GANA 2JWPA 4GB33 4LHSA 1EV13 1VBA3 1ENXA 3AP6A 1W8NA 4LLFA 4NAOA 4BLJA 5LATA 4IV1A 2XH6A 1HLCA 3TBDA 1RUG3 1DIWA 3JZVA 4GWJA 3ZFFC 4XDOA 3GALA 1V0AA 1VBC3 1B35A 1SZBA 4QQPA 3H1MA 4QAWA 4CCDA 1RINA 4A3XA 1AR73 1JU4A 5F6KA 3KHCA 1ENSA 1W03A 3ZXFA 5KWRA 1BBT3 1H8TA 1X82A 1YFXA 2RS31 4Q0PA 1TG7A 1CAWA 3ZN5A 1HKDA 3KM5A 1QNYA 5DAVA 3RMYA 3PUSA 1TNFA 3NNJA 3NKGA 3VZMA 2XWJB 3WHTA 1RUE3 2G9GA 1DDLA 4BIOA 3GZAA 2A73B 1LOAA 3POEA 1EUUA 3L2HA 5TSWA 3WQ0A 2DVAA 3WD5A 3GBGA 4X8NA 5BXXA 1BEV3 3UK9A 4AXOA 3O1SA 1FAYA 4OQ8A 2HWE3 3MBWA 1AJOA 4Y5SA 1LESA 4P9JA 4PF5A 5FZGA 4PIYA 1MS0A 2QQWA 5AC91 1AR62 1MZFA 4NRMA 1NZIA 2CWMA 3BTAA 4IGPA 2NQYA 2ZHKA 1DYOA 3H1WA 1Z7S3 4JDMA 4MX3A 3VHNA 5A1FA 5I0RA 5LY1A 2WFF1 4OUMA 4XMIA 4KGGA 4KWKA 2DCYA 2IFRA 3OY8B 2EAKA 2ENRA 1W8ZA 4YW4A 3WUDA 4CEWB 4NHMA 2VGDA 4PT6A 4ES8A 1RIRA 2ZCWA 3A22A 4KI5M 1X8MA 3D6EA 1PGSA 1KFUL 1DP0A 2RS53 3ZR6A 3M8LA 4DNYA 2QDRA 1LGCA 2WA4A 1YI9A 2TEPA 3B00A 3PVNA 4XBNA 5FPAA 3CZJA 4E27A 4D8MA 4D6RA 2WWUA 1DZTA 5IK8A 3J8F1 3GHMA 3IZOA 4O61A 1RUOA 3FLTA 4XZPA 2XJQA 2Y8KA 3VD7A 1W9YA 2CTVA 4P9GA 4Q4V3 3WLUA 1SMVA 2JIGA 4C90A 4JQTA 1UY2A 5EYXA 3ILFA 1RXFA 3WINE 1F5FA 4CDQA 3S5QA 4JDNA 5JI9A 5FZIA 3NNLA 2TUNA 4HXCA 3UGGA 1S0GA 4BIFA 3K4AA 4M00A 4UOJA 4OLLA 1OOPB 5FIXA 3RFRA 3T0BA 4Y22B 4DQAA 3JUUA 4C8DA 1VRH3 2WQZC 3HVDA 4XJ8A 4CU7A 1BCXA 1R093 3CHXA 4IE6A 4KL1A 2FD8A 4BMBA 2W87A 1A8MA 5D2AA 5DAXA 5FYYA 4UT5A 2QQNA 4RHV3 1YFUA 5B4NA 2JECA 2ZGNA 3M2MA 5FJHA 1HXS3 1RVF3 1VE0A 2A3WA 2GC3A 3DKWA 4FFGA 1RUI2 2A6YA 2IZWA 4YGDA 1VPHA 3RZMA 4N8MA 4QPGA 3UKNA 1XNKA 1IGOA 1PIV3 1PMJX 4QT6A 5J36A 4E8CA 4OI2A 5ANQA 3RZHA 2VUCA 2W1WA 2VY0A 2YFZA 1AR81 3NRUA 1JW6A 1PZ7A 3TN91 2FZ2A 4IQPA 3A7QA 4EN0A 5JI7A 4GKYA 2QUOA 3ZFEB 2QQJA 4ZKTB 1TMF3 3VBRC 4BU2A 5AVPA 1AYM1 1CAVA 1U5ZA 2CHHA 1XOYA 3P6BA 4IV3B 5CAZA 2ZKLA 1UY0A 1V70A 2ZMNA 4M4RA 4NPMA 5FLIA 4HPKA 3FHAA 4UFMA 5ANNA 2ILMA 1GZWB 2WBKA 1UZ0A 5G04L 4Z8BA 3H1YA 2EALA 3UGHA 1UOBA 3PVBB 3FX3A 4ORFA 3AX4A 3SISA 5FUIA 1WUVA 2OT7A 3CKHA 3RZJA 5F2SA 1I9RA 4CP1A 5K9YA 4IDZA 1CX4A 5AVAA 2JENA 1LNSA 1GFF2 1PO13 3GDBA 2BV4A 2MHFA 4R9DA 2CAVA 2JXAA 4V2VA 3ZFGA 1F2NA 1MS9A 4CYDA 5M0TA 1PK6A 3QACA 1HN0A 3EJKA 4LIVA 3L9JT 4Q5OA 4UW5A 2DUPA 4AEDC 4LBKA 2VMEA 1MS3A 4Y20A 5DAQA 3V64A 2YUEA 4IXLA 3SMHA 3LEKA 4O7XA 4IESA 1FT9A 4MGQA 2AREA 2Y0OA 1IPJA 1OA3A 3GCXA 4K20A 4QDSA 2AYHA 3AL6A 1JYCA 2VQ0A 1O5LA 4N43A 1V9U3 1RUJ2 3VKMA 4QB6A 1LOFC 2RS11 2GNBA 5FV3A 3ROUA 1SCRA 3B94A 2DUQA 1L7LA 4S2HA 3UNPA 3FFZA 4DINB 2RVAA 3OEAA 1U0AA 2HWF1 5DZEA 1W28A 2J1EA 2E53A 2FBEA 3LEMA 3VN4A 1ND2A 3B93A 3AKSA 2DFBA 2CWSA 1W3XA 5ACA1 4HOOA 1YHFA 4HLTA 2KR2A 5E6HA 2J1VA 3IDBB 2FDJA 4MZUA 4A6OA 3N35A 5FK8A 2PXJA 2XJPA 5LEJA 1O3QA 4UBHA 1V6JA 2YBSA 3HMYA 2H6CA 1Q8SA 3AKPA 4HSLA 3MZHA 2D6NA 1OMIA 3WP4A 1R1A3 3JQXA 4CU6A 3ALQA 5J98B 4YLZA 2P17A 3D4KA 5JXGA 4P9YA 3AMQA 5FOBB 3PVOA 1J1LA 1J1TA 4MVTA 3DPRB 2PHXA 4MGYE 2BNOA 3KGZA 1OLRA 1ODNA 3MO4A 2FCTA 2ZACA 2OZJA 3LEIA 1N47A 1MQTB 2BOIA 5HCBA 4AK3A 1GNHA 1POV0 3MIDA 3WNLA 2F4PA 5BNOA 3I3EA 4X6QB 5C8CA 5CA6A 4QQHA 2AACA 1DYKA 4XOGA 1ASJ3 1RJ8A 4FAGA 5D21A 1YWKA 3E5XA 3I97A 1CAXA 3KD4A 4GMP3 4XBQA 1AZDA 1JS9A 3CBNA 2DFCA 1FMD2 4YVWB 1IQAA 4FOQA 3VBUC 2YPJA 4HL0A 1G7YA 5FPLA 1UY3A 3A4UA 2PFWA 1WKYA 2XVGA 3KQ4B 1H4GA 1W6NA 5IVFA 4LOSA 2W52A 2PHFA 3ZFFB 4W4ZA 2BBAA 4LITA 4XIOA 4YM2A 4GH4A 5IUQA 2Z42A 2X53S 3OOXA 5L9VA 5FZOB 4Y24A 5FUNA 5T52A 5T5PA 4CA9A 3A0KA 5DZGA 1JOPA 1UXXX 4CDXA 4CCMA 4XACA 3E5UA 3HBKA 4I02A 4EN8B 4HVQA 3LA2A 3CDZB 2NMNA 1FOD3 2BERA 4OI0A 3QOPA 1LCLA 2W1SA 4MLOA 1GNZA 2CAUA 3UETA 2XL7A 2VM9A 3I59A 3OYWA 4NRQA 5E16A 3W5MA 5EPAA 5JR7B 3VDBA 2JG9C 1COV3 2ZAHA 5T5OA 4UW3A 1UNBA 1U5YA 4N7UA 5FK7A 5A7OA 4FSJA 2ZOEB 4JKMA 4BMEA 4CZSA 1N1VA 1UXZA 3LSDA 4PBPA 4ASLA 2W9XA 1UMZA 1QKQA 1Q56A 4LNVA 4L2NA 1JZ4A 4CXWA 2WQ8A 2NLRA 1ALYA 3PJQA 2QJVA 4XVHA 5A7WA 2DVFA 1RUC1 2ZKNA 3IAPA 3PURA 1TNRA 4DS0A 1D4M3 3ZMOA 1T2XA 4YVSC 4W8JA 3AP7A 3LF7A 3RGBA 2PHWA 1GOGA 5FXZA 2R072 1CONA 1HIXA 3MIFA 2BDRA 2G4IA 2ZGQA 1HRI2 3OG2A 5F5AA 3T0AA 4ET7A 4AVBA 1MPXA 2P3JA 2V5YA 3LWCA 4A7YA 3FHQA 3D82A 4OHWA 5K8SA 2HWC1 5DAPA 1AJKA 4TZDA 4EN7B 3AYCA 1Y9QA 4ISRA 4NIAA 1VLNA 1GP4A 1X8EA 2PQQA 2X5IC 1ZVFA 3BPZA 4L99A 4H7LA 4XFFA 3B9IA 1XB9A 5DUVA 3FWEA 1QJU3 4H55A 1YQ6A 4FXGB 4XJAA 3T30A 3WCSA 5IFPA 5JWPA 5L7OA 2RJ2A 4IEWA 5JZGA 4QX7A 2YB7A 4URAA 2BZDA 4OI4A 3U0ZA 1CJPA 5F2WA 3O1UA 3FL7A 4RS5A 1CIWA 1Y9MA 3WW4A 2OS2A 1OLME 2WNOA 2UWCA 1H2LA 2BFUS 2LRPA 4YSFA 3DEMA 2JB8A 1PVC2 3FZ3A 2FDIA 2RR13 4KH9A 1YC61 1J83A 2XKPA 5SV5A 1OH4A 4AEKA 5C3PA 1LEDA 5GALA 3J7MA 1Y4WA 5K4LA 3M7AA 4AW7A 1HRV3 2ZGLA 3KCCA 2VMIA 5FAXA 2O14A 1OKOA 4LQRA 4BQWA 5DUWA 4QGMA 3USSA 2W3JA 3BALA 5CKNA 2AEYA 2P3KA 2Q1FA 1QOOA 1N3QA 2WA3A 5HV4A 1MZ6A 4FFHA 1DYPA 2BPA2 2HWD1 2C1FA 3MIEA 5L73A 5FY7A 4IE4A 3VD5A 3THTA 2YPDA 4XTPA 4BWOA 3IBMA 3J9SA 5FO9B 1UU6A 1S0IA 1XNCA 4AGGA 3TEZA 1NA1C 1BK1A 1DHKB 4HZFA 1ONAA 1QMJA 1OQDA 2VXRA 3D3AA 1NQDA 4NO4A 5C9AA 3VBRB 1J3PA 4XBLA 2Y0IA 1VJ2A 4Q4Y3 3KHBA 4XUOA 3AJYA 5CEHA 3BU0A 2GNMA 4C0HA 4OHYA 4AOCA 2G9ZA 1C1LA 1RUH3 1DGRN 2PAMA 2VOWA 5A80A 3JXSA 1H2MA 4LA2A 3T1LA 5FYSA 1UKRA 5FZHA 3DXUA 4MGIE 4LK6A 4RR3C 2PAEA 1NCQA 3O0XA 3BIWE 2GP3A 4FFIA 4CPBA 5A32A 5JOYA 3SLIA 1EYBA 1TME1 1BVP1 4YPJA 4XUQA 2C4XA 5A3PA 3WF3A 1O3RA 5B2GB 1XPWA 2XJRA 3NAPA 3AMNA 3VKLA 3I2DA 3M3CA 5K0UC 1NXD1 4I09A 4NAMA 3VBSA 1VBE1 1LB2A 4WM8A 2WS93 4WM7B 1KRIA 4FPEA 4AEDB 3OBAA 5CKQA 1U12A 5AC92 4DY3A 2RDQA 4HKOA 3IIAA 3C7OA 4RFT0 1U5XA 3LFMA 4NR1A 5C5UA 2OX0A 4LBQA 2WFF2 1SPPB 3H8XA 4KU8A 1EAH3 2D5HA 1A8DA 4GB31 3RYRA 1EV11 1VBA1 2VMGA 3LDKA 4NPLA 3VHOA 3WDTA 1XNTA 5FY9A 4EV0A 4PQQA 1B35C 2OZ6A 1RUG1 3RI9A 4AVVA 1Q8OA 4HKLA 1UX7A 3RZLA 1VBC1 4J1XA 2CU5A 5JMOA 3F95A 2OXBA 2XL9A 1H8TC 2ARAA 1ZZ6A 2RJLA 4FOYA 1AR71 3PUAA 2RJKA 3POFA 3V0AB 3BB6A 2VZTA 4JKKA 4XPVA 1BBT1 4Y4YA 5ISLA 2HLEA 3I2JA 3WF0A 2ZABA 4ATEA 3TYJA 3J8F2 1KS5A 1QJEA 3MIHA 5BNPA 1WW5A 3GJBA 4XDPA 5FMOL 2DDUA 3JQWA 1RUE1 1ZZ7A 1GZCA 1ND3A 4XF0A 1CZVA 4CTEA 2ZA9A 3MGUA 4JX0A 4XQWA 4IERA 3WDUA 4AI3A 1NZCA 5L19A 1JMUB 1GQGA 5DDJ2 1BEV1 1S55A 4AFDA 4QX3A 5G05L 4A42A 1HQWA 4NIIA 2HWE1 5I0DA 1NE6A 3FC0A 4R9AA 3O12A 2QQKA 2W91A 2ADDA 2HYKA 4M3CA 3QCWA 4S2DA 2VC9A 1S2BA 1W8OA 2Y6LA 4NHLA 5LBEA 1DQ5A 1DQ4A 1DU3D 1UW8A 4HN0A 1Z7S1 4LBMA 5A7NA 3WV6A 4ZXKA 4PBOA 4XYXA 2VZPA 2NM1A 3NV2A 1PO22 1S0BA 1YFWA 3ZPOA 5A6XA 4QDRA 4OQ9A 1O3SA 4FP3A 3LPFA 5IVBA 3NV1A 4DXZA 1CX1A 2RS51 4COUA 1HB4A 4TLGA 4QX1A 5CISA 4GWIA 4KU7A 4QMAA 5E8AA 1QIQA 5FZAA 2KXLA 1RGSA 4Y5Z0 3VBUB 5HXMA 1ZBA3 2VW2A 2K0GA 3AKQA 1D0GA 2VCBA 2QZ3A 5H9PA 3R6SA 4FAHA 2QQUA 1PVXA 3DYMA 4OYUA 1AR82 4AFMA 1OD5A 3H3LA 3E6BA 1DLCA 3LDBA 3I8TA 4LBOA 4MGSA 4Q4V1 4XHBA 5FZKA 3TN92 5GZEA 3AC0A 3LKJA 1ZM1A 2IVJA 3N4MA 1QJY3 4QB2A 2HEYF 3AZZA 3NNGA 1BKZA 4FO9A 4M0NA 4B1MA 1KDMA 2ZEZA 1ZRCA 4K8FA 3QLQA 2IXIA 5DUUA 5A3UA 3W58A 4FOWA 3OTFA 3PU8A 1VRH1 3WQBA 1R091 2RM22 5LB6A 1J3QA 2RMU2 4NUBA 1F5JA 2BGOA 4EJRA 3U1XA 3ZM8A 1RHI3 3VL9A 2R16A 4NVPA 4HVRA 3RYPA 4ASMB 2KA3A 2J1AA 3FBMA 4RHV1 1IG3A 2Q1MA 2Y6FA 4SLIA 4AFBA 2XVKA 3ZLIA 1YJLA 1HXS1 1RVF1 3J4UH 3E5QA 1KGYA 4OI1A 4QQ2A 4FPCA 1J84A 1YO8A 3NSTA 4RQPA 5F3CA 2VTFA 2RV9A 2ARBA 4K1ZA 1SDWA 1VMHA 1D2QA 1PIV1 4UF0B 3K3OA 4MH0E 1RUD3 3ZXDA 3JCIA 1OUSA 2B9VA 3MIBA 4DO0A 1OPMA 1OQEA 4JTOA 4MOAA 1JYXA 5IK5A 2DBNA 1YNAA 4W65A 5DN2A 1JH5A 1UY1A 2ZX1A 4CVUA 1WGPA 1TMF1 3OUIA 4HANA 1PX3A 1VAMA 3ON7A 1HN1A 2VOTA 3DYOA 3PTRB 2Q30A 2RS12 2VZQA 1F35A 3ILNA 5JXHA 2HWF2 2X5IB 1LHUA 1UYXA 3AKRA 4WVMA 4Q27A 3UT0A 4BXFA 3AJZA 1UF2C 5LCWL 1O3TA 4K21A 3L2YA 3H42B 5T5LA 2WL1A 4LHLA 2YBKA 5FZ6A 2OQ6A 5HI0A 5ACA2 4CUBA 2P37A 2ZX4A 3U07A 4AE2A 3VGIA 3KF3A 3ZKUA 5BYNA 3N9QA 1LEMA 1L7QA 5FQ0B 1I5ZA 3ZFGB 3W5NA 1STMA 2D6OX 3ZYFA 1OC1A 3NKTA 4P9IA 1QDCA 1PO11 3WDVA 3KGLA 5D8AA 4HMZA 1G9DA 1D7PM 3VDCA 2G19A 1H6XA 3OD0A 1MACA 3OGGA 2A1XA 5FZBA 4CCNA 2R49A 3VBHA 3TEYA 2PHLA 4GKXA 1OI6A 4XFIA 2FMYA 3VBOA 4XMAA 5EYYA 3VZLA 2ZEWA 4LLOA 3M3IA 2QQMA 2YGLA 4N43C 1I5PA 1UCXA 1AL23 2W1QA 4G3YC 4NHKA 2GC2A 4QXCA 1H8VA 1V9U1 2WO2A 3VBFC 1Q8VA 2E26A 1C5HA 1W2OA 1A6CA 4H2AA 5FP9A 2JDAA 1ND2C 2JG8A 4YW3A 3QBQA 4XIKA 1POV3 4CCEA 2ZHNA 3O1MA 5DPNA 2BBVA 2W94A 4FFFA 1NA1B 2J1UA 2WO1A 4Z07A 5FP7A 3H7JA 1V6OA 2QKDA 1C8M2 5BNNA 3INAA 3PL0A 4H7MA 3RWNA 4F83A 1K3IA 1CWPA 1Q43A 3SKJE 1UPSA 2WNUC 3RWKX 4XJUA 3KV5A 1R1A1 1RTVA 3IAQA 1IG0A 5BUVA 3GZTB 5CADA 5JPNB 2ZAAA 4AI9A 3RQ0A 2WR9A 3ME2A 4RR3B 5A1AA 3SCFA 1C4RA 5H9QA 1HJGA 4BQ5A 1XC6A 1DLLA 3PJYA 2PELA 4ARYA 5AFEA 2AR6A 4XUTA 3BTYA 1EPWA 1X50A 4AHYA 5K0UB 2FQPA 2QQIA 3ZDSA 3WG1A 2V4AA 2IWGB 2W95A 1JU3A 1DGWA 1XYNA 1ASJ1 2VL4A 1ACCA 1C28A 2JDNA 2VBBA 4W6XA 4GMP1 3U37A 3ZN6A 3ES1A 5GZCA 3UV9A 2BNMA 1ZREA 4CDUC 1YQ8A 3I3QA 3ZOIA 5LK7B 4KBBA 5CNAA 1YIFA 1RUC2 3EHKA 2ZX2A 4AI2A 3MF9A 1LRHA 1PNGA 4YW7A 5FY4A 2ET1A 2D7FA 1SG3A 1MZ5A 3POGA 1BJQA 1S4CA 1E5RA 2YC2A 3HQRA 4GH4C 3W20A 1B35B 2YY1A 5CG9A 5C8WA 3CIHA 4HBNA 1UU5A 1O4TA 2XLAA 2VMFA 4L0PA 2I74A 4CEYC 1W05A 2WAAA 5FO8B 1H4HA 1T6BX 3EB7A 4I0WB 1F4AA 3BIEA 3D5OA 3PUIA 4P9LA 4IE5A 1OD3A 2HWC2 3AFGA 1D4VB 5JOXA 1XE7A 3RZKA 2EAAA 4IEYA 5JR2A 4FTEA 1OSGA 1FOD1 2PN5A 4QXBA 2P3IA 3FLPA 4GWMA 2JDMA 4NWWA 1HJFA 1ST8A 4RGAA 5LBFA 4XDQA 4CP9B 5FY8A 4AVAA 1RB8G 1NQJA 1COV1 3MYXA 4XC9A 2LW8A 1QGLA 1HB1A 4E2GA 3I2OA 3CJIC 1GOFA 5C3OA 1GV9A 1X9TA 4Y1ZA 2ZJCA 4FI9A 5J1XA 2B42B 4S2GA 3K46A 1QJX3 1XSRA 1Y7BA 5J3UA 1CD3G 1LODA 1UYPA 2O8QA 2ARCA 5FKBA 3S57A 4U36A 3VD3A 1SCSA 2GALA 4UFIA 4JC1A 4YRDA 4K1YA 1D4M1 2D3SA 3F2ZA 4L8QA 5JVVA 2WO7A 3MDPA 3OY8A 4NRPA 4HN1A 4NJ4A 1D0HA 2B46X 1JXNA 1G9FA 1CR7A 5L9BA 2VQAA 2CL2A 4PLMA 5IVYA 4XCAA 5LASA 1NT0A 2FMDA 1NLQA 3I2KA 1XBFA 2ERFA 2VU9A 3HNMA 1LHVA 2WINB 2YG0A 5IAVA 3FUOA 1O8SA 1V6LA 2YHJA 5CIRA 3ZYGA 1IOAA 4YNIA 1ZRDA 1GKBA 2BW8A 3A21A 1QJU1 2YC4A 3IIIA 3RDIA 2ZEYA 4Q4X3 2QNKA 3I54A 1FATA 5F39A 1WLTA 4AZZA 4DZGA 1UD1A 4C91A 5FBJA 5FOJB 3M3QA 1ZBE3 3OGVA 4P9WA 5H9RA 2YXSA 4LBLA 4RS5C 1R082 3CJXA 3GZUC 4XFBA 3WP3A 5KHJA 1H30A 1OOPA 1KS4A 4Y22A 4GALA 5IFTA 1ZRFA 1WBFA 1S0DA 3BCWA 2XLFA 1V6IA 1QJFA 2XJSA 2FZ1A 1LENA 1L7RA 3RNSA 2RR11 2A6XA 4LKEA 4RGKA 4EZHA 3ZYPA 3IM0A 1POQA 1CAUB 5FTTC 3TEXA 1G9AA 1HRV1 3WW1A 2YC0A 4R8HA 1TE1B 3P1IA 3WF1A 2F17A 5DZFA 1VBE2 1A34A 4B8EA 1QWRA 1LOCA 2HEVF 4QGLA 1WMFA 4XFCA 2VNOA 5FJKA 3SKVA 1ULGA 3I7DA 3PTYA 2XGXA 3M4FA 4JCKA 1V6MA 3C2UA 2Z79A 3ECQA 5KBFA 2VUJA 1VB4A 4B4PA 1G8WA 5J48A 4AG4A 1W0PA 3PMEA 5GKAC 2VH9A 2RG4A 1R64A 1UMIA 5C9AC 2C24A 4D7SA 3JU9A 3OEBA 4GB32 3ZFEA 4UWDA 4ZS3A 1MS5A 4D3WA 5FCCA 1NCRC 1RUG2 2XONA 1XNAA 4U2AA 1HX6A 4RSUA 2XUMA 4Q4Y1 2NPIA 2A5ZA 1JZ3A 2I2SA 3NMBA 1VBC2 5A3OA 2A7AA 1GZWA 4IE7A 4FP2A 1RUH1 5JSRA 2FHRA 1KQRA 3SC7X 1KEXA 3I3BA 1REDA 2E7TA 1BQPA 1NCQC 2OUJA 1BBT2 3N9MA 2FDFA 1YQCA 4XFGA 4Y33A 2A71A 1VBB2 4Q29A 2CSGA 3H7YA 3VHPA 1O91A 1REEA 3T4HB 2F4LA 3NNFA 3C3VA 1RUE2 1GZ9A 4YW6A 2JICA 2E51A 3THDA 4Q0SA 4AEMA 4QB1A 2AEZA 3VBSC 4NHYA 1BEV2 1OFNA 3T08A 3WQ7A 2O1QA 3CNAA 4QDQA 4QX8A 5I8SA 2PMWB 2HWE2 4IEQA 2Z2SB 4AFAA 1GQHA 2WS91 4XHXA 1W04A 5C70A 4TN7A 2UU8A 4K40A 4LULA 5A3NA 3KT7A 2P6CA 1DCSA 4AAPA 4Q8KA 3ELNA 2XBO3 1OQ1A 1UZWA 1K5MC 2E32A 3O5SA 4XAAA 5LBBA 1W2AX 3KWVA 1EAH1 3VZOA 4EE2A 2LROA 2VTXJ 4DY5A 1CESA 1M06G 4M4PA 2AUYA 5I0UA 2VJXA 4ZZ5A 1S2KA 4UBGA 5FMOS 1LTEA 4LUMA 3WCRA 4E2QA 3IN9A 2RS52 3VBFB 2JKXA 2WJSA 4EWDA 3IKWA 2Z4FA 4CRQA 3PHMA 4FQZA 3SXWA 2Z5WA 1H1AA 5BNPC 4KG0A 5LA2A 1B09A 1TZOA 2CV6A 2R1BA 3N7JA 1JOJA 1FPN3 2AENA 2A6VA 2OUHA 1QOSA 3R4UA 3ZYHA 2AGSA 4Q4V2 1W6MA 4MHRA 1O7FA 1QNWA 4K6BA 3BU7A 2K46A 2TNFA 1XU2A 4NWVA 2WNUB 5KXBA 2J1SA 2HWB3 4BDVB 2EXHA 4YZ1A 5FYMA 4K9SA 2V4VA 1QXJA 2CDPA 4FPLA 1PGL1 3WXPA 2ZGUA 3N9PA 3T2PA 2VBDA 3H9AA 3POJA 2BQPA 1SEFA 2GDFA 1OF4A 5FPVA 2VULA 3EO6A 3NJYA 1S0JA 3DPRA 3O7OA 2WNVC 3WNKA 2ZGRA 4BQXA 4E4SA 1YCIA 3QH6A 3POWA 4RHV2 4TYSA 4XW3A 5LBCA 5CFDA 2OVUA 2V09A 1MQTA 3WUCA 1SDDB 1HXS2 2HKXA 1RVF2 4CP2A 2CGPA 5A7PA 5IATA 1S1AA 5FZ3A 3A23A 3M1HA 4K7JA 3AYAA 2JD4A 5JIUA 3SH4A 2W5FA 2VNRA 3I2IA 3NQHA 3VDDC 2X05A 5KR7A 4CDUB 2ZGPA 4YVWA 2VECA 4Z92B 1YQ5A 1FYUA 1ZBA1 5C3SA 2BGPA 3VKNA 3LOBA 1W6NB 4Q2FA 4L11A 3WP6A 4BISA 1HV0A 2IVIB 2P2KA 2PYTA 3ZSLA 3RJRA 3JD73 5KXDA 2QQVA 2UWBA 4AL9A 4LTAA 3ZFFA 4KQ7A 3VDAA 4FPKA 1TMF2 3MLKA 2XOMA 2DVGA 3MW2A 4META 3EQEA 3PIJA 4CEYB 1QJY1 4Y1UA 3K51A 1BMV1 1MEC3 4Q1PA 3LZZA 2DUOA 4YGBA 2WSVA 3GJAA 3KV4A 4GQ7A 4RD7A 3MUY1 3OJBA 5CFCC 3AVSA 1J58A 4PIXA 5FDBA 2OYZA 3B3QE 4P14A 4JDOA 1ULPA 2GAUA 1C1FA 2XHNA 3JBG3 1RHI1 1DGLA 1W39A 3KCYA 2AH2A 3HWJA 4XQ4A 3RG0A 2XXZA 3NVCA 1EP0A 2HEWF 2R043 3I2HA 3C7FA 2VUDA 4GWNA 4FCAA 2CGOA 4YG3A 1LAJA 4BPZA 2IXHA 3BN6A 2X10A 3WZ1A 3OBTA 1PO12 3CJIB 4XE9A 1AR93 4JGYC 3RS6A 4OZXA 2YFUA 2WT1A 1AUYA 1GR3A 5F37A 2W47A 3BOWA 4WVZA 2GH2A 4CPBD 4FTBA 4JQRA 1X36A 2K9ZA 2WO3A 4HFSA 3CU7A 3ZXAC 4BQ4A 1RUD1 4PCRA 4UFHA 1OUXA 1UYZA 2VTXA 4QHOA 5FRAA 2XPJA 1RUNA 4K3UA 3LB9A 4MXWB 3UJOA 1I1EA 4OHXA 5I8YA 5CVRA 4UYBA 2FDGA 3ZYBA 1V9U2 4LBJA 1W90A 4MGZE 2VO5A 4QKDA 1UOJA 4QPIA 4CXXA 4QXKA 4AI8A 2B39A 4XJWA 2Y6JA 2JDZA 4LBQD 2X29A 3K2OA 4D6QA 3RSJA 5EP9A 4XURA 5C4WC 4O9GA 1I3HA 4I3GA 3AZYA 5DAWA 5DDJ3 5FBZA 1GZTA 2VNVA 3VB9A 1NY72 3FUQA 5JOZA 4ZHNA 4JGZA 4RS5B 4CDWA 4YWAA 2BVBA 1JUIA 1J3RA 1J59A 3SEEA 4I0AA 4PDWC 3GYDA 4N53C 5EXOA 1V6NA 1F8VA 1WBLA 1R1A2 1GSLA 2VXJA 4AHWA 2YGMA 3K4DA 4LJHA 5DMYA 1VBD3 4OMDA 1XE0A 1C57A 3OCPA 1YLLA 4ES9A 3VBOC 1LHWA 3SQOA 4UFLA 1PO23 5FZ8A 4F3JA 5IHRA 4CP0A 3RZGA 4M3CF 4ONUA 3PUHA 3BTXA 2VQUA 1AYN3 3LDRA 4BCUA 1MVEA 3IPVB 2BJSA 2J42A 5I93A 3I2FA 1AL21 3WX5A 2ZGOA 1QHDA 4OVEA 1DBNA 1NAEA 5C71A 2E6VA 2JG8C 4ZY9A 3VLBB 3AP9A 4BA6A 4NHXA 3ENRA 5F6LB 2KM2A 1XYOA 2J1RA 3KB5A 4JHTA 5T54A 4XF3A 1POV1 1DGRA 4OUEA 3KZ4C 3I3DA 4AQSA 5BNNC 5JDBA 1XU1A 5C9AB 3ZYJB 2D97A 2VE1A 4LO5B 1LU2A 3WNNA 2RS32 1SFNA 5FXVA 3VBRA 2OPKA 3WY6A 4CUAA 1NCRB 3OD4A 1CPNA 4AVCA 5FPZA 4QWNA 4MYEA 4QXHA 2G1MA 2RM23 4XUPA 4A45A 1JZ8A 1G9BA 1US2A 2RMU3 3MPPG 3FJSA 3GXUA 4IEOA 1NCQB 4QM9A 5KXEA 5HPOA 5CG8A 2OIIA 4C0BA 1VIWB 3O0VA 1SLBA 2HBTA 1REFA 2VR4A 2GSYA 2HH9A 5FZCA 1FOD2 3MFCA 3TEWA 1S2EA 4E4ZA 3PVEA 3N9OA
chains in the Genus database with same CATH topology
3CEWA 3M70A 2XJVA 3ZXGA 3UKTA 1COV2 5FLHA 3E6DA 1DF0A 3VV1A 5JAXA 5EJ3A 4IV1C 4E2SA 5A33B 5CBLA 4WM7A 5KHIA 2JE9A 1KJLA 4P9XA 1FV2A 1OLQA 3ZSEA 4AEDA 4AVTA 3N7KA 4LBQB 5CU1A 1IKQA 1IS3A 2XJTA 3OBRA 1K5MB 1D4M2 5E89A 3B02A 2X8KA 2Q0AA 4D94A 5GLTA 3MEPA 1LOFA 5F1RA 3RPQA 5LEKA 2LTNA 2GC0A 2D43A 3QH7A 1NLRA 3H0OA 3ZYIB 3V0AA 1W6QB 5JMCA 5FFOC 1NXMA 4D7YA 2R30A 1DGWX 5GZGA 3WHUA 3FMGA 2GU9A 3FLRA 1QJU2 1XQNA 3K48A 4D69A 2WSUA 2WZR3 3GF6A 2DYCA 3AFKA 4Q0VA 4RA0A 4LO6B 3T2TA 3N3HA 1SQ4A 4M3CB 2OA2A 2ZHMA 4R9CA 4LHNA 1UIKA 5T50A 5JCTA 3WW2A 1QJX1 2Q8OA 5I8TA 4Q4W3 4R4ZA 1NE4A 2RR12 5ABJA 1OA2A 1FX5A 3EBRA 2WNVB 4FTSA 2ZGTA 5DG2A 4QQLA 4I3PA 5EWSA 1HRV2 1JUHA 1MR5A 2WIIB 3KCXA 1QU0A 3TNPB 3RI8A 4NOTA 2DF7A 4YW2A 1MS8A 4CDQC 2GN3A 3B7MA 2EIGA 3VDDB 2PLV3 2DVDA 3AM2A 3WT3A 1RMU3 2VOVA 1AYM2 4XTMA 2ZBJA 2WQ4A 3VBUA 1W6OB 3UL2A 1DFQA 2D98A 3IMNA 4EWAA 1RJ7A 1I6XA 2IFWA 3S30A 5BY5A 1N1SA 4Q4X1 2ZX3A 4H3WA 2PHDA 1MVQA 1OOPC 1ZBE1 1YI7A 3JB8A 4HKWA 4Q4Y2 4WZFA 4YG0A 4LT5A 2B9UA 2JG9B 3R05A 1QQP3 2R063 2EF6A 1YJKA 2W08A 1RUH2 5CFCB 4M01A 4JTNA 3A0NA 2K2SA 1UKGA 1ULDA 1RUF3 4A7KA 4QPGC 1H1MA 2B7YA 3ZXKA 5HCAA 2PTMA 3WDXA 1A78A 2VW0A 2MEV3 2GN7A 1QOTA 4Q8LA 4OULA 1KD7A 3VZKA 1N3PA 2EXKA 4YYOA 1F9KA 1QF3A 3R0RA 2NN8A 4FPFA 4JGYB 4YVSB 3DN7A 4XXPA 4WBBA 2WS92 2VVDA 2Q5TA 2A3XA 3ZPYA 3ZMNA 1KITA 1QH7A 2GMEA 5HBAA 4YM1A 3W9AA 3FBYA 5E1RA 1EAH2 2P34A 3H3UA 3OGJA 3DF0A 3AYDA 3B01A 2Q1ZB 3LGRA 4LA3A 1TEIA 1Z0HA 4M0HA 1VR3A 2JX9A 4ZU4A 5KXCA 1FNYA 3ZFGC 2X5IA 1PK6C 1YXWA 1M4WA 1WW7A 1AR63 1ZZ9A 3E97A 4YM0A 4ZU7A 1QXRA 1KXGA 5C4WB 2WLQA 5FQ0A 2ZX0A 3WQ1A 3SHRA 1G9CA 4PDWB 4N53B 3WNXA 2VVFA 4BE3A 2DURA 4MV2A 1WW4A 1H0BA 1ZNPA 3DGTA 3V0BB 1PGL2 2IXCA 3VBOB 2YZ4A 1PM7A 3AMMA 3V56A 4N9HA 4SBVA 2H6BA 3WP5A 3URFA 4B29A 2A70A 2XBO1 3ZSMA 2XWBB 2ATFA 2VOXA 4PLOA 1DG6A 3VKFC 5KC6A 5J96B 1BYHA 2N7GA 4QPYA 4ZU5A 4F7ZA 1WD3A 4GXLA 3GHNA 4Q0UA 1ZBA2 4FVVA 2ZGMA 3POSA 1NA1A 1W6PB 2MPFA 1FPN1 1PZ9A 3SITA 1R083 2BYVE 5GZDA 4OFGA 1QJY2 1BMV2 1RUI3 2QFEA 2HWB1 1DZQA 3MLJA 5BNOC 5C8CC 3ASIA 3S7IA 1UX6A 1NOVA 4R52A 4RR3A 3DPRC 3APBA 4AGRA 3B9CA 5F9TA 4BOWA 5CFDC 1C8NA 1RHI2 1MQTC 3ILRA 1CPMA 2BUKA 5K0UA 2ZGSA 2GH8A 3AYEA 4IV1B 4LR4A 1EY2A 3TB0A 3ZX7A 3WDYA 2W68A 4QM8A 4CDXC 4TLFA 4B3NA 2ZGKA 3AXDA 1H8TB 3TWIA 1CGPA 1RUD2 4I0BA 1CAWB 2XLGA 3H3ZA 3U10A 3JD71 1ZZBA 2R1DA 2GNDA 5F5QA 4YW5A 2D40A 4COWA 2WNEA 4FBFA 4LHKA 1ZRRA 1MEC1 5DUXA 3DUIA 5L36A 2D5FA 2VVEA 1VBB3 1GLHA 1XE8A 1ZA4A 4IL7A 4OHVA 3SCHA 2BVVA 3VL8A 4QX5A 4ITCA 4A7ZA 4HK9A 5BPXA 2JE7A 1OA4A 1Y43B 4EN6B 3JBG1 2DCJA 2R041 1AVBA 1EPZA 1QXPA 1DQ6A 1N3OA 2DU1A 1SFYA 4QU2A 2D6KA 1AR91 4KG8A 4CEWA 1RUJ3 3VZNA 1IS6A 1WLDA 3RZZA 1TQ5A 3KT1A 4URTA 2HWD2 5BNQA 3HBZA 3R4DB 5FLJA 3KSCA 4AHXA 1LOEA 1LOGA 1ULEA 2VOKA 5I0TA 5L7OC 3MFAA 5JZGC 1LULA 1AL22 2I07B 4CDQB 4LE3A 2PHUA 3MW4A 4QPIC 4UXAA 3WVJA 1AL0G 2WT2A 4V1PA 4YZ5A 4XJZA 3ZSJA 4M3CE 4QD2A 3NWKA 1GBGA 4C1WA 3MLLA 1H2KA 3PNAA 3LOIA 2BWAA 2D44A 3LSEA 2XKOA 4W6WA 4JGZC 5DDJ1 2B5HA 2ZMKA 1WW6A 4FXKB 4CDWC 2MNGA 1L3JA 4DRRA 4FPGA 1TME2 4XEZA 1OPOA 4HK8A 4GIQA 4LUKA 3GBFA 4QPGB 1VBD1 4Y26A 4DRVA 1FMD3 1MZEA 3N36A 1CAUA 4FPHA 1SBDA 4PLNA 4N90A 4A2UA 4INDA 1PO21 3SNMA 3ATGA 5AFBA 1URXA 3B69A 3NV4A 1AYN1 3AMPA 4LE4A 2GNTA 1BZWA 3HQXA 1OHFA 3IT8A 1HDKA 1N1YA 2IXLA 3MI8A 2GMMA 1S0CA 5LRRA 5SV8A 3ZO0B 1CAVB 1EV12 1VBA2 3SH3A 4YARA 2DTWA 1VP6A 4PQ9A 2EXIA 4HPKB 1AXYA 4IV3A 1IS5A 4E9KA 1HV1A 3EXUA 4B4QA 5K7PA 3KT4A 5C6CA 2CNAA 1AR72 3U4XA 5I0SA 4BH9A 3WG2A 1AX2A 1OFSA 3B5LB 4XF1A 4O9EA 2ARXA 2Y38A 1APNA 3Q9OA 2LUWA 1JHNA 3NAPC 5DXDA 5KHGA 4HVOA 1NG0A 1HQNA 2RM21 1XXNA 1YIPA 3CLPA 4LO4B 2IXJA 3CL1A 2RMU1 3T1MA 3ZFGB 1PK6B 1XNBA 2ZZQA 3AP4A 4WM8C 2PHRA 5J09A 2A75A 3AK0A 2EXJA 4NN0A 4X8PA 4G9SB 5C33A 5J37A 4Y20B 3N7LA 4BLIA 3ZVXA 2CY6A 4HETA 1GICA 3SH5A 4YGEA 1MS4A 1BVVA 3J26N 1AXZA 4HSJA 1Z7S2 4WM7C 1YYNA 2R073 1HRI3 4J1WA 4N43B 2DV9A 4Q26A 1PNFA 2DU0A 1PMIA 2BNNA 4L9BA 2R0FA 2GZWA 1QJX2 1YUDA 4AF9A 4Z2WA 2DCKA 3PLQA 1ZZ8A 5FO7B 1RC6A 4DMIA 2TBVA 1ND2B 1U5IA 1R1ZA 1X7NA 3HT1A 4YGCA 4AHZA 2DVBA 2B8MA 3KS7A 4Y1VA 3PMSA 1LECA 2Y26A 1CVNA 1ND3C 1C3HA 3LA3A 1GYKA 3VBFA 4JRLA 4YFZA 3O0WA 4AYUA 4UW6A 1IZ3A 2Q4SA 1LHOA 1SLIA 4WZCA 5KHKA 1G86A 1Q8QA 1PVC3 3GBWA 1W6MB 1WLWA 4AGVA 1VRH2 2E63A 1VAVA 1R092 4Q4X2 2YYOA 4COZA 2WZR1 4YZ4A 5A3MA 2VW1A 1ZBE2 1SLCA 4Y1YA 2WNUA 5BNOB 5C8CB 1H9WA 4EN9B 3FFQA 1QDOA 4EROA 1LKNA 3THPA 2A6WA 5ABJC 5JLVA 4NPRA 4XJ9A 1CAXB 3RJ2X 4RL7A 4Q4W1 2DTYA 5CFDB 1RITA 2R6QA 4GULA 4Q0QA 1KJRA 3O14A 1PIV2 4JV4A 4X6RB 4LEJA 3I4IA 3AZXA 3RYKA 1H1IA 1AXKA 2PHTA 3UKVA 4QQOA 2ZMLA 4GH4B 4WVVA 2A3YA 2PLV1 3SCGA 5T55A 4CDXB 4E4DX 4CDUA 5LRSA 1RMU1 4Z1VA 2QZ2A 4KGQA 2O0OA 4IETA 2RS33 1C8M1 1AX1A 1DZRA 3LA7A 3FHIB 3NW4A 3S7EA 4FPYA 1VAKA 3I59B 3OYWB 4CEYA 4XETA 1PGW1 5GLZA 2ETEA 2WWSA 3M3OA 3ZIWA 1H9PA 1QQP1 2IC1A 2R061 4DFSA 1LOBA 2JKBA 1VALA 4RQPC 5AC93 1RUF1 3VHRA 3IWZA 2C9AA 3D0JA 1OKQA 3AXEA 4XILA 4YFWA 2MEV1 2WFF3 2QCSB 3HAGA 2V73A 1Q3EA 3POYA 5GLUA 4IEZA 3CJIA 2NMOA 1SLTA 4MUVA 1UAIA 2LM3A 3ST7A 3G7DA 2RHPA 5HCFA 1UU4A 1ULFA 3D0SA 3J8F3 1FNZA 4KNCA 4AWDA 1XNDA 2XBO2 2Z69A 3NL1A 1JYIA 5L7OB 3VKOA 4MXWA 5JZGB 1IHMA 3ZIXA 3KQRA 4QPIB 2W39A 2LALA 4IEXA 1NYWA 4D7TA 1CN1A 1XYPA 1SLAA 3V65A 5D8AC 2VPVA 1O5UA 4YZ2A 1AR61 4EWEA 1Z78A 1SACA 2C0ZA 1FPN2 3VBHC 4JGZB 2EVXA 4CDWB 3CF6E 3AKTA 4KWLA 1H2NA 1DQ1A 1ZZCA 1LGNA 3WW3A 3U11A 1IKPA 5CB7A 4AFCA 3ES4A 1FXZA 3HR9A 2HWB2 4AQ2A 2D3RA 3LCPA 5KHHA 5A3LA 1AHSA 4N9IA 4ISQA 5IT6A 4FOVA 1ASJ2 3HT2A 2SBAA 4I01A 3HIFA 1AR83 1YFYA 3TN93 2EA7A 3IPVA 1W0OA 1ZX5A 3BOPA 3DL3A 3WG4A 1AYM3 1PZ8A 1W2UA 5IK4A 3GNEA 1S0EA 4B7EA 2D93A 1Y3TA 3MICA 5J7MA 5A32B 2WFPA 3P3PA 5T3NA 1R081 2ES3A 3JD72 4L92A 2RE9A 4FPJA 1NCRA 3S6PA 2SLIA 2NZ9A 1AF9A 3NAPB 2DCZA 1FV3A 4LO7A 1RUI1 1MEC2 5GLWA 1JBCA 3R4SA 5IK7A 3KMHA 3KLSA 4AVSA 3VBSB 2DCTA 4WM8B 2F6BA 4Y1XA 3VZJA 5JIAA 3QD6A 2UYAA 1ENQA 1QH6A 1JN2P 2R0HA 1DQ0A 3JBG2 4TWTA 1HQLA 1MS1A 2QDNA 2R042 2WC2A 1KDKA 4YM3A 5A33A 1AR92 4G4FA 3ZXJA 1LGBA 1QJZA 4QGNA 2RS13 2ZHLA 3AZWA 4P5HA 1XRUA 2VMHA 1UPIA 1CQ9A 1X33A 2HWF3 2NYYA 2YV8A 4XFHA 2PAKA 5JSOA 1K5MA 4I30A 3TRSB 1V00A 5BNPB 5ACA3 2NP0A 5E88A 1ND3B 1WD4A 1DQ2A 4BYYA 3ETQA 3NV3A 1SBEA 1FI2A 1VBB1 1W6QA 4LBNA 4J6GA 1WMEA 3MF6A 5LK5A 2A6ZA 3ZN4A 1N1TA 2H0BA 4XXAA 3OPZA 4FT8A 1LU1A 1WCSA 2W0XA 2GC1A 4CEWC 3M3EA 2UYBA 2BEOA 3N7MA 1SLLA 1CJDA 3HN1A 1WLCA 1UIJA 4HT1T 1RUJ1 5ABJB 2R32A 2JEMA 1F31A 2UWAA 1E57A 3P3NA 1VBD2 1SBFA 5FPXA 3MW3A 2ZZJA 2C5DA 4JRAA 2WNVA 2VG9A 2VNGA 3E6CC 4MGKE 1UZYA 1A3KA 4R9BA 1C8M3 1AYN2 2JJ6A 3AP5A 4WV8A 1Q5OA 3X29B 3ZXLA 4AQTA 1BXHA 3CO2A 1AX0A 4N7IA 2PA7A 4H14A 3NO8A 4XF9A 3VDDA 4DOUA 2XHKA 2YROA 1VB2A 4L97A 3BODA 3LAGA 1W6OA 4ATFA 1IS4A 3TOJA 3ZXEA 3AZVA 1WCKA 2D6LX 3RRDA 5EFUA 1UL9A 3S0MA 3G6JB 4GMP0 1UN1A 2O8OA 4S2FA 3H8UA 4XQDA 2JG9A 2IXKA 2WT0A 2DWRA 1WMDA 5CFCA 1LHNA 2D6MA 3AMHA 2QVSB 4RQPB 1V6KA 2ZTNA 2G9FA 3D8CA 1Q8PA 1FMD1 3WOGA 3VUOA 4OUSA 4AQ6A 3MIGA 1UZZA 1NLSA 1RUC3 2E7AA 3HD8B 3NJZA 2CGNA 2XG3A 2BWCA 2QQPA 4B4RA 5GM0A 3UJQA 3DV8A 4W6YA 1PHMA 4F8AA 4AI0A 1KFXL 4JGYA 4YVSA 3ZFEC 4C1XA 3ACLA 3IDEA 4IV3C 1O4ZA 4OHZA 4MSVA 5GZFA 2BGCA 1JTZX 2OW4A 2HWC3 2UURA 4PJYA 2H0VA 4AI1A 3FE5A 4XF4A 4WVMB 4JVAA 2ET7A 4FQ4A 3WDWA 5JSPA 1ULCA 4B7KA 5JOWA 2XVLA 4MXVA 1RL3A 5I91A 3IDCB 2D6PA 5D8AB 5H9SA 4QHBA 2B45X 3ZYRA 4BHPA 4Q1RA 1IPKA 5C4WA 4UW4A 1S0FA 2YMZA 3VBHB 1C5IA 1O4YA 4TSVA 5FREA 4KWJA 3TNQA 5GJ6A 4RGGA 2WZR2 1LR5A 3W59A 2HJIA 4PDWA 4N53A 2UY9A 4I2OA 2BFUL 2R071 4AEJA 5EZWA 3OF1A 5HXVA 1HRI1 3V0BA 2E7QA 5D1IA 3MPBA 5BV6A 2HWD3 1HW5A 4Z82A 2JG8B 2ZPXA 4Q4W2 4DPNA 2BTVC 3ZSKA 4JAAA 2XJUA 2QE3A 3WG3A 2ZS6B 4DB5A 4R4XA 2WZPP 3H50A 5BNNB 4COVA 2E9QA 1LJ7A 1T6GC 2I45A 2WLPA 4IEPA 2XB6C 4YW1A 4WVWA 3WR0A 3JB4C 2PLV2 1RMU2 5JPMB 2GMPA 2YDEA 2D3PA 3TAYA 4IEUA 1G6NA 4COYA 1PVC1 1W6PA 1NY71 1WCDJ 2WKKA 2CYFA 4BM8A 1TME3 2VUAA 5T5JA 2AZ5A 1D2SA 5GLVA 1PGW2 4GA9A 5DG1A 2UY8A 1QQP2 1VBE3 2R062 4YZ3A 4IEVA 3USUB 5EV7A 4FPOB 3RMXA 1ENRA 1ZYBA 4XFAA 3ZN6B 1RUF2 1WA4A 4PIZA 4BQ1A 4LO8A 4YVWC 5KC5A 1YRZA 3AB0A 2MEV2 1QY4A 4BZ4A 1GANA 4GB33 1EV13 1VBA3 1ENXA 3AP6A 4LLFA 4BLJA 3TBDA 4IV1A 2XH6A 1HLCA 1RUG3 1DIWA 3JZVA 3ZFFC 3GALA 1VBC3 1B35A 4QQPA 3H1MA 1RINA 4A3XA 1AR73 5F6KA 1ENSA 3ZXFA 5KWRA 1BBT3 1H8TA 1X82A 1YFXA 2RS31 4Q0PA 1CAWA 3ZN5A 1HKDA 3KM5A 1QNYA 3RMYA 1TNFA 3NKGA 3VZMA 2XWJB 3WHTA 1RUE3 2G9GA 1DDLA 4BIOA 3GZAA 2A73B 1LOAA 3L2HA 5TSWA 3WQ0A 2DVAA 3WD5A 3GBGA 4X8NA 5BXXA 1BEV3 3UK9A 4AXOA 1FAYA 2HWE3 1AJOA 1LESA 4P9JA 4PF5A 4PIYA 1MS0A 5AC91 1AR62 1MZFA 2CWMA 3BTAA 4MX3A 3T1LA 2NQYA 2ZHKA 3H1WA 4JDMA 1Z7S3 3VHNA 5I0RA 2WFF1 4OUMA 4XMIA 4KGGA 4KWKA 2DCYA 2IFRA 3OY8B 2EAKA 2ENRA 4YW4A 3WUDA 4CEWB 4NHMA 2VGDA 4ES8A 1RIRA 2ZCWA 1X8MA 3D6EA 1PGSA 1KFUL 2RS53 3M8LA 4DNYA 2QDRA 1LGCA 2WA4A 1YI9A 2TEPA 3B00A 3PVNA 4XBNA 4E27A 1DZTA 5IK8A 3J8F1 3GHMA 1RUOA 3FLTA 4XZPA 2XJQA 3WLUA 2CTVA 4P9GA 4Q4V3 1SMVA 4C90A 5EYXA 3ILFA 3WINE 1F5FA 4CDQA 4JDNA 5JI9A 2TUNA 1S0GA 4BIFA 4M00A 4OLLA 1OOPB 4DQAA 4Y22B 3JUUA 1VRH3 2WQZC 4XJ8A 1BCXA 1R093 4KL1A 4BMBA 1A8MA 4RHV3 1YFUA 2JECA 2ZGNA 3M2MA 1HXS3 1RVF3 2A3WA 2GC3A 3DKWA 1RUI2 2A6YA 2IZWA 4YGDA 4QPGA 3UKNA 1XNKA 1IGOA 1PIV3 4QT6A 5J36A 4OI2A 2VY0A 1AR81 1JW6A 1PZ7A 3TN91 2FZ2A 4IQPA 4EN0A 5JI7A 4GKYA 2QUOA 3ZFEB 4ZKTB 1TMF3 3VBRC 5AVPA 1AYM1 1CAVA 1U5ZA 4IV3B 5CAZA 2ZKLA 1V70A 2ZMNA 5FLIA 4HPKA 2ILMA 1GZWB 4Z8BA 3H1YA 2EALA 3PVBB 3FX3A 4ORFA 3AX4A 3SISA 1WUVA 1I9RA 4CP1A 5K9YA 1CX4A 5AVAA 2JENA 1GFF2 1PO13 4R9DA 2MHFA 2CAVA 2JXAA 4CYDA 3ZFGA 1F2NA 1MS9A 1PK6A 3QACA 3EJKA 3L9JT 4UW5A 2DUPA 4AEDC 4LBKA 1MS3A 4Y20A 3V64A 2YUEA 4IXLA 3SMHA 4IESA 1FT9A 2AREA 2Y0OA 1IPJA 1OA3A 4K20A 2AYHA 1JYCA 2VQ0A 1O5LA 4N43A 1V9U3 1RUJ2 3VKMA 1LOFC 2RS11 2GNBA 3ROUA 1SCRA 3B94A 2DUQA 4S2HA 3FFZA 4DINB 5DZEA 1U0AA 2HWF1 2E53A 2FBEA 3VN4A 1ND2A 3B93A 3AKSA 2DFBA 2CWSA 5ACA1 1YHFA 4HLTA 3IDBB 4MZUA 3N35A 2XJPA 5LEJA 1O3QA 4UBHA 1V6JA 3HMYA 2H6CA 1Q8SA 3AKPA 4HSLA 3MZHA 2D6NA 1OMIA 3WP4A 1R1A3 3JQXA 3ALQA 5J98B 4YLZA 2P17A 3D4KA 4P9YA 3AMQA 5FOBB 3PVOA 1J1LA 1J1TA 4MVTA 3DPRB 2PHXA 4MGYE 2BNOA 3KGZA 1OLRA 2ZACA 2OZJA 1N47A 1MQTB 5HCBA 4AK3A 1GNHA 1POV0 3MIDA 2F4PA 5BNOA 5C8CA 4X6QB 5CA6A 4QQHA 1DYKA 4XOGA 1ASJ3 1RJ8A 4FAGA 1YWKA 3E5XA 4GMP3 1CAXA 3KD4A 4XBQA 1AZDA 2DFCA 1FMD2 4YVWB 1IQAA 4FOQA 3VBUC 2YPJA 4HL0A 1G7YA 3A4UA 2PFWA 2XVGA 1H4GA 1W6NA 2W52A 2PHFA 3ZFFB 4XIOA 4YM2A 4GH4A 5IUQA 2Z42A 2X53S 4Y24A 5T52A 5T5PA 4CDXA 3A0KA 5DZGA 3E5UA 4I02A 4EN8B 4HVQA 3LA2A 2NMNA 1FOD3 4OI0A 3QOPA 1LCLA 4MLOA 1GNZA 2CAUA 2XL7A 3I59A 3OYWA 5E16A 5JR7B 2JG9C 1COV3 2ZAHA 5T5OA 4UW3A 4FSJA 1U5YA 4N7UA 2ZOEB 4BMEA 4CZSA 1N1VA 3LSDA 4PBPA 4ASLA 1UMZA 1QKQA 1Q56A 4LNVA 4L2NA 2NLRA 1ALYA 3PJQA 2QJVA 2DVFA 1RUC1 2ZKNA 1TNRA 4DS0A 1D4M3 3ZMOA 4YVSC 3AP7A 2PHWA 2R072 1CONA 1HIXA 3MIFA 2G4IA 2ZGQA 1HRI2 4AVBA 2P3JA 2V5YA 3LWCA 4A7YA 5K8SA 3D82A 4OHWA 4TZDA 2HWC1 1AJKA 4EN7B 3AYCA 1Y9QA 4ISRA 1VLNA 1X8EA 2PQQA 2X5IC 1ZVFA 3BPZA 4L99A 4H7LA 4XFFA 3B9IA 5DUVA 3FWEA 1QJU3 3WCSA 5JWPA 4FXGB 4XJAA 5L7OA 4IEWA 5JZGA 4OI4A 3U0ZA 1CJPA 4RS5A 1CIWA 3WW4A 2UWCA 1H2LA 2BFUS 4YSFA 1PVC2 3FZ3A 2RR13 4KH9A 2XKPA 5SV5A 4AEKA 1LEDA 5GALA 3M7AA 4AW7A 1HRV3 2ZGLA 3KCCA 2VMIA 5FAXA 5DUWA 4QGMA 3USSA 3BALA 2P3KA 1QOOA 1N3QA 2WA3A 1MZ6A 1DYPA 2BPA2 2HWD1 2C1FA 3MIEA 5L73A 3THTA 4XTPA 4BWOA 3IBMA 3J9SA 5FO9B 1UU6A 1S0IA 1XNCA 4AGGA 1NA1C 1BK1A 1DHKB 4HZFA 1ONAA 1QMJA 1OQDA 2VXRA 1NQDA 4NO4A 5C9AA 3VBRB 1J3PA 4XBLA 2Y0IA 1VJ2A 4Q4Y3 3AJYA 2GNMA 4C0HA 4OHYA 1C1LA 1RUH3 1DGRN 2PAMA 2VOWA 1H2MA 4LA2A 1UKRA 4MGIE 4RR3C 2PAEA 1NCQA 3O0XA 3BIWE 5A32A 5JOYA 3SLIA 1EYBA 1TME1 1BVP1 1O3RA 5B2GB 2XJRA 3NAPA 3AMNA 3VKLA 3I2DA 3M3CA 5K0UC 1NXD1 4I09A 3VBSA 1VBE1 1LB2A 4WM8A 2WS93 4WM7B 1KRIA 4FPEA 4AEDB 1U12A 5AC92 4HKOA 3IIAA 4RFT0 1U5XA 4NR1A 4LBQA 2WFF2 4KU8A 1EAH3 2D5HA 1A8DA 4GB31 3RYRA 1EV11 1VBA1 2VMGA 3VHOA 3WDTA 4EV0A 1B35C 2OZ6A 1RUG1 3RI9A 4AVVA 1Q8OA 4HKLA 1VBC1 4J1XA 2XL9A 1H8TC 1ZZ6A 2RJLA 4FOYA 1AR71 2RJKA 3V0AB 4FTEA 3BB6A 4Y4YA 4XPVA 1BBT1 4ATEA 2ZABA 3TYJA 3J8F2 1KS5A 3MIHA 5BNPA 1WW5A 5FMOL 3JQWA 1RUE1 1ZZ7A 1GZCA 1ND3A 4XF0A 4CTEA 2ZA9A 3MGUA 3WDUA 4XQWA 4IERA 4AI3A 1NZCA 5L19A 1GQGA 5DDJ2 4AFDA 1BEV1 1S55A 1HQWA 2HWE1 1NE6A 3FC0A 4R9AA 3O12A 2HYKA 4M3CA 3QCWA 4S2DA 1S2BA 4NHLA 1DQ5A 1DQ4A 1DU3D 1UW8A 4HN0A 1Z7S1 4LBMA 3WV6A 4ZXKA 4PBOA 4XYXA 2NM1A 3NV2A 1PO22 1S0BA 1YFWA 1O3SA 4FP3A 3NV1A 4DXZA 2RS51 4COUA 4QMAA 4KU7A 5E8AA 2KXLA 1RGSA 4Y5Z0 3VBUB 1ZBA3 2VW2A 2K0GA 3AKQA 1D0GA 2QZ3A 5H9PA 3R6SA 4FAHA 1PVXA 1AR82 4AFMA 1OD5A 3E6BA 4Q4V1 3TN92 3I8TA 4LBOA 4XHBA 5GZEA 3LKJA 1ZM1A 3N4MA 1QJY3 2HEYF 3AZZA 4M0NA 1BKZA 4FO9A 1KDMA 1ZRCA 4K8FA 3QLQA 2IXIA 5DUUA 3W58A 4FOWA 3OTFA 1VRH1 1R091 2RM22 1J3QA 2RMU2 1F5JA 4EJRA 1RHI3 3VL9A 2R16A 4NVPA 4HVRA 3RYPA 4ASMB 2KA3A 3FBMA 4RHV1 4AFBA 2Q1MA 4SLIA 2XVKA 1YJLA 1HXS1 1RVF1 3J4UH 3E5QA 4OI1A 4QQ2A 4FPCA 1YO8A 3NSTA 4RQPA 2ARBA 4K1ZA 1SDWA 1D2QA 1PIV1 4MH0E 1RUD3 3ZXDA 3JCIA 3MIBA 1OPMA 1OQEA 4JTOA 5IK5A 1YNAA 4W65A 1JH5A 2ZX1A 1WGPA 1TMF1 4HANA 1VAMA 2Q30A 2RS12 3ILNA 2HWF2 2X5IB 1LHUA 3AKRA 4WVMA 4Q27A 3AJZA 1UF2C 1O3TA 4K21A 3L2YA 5T5LA 2WL1A 4LHLA 5HI0A 5ACA2 2P37A 2ZX4A 3U07A 4AE2A 3VGIA 5BYNA 1LEMA 5FQ0B 1I5ZA 2D6OX 3NKTA 4P9IA 1QDCA 1PO11 3WDVA 3KGLA 5D8AA 4HMZA 1G9DA 3OGGA 3OD0A 1MACA 2R49A 3VBHA 2PHLA 4GKXA 1OI6A 4XFIA 2FMYA 3VBOA 4XMAA 5EYYA 3VZLA 4LLOA 3M3IA 2YGLA 4N43C 1UCXA 1AL23 4G3YC 4NHKA 2GC2A 1H8VA 1V9U1 3VBFC 1Q8VA 1C5HA 1A6CA 1ND2C 2JG8A 4YW3A 3QBQA 4XIKA 1POV3 2ZHNA 2BBVA 1NA1B 4Z07A 3H7JA 1V6OA 2QKDA 1C8M2 5BNNA 3INAA 4H7MA 3RWNA 4F83A 1Q43A 1UPSA 2WNUC 4XJUA 1R1A1 1RTVA 5CADA 5BUVA 3GZTB 5JPNB 2ZAAA 3RQ0A 3ME2A 4RR3B 3SCFA 1C4RA 5H9QA 1DLLA