1S2DA

Purine 2'-deoxyribosyl complex with arabinoside: ribosylated intermediate (araa)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
164
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 50
structure length 164
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2dA00
4RH3A 4KXMA 1S2DA 3SBXA 4WL0A 3HNOA 4OHBA 4FYKA 3UQZA 2A33A 2IZ6A 4MEJA 4LJRA 2KLHA 2F2TA 3BQ9A 3PFKA 4NPAA 4JENA 1S2GA 1T35A 1S2LA 4I7EA 4KXLA 3OPYB 4LJLA 1WEHA 2IZ7A 2F48A 1YDHA 4P5EA 2IZ5A 1S3FA 1RCUA 3EHDA 2A0KA 2F64A 5AJTA 1WEKA 2KHZA 4PFKA 2PFKA 2NX2A 4LJKA 4FYHA 3O8NA 3O8OA 4KXNA 4P5DA 3IMKA 4MCJA 4FYIA 3MAJA 2Q4DA 1PFKA 4U1RA 2F62A 4JEMA 2HIGA 3F5MA 3K2QA 3U39A 4I36A 2Q4OA 4OHRA 1KZHA 1ZXXA 5ITSA 3O8OB 1F8YA 4A3SA 5AJUA 4JELA 4HX9A 6PFKA 4I4IA 2F67A 1MTOA 1S2IA 2PMBA 1F8XA 3QUAA 3O8LA 3OPYA 3GH1A
chains in the Genus database with same CATH superfamily
3UV3A 1MZPA 1P3JA 4DV3B 1ULTA 7REQA 4ZGGA 1GAWA 2RHLA 2WIBA 4KTTE 5JFTA 1R0LA 4BECA 2HAEA 3DVAB 4NFSA 1Z45A 2I3GA 3OECA 3E58A 4YBZA 1EYZA 1WSBA 3IE2A 3K4HA 4B6SA 3QSYA 1D4AA 1H05A 3U48A 1XDSA 3TEFA 3V4LA 3HCFA 3L7AA 3UMGA 3ZK9A 4B3CA 3EARA 4AURA 2CXPA 5KYUB 4LDAA 1S89A 5F5XA 3ER9A 2WNSA 3CR7A 3DE1X 2HDWA 2PT9A 3AFMA 4OJTA 5BSVA 3C8MA 2YZGA 2VBGA 3CJTA 4RVFA 4CG0A 3D0QA 4FYYA 4R2JA 4KQ9A 3K0KA 5GP1A 2YN4A 1N75A 5EE3A 3S7TA 3FZQA 5JD5A 1GDTA 1E4EA 2R1VB 4FQ5A 4WD3A 2FGKA 1P1KA 1SVMA 1Z8HA 2RHMA 2VSFA 2DFLA 2YN2A 2UVDA 4I1VA 4MZXA 4DJDC 5BSWA 3FWKA 4A2QA 2JI6A 2WVJA 2C2KA 2QSZA 4P8RA 4ID9A 5EFOA 1G5RA 2NWQA 4NPHA 2BFPA 2HT1A 1LSSA 2HA0A 4MWGA 1TVKA 5E4YA 2P35A 4NMWA 2ERXA 4FKZA 1UBCA 1GAXA 2IELA 3L6DA 1N2CE 3NRCA 4Z4FA 2H1RA 4R1LA 2BHSA 2G0AA 3KQMA 1TX4B 4PSKA 1CY6A 2HRRA 1IVNA 2NSDA 2DBYA 4HNAA 2ID8A 3TE7A 5ES4B 3O3CA 3WB9A 4QARA 3ACDA 1GITA 3AVQA 3SM9A 1IZ7A 5HF6A 4E08A 1EVQA 2ZTMA 3ZW8A 4ZZ1A 3KOZA 3GDWA 1KWGA 3BAZA 2F1KA 4DMHA 3G17A 3IAM1 4JT9A 4X0EA 2XF8A 4YRTA 4ZYWA 2VJQA 2ZUUA 3O73A 4GEKA 1IEWA 4N8DA 3F9IA 3WJ2A 3WKDA 2PCJA 4BV8A 5AW3A 3BD8A 4OKNA 4ZWNA 2H0QA 3EVGA 3K5WA 4N40A 4WN3A 4IX9A 5IK2A 1T9CA 1EVKA 3RQSA 1ZD4A 1KJQA 2O8NA 3I28A 3V00A 3RAFC 2RHJA 1H69A 2P0AA 2IYSA 3LXMA 3RSQA 1Z83A 2QV7A 1UQRA 4B5KA 1JAHA 1BKYA 1JA0A 5CDYA 2JGMA 3EC2A 5C51B 2XVZA 4FHZA 4UCXA 3SYLA 1KBOA 5F76A 1O6FA 1Q92A 3K35A 2PGDA 4JI3B 3ELUA 1FLVA 1NRJB 4QGFA 1GQOA 1S7GA 4G0YA 3V46A 4CM9D 2JEOA 5EXPA 1NJFA 3GMIA 4Q1DA 3H18A 2D2FA 2CMGA 1X86B 4MX8A 4JBLA 4XRGA 5ABPA 2O6LA 2V4UA 4Q4AA 2VAVA 4HWTA 1NASA 1J7KA 3H5TA 1SBYA 2E4VA 3OQBA 3ZNOA 4IVRA 2FV8A 1AGYA 1ZW6A 3P9PA 1LQUA 2JKZA 2W2KA 3JYNA 3NHKA 4W8HA 4WXPA 5BSTA 4MULA 4O0MA 5FH9A 2DOKA 2I1LA 2NT4A 4EYQA 3KLPX 4TVOA 1OTHA 4GZMA 1E2NA 2ERCA 1JB1A 3BD7A 3PS9A 4J4TA 5FA8A 1DPFA 2IOFK 1M9NA 1DRVA 3OCWA 4N12A 5TNXA 3L4KA 2NMVA 2AS0A 1MAUA 2RIPA 1JYFA 2RHBA 3C3AA 2PSSA 3PR3A 2Z58A 2GJ9A 4GGOA 1H6DA 4OFXA 1CEEA 1L4HA 3PDUA 1FYDA 5C1IA 1S2DA 3OG9A 1K3FA 4P98A 1ICEA 2G5PA 1O4WA 4PC3A 4XFDA 3D7NA 2PX2A 5IKOA 4EPXA 5E6RB 2AD1A 3AZQA 4C3ZA 5A2GA 5KMGB 7MHTA 3OKAA 4HRXA 3SM3A 4X1KB 2WT8A 5KSYA 3BXPA 2O7QA 1EP1B 2YIDA 3AYXB 2KJQA 1IJBA 2Q99A 4XIGS 3RU3A 1ABFA 1D8TA 2A5JA 3Q88A 2G25A 1E99A 4ZCTA 1ZR2A 2GA9A 1NG1A 1XELA 2GK7A 3T35A 3DFKA 4EHKA 1T6NA 4KR2A 4NMLA 2C2OA 3S2SA 4NK5A 1CULC 3ZGYA 3L3BA 4JBGA 3PA8A 5JH7A 1KR2A 1XD2A 4D0NA 5I9BA 2BSAA 2UUBB 4K87A 1BE1A 3AIOA 2ZCVA 5I9TA 1JRLA 2DUUA 1A98A 4XUCA 5T4HA 5KOJA 3R9WA 3WLIA 1OUMA 3ILVA 5TMEA 4B3SB 2Q2VA 1N1EA 4M76B 4QTXA 3RGGA 1NMEA 1V8BA 2PVPA 4CZ2A 4F4UA 4BNYA 4LIPD 1QYVA 1Q5PA 1SQSA 2C7BA 2Y68A 4RGYA 4UKDA 5ESRA 3S28A 1LF0A 1VJ0A 2W00A 3NLLA 4I0WB 3A9UA 5F3RA 3QJGA 1V48A 3SJAA 4G6ZA 4FPXA 2PT6A 3ANNA 3NAZA 2XVAA 4I2VA 1GAJA 1RZVA 1YA8A 3IBYA 4QDKA 3VR5D 1CRWG 4DYVA 1P0QA 3MOIA 5GJWC 5JOQA 2Q5OA 3USES 1NUAA 1KAEA 4LJKA 2Q9BA 3DEFA 3L02A 2CJPA 5C4GB 1K2WA 4YXFA 2GBPA 2GK4A 2XTAA 1TYBE 2ZB4A 4IJKA 3Q8KA 1VKRA 1N92A 2Z98A 1V1MA 1P3Y1 1HI9A 1NBHA 2PN1A 3L04A 4NI5A 2YWRA 3STWA 4B43A 3GCWA 1CY0A 3HZHA 2CSUA 2C97A 4M55A 1EUDB 1NJGA 3CTPA 1ISMA 4Q9AA 4RK4A 1VHDA 1DAFA 4W1RA 5DHFA 4CV1A 16PKA 3KUUA 2II6A 4FC7A 4K26A 3STHA 1C3VA 4MWOA 5DPMA 4F0JA 1GTSA 1VL5A 1G64A 3OM8A 1Q11A 4V0SA 3H05A 1FU7A 5D01A 4NOKA 2RG1A 4LJSA 5K3FB 4DR2B 3HMKA 4M8NE 4UVEA 5TPZA 3ADOA 3V97A 4CVNA 2J30A 4CXMA 1GNRA 3SXUB 1ORVA 2WTMA 3SQNA 3GVXA 2EWVA 3C3MA 2RARA 2RIRA 2ATXA 4GWLA 3AVPA 2J6BA 3EXEB 3L06A 4E3ZA 3FG9A 1F3LA 7YASA 5HQ3A 5JLJA 1I80A 3AK4A 3B7GA 1EK0A 1Q77A 1SUWA 2V7QA 3NTXA 3ND8A 2GZMA 4ESOA 2J09A 2XNHA 3ANYB 4I6EA 2OBBA 4GZ3A 1LX7A 2V8BA 1EA5A 1M6WA 1MO2A 1ZD3A 3B82A 1SXJC 2JGLA 1MTZA 1LVHA 2WJAA 4PNZA 3ME5A 3ABRB 3ZY4A 2C3UA 1RBYA 1YOVA 1JDUA 3S68A 4AMZA 4DLLA 3BXZA 4PQRA 4BUJA 1B16A 1LUAA 3AY3A 2HIAA 3QVOA 1KZGB 1QZUA 3DP9A 4ZQIA 3W5DA 4JUDX 2Z2KA 2X6TA 3UT6A 3OE4A 3HB0A 4U9UA 2ZXFA 3S55A 3TB4A 5ALPA 1Z8DA 4WI1A 3R74A 2GAOA 1QF7A 4G5QA 4LK3A 1DBSA 2VT7A 1VHQA 2PMEA 1N2JA 2YYZA 1DX4A 3FLBA 3JZMA 5DT9A 1OVMA 4KPYA 1HT3A 4URUR 3RLIA 4OB8A 1HLDA 5DF1A 2IHYA 1DJMA 4BAUA 4JLMA 2A9RA 1BA3A 1IQUA 2KLBA 1X2EA 4PPGA 2I7XA 1X0VA 3TZLA 3UC9A 3L9WA 4D8UA 4RH0A 5JQGB 1WKCA 3IBGA 1GRNA 2Z2JA 1X92A 3GCZA 4YACA 4CMKA 1OX4B 2KLHA 1FXSA 2ZTVA 3OE1A 1GCGA 1V71A 4YMIA 3IPYA 4BQSA 4RK6A 2W42A 3SJBA 1NX9A 3R6LA 2FN7A 2XKKA 1QU3A 3DWIA 4C4ZA 3BTOA 2XJ9A 1QGAA 3AIIA 2DLCX 4UMEA 2EIXA 2AFIE 1PR2A 4NEGA 3HV2A 5J40A 4YPFA 4IS3A 2FEOA 3NEPX 1TMOA 1K0FA 5F1YA 3BN3A 3VR3A 1OB5A 1EWVA 2XTJA 3GLSA 5AHWA 3WICA 3WK4A 3W2FA 4CKYA 5L4SA 3KJEA 4N5MA 2QY6A 4N8EA 4FHEA 4CYMA 3GNSA 3IQEA 4C2TA 5DCWA 4ENPA 2OSVA 3DBVO 3G1UA 1BKDR 3WBFA 3IAFA 2J31A 1V4VA 2H2DA 5FT9A 5CFZA 4MB2A 4AJ1A 3DVRX 1JE1A 2PZFA 1OWLA 5TARA 3PC4A 3ZUPA 1IRIA 1QE3A 1CKEA 1T1JA 3CJQA 1EZ1A 4EAQA 1SWWA 4EI7A 4E3WA 2I76A 3ZVKA 2OZPA 1XRMA 4MUAA 1IHYA 4NBUA 3HA7A 2EKDA 2ZYTX 4NBSA 1EU1A 4TV9B 5KOJB 4LG1A 2KS6A 2CXHA 5I48A 3R24A 4LHXA 3WNVA 3GH3A 2WYUA 4YGXB 2WWGA 1TQ4A 2FR0A 3CUUA 3SHOA 3Q3HA 5KO2A 4E22A 1PZNA 3ZCXA 3DE6X 1W94A 4KLNA 5ALQA 3ZD9A 4DEXA 3IB3A 4HNAB 3KSRA 1C0PA 4RPLA 1S2OA 2VOEA 3AW8A 1D6JA 1LJ8A 2FPPB 5A4MS 1RYHA 1Z4IA 3AP3A 2QF7A 4B6QA 4H1HA 5F2KA 2P5TB 4XKJA 1B0AA 4PSAA 1L4YA 5SYNA 3BSYA 3M34A 3KDSE 2NADA 1RJWA 4O4HF 4YJ3A 2J3JA 1Z5VA 5CPFA 2ZJOA 3SOPA 3QX9A 4O33A 1CJSA 4BNDB 4LGVA 4M98A 1PJ4A 2J4FA 1MG5A 2VNSA 1GKUB 3KCNA 4WHMA 4HWPA 2C8KA 3OUTA 4KEAA 1H0KA 4M37A 4OBEA 3E3LA 2C1XA 2HSEA 4ZOCA 3UMCA 3SHTA 2X0EA 5BORA 5FWDA 2WM2A 4A1FA 4EHBA 2EZ9A 1ODLA 3L7NA 1KSFX 1QRAA 1EX1A 5F78A 4MICA 3ZHUA 4B3JA 1MTOA 3Q2OA 3IP8A 2BZ0A 3PJGA 3R2JA 2PX3A 4WNAB 4AUKA 3VNSA 4CIXA 2O9JA 1OT5A 3SZLA 3UYKA 4CMJA 2DCMA 1M74A 2V74B 4QYSA 3FTPA 3R7BA 3TXXA 5J23A 2VP4A 2ADOA 3HXTA 1WBBA 3SC6A 1P60A 4NRDA 4ZYUA 2I2AA 3RDPA 2Q3BA 1XO1A 1XAGA 3H65A 4E2FA 5DCUA 4GPEA 1BOFA 5IBPA 1VCNA 1ODIA 2BOVA 2G07A 2O2ZA 2DC1A 2W2TA 4MRRA 3MELA 4ASUA 5J47A 1G7CA 1NF3A 1NRWA 4MV4A 5EJ8A 4OMCA 3BK2A 1RP1A 1ZD8A 1KP2A 3EWAA 3TNYA 3V1NA 4CLXA 3WGGA 1TRKA 2RGBA 3KU4A 3UPTA 4ARCA 3VR0A 1O9BA 1Y4SA 2Q2NA 4E1AA 2IHVA 4QG7A 1Z6YA 5ECWA 5DN9A 4NULA 1UEJA 4X64B 1BMFD 3TLCA 1OXBB 5JEDA 5GONF 4RY8A 2CN1A 3SC2A 1T4BA 3KC2A 4QOEA 2ZXUA 1TA4A 4ABYA 5JSQA 2YIJA 2VDUE 3BXGA 1KVRA 2P6MA 3U0VA 4QVIA 4ZO4A 4BX0A 3V7NA 2BI8A 5L51A 1S2LA 4PAWA 2RI1A 2H1SA 3L8HA 3NIWA 4YFVA 4BGEA 4GLOA 3IVAA 2ZJ6A 5FUQA 1JFTA 3CS3A 4G0VA 3CRMA 4FDLA 4KYVA 1UC8A 4WY2A 1WVMA 4EFNA 1KAQA 5JNUA 4OHXA 5LQAA 4Y0VA 3RSFA 2QQ0A 1O6CA 4DC1A 2AEEA 4HDAA 3F9CA 4N47A 5KTSA 2HMVA 1EGHA 1OMOA 1GQ2A 3G0OA 3NANA 3PRJA 5HE8A 1VDMA 3FOWA 1MR3F 2NAPA 1U1CA 3NEAA 4PFKA 4XSVA 1TZCA 1NIJA 3ZDYB 4NCHA 1CQWA 3N0RA 1Z25A 5K3EA 1QG4A 1XZMA 2XOKA 3ETEA 1YU9A 1TVKB 3B1KA 4GOKA 4ZQHA 1P91A 5DH9A 1XD9A 4ZODA 1QH1B 1NQTA 4OFZA 3CURA 1WW3A 3H19A 4BNUA 4YXWD 1JHRA 3W77A 1Z29A 1ZNWA 4BVJA 4BQIA 5GTDA 3D7KA 3GAMA 4PXAA 2DQYA 1L7DA 1SGWA 1XQVA 2P7IA 2Y0PA 1ZJJA 3IMKA 5EQTA 3D3WA 1L6RA 1TLLA 3C14C 4RVOA 2PUCA 2AQHA 4IQ8A 2H4YA 1I4EB 3P26A 2Q4BA 2N0SA 3QITA 1OC2A 4OQYA 4REMA 4ZCLA 3THOA 4ATNA 4EB8A 1OAKA 3O4HA 4QTUB 4YONB 3WAGA 1Q0LA 2F9FA 3G2KA 4B48A 4E0BA 1ZL2A 3B3GA 1P62B 1V4BA 2J9FB 2R8EA 3ORFA 1Z0ZA 3QHAA 2D1TA 3U80A 1MO5A 1UK8A 4HVTA 4IUCS 2RC6A 5CLGA 4J6FA 3LKBA 3D54D 2XXAA 1K8RA 4Z3DA 3IT3A 1E2FA 1K7SN 3E4CA 3KL4A 3MOGA 1NC3A 3NETA 3ENQA 3LLSA 1L2TA 1Z0SA 3P32A 4G89A 1J24A 3PNLA 4OI1A 3O8CA 4RS3A 1HG1A 1W4ZA 4EHAA 2O8FA 1JBQA 1UP6A 5IASA 3LTEA 3QM1A 2IOFA 5SYMA 4CDNA 4KAAA 2VAXA 1O95C 1TCBA 2YZKA 2H1WA 2NT3A 1U9IC 4PYKA 1MBZA 2EX0A 3AF4A 1UK7A 3K3PA 3C7KA 2PQ6A 3T7EA 3SJCA 2G6TA 2J08A 4X1KA 1ZNXA 2R7MA 3P1JA 3LZDA 2ADMA 2IXDA 1O0BA 5CYOA 3E70C 4YCLA 2ZUCA 3PSAA 2GYVA 1R16A 4QD3A 3F6YA 3L8ZA 4Q1FA 4ZK2A 1G98A 5LKRA 1UKVY 4MUKA 2IODA 3CNEA 4OIFA 3UB2A 4EENA 1QBGA 4Y2YA 5BURA 5AESA 3FZGA 1N3LA 5EJ5A 2PE5A 1NAHA 1M76A 2XODA 5DLPA 5B3JA 4KH0A 1Q15A 4GOXA 5CGQB 3ZDCA 4R2MA 5J2TF 3U7JA 4DJFC 3BXXA 5C52B 2HU5A 4Z6KA 4P92A 2QVLA 5CNIA 5DWDA 2HXSA 1W2HA 4NMHA 5EPUA 4FLFA 1Y6FA 1AN9A 2AZDA 2UKDA 1G5TA 4NYMR 2QM3A 2I22A 4E1VA 2XUIA 2OXIA 1YR9A 2NV2B 4ZIRA 5EE1A 4L5IA 1JXAA 3IEVA 1NI4A 2UYYA 2AHRA 1Y98A 2NYUA 1YL6A 1L4FA 4QUGA 4CCSA 2JAXA 3RBVA 4ER6A 2YZNA 1Y6JA 2FR8A 2ZIEA 4Q03A 3K72B 5COBA 3RAJA 2JDID 4Y9DA 3UK7A 3R7DA 1L5MA 1MH9A 3TLZA 3JARA 1MPTA 1NYRA 2FVYA 1A4RA 1DZ3A 3C8UA 3KVYA 2FK8A 2R5WA 3CZAA 5FUYA 3ZH2A 3HO6A 1VE5A 5EVJA 3JPWA 4H08A 2O8BA 1XEXB 1WL8A 3IDQA 4ARAA 4CQMB 2ZRAA 1B8VA 3LO5A 5A05A 3OIDA 3V4PB 2QX6A 2A5LA 3SR0A 1Q57A 4LDRA 2PRKA 3RODA 2AXNA 4D4HA 5BQXA 3P9QA 5LDDC 2D1SA 3GD5A 4DIDA 1ZOSA 5TX7A 3GXBA 3E15A 2WWHA 1D2RA 2WE7A 2W11A 1S1CA 3OHMA 2P30A 4XVHA 4DREA 2WUGA 5JCZA 2EJUA 1JLLB 1V96A 3FR8A 4FNGA 1QE5A 4LY3A 4BLPA 5ELLA 1EAMA 1VI6A 5HF5A 2FI1A 4LDNA 3L8GA 2ADFA 4PGGA 3NM4A 4Q24A 3ZWXA 4EDFA 2QRUA 3ZW9A 2W22A 3NU1A 4CQLA 3K70C 3VZQA 2H65A 3HC7A 3QBVA 5BSEA 3MWJA 5K05A 2EQBA 2HRCA 4B44A 4PR3A 4FYIA 2ZI7A 5A9TA 1HRKA 1LW6E 2XBLA 3ROEA 3TQTA 5CEEA 1PUIA 1AO3A 4OK3A 1U0NA 4OI2A 3FVVA 1TVMA 2VRNA 5FFMA 5HQ3B 1T34A 1XVTA 3GLFB 2FXIA 5A9RA 5ENDA 3QPVA 5BN5A 3K2QA 3FTFA 1E6KA 2H7YA 3SBEA 2BLLA 4WCFC 1E8NA 1D03A 3FFAA 5E9QA 3ZCSA 4ZYYA 2YASA 5E2BA 3TRDA 5LD2B 1PS8A 4QGGA 2HPAA 4I1RA 1G16A 1GN8A 4R9RA 2A59A 2FJUA 2PH5A 4CL2A 2WEKA 2OGSA 3DQQA 4BIMA 4CLOA 1VFNA 4RD3A 1JJAA 4IHJF 1ZAKA 2PWYA 4L9RA 1BWPA 1EM8B 1BE0A 2R85A 2QRPA 4PNPA 4KVFA 2W70A 1V9CA 3U7EB 1T9GR 5C1PA 3JQ9A 3OPQA 1FSPA 1RZ3A 2W71A 4NK4A 1KYYA 3EZ6A 3OEED 5CVUA 3UK2A 4HC4A 1HT1E 3NIBA 4ZYZA 4DV7B 3AVTA 2ZSDA 3IULA 3KZKA 5HZGA 1OPXA 2LCQA 1XNQB 3OT1A 4ZQBA 1O9HA 3DAOA 1Y4ZA 2O0LA 4H27A 4MW4A 4UTXA 4BOYA 8GPBA 2QVYX 2R6HA 2AR7A 2DB3A 4OJNA 3RC9A 1L5HA 5EXDA 4RHEA 5FADA 3VYRB 3LPNA 2YNMC 2E18A 2GGSA 1VPLA 5C31A 4QQKA 1BEUB 2GCGA 1F5NA 3T34A 3ZWWA 3DOFA 4RFSB 1JKJA 2WF5A 1H8EA 3BFXA 1GTRA 1ZFNA 3FWHA 1XMIA 2VKQA 2XT6A 1S7CA 5CLHA 1AKTA 4QNMA 3KZOA 1A1SA 3QBTA 3F2IA 3DBLB 4Z51A 2GSWA 3CW8X 4LBVA 4R98A 2AZXA 2IW1A 2ECFA 1LSJA 3MUNA 4HMQA 4M99A 1G5FA 1IK6A 3I9JA 1CJVC 4CW7A 4OHWA 2JAUA 3NEYA 4JBHA 3THXA 5ILQA 4HMPA 5IYZB 1X1QA 1OKKD 3D6MA 4CKCB 4BU0A 3PGKA 2AQKA 4I7EA 4X94A 1RYMA 3BHJA 1XL0A 1KERA 2ZAYA 1BH2A 5DWQA 5B7GA 4M46A 1CNEA 1CRZA 2HR1A 2FFQA 4B6FA 1DWQA 1ZP6A 3I83A 5BW5A 1OXSC 2BYTA 1I6MA 2X8JA 1LSOA 1LBIA 4MUGA 4MUBA 3WKCA 4DBLE 2B78A 1PLJA 3QENA 4FUTA 2OAEA 2IS4A 1NVDA 1PZEA 1J6UA 9LDTA 1K4KA 1A71A 2PL5A 3E7PA 5F23A 1ZXLA 1U3DA 2OV4A 2CFSA 3NAGA 1EBBA 1LTKA 2CJWB 2GXSA 2JI4A 1RI5A 5I7OA 1Z7EA 3ZDDA 4ZRNA 5LUAA 2C61A 4HDSA 5JAIA 2ACWA 3RM3A 1D2EA 1JDZA 1DCKA 4IVPA 1GLVA 4L8YA 4BJ6A 2WQ6A 2E4UA 1SD1A 1DTSA 3SEQA 4OHKA 2UXDB 1X6VA 4I6GA 3ZEAA 4RTMA 3CRVA 4RV5A 3FMIA 1LC0A 2G8LA 4Z4IA 3M9XA 3P0HA 3CLVA 2GCOB 1REQA 1JVNA 3CNQS 2IZ0A 1FQWA 1GTMA 1YQEA 3F6BX 3H0EA 1NVBA 1G41A 2C9MA 1SHJA 2AD5A 4TXLA 3RRMA 1XPUA 5KKNB 2DPMA 4J16A 4DPMA 1SIBE 2X15A 4RKRA 1KL7A 2YHIA 2LDXA 3B53X 4GOLD 5B4VA 1I4LD 3TFQA 4QYMA 3GFTA 3H1GA 4UNIA 2P1ZA 2GQ0A 2PZMA 4D9CA 5FBVB 3CVVA 1MJNA 2FUG1 5IKPA 1ECJA 4RHXA 3RTDA 1Z0FA 2WIKA 2Y2VA 3UHPA 1PWYE 1SZCA 3NT4A 2WNHA 2X2PA 3QNMA 4H15A 3UMRA 3AGPA 3I4LA 2CNKA 1E5QA 2BMDA 3FX2A 5DB4A 5KPJA 1W1WA 2AJDA 1T26A 4C4YA 1WU7A 3H5IA 2CB9A 2VF8A 1JU3A 3AR9A 5JVDB 4NOJA 4LXGA 1CNFA 1YGYA 5ANRB 2JFGA 2QGNA 3PIRA 5LLSA 5CIQA 4YJDA 5HIJA 3VU0A 3ELYA 3EGDA 4PYRA 1MOSA 4JOQA 1QFZA 4FCCA 3RVSA 5MN5A 2CLFB 3OUUA 3LBIA 5JS1A 5JMTA 4GKKB 3R6GA 2Q3CA 2BLNA 3BTUA 5BXYA 4CTOA 4NIMA 3D3JA 3HKDA 3LJKA 3OZIA 3SFVA 1VLZA 1IXZA 4LRWA 3LSTA 3MS2A 2OZVA 4EGCB 5IP5A 3LYAA 4WBNB 4EUFA 1GKYA 3QMMA 1IHDA 3ZZTA 5C32A 1ZNYA 1DMRA 3UM9A 1IDN1 2OUIA 4FI3F 4BJ5A 5LLDA 1V47A 4QDOA 4YAJA 1DXYA 5ENZA 4I4TF 4KDRA 3IOYA 2O2XA 4RY0A 4FXPA 1FXWF 1RW4A 1VSBA 1E3WA 3NKVA 1NJ8A 3RIYA 3UA4A 5CT4A 5FOXA 1FFGA 4S0ZA 1HG0A 1T1EA 4TVKA 2HMTA 3IAHA 4C0BA 5A0FA 2XUKA 4ND6A 4XR4A 3U3JA 4HNSA 2GNPA 1XZBA 1YBVA 5DP2A 1NQOA 1ECCA 2H4XA 3E84A 3OPXA 2WFMA 2BEWB 3D2BA 2O3TA 2H3HA 3GP3A 4JLDA 1Z15A 2ID9A 4KQFA 4L0QA 4LHWA 1KU6A 5ED0A 1RKBA 4OI0A 1MUUA 4RZIA 4B46A 1BDBA 1S3FA 5L3QB 2FNAA 5PGMA 3G0IA 4BY9E 4OQ4A 4QGSA 1CU1A 1MC1A 4MYTA 3GLFA 3QNUA 3L8FA 1LFAA 2HNBA 3EQZA 3WO1A 2IVZA 5CMLA 3RVNA 3L7DA 4FSXA 3BL6A 3WYCA 5BWCA 3GUVA 4RA6B 4INOA 4L4RA 4R9NA 4TWZA 3ON5A 1FQOA 5HUJA 1E3TA 3HYTA 1YQTA 1LVUA 3AEZA 5FWYA 3CZCA 5F77A 4AJLA 3PUVA 2J8ZA 3FXAA 2VTVA 1VL0A 4QU0A 3SR3A 4JB3A 3JWIA 5IEBA 3G5LA 3G13A 2ZBEA 4R8SA 4Z3OA 4IZHA 1Q0TA 4D9HA 3NJRA 3H5LA 1XTZA 4GLJA 3HO1A 1XQ6A 4A0RA 2RH8A 1R18A 4D9EA 3TTVA 1X70A 2XQGA 1QTQA 1ISPA 2WRZA 2XPCA 3N0TA 3W5AA 3PWSA 1ZK1A 4MW9A 5AIAA 1PV4A 5H80A 2HPZA 2IV3A 3A1VA 1XEXA 2C2GA 3WL4A 5HJ7A 5L6LB 2FEWB 1ZHOA 1H93A 2OAGA 2QENA 4JYMA 3U4AA 4YYEA 4K9LA 4JQOA 4E88A 1YMQA 4B6RA 3O8OB 4N39A 3T5MA 1FFXA 1JSZA 4RTKA 3P9NA 1II8B 2XDAA 3CG0A 3E9QA 5FBKA 2CLMB 2H1CA 5LUBA 2QZPA 2QN1A 4WADA 1QP7A 1A5SB 3HKDB 1RRPA 3WLTA 1E4YA 2ZM6B 1GUYA 1MW9X 1LWNA 4IIHA 4HGPA 4QO7A 4P7FA 3MTBA 2Y1FA 2VP0A 3N7UA 2ECKA 2GF9A 4RD4A 2FWIA 3FVWA 1YBHA 3O91A 3WLJA 1E3LA 4AROA 4BLVA 4YI3A 1KI8A 2ZBGA 3S3TA 5B3LA 3QELB 4A6DA 2OZLA 5LP6A 4P0QB 4FXOA 1ZBQA 4J75A 3NXSA 1ZK0A 4OIMA 4ARZB 4CMIB 2AOTA 1BWSA 2V03A 1PNRA 4PYQA 1G3RA 1CUFA 1NQUA 1WQ1R 1N6HA 5TMPA 1VP3A 1BVRA 1C0EA 2ROQA 4WCVA 1EBFA 5JJLA 3SVTA 2ZM5A 1CR2A 1OXMA 2P0EA 1K6JA 2VQSA 1TCCA 5EMJA 2LZ0A 1T5BA 3MWLA 4KWHA 1YZVA 3PXGA 3X2FA 1ZCAA 2JAHA 4QU8A 1UDBA 5FA5A 3P9CA 5GWXA 2M1XA 3SZ3A 4E2YA 1Y8CA 2BSXA 2PU7A 4KUEA 5HTOA 3RRZA 2IBSA 1G9XA 4EY6A 1TZKA 3NNSA 1A88A 4I5FA 4RD2A 5CVJA 2D8MA 3DV9A 1RPTA 4JLJA 1X8LA 2HLDA 2QROA 3F1LA 4J4HA 3IV9A 1CJTC 5JAQA 2EKPA 4RLQA 5DYWA 2P9EA 5FBZA 1BX1A 1YC5A 4O2BA 4TT3D 1NT2A 1JFVA 4BFTA 2AUTA 1UP7A 2A58A 5L3QA 2CL0X 4RELA 5JCOC 5K3FA 4PZDA 5I7SA 4HD8A 1AZLA 2WWRA 3NVMB 4H7JA 5EIHA 5AI6A 3DQZA 5DBGA 2BGJA 2KPOA 3VDRA 1B6TA 1OZHA 4Q3EA 2ZE7A 1NE2A 3T3DA 5MFPA 2JCYA 1S6YA 4GXTA 4EY3A 3WFIA 3RHSA 4YUXA 4R8KA 3TR6A 2HJSA 4Q3AA 4RQTA 3U0BA 4GQAA 3U62A 5JI2E 4AZ3A 5KQMA 3I58A 4JSRA 4ZI7B 3M6WA 2H1OA 2EU8A 4MWZA 3X3HA 1O89A 3L8DA 4BMYA 2H59A 2C96A 1JG7A 3EGCA 1PFYA 1NV8A 2C9ZA 3PNBA 3C5WP 1Q2XA 3U7QB 2FDCA 3BE4A 3DCJA 4C7VA 4IWYA 2OBNA 4EBFA 3KVRA 3VPSA 4OY3A 3FSEA 2IYYA 1HOXA 1TECE 2FR1A 1EESA 4XIIA 1KQNA 1M6YA 2ZI4A 4LXXA 1AT1A 1W0JD 4ARBA 3LX5A 5IHXA 4WOJA 1MAWA 4KK3A 4Q48A 1OH8A 1RYEA 1SG0A 2RHCA 3DKKA 4GR9A 1T4CB 4N0EA 4MQEA 5FFFA 5JCJD 1XTRA 4EGQA 1QAOA 1C9JA 3OC6A 1N2EA 1ZOLA 1IBKB 1EE2A 2PXHA 1X2BA 1QYDA 4QRHA 4IM7A 2IPLA 3OX4A 3RYCB 4BCCA 5K3CA 3SHQA 4CL0A 5G53C 4RDIA 1UM9A 3SSAA 1BE6A 3NBMA 1JLMA 1U99A 3L8YA 5TC4A 1E18A 3CU5A 2AXEA 3QPWA 2HHHB 2ZSEA 4JKIA 3C1TA 4L15A 2JGKA 4BC1A 4FZJA 1KQOA 1CP3A 4TSFD 3HXPA 3G9XA 2XBMA 1VZ2A 1XLWA 2NPFA 1MJFA 1GWNA 1QM5A 3CMMA 3EJ6A 3FNHA 4QOHA 5LBIA 5BV1A 2ZIUB 4AT1A 1I1NA 1QAMA 1JKJB 4J1TA 3LI2A 1X74A 2XYGA 3FFXA 3H5NA 4MW5A 4U7HA 5IUKC 2PS0A 5F5LA 3O03A 5JSZA 4BO1A 5KNDH 3GBPA 1JKFA 4K9NA 4TMFA 3NB0A 1E9CA 4YQYA 1K6IA 5JEEA 3SWWA 2O19A 4C2AA 3UWSA 4KL8S 3GGOA 2QIPA 5SZHB 3QLVC 3AUUA 3M2PA 3C24A 3ISJA 2CHVA 2D54A 5DM70 1ISRA 4EY5A 1TCAA 3I01M 2BGWA 3DTVB 2ODPA 4HAOA 4B3RB 3GOHA 3Q7SA 4FDTA 4O5OA 2Q3JA 3DM5A 4DR4B 5EINA 5CVTA 3U13A 2WLSA 1L5OA 1XLUA 2YWCA 3G6KA 4I3FA 1KOGA 3ESZA 1II0A 1W59A 1Y4AE 2JVKA 3HWWA 4HS9A 3ZI0A 1TJNA 3HDVA 4JLVA 1RWNA 2OCIA 4WKOA 3ZOKA 3PPYA 5GGYA 1USWA 2DJ5A 5HS4A 1DHRA 2E5WA 3DO6A 4XYEA 3E23A 4U9IS 1RYNA 1ZJYA 1NE7A 3C5EA 1JJIA 3U56A 4TVSA 2J9RA 1FXWA 2FF7A 5M34A 2ZB3A 1IZ8A 2QD3A 3BT7A 4KLZA 1YS6A 3OM9A 2FZEA 4P5EA 3P0EA 3VU9A 1FPQA 4F3TA 2BBOA 4GI5A 1OGIA 1ZQ9A 2BHLA 3VJKA 3LUJA 3TWOA 5BMVB 1PGNA 4FU0A 4EG6A 3SQDA 2D7DA 3H6HA 3BKWA 4P3KA 1P77A 1U2DA 1HUQA 1G63A 1IBSA 4NQZA 4ER7A 1NJ2A 2FN9A 4N5HX 4F60A 1RXCA 2GFHA 3O82A 3EIHA 2PD3A 5CBPA 3NGXA 1VJGA 2NUBA 5EJAA 4ND1A 3UOAB 3WWCA 4B3DA 4YT8A 1RCFA 4QBTA 2BKEA 1U81A 4IICA 3U7RA 2X8WA 1KU0A 4N8SA 4CE6A 3DH0A 3C3CA 3PK0A 4F3CA 1JIXA 2QVGA 3IKJA 2J9FA 3EBOA 1YVDA 1KY2A 4EPTA 1GCOA 4XE5A 1XRLA 1X0XA 4I6JA 4O4JB 5IJXA 2J0EA 5DTJA 4G8DA 4B2YA 1JMYA 4YECA 1JZQA 3MAAC 4R16A 3OAAA 2Z2IA 3GHYA 3WRXA 1J1ZA 4I36A 3QU5A 5EJ2A 1VA5A 1XTBA 4EG5A 4OSOA 4M22A 3BZUA 3VGPA 1IUOA 1LSUA 1W0KA 4A3SA 1QO0A 2QUIA 3CX7A 3WSWA 2FPKA 3N53A 1T9GS 4I4LA 4MQ5A 1GL3A 4B2LA 3VNVA 1DAOA 4EW6A 5H3LA 3A4TA 4MVJP 1MFPA 1XTQA 2NAFA 3ZLUA 2QRHA 5F1PA 2LKCA 4AW9A 2QM8A 1ZGHA 1WLYA 1T3SA 3ZDFA 4JBYA 2UZ1A 2DP4E 5IAAA 3Q0EA 1MVLA 1O95D 2XQFA 4GGMX 4RPCA 4Y67A 1O95A 2I4RA 4UAJA 2Z4RA 1E9SA 2FWMX 3KDAA 3RYFA 5AICA 5HJEA 3EEQA 1FNCA 1E1MA 1MHPA 3O4GA 2ZBPA 3CX4A 3JSXA 2NO4A 1W5FA 2BELA 4YLGA 5CDTA 3HEAA 2ATIA 4E5PA 5HM8A 2H18A 3SX2A 1U9IA 2D06A 2JA1A 3FZNA 4JVLA 1ESNA 3TUZC 2FPXA 1CFZA 1CS0A 2VEDA 4N6NA 3FDJA 4OXIA 2O1WA 1UJ6A 4A5OA 2AQIA 3E9NA 3G23A 4I1OA 1UF9A 5EESA 3O8RA 4KMRA 1KFEB 1V5IA 2DKOA 3S5JA 3ET5A 5JDIC 4YLEA 2ZYWX 3ETJA 3UICA 3U3OA 2ZDQA 3IV6A 1VMDA 2HLNA 2RJNA 4NH0A 1S02A 1YB4A 1Q17A 4IYRA 4CKWA 3WHLA 2GVZC 4S1NA 2IZOA 5EHIA 3GJSA 5FWAA 4IHKA 3VQTA 3OPMA 3FYTA 4IIFA 4XQGA 5KVAA 3QOYA 1FVFA 1OX6A 1X7XA 2HADA 3MXOA 3FOCA 4GVPA 4PG8A 3OZUA 4XOUA 4KX3A 5KINB 3ADDA 2QZSA 4D4KA 2R1ZA 4IGAA 3ZUGA 4XWGA 5DEIA 3FDIA 4F06A 2GZDA 2QTFA 1QVZA 1Y7IA 2WSBA 3QMVA 1OX5A 4K40A 5K6RA 4LF8B 4KXLA 5HCNA 1R15A 3T52A 1YR6A 4LRTB 2OAP1 3I62A 4BMNA 2HF2A 5HGXA 4K46A 2PXCA 3OHPA 3IERA 4EW1A 3VZCA 5MN4A 3JAWB 1U2ZA 2LCFA 5AKHA 1AVTA 1DIGA 4R1SA 2BM8A 1IWBB 1U8AA 4PWYA 3RYHB 4HFNA 3RVOA 1Q0QA 3SS7X 3PQ3A 4NCBA 3VXKA 4JL8A 4Q9IA 2HJVA 2QW0X 3HA2A 1MENA 3RRJA 2BM0A 3G2PA 2FPLA 4LDJA 4PO9A 3AKYA 5LVAA 3FOFC 4P83A 3UMJA 2ZJ5A 2REQB 3MMSA 1Z06A 2XXJA 1XXLA 3A6LA 4P9NA 4A8PA 1TGYA 4BKRA 4BGDA 5CFLA 3EG5A 3ST7A 1GSHA 3KUDA 1OB2A 1HE5A 1EEXB 1PZHA 3WLAA 1YIAA 1Q0PA 3PFCA 4LJ4A 4P34A 4G65A 2I2FA 2GARA 1WDWB 2PUFA 3JATA 4RYDA 2BL4A 1LDEA 2BC9A 2P2CA 2Y6VA 4YEDA 5WRFA 3TZQA 3EPJA 1HLPA 3BE5A 4J49A 4OHUA 4ZOLB 5H5JA 2VT3A 1WWKA 3E9YA 3LT1A 3T9BA 1XZCA 1EHYA 3DBIA 3LE8A 4FD2A 1GFZA 4LBYA 4MVJH 2OBMA 1N6LA 2X3YA 3C8DA 3KFVA 4BE9A 3ECAA 3F6CA 4TUYF 4BNFA 4BPRA 2CMKA 1KY3A 1CR6A 3AF5A 2MSWA 2TMDA 3BEOA 3QE0A 3PKJA 4DR3B 3W9BA 1P45A 2Y05A 4TSRA 1GNTA 1DOZA 1JHUA 1Y1TA 1BS1A 3O93A 1IZ0A 4B3GA 1Y5IA 2NYVA 4KQ2A 2QLJA 4DKXA 3A4VA 1FRZA 4NFYA 2W6JA 3TRJA 1QH0A 1YSCA 1Z82A 2K4MA 5EWMA 3F71A 1XJQA 4D4JA 2BFNA 2CLSA 4IO1A 2VNJA 2Q7DA 1EGQA 5FORA 3W2IA 2HMAA 3L77A 4YXWA 4N54A 3MMPA 3UWOA 4BU1A 2G1PA 2CJXA 3B1ZA 4H4EA 2DHRA 4HATA 5KEIA 3NBKA 5BYBA 3KPUA 1UBEA 2G3YA 3VOSA 3UJ3X 4E51A 3H5AA 3Q3JB 4GP7A 5CA0F 1MPXA 1HX7A 2G4CA 4PYOA 1RYYA 4GLLA 2Q2QA 3RF6A 1EI9A 3G5AA 4LJ7A 1NJ5A 1UXGA 4WKNA 3PCXA 1M2OB 5EJIA 3WVNA 1SQ6A 2YFHA 1DFIA 1RHRA 2JCSA 4G41A 4LECA 1CZNA 1BIFA 3PKZA 5EMKA 4Z1MA 3NHZA 3UUGA 5BVHB 1YASA 1Z75A 2Q5LA 4C4AA 1YA4A 1SBZA 5IF9A 4MUEA 3OQOA 2CDRA 4XFKA 2OCBA 3W3AA 3VYSB 3D5TA 3WB1A 1KKUA 3A9TA 2GR9A 4G1FA 3IPLA 5E2AA 2OXTA 3IE0A 3VR2D 4M0FA 2A14A 1C0KA 1FDTA 5E3IA 5JCOA 3GPLA 2R0QC 4RTRA 1KDPA 3K9HA 2C59A 2GZAA 3V4VB 3WLPA 2W90A 4ZT5A 4CLHA 2O7RA 4B7UA 3JU3A 2D62A 5D51S 3WKBA 3ZYZA 2J32A 4DSTA 1MA3A 3PKIA 3ICCA 1U0OC 2WB2A 4TMTA 1E8DA 1PJ8A 5BQ3A 1QK3A 2YV1A 4DLBA 1M0EA 3CLRD 1K1EA 3DXFA 2QTCA 1GSIA 4PAOA 5J59A 1A8QA 3O21A 1KI1A 5BPHA 2BRUA 2CY0A 4G67A 4GW3A 3FB4A 3WSVA 5LBTA 1UXOA 1YHYA 3OF2A 4FFRA 4QJBA 4QUJA 4D42A 1XXHA 3EPRA 5DFAA 3H1TA 1J2RA 3CB4A 1BROA 3HWRA 5CW1A 5JMOA 2VUTA 4DWJA 4D26A 2MR5A 4ESHA 1FXUA 2YZMA 4BVBA 6LDHA 4AIRA 5ALEA 4G5GA 1WDKA 3BA1A 3OOJA 1XHEA 3ND6A 3GRYA 3K6RA 2OQIA 4PG4A 3FTNA 5GJVC 5J1TB 3S8MA 3J81A 3EQ8A 3L0CA 1QC5B 4NYMQ 4NU8X 5IFLA 1JLRA 5DYGA 1EFVB 2VQ3A 4LZWA 4CTKA 2CD9A 4UD6A 5DBEX 3E5MA 2R6DA 5SY4A 4AJ2A 3EZXA 1IM8A 2APJA 2Q1WA 5ALMA 3WIBA 4HX2A 5GOZA 5AJZA 3JYHA 2QMYA 3PG5A 1UXHA 4PLVA 2IP1A 3FWNA 4S1OA 4AYWA 4WFQA 1Q95A 4G26A 3ZPXA 1PJLA 3MJ4A 4NMMA 5DO9A 1ZVVA 2Z2ZA 2BE9A 3IAXA 3A6FA 1DIBA 2KBFA 1ZD5A 1LZLA 1PP4A 2GNAA 3IL2A 2FOLA 1QTRA 3IVMA 9ATCA 4MYRA 3KTFA 1BSVA 4JEMA 4DOMA 4OHFA 4MDEA 4REQA 2G76A 4B6PA 3L4BA 2FEMA 2PH7A 2PRYA 3GLTA 3PTZA 3QLUC 3ES9A 5ICSA 4AZWA 3QG1A 4Z1OA 1YCHA 3I37X 2CL7X 1BHJA 3QLVA 5MDHA 2PZLA 4G5FA 3ZGLA 3SLRA 2G80A 2O4CA 3A27A 2BTEA 2L69A 4B32A 5EL0A 3JASB 5H68A 2FTKE 1YQQA 3VR3D 1CJBA 1SC3A 4WOBA 4JMPA 4BLRA 2ZWIA 2WAOA 2AG5A 3CUVA 4NQRA 1NF2A 2PX0A 5CYFA 1ZMXA 1KP3A 1WRBA 3VU8A 2QMEA 4DV0B 5AW6A 1W47A 2DR2A 4YRDA 2WUDA 4X93A 2ORVA 2HRBA 2OV3A 3NTQA 1MOZA 4AY6A 5E7MA 4NDAA 4QICA 2DH6A 4S1WA 4JZKA 4LZNA 1PJ2A 1OV6A 3K1AA 4JVNA 5CX1A 3GLGB 2UUCB 1RIFA 1SXJE 4DRXA 4F1KA 3GO4A 4R0MA 2C42A 4WXRA 5IUJC 4UHEA 2J6HA 1RJEA 2CF5A 4Q1VA 3WL3A 2IPMA 2VBIA 2XGGA 5BV2P 4RTLA 3BDIA 4FM9A 1FUIA 3B5EA 4JNKA 1SBCA 1Q7RA 4WFKA 4I1YA 4CT0A 2WPNA 2V1XA 1GGHA 1ZXBA 1IZZA 1DT5A 1R8SA 4BB6A 3DYVA 3O9MA 1I1OA 2BY4A 3TMAA 4Q1BA 2UYOA 5JI3E 4FONA 3KOOA 2IIVA 3GUCA 4HNRA 4AZ0A 2IKQA 1VJ5A 1SOVA 4HI0E 1DXOA 3C5VA 3M6IA 2Q8PA 4OJYA 2BFFB 3BQNB 2OGWA 4ZAWA 3W1VA 2JIPA 5L7YA 1RZUA 3EE6A 3ILHA 2NU7A 1C41A 3QEOA 1JH8A 3BJRA 5T57A 4QG3A 1YJ8A 1RC8A 3LUFA 4AYTA 4PBSA 2WJYA 2Y4OA 4N3GA 1N0WA 1P7ZA 4I46A 3RT1A 1PR1A 2JL1A 3LDFA 3TTWA 3U4IA 1UADA 2ALJA 2H9AA 3EH2A 1FS6A 3DNFA 4BNGA 4BO5A 4YHHB 2C2ZA 5AVZA 3MILA 3BB3A 1WUHS 2QN2A 4TYMA 4G56A 1SOUA 4AKEA 2O8EB 1V1MB 5E8JA 2QJFA 1AHPA 4AKIA 4FZRA 2WMNB 3VH4A 5T64A 2Q28A 1T1IA 2Y1LA 2H1VA 5DM60 1T8SA 2QYSA 4HDNA 4JR2A 5JISA 1FSGA 1XRPA 1NP7A 4C5AA 2XCOA 4G4GA 2CUNA 2WUEA 3HPQA 2Q7OE 1JW9B 3ZQ4A 4YUZA 2AFIA 1MT3A 1U3FA 1LDYA 1RQXA 3MCAA 4KQEA 4AS2A 1ENZA 4B6OA 3CONA 1XYGA 3FCOA 4C21A 2Z0MA 5FKJA 1VPTA 4C6HA 3K70D 1IWPB 1G6OA 3RYTC 3T3EA 3Q7EA 4ANFA 1S8AA 4UUPA 1QFYA 3GX1A 1DZIA 4HRYA 3L7IA 4YCJA 2VLIA 2ZT7A 1E6CA 3T94A 2ODQA 4R2HA 3X1XA 3DOJA 3JVEA 5A5DA 1XDUA 2C2XA 1QOZA 3FCSB 2MIIA 5BN3B 4MAAA 4XWWA 3H1EA 1JNXX 2FZVA 1KVUA 1OU0A 1QNLA 3MAJA 4Y2UA 3AVUA 5K0EA 5CIWA 4CMBA 1GL6A 1PEYA 1YNSA 1UOEA 4X8OA 1D2GA 1U8XX 1RRCA 2A84A 1KO5A 5E9AA 1PCXA 1TYDE 1D6SA 4QEKA 4HNVA 4YRAA 3VTZA 2ZPTX 3L1IA 2O2EA 3I2KA 2OYSA 2R6GA 1KBZA 2H5IA 2WDZA 3VR6D 1KOLA 3BJEA 1P2UA 5ITZB 3DO5A 2CHEA 3U44A 3KL2A 5BWMA 3BICA 1F2UB 3LYUA 3B8EA 2NU6A 3MS7A 1TJ4A 4ETMA 4O02B 2VH5R 5C5IA 1ISJA 3PJRA 3PDJA 1F0YA 3PUZA 4B8WA 5JYCA 1FRNA 5E6RA 1TO6A 3B89A 1D2HA 2DHDA 3K0HA 3ZVRA 2WU0A 5K03A 4DW8A 1XT6A 1FP4A 3MT0A 4TXNA 4CR6A 1G4AE 2A57A 1J20A 1E32A 4EYKA 4RAQA 4B3BA 4F6CA 6NULA 2E1RA 4O29A 3AMVA 2XUOA 1FSSA 3ZOZA 2OHVA 5DYIA 4YP7A 3ADBA 1VE6A 5C8VA 5JNWA 4EUKA 1FPMA 1GDHA 4PCUA 4RGBA 3PX7A 1VMIA 3L7CA 2JI8A 4D4MA 2ZITA 1Q3TA 3SHVA 2OZEA 4UMFA 5JJCA 4Z99A 1O8CA 3W34A 2ZB7A 3OETA 3PUYA 4NS1A 4EOGA 2JGFA 1NSFA 2QPTA 3HKBA 3COPA 1ZU4A 3OCYA 1UC5B 4JA0A 4M8IA 2H2HA 1RAGA 5FHQA 3UN1A 5CA1B 4G81A 5IC5A 4EARA 5BW8A 2FXVA 3ZKWA 5CFNA 1PVDA 3QU9A 2R1TB 2VK2A 2RAPA 4Q9NA 2M2IA 2LTAA 4W99A 1XTSA 1Z17A 1VIVA 5CCDA 1CS4C 4ML3A 1K7XB 4B3HA 3EXAA 3SS9X 3VYUB 2PKYX 5C35A 4EGJA 4BO7A 2HC9A 3MZ0A 3TX2A 2PAFA 2W2KB 3KQKA 1RC0A 5HW0A 4Q4HA 1JF8A 3OO1A 4FW9A 2G67A 4FSHA 4PX5A 4F5ZA 1BRTA 3M4YA 2XZOA 4FFPA 4Q4JB 4MMYB 1QX3A 1IVSA 4KQJA 3T9AA 2ERYA 4HQNA 2KBEA 3DVAA 3E3AA 3I42A 3CCFA 3PC3A 4C04A 3OF5A 2GXAA 3INYA 3KRTA 4MAFA 2NU8A 5HF8A 4WCDA 3U49A 2WSMA 1GFSA 1N2BA 2HFKA 4F72A 5FDFA 3H5RA 1WBDA 4RTSA 2JFPA 1GGEA 2ODWA 4PZ9A 4RSMA 5F7XA 3ORQA 1GTG1 3OQJA 1Y63A 1M1YA 4JSYA 4RVHA 4RIFA 5DKFA 5KTYA 2QRKA 1OC4A 2YWFA 3JVIA 5A02A 4MDHA 3CF0A 1JI3A 4TKZA 3B6EA 1QJCA 3OTWA 1P2SA 4TLEA 2UZ0A 3GI1A 4NLLA 2PH3A 2H4HA 1UKZA 4UBIA 3Q41A 5GIOE 3KQWA 4AJNA 3N70A 1MJGA 5LD2C 4A82A 4OPMA 2GKOA 2YZ2A 1Z7YA 3OJXA 4YMTA 1NJ6A 1OYOA 4ZEVA 2A5YB 3J7TA 3NUZA 3PJDA 3GGSA 3TIFA 1VLMA 4DL9A 3DGEC 3KYIB 1HFKA 3MIZA 3HDGA 1FMTA 2F9MA 4AJJA 1QHHB 3RKSA 5REQA 3DDSA 3N8GA 1H9BA 1J0XO 1EVLA 2FWBA 2YC4C 3EGOA 1SPXA 4HOYA 4RJKA 4Q9JA 1ZUWA 1WUIS 2JANA 3L82B 4GOOD 4OX9B 3HCNA 4EH1A 3M33A 1RT9A 2IUEA 4P93A 2PFSA 2R4UA 3B9QA 1NMXA 3K8QA 2WWTA 3IMEA 3SX4A 3GVPA 2YTZA 1RE1A 1YQUA 3G02A 1KNXA 2Q07A 5HILA 3ZE2B 1P1HA 1BD3A 2IIQA 2RHRA 4ACAA 1XROA 4HVAA 1ULUA 5F73A 1VI2A 5JTTA 1IN1A 3A4LA 1US8B 2ISQA 4DEVA 3ANXA 4OL9A 3TSAA 2CK3D 2AC7A 2IYUA 2XEXA 4B82A 3CA8A 4E2WA 3IJ5A 1GGKA 1K7FB 2P6NA 1W73A 3LFTA 4K28A 1QHYA 4QBIA 4OX9Y 4EYSA 3S8EA 3DZIA 3IVRA 3VVCA 1Q14A 3EXHA 1R74A 3GQVA 3PGMA 1A96A 2CNBA 1SU7A 3PT5A 4TZ6A 3DBRB 3VAAA 2CHQA 1KMIY 1M2OA 2K5UA 4I5DA 3LUAA 4XCVA 3S4YA 5K8CA 2MINB 3UB3A 1P17A 5LIPA 3LVBA 1V9LA 1YZYA 4B71A 4LZLA 4KO3S 4HAXA 4Y2PA 2ZJBA 5G1OA 5K0JA 3F74A 1Y5MA 3I53A 1AA6A 1QIGA 3OFNA 2GZ2A 4DCUA 2PKQP 4P2GA 3JTEA 3KU1A 2YVLA 4C6RA 1JEYA 3M9WA 3BCSA 3ZV3A 1OQAA 1L7MA 2GN1A 3W78A 1OA1A 2IEAA 2ONJA 4MB6A 1UBGA 3ABSB 5TLSA 2F7SA 4IDDA 5KJFA 3NHJA 4PXSA 3HYRA 5DNCA 2EL7A 3L8EA 4TYNA 5BWOA 1ZR4A 2QVCA 2VHCA 3EVFA 5TXGA 3BMXA 3KUXA 3Q8XB 5EZYF 4R71A 1XA0A 1JV2B 1IN4A 4KDEA 3VYTB 1XNGA 4OOFA 5EUCA 4Y6QA 1IYZA 2QE7A 2O8CA 4GOJA 1CZKA 4DTCA 2GEBA 3I5AA 4HKTA 1OGYA 3DWFA 1PGQA 1IXRC 1JI0A 5EWJA 5B6IA 3V8PA 2QVXX 5FCDA 2CLEB 2GEJA 5CNKA 3PUHA 4HAVA 2PS1A 3GG9A 2VWQA 4DV4B 1W88B 1EX6A 3QLTA 3OJOA 4UZSA 5EZSA 3MGKA 3JATB 2WJ6A 1SC1A 4C14A 1A9XB 5I9SA 1Z2EA 2ZJ0A 1TJPB 5BQFA 2DETA 4KGDA 4PGMA 3NWPA 4KWIA 5JZVA 5K4GA 2I3BA 3FSRA 3HBMA 1FP7A 2RHWA 2ZJ4A 3AP1A 3DD5A 5EA2A 4YREA 4QHYA 1N4AA 2J9YB 1N5MA 4MUHA 2I87A 3UAZA 4XAQA 1CSEE 3II6X 1PUXA 1H6AA 1P1RA 2PS9A 2F1HA 4ZHQF 1YR7A 1JXQA 1RXEA 2POCA 3V8BA 4B74A 3Q8MA 1ZONA 4IV0A 2YIVX 4X92A 4K03A 3MJCA 1HT2E 1U2RA 5DNVA 5DTRA 3FETA 4ODIA 5KAPA 5LMUB 2O7NA 1SR8A 2FWAA 4JP3A 4KIUA 4KUGA 2I5PO 3RANA 3R3VA 3TSWA 5B7NA 2VHWA 2JGEA 5A4JA 5FI0B 3O3OB 4L85A 4OREX 1I4DD 1LLUA 4Q19A 5FI3A 1Y7PA 3W2TA 3MBOA 3O8OA 1TKRA 2YWXA 3IELA 5ALYA 1AUOA 2OFPA 5G0VA 3S1SA 5KYVA 3WGZA 4MLZA 4PINA 5IF3A 1ABBA 4JI4B 1PG0A 2YOHA 2XRMA 3DL7A 1OBCA 3ZKAA 1YS9A 1RRVA 3C5CA 3GIWA 1AUVA 1KI6A 3HNRA 3P94A 2PQMA 5JG7A 3ZJYA 4C7KA 4FOPA 4DCSA 3CH5A 3G85A 3OU6A 2JCBA 4RC9A 5EMNA 2BFDA 3PBKA 3N2GB 1WPGA 2BDUA 2H9YA 2O2CA 1E3EA 2O8DA 4WFJA 2JGIA 1A2OA 2C07A 3SHWA 1VIYA 3V4ZA 5JV5A 2VHZA 4Y8VA 1YTUA 2HMSA 3AWDA 3K71B 1I5RA 4PLTA 2G70A 3NHPA 5AKGA 2ODEA 4LWPA 1TU3A 3PV0A 3F4LA 3EXHC 3H7IA 5BMVF 5KWSA 5IMBA 1E6WA 1EGAA 5FOWA 1ESCA 5LLTA 2WZQA 5ILGA 3WLRA 3HP4A 1NUHA 6PFKA 1O7JA 1FRFS 3UAWA 1CS0B 2FE1A 4V0LA 3MBKA 2HA6A 1YKGA 1WXEA 1VSUA 1HOTA 1VSQA 2LUOA 2XRYA 3ISVA 4OHVA 4I1SA 4PQFA 3UJPA 4N5DA 3FNQA 3E1SA 3IBCA 3NJ8A 4D6PA 4A91A 2BEWA 4EUNA 2GTPA 1O0SA 2G5CA 5IWCA 3HNPA 3JR7A 4A0GA 2FW0A 4MKIA 3K0SA 5LOVF 1WXGA 4PEVA 2VJPA 3UHFA 3NAMA 1C1HA 4XB6B 1GZHB 4AJPA 2EWMA 4WRRA 1T1RA 2GHIA 2VATA 2FK7A 1RQLA 1TMKA 2X76A 5C5DA 5I7EA 5IM4A 2EP8A 4YWHA 2FZKA 2XMDA 1ZEMA 3MWKA 1XU4A 3EVCA 2I2WA 3WIVA 1BYIA 1KO1A 2NXCA 4M9SA 1D6MA 2P9FA 5ENVA 3WB0A 3HBAA 1ULBA 2OESA 3AOGA 1IN5A 1E98A 4G8CA 4TRJA 1KEKA 721PA 2IE0A 3GOQA 1YJ5A 3I2IA 5AKZA 4JJ7A 4C3VA 4UUOA 1MVNA 5BNIA 2X9VA 3IUYA 2NNLD 2JIDA 4QX6A 5IMSA 3UW3A 1UJCA 2J6IA 2C04A 4HB3A 4MK4A 5JVDF 1GJRA 4UHDA 1YUBA 2G09A 1JHQA 4GAEA 2EDCA 1HYBA 1RTTA 2NU7B 2EKBA 4JX8A 3JALB 3JQDA 3QKIA 4JP1A 4FFLA 1UJ5A 4YCBA 1PGOA 2C3PA 1YRBA 2GVNA 2QY9A 4Z2AA 1HKUA 1PJCA 3A2LA 5ALXA 3EUWA 5E6SB 4CKZA 3T38A 1HORA 1NBWB 3IJPA 3OCUA 4P7KA 1T8PA 5HEKA 3W5SA 4D0GA 2W0MA 4LF5B 2GM3A 2NP7A 1EVIA 2X0DA 1XNHA 1Z0UA 4I8DA 1NQAO 1K6XA 1QHEA 4BRSA 3MFYA 5TRTA 4E4YA 4HLQB 2YRFA 1E2MA 4MCAA 1WV1A 4RJ2A 2ZRPA 3HCAA 3ABQB 1UKBA 4JYBA 1XAHA 1NQWA 2AJLI 4O8CA 3VO9A 4B7AA 2FW8A 2YMMA 4G09A 4UFNA 3ZLTA 2XB8A 3JSAA 2PXAA 2ZIZA 2H5EA 4LYJA 4HEJA 1Y4UA 4MR8B 3DBHB 1K9SA 1RACA 3BJMA 3ONEA 2Q1TA 1HFWA 2VJAA 2Q1UA 3BYZA 3R7LA 4AWBA 3B1XA 4NAVA 3JS5A 3RVRA 2VTBA 2M1ZA 4RXUA 4NNPA 2FE4A 4L08A 2X7XA 1ULSA 1QLHA 1PGJA 1L6IA 4IMJB 1OXVA 1KAHA 3TL6A 2V7BA 5DRYA 1A9PA 4MROA 2BDEA 2MSDB 2P75A 4HDKB 1IULA 1NQVA 4XARA 1HO3A 3IQDB 5H1YA 3D3EA 1Q83A 3WK6A 1EINA 4PZUA 2B6HA 4LN1A 1J8QA 2OLJA 2C9DA 3AV3A 4FFSA 2MSLA 1KAMA 2DRIA 3BRWA 3E81A 3VC1A 1PGPA 2OCPA 3OWOA 4FB5A 1FA9A 3KJGA 4R31A 1CZHA 1RHQA 3EUFA 5DK4A 5IZCC 4MWBA 5FB3A 3T3IA 4G9EA 1J8FA 3JAMA 1NWCA 1Z6PA 2PR2A 3EZGA 3I04M 2XGJA 3TKYA 4IDQA 4AXBA 2JAQA 3DPIA 3E48A 3HCPA 4M0PA 4EELA 1TT5A 2FU5C 4I4IA 2QP3A 1JJBA 1DHTA 4RE6A 3SSOA 2GBGA 2ZB8A 4CCYA 4RDCA 4C7OA 2JD2A 2NSHA 1PK8A 4PPQA 4FR0A 4JC0A 1DJPA 1EX7A 5AKXA 2D00A 3ESYA 4Q37A 1DFHA 4E4TA 2YVKA 4M2LA 4MINA 4QOFA 1R0XA 1AZSC 4AF7A 1I24A 4JEUA 4PZAA 4EGFA 2I6XA 2Z5FA 1CUWA 4HGQA 3STTA 4RZXA 5CNMA 2XZLA 4JUAA 2QXUA 1DUSA 3FAZA 2VYCA 2VUHB 2P77A 4PIVA 4BASA 5E0KB 2JBWA 4HDRA 4IQGA 3LQ2A 1YB7A 2W6JD 3IEMA 1DX6A 4GBED 2RI0A 4F38A 1VKOA 5LZ7A 2EFCB 2YJ3A 3NIFB 3H0KA 3OPYI 4GF5A 4JGGA 4X1OA 2ZBRA 2ZS8A 5INTA 4D0RA 4GX0A 4ZU6X 3F8TA 4ZC8A 3WWZA 2DXIA 2OZKA 1SJ9A 2JF0A 4U7PB 5DTIA 1RMQA 2ZRFA 2P91A 5AP9A 1QO9A 3O4VA 4IZ6A 1Q44A 4GG1A 2QLMA 1FX0B 4WESA 2GKGA 2YHUA 2RI6A 4NE9A 3IUSA 4GPD1 2N47A 5T4BA 4YAUA 5FL3A 1K88A 4EJMA 5BXQC 3GEGA 1W93A 3HGQA 3KQLA 4FMCB 1D2MA 3GRAA 4Z54A 1OIVA 3WIEA 1UM8A 2ZXEA 2ISCA 3E9DA 3MUEA 1M1UA 3DE4X 1HYGA 3QQ5A 4IJWA 3FPGA 1OXXK 3FPFA 5C8XA 4Y7CA 1OFUX 2WG2A 1XTVA 2OBXA 3PHJA 3TRIA 5EZ5A 1M2VA 3PGJA 4FYXA 2RGYA 5DGXA 5CK5A 4DA8A 1KH1A 1E1RA 2WI8A 3T4UA 1MRNA 1NWHA 4MHOA 1ZQ1A 2FQYA 1VKNA 3GZNA 3E18A 4FIDA 5JHHB 1VOTA 4BL5A 1JWBB 4L7QA 3PX2A 4LX0A 2B4TO 2ZE6A 5D7BA 5ALRA 3VZRA 1LNZA 2BGMA 3BC1A 1V3VA 4TRRA 4C0WA 3PTLA 4TZ0A 1D1QA 1E4EB 2R1VA 3USCS 4GX1A 4YJ2A 5AVWA 2XB9A 5JAMA 1QU2A 1R6DA 3EA0A 2J0VA 2C5FA 4TKLA 4QAQA 2VPPA 4WZAA 1YRAA 3ID6C 9ABPA 2Z4SA 1YIDA 3FBWA 4I4NA 3THSA 3GGDA 4BB0A 5AOBA 1VJCA 2A4KA 1FUYB 1SBIA 1XAJA 4IDBA 2AOUA 1NDHA 1FSZA 4R2XA 2OD9A 4OA8A 3VV3A 3ZDZB 2YKGA 1UINA 4GRIA 4DSAA 1BA2A 3D43A 1L7PA 1USKA 4YCAA 2GFQA 4IUBS 1H2YA 2YINC 3OX1A 2GPAA 3RVBA 3VYWA 2ETVA 2ACEA 5HSGA 1WW2A 2NV6A 3ZV7A 1JQDA 1G21B 4DAOA 1PQUA 4JLBA 1VLQA 2VNIA 1GXSB 3C4VA 6GPBA 2XMPA 1V7ZA 3SIPA 3DNMA 3F67A 3KQUA 4M3NA 4WLVA 1JAXA 4RL4A 1PU2A 4GIBA 4KFRA 3ZWBA 3MCTA 1XNJA 4X24A 4TWIA 3NIGB 3A10A 1K4MA 4Y2VA 4M0KA 4BYMA 3U6KA 5EXXA 5C8YA 3CUWA 4AC9A 4BQNA 4EATA 1M2KA 3JYQA 4DYHA 5KTRA 3A1UA 3E2MA 2QWXA 3HL4A 3L5OA 5FWXA 3TBHA 4D43A 1JLSA 5T3YA 3SKXA 3UFBA 1GA6A 4I4TA 2G9ZA 3HGTA 3HS3A 3JAKA 5HVNA 1TB4A 1EVZA 2B99A 3AF1A 3A6GA 4RS4A 3FDZB 4IJQA 3ZCQA 3E8MA 3MLBA 5ESXA 4NENB 1EG7A 1C4OA 3WSTA 1ZM3A 4C7XA 5A6VA 4R41A 2EBFX 3CO5A 3KYDA 1KORA 4YPOA 2CMDA 2C83A 4FFBB 3JARB 3CGWA 3K09A 1QXSA 1DPGA 3QXCA 5E3JA 4QXOA 2PZGA 1X1CA 2YNMA 4BFUA 4ZGWA 2NO1A 1FCJA 1FDUA 2AMYA 3MOSA 3BTSA 4LNUB 4NR0A 1M8PA 4M1EA 3R7NA 4EAAA 4EB6A 1QQ6A 1RXWA 5K6AA 3FPJA 3R4VA 1B3RA 2JLVA 1DOAA 1NVXQ 1SCJA 1YULA 2R7NA 3I5UA 1Q0HA 2I65A 4LHEA 3VPFA 4F4DA 1O4VA 4JUFA 1PLKA 1YO6A 1ZVMA 3HU1A 4DPLA 3OURA 1KOFA 2P69A 2UVQA 2G0TA 2VDWA 2GEVA 3EH1A 3SZOA 4C6TA 1N0UA 4LGCA 3G0BA 4D56A 2DU8A 4BMDA 1GPMA 2DUMA 1YKFA 2EGHA 5I7UA 5LR6A 5JVDA 3DZBA 3PE3A 3SP1A 1JR6A 1ZGJA 3GLIA 3QVXA 3KX2A 1YH3A 3NM5A 5M5BA 2EF0A 1M6VB 1R00A 1UMDB 1NXQA 2F48A 1L7VC 2YOGA 4IDHA 1KZ1A 3EJWA 1OYYA 1PW7A 1H2WA 2FW6A 4IIYA 4ENSA 3C6KA 5IDQA 4KO8A 4BO4A 4EUEA 4LGYA 2ZJYA 2HQRA 3R3ZA 3WISA 1W5BA 2FFRA 3K4QA 2GEUA 2Z1MA 4EWLA 1DBWA 2AMFA 5LZ5A 4WGGA 1JXMA 4V0MA 5SYAA 4KAFA 4QYXA 1RYFA 4ZOLF 4CM1A 1Z4MA 5HKLA 1I10A 8OHMA 2C1EA 1QMPA 2PO7A 3G8DA 4UNPA 4BAGA 1U9JA 1U4NA 4OQPA 3OA2A 3KSBC 4X8HA 1PN3A 4G36A 1GU0A 3OCJA 5G2OA 3T5GA 4EABA 2IYZA 2HK7A 5B6PA 1BCRA 3TKLA 2P9QA 3PXXA 5IWAB 3FUXA 3IB6A 3PVSA 2XUFA 4DVJA 1LTHR 1SXHA 3ASZA 1E1CB 5ECDA 4C0XA 4E5VA 3WBKA 4PYJA 4YRGA 4FWBA 3R5SA 3EF1A 4CM7A 1JYEA 1KIFA 3A0UA 4Y2QA 4DBLC 1OI3A 3CT6A 2FMKA 3BXEA 3QBDA 5F35A 4DSZA 3QVJA 1FW8A 1G3QA 2ZE8A 1UFKA 1G60A 3DXYA 2I7TA 3I0NA 1VJTA 3PEFA 4PPFA 4C76A 4DY4A 8AT1A 2P4SA 3MWEB 1ODSA 2YV3A 2CFTA 1U1EA 2J3QA 3PHGA 4IOMA 1WV0A 1ZH0A 2Q4OA 3HBNA 4NYIQ 1JILA 5C34B 5U4QA 4BMSA 5EGNA 4L3WA 4DIFA 5LSAA 3QW4B 4C1BA 2ACVA 4Q5IA 3SYRA 3MD0A 2CV0A 1QB7A 1ACLA 1T4GA 3ORHA 3MRXA 2UUPA 3LQQA 4G1UC 4QUDA 1DQYA 2P4EA 4R2WA 3O1JC 5B2FA 3ZI4A 4YAOA 3M8KA 3P5BA 1E92A 1XPJA 4L22A 2ZCUA 5AW2A 1MQAA 4FFVA 4XB1A 4DBZA 4GL2A 2DQSA 4ZVNA 3FUWA 3VDNB 5HK8A 4EA7A 4YGYA 3EIFA 2E2WA 1F8XA 3U81A 2HWWA 3PHBE 1O5OA 4F45A 1P0IA 1KETA 4AUNA 3GLGE 4FEGA 1E8MA 3RTAA 2H11A 2FWNA 3D8NA 3O8BA 5EKDA 5TPZD 2IV2X 3TDMA 3TINA 1YJXA 2EJBA 3VH1A 5JH7F 3IIEA 2JARA 2VTDA 3LT4A 5KSOA 3CGGA 4KHPB 4Y6RA 5BSGA 4B4DA 2RAVA 5HM6A 2J07A 1W4AA 3PRHA 5IDXA 3PC2A 2UZ3A 4B33A 2ZSFA 3VBCA 1NATA 3M6XA 4BP1A 3EN0A 2Y1CA 1NFFA 2B1QA 3A58B 3MWDA 3R3JA 2NZVG 2Q6OA 1QH8B 3H9CA 1QVRA 2WHYA 2HMUA 4FI3C 4H4DA 3LA6A 4I9UA 4M0LA 4NTZA 4YQFA 4JI8B 4YCDA 1EJ6A 1RBQA 2DWCA 3I2HA 2XB2A 1PVOA 1YC2A 2Q5HA 2V4MA 3QUTA 3FOZA 2ZYSA 3IO3A 4RZSA 4Z9BA 1I2BA 4IHJA 1E2EA 4QQNA 1F4PA 2GZ3A 3A0RB 2BKXA 4ZOAA 2MINA 3R8CA 3H4IA 2NG1A 3LC0A 3Q87B 1J5EB 4FILA 2ZYVX 3FI0A 4GZLA 2VL7A 3OZSA 1QV6A 4TTTS 3V4RA 2JZNA 4UNSA 3PC8C 1RWXA 3FRJA 1WEHA 3M1YA 1FLAA 3NDJA 3VOAA 4BNTA 3DLCA 2QAGA 3JW8A 4B76A 1QC5A 1X87A 4C6SA 4M0DA 4IOLA 2KW5A 4BBAA 5JRDS 1C1DA 3CVOA 1V6AA 3K15A 1SXPA 1SQ0A 4J2TA 2CYBA 3L18A 2IA5A 4WCFA 2L18A 4HDOB 2NU9B 2C4WA 2Z04A 1E96A 2AWOA 4UCFA 3UAGA 1NXPA 1YQWA 4DQVA 4DTIA 3U7GA 1YJBA 3GLHE 3UZUA 1OZ0A 4ID3A 1R5NA 1V1RA 2H1LA 4GNRA 2HO5A 1VDZA 1OT3A 1GN9A 4KWCA 5EJFA 4C08A 3O8QA 4I66A 3IA7A 2Z8YM 2IP4A 3RUDA 3JZAA 1HFJA 3KJQA 2GLXA 2XCQA 3KLNA 3P52A 3Q3CA 4D8TA 1T13A 2OUKA 4RKEA 4IV8A 4ZREA 3MLEA 4JA2A 3GCDA 3LUDA 4C06A 5DNUA 1F38A 1WZ2A 3K9BA 1U98A 1OE0A 2FYTA 1ZM9A 1XRJA 2JFNA 1CQIB 1JLLA 1XK6A 2HY7A 4P2BA 5CX4A 1CQPA 3SOZA 4OLBA 4QPPA 2HV9A 2PGLA 3KD3A 3L6CA 3CWQA 1N9GA 2QZ9A 3K2EA 3RIXA 3SAJA 1B6GA 1OH7A 1P9LA 4Z53A 2Z83A 5C1OA 1FVOA 3GPBA 3G59A 5I7AA 1ORTA 2ZSIA 2CJWA 3HLKA 1BS9A 1A4UA 2XRFA 3VM6A 1C1DB 1JE0A 1Y1QA 3AKZA 1HRDA 1PDVA 1YRYE 4TQAA 5ALDA 1NVGA 5FULA 2WM3A 2WTEA 3VR1A 2XNSA 4DA7A 4RLFA 3KOWA 4J0EA 3TPCA 1J21A 2HRQA 4X8MA 3VI4B 3N58A 1JQ3A 3L79A 1IAVA 4RMGA 1Z3IX 4YJGA 4EEKA 2I1QA 2ORED 4L3OA 2C8JA 3V6LA 5AVYA 1UBLS 3HVJA 3D6AA 2RONA 1G2IA 3D7SA 1D7AA 1LI7A 3INGA 3QFTA 4DMCA 3ZV5A 2ZVPX 4Q9DA 1YL7A 1N7HA 3OPVA 3CCCA 2ZULA 3MBIA 4WEQA 5TE9A 1OD6A 1QAQA 3AOEC 4YVFA 4J07A 4MQLA 5DU2A 3K9LA 3ZK8A 2K6GA 2XMRA 1KBQA 1X7ZB 2QU8A 4CUJA 5K0ZA 4A8JA 5LFAA 1U7TA 2XNJA 2X7HA 1GQRA 1UBMS 3DEJA 3TX6A 3DC2A 3YASA 1HE8B 1T6ZA 3AEYA 2MOKA 1E9EA 3AETB 4OA5A 5HBRA 3SBXA 1ODCA 3SK0A 1N7IA 1JG4A 4DANA 4X61A 4IDNA 3ND7A 4KE9A 2P78A 4BO2A 4D9IA 1ADCA 1FMLA 2PGNA 3ADKA 5ICMA 1NW4A 1FQJA 2Z56A 4B4WA 1G42A 2K2QB 1RWBA 2B8JA 1MO3A 3DZKA 3L0DA 2ZIFA 2VZ9A 4B4VA 3EMVA 3BCUA 4FDMA 5LYJF 5FUBA 3KR1A 1NR1A 1TK2A 2DTXA 4BATA 2ZWPA 2XOXA 3ZWYA 3L7KA 3WRYC 4A36A 4TTVA 2BR4A 4LYDA 4ARSA 2A86A 2QTRA 5HX7A 4H3KB 3CLSC 1U11A 3SKYA 1IXKA 5I4KA 1W96A 3RUFA 3AX6A 2ZR9A 3B7WA 1RJDA 3EIUA 3HZRA 3KR2A 2PD6A 1IB0A 4DXAA 1TUIA 2AR0A 3JQ6A 4EL5A 5IX8A 1VXRA 821PA 4IUYA 3N3BC 1YZ3A 1M1XB 2XE6A 4CEIB 1UDCA 2A88A 4W7IA 1T5DX 3OU7A 1T8YA 2HQBA 5E6UB 3GEIA 4WJZA 1Q7EA 2CFCA 1LPPA 4KVGA 4P4SA 4CCAA 1WMFA 2R6ZA 3COJA 2G1AA 4F91B 4UNNA 3QXGA 5K5EA 4LF4B 1B4DA 3JQCA 4HLUC 2E5LB 2R11A 3ENWA 3GDGA 3OZEA 4E15A 4RPIA 1YCFA 3O4JA 1FYVA 1U7DA 3FM9A 3HWSA 3KZXA 1JSCA 2VN8A 3KXPA 4JB0A 2D7CA 2C2MA 2FPIA 4UDOA 4AUEA 1BE8A 1B7GO 1NW9B 3FWPA 3K53A 1DRWA 4LY6A 1C4XA 5IW8A 2XWBF 3ADPA 3NATA 1SEPA 1SCQA 4POAA 4UFPA 3A3OA 4KREA 4BWYA 3I04A 4QREA 2JJ8A 3G2OA 3PP8A 5BVGA 2NQ2C 2C95A 1KTVA 4QE3A 2ZVQX 1JB9A 2B5VA 4BV3A 3ZQUA 2CFOA 4UU0A 3ZW7A 1CFJA 5H0IA 4UNRA 1GPNA 5K4HA 3WL8A 5TSDA 4UE2A 1DUVG 2GVDC 1OFGA 4DF3A 4ZEWA 3HM9A 1Z38A 3MTQA 3EYAA 4R69A 1JVSA 3EWIA 2ZTLA 4RZHA 1FVXA 1RKQA 5EIAA 1TUEA 3KJFA 1PFUA 4LJ9A 2OGZA 3AZOA 4DB4A 4UVHA 4AAYA 3U1BA 2HJHA 4L0CA 1KI6B 2N75A 3VH2A 1A69A 3MG9A 1J06A 1Z39A 5DRTA 4JCCA 1ZHFA 1B0UA 1N9KA 4GPZA 3N2LA 1A8UA 4FYWA 4JKOA 4Q15A 4OKSA 4PNEA 4DA0A 3Q7TA 2GNOA 1I3NA 2Z08A 3IOBA 1IY9A 2D13A 4GI7A 4H3HB 3EZNA 3UJHA 5JPIA 1RFLA 3BOSA 3PNPA 2V6GA 3ZBPA 2WA1A 2I8LA 2V1UA 2CLLB 3H2SA 4DV2B 1IOVA 3EYWA 1EZ4A 4GP9A 2ZUDA 4A9AA 5GINE 4CJXA 3U4QA 3I9KA 4EHNA 1ZN8A 3HKEB 2EBHX 2BMVA 3Q0IA 1Y82A 4QFDA 3SF8B 2XX3A 3HVRA 2WKWA 4V3BA 1J2JA 1FUKA 1JWLA 2CZGA 4GLBA 4PGFA 1G8KA 2IYPA 1X7ZA 1KFKB 2WYIA 3A36A 4LUCA 2CVFA 1SUDA 3HSYA 4OHBA 2HTFA 4A1OA 3LC1O 4CKBA 4ENUA 5DXFA 4N7RA 1WW8A 4YAGA 1F0KA 2BFAA 4YUAA 3DAHA 1MC8A 3CX3A 3TVDA 4NYIR 1R0RE 3IOMA 4DRXB 4JVMA 1S9DA 1A8IA 1WD7A 3K1AB 4AMGA 4IZOA 1P8JA 3AEUB 4HDQB 1OXUA 2YHAA 3I6MA 4AQDA 4JHLA 3UV6A 1XBTA 3K9NA 1DNPA 2WFAA 2DSTA 2OHXA 3ESXA 2RHHA 4BFSA 4HYYA 1FFBA 1BGVA 3CT4A 4F6RA 3W90A 1IPEA 3W7AA 1H2ZA 1JG2A 2XWQA 4JNCA 1V2HE 2AB0A 4C20A 1C29B 4HX5A 2NV0A 1L4GA 3EG9B 1OI4A 1QZTA 2J0SA 4JB2A 2HKIA 2WF7A 3PVCA 2JLAA 1DELA 3DMTA 3ZIAA 3EIEA 1F6WA 1KFBB 2D5IA 3MCUA 5A7FA 1AQJA 1X15A 1F06A 2Q2WA 4ILEA 4HJRA 5IVDA 1TRHA 3H0CA 3MJSA 4BKQA 1LWOA 2FPPA 3DFMA 4QECA 1QO7A 1ZRMA 5C5EA 2E89A 1XJ0A 3ZNQA 5JANA 5HE9A 2VYVD 4M1MA 5I7VA 1XMXA 5LOVB 2Y8EA 1UPAA 3LUBA 2VCYA 3DVQX 1JVBA 3PJFA 5FOSA 3ZGVA 1DAPA 2PL3A 4I9GA 4KDFA 4WDQA 2AV6A 4OV6B 1QP0A 4D3SA 3R5TA 2X2FA 4OXYA 1V16B 3N2IA 4AG3A 3FLMA 1N2OA 1K8QA 2O2HA 3IGFA 5IAJA 1AQNA 3LLCA 4DZRA 2B5OA 1KYWA 1J2YA 1E5LA 1LDBA 1RU3A 2QN7A 2DUNA 4PC1A 5L3ZA 1FE8A 2QBYB 3EXHB 2VRWA 1N78A 3EIQA 2GXUA 3AP2A 2DUWA 1CB0A 4WE3A 2GHTA 1NNSA 2BSQA 3F5MA 4FGZA 4WK2B 3UNXA 3OESA 5C2JB 3I5XA 5BN4B 4XJXA 5EIOA 1J2UA 4E5YA 4WX2B 4P4GA 4ZAYA 2WSLA 5FWNA 4F3RA 5DSTA 1FLDA 5EJ4A 4PCLA 1V8PA 3NNDA 4W5WA 4W63A 1R64A 1P9WA 1WCYA 3IKLA 5AVSA 4YV2A 3SQWA 4NZNA 3C5HA 4BWVA 3A4MA 1H8HD 4ZT6A 5B7PA 3UT0A 2H8KA 3T7CA 1I2CA 1EFKA 3LKDA 3COVA 3F96A 3TW8A 1QIJA 1J42A 2IHTA 2JA2A 1NR7A 2QD1A 3DFZA 4XZ3A 3OEHA 3VDQA 2OV6A 2V6JA 2GCOA 4GFDA 4LC0A 4QVGA 3HU2A 1FFHA 5K51A 2OY0A 2VSYA 1JHYA 1JR3A 2DE0X 4QAJA 5CJ2A 3WO0A 4IOKA 4LMBA 1DEKA 2IX3A 4TXMA 3P0FA 3OCCA 3G49A 4PYLA 5KYWA 3A3PA 1J1UA 3QFSA 1J49A 2J48A 2RB4A 1T2NA 3IPAA 1D2AA 3EQ7A 3N2ZB 5AHKA 4GZ6A 3VSBA 2CYAA 4ZPXA 2PBRA 1KJ8A 3A05A 3W2HA 2AX4A 1P5HA 4G9BA 3REGA 4Q9KA 1MA0A 1KQ3A 3R3YA 2W2LD 1MV8A 5M3BA 3WJ7A 5H8WA 2ZTHA 1XJCA 3VU1A 2ZI6A 4H4CA 5TMBA 1FDVA 4BNDA 2QA5A 1T8RA 3VX3A 3E2PA 4JROA 2VQFB 1ZK4A 2XMZA 4G0WA 2GJ4A 3ERCA 2DG2A 3NP7A 2PJUA 4MEJA 4MV8A 4XB2A 4DFDA 3LL7A 3WZLA 4LA4A 5LXTA 2J0UA 4RL6A 4C5BA 2LWIA 1D2NA 1DEAA 4C6TB 3WBBA 1DKRA 4D5GA 1GOTA 4D9JA 4DKJA 1R0YA 1ODFA 3K8ZA 2BEUB 4HB0A 4RV4A 3SE7A 1AMUA 4EDHA 1QB8A 3TMKA 1XYYA 4ZYTA 1GUAA 3L8MA 1SQGA 1XALA 1JZSA 2I67A 3DOUA 3MN1A 1JKIA 1KVQA 2WF9A 1PT6A 1LGYA 4G0XA 5D8DA 4ZXFA 1ORIA 2R97A 1P5FA 1PQ4A 3QEJA 4PNHA 4XFJA 4WZAB 2R5NA 3RKUA 3DZ8A 1E1YA 3AJAA 5C53B 4NBRA 3UKOA 3R8FA 4M87A 4EZIA 5IXYA 3LP6A 1HA3A 1CERA 1NVMB 5EMLA 4LEIA 5JBIA 2WP8J 2ZSHA 3WRWA 2UYQA 1DGQA 1GV1A 3U3RA 4RFSA 5IH3A 4FCTA 3RT7A 4X65B 1TQ6A 4Z8YA 2FA9A 2WJVA 5IC6A 4BXOB 4UTNA 3AONB 1P9OA 4V1CI 5KCZA 2B8WA 2C9OA 4HY3A 4OAPA 4XIYA 4ZJYA 4QDXA 5E2IA 3RC3A 4LF7B 2G82A 4R1UA 3ICQB 2VUIB 4FR5A 4UREA 3B6KA 2XWJI 4F46A 3T1VA 1PFGA 1AS0A 3BCRA 2G17A 3CE6A 2BKUA 2IRWA 4JBNA 1RXUA 4ZI7A 1VG9B 2EFHB 1HETA 1SA0B 1G3IA 1JAYA 1A3CA 3CR8A 3IAS1 2REBA 3IVCA 2GBFA 2GYWA 3EOBI 4JC4A 2EFYA 3R7WA 1KMHB 1ZBDA 1UZAA 1ODKA 2QLFA 1TLTA 1G3MA 1E9DA 3PDIB 3RQIA 5FLKA 3ZJ4A 3JD0A 1L8XA 1Y1SA 2QZ4A 4Q12A 1X14A 3KPVA 4ZOEA 3RG8A 3EISA 3B12A 4HDMA 3SKVA 2YY6A 3G5TA 3O74A 1TW2A 2D2VA 3N6RA 4RVUA 3M3PA 2WD7A 2DY1A 2P90A 2PX8A 1KEVA 3JALA 3KQSA 2GM5A 4R68A 4TQUS 4IDFA 5JS7A 2P68A 3JQ7B 4KCGA 3O0TA 1QV9A 1L5NA 4NPCA 3UFXA 1FZTA 4L8GA 2UYGA 4DEYA 3AUSA 2OLKA 4B9AA 5AVOA 4ZI5A 1L1FA 5A5VA 1YONA 3I0ZA 2JGNA 3QKWA 1FY2A 2CGEA 3REOA 1CHNA 1V11A 4MS1A 2IXFA 2JLCA 2GZ1A 2QQFA 5FLEX 4AL4A 1T5HX 4WNIA 3U7IA 4ZVLA 2IYQA 2VDWB 3THWA 1ACMA 1AIPA 1W48A 3GFQA 1K5PA 3O3NB 5K0BA 1ZUIA 2X41A 1N6IA 4FOOA 4J76A 1VKZA 1RKVA 4QA9A 3T4XA 3WLHA 2ZR7A 3R3WA 3ZZ1A 4FFOA 1U5CA 3O95A 2DFTA 5A71A 4CUZA 3CF4G