1S2DA

Purine 2'-deoxyribosyl complex with arabinoside: ribosylated intermediate (araa)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
164
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 50
structure length 164
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2dA00
1YDHA 2PFKA 4FYIA 4FYHA 3BQ9A 2IZ6A 2NX2A 4I36A 1PFKA 2PMBA 1S2DA 3O8NA 2A33A 1KZHA 3GH1A 3O8LA 4MCJA 1F8XA 2Q4OA 4WL0A 3EHDA 4P5DA 1WEHA 4KXMA 5AJTA 2IZ5A 2IZ7A 2F62A 1S2LA 4KXNA 4FYKA 1WEKA 1S3FA 1ZXXA 3OPYB 4I7EA 4OHBA 4P5EA 1MTOA 1S2GA 3O8OB 3PFKA 4MEJA 3MAJA 4NPAA 4RH3A 5ITSA 3HNOA 2KHZA 2F48A 4OHRA 2Q4DA 2A0KA 5AJUA 4JENA 3UQZA 4LJRA 1T35A 4JELA 3O8OA 4JEMA 4I4IA 2KLHA 1S2IA 4A3SA 2HIGA 4HX9A 3F5MA 2F64A 3QUAA 3K2QA 3OPYA 2F67A 1RCUA 6PFKA 4LJKA 2F2TA 4KXLA 4PFKA 3U39A 3IMKA 1F8YA 3SBXA 4U1RA 4LJLA
chains in the Genus database with same CATH superfamily
5KZMB 3OURA 3T3MB 1VLMA 2Y0CA 3C3WA 1Y1LA 1I01A 1NY5A 4KVAA 1UDRA 3DEAA 3IPYA 2XWJI 4S2EA 4TLDA 4XR4A 3RADC 1HNZB 3HHEA 1LW7A 4KBGA 4V0LA 4OLJA 3FYCA 3GWZA 4ZHQA 1F7VA 3K9HA 5CJJA 4ZVTA 4L4SA 2A86A 2HRCA 3R3SA 2P2LA 3ZBTA 5EIEA 4X3PA 4EGQA 1Q0ZA 2Y1DA 3W9SA 2OLKA 3QX9A 5I7HA 1XCMA 2PKXA 4CHTA 1K2VN 2YDYA 3VUEA 5LPNA 4MWSA 1K75A 1E4YA 3I9JA 2KSQA 13PKA 2A9JA 3AF1A 4EYEA 1S89A 3PEVA 3T1TA 2QN8A 1CLUA 3DZBA 5HIIA 2CXTA 3ABZA 4PC1A 2YZ7A 3PNMA 1ZCJA 4TMKA 5SV2A 1T6NA 4U7WA 3K9CA 4QUHA 5EMKA 1U0FA 1Y1PA 2QVZX 3REQA 2MDTA 1WXDA 4EVRA 3X1MA 3AZQA 2R8ZA 4IW3B 1J23A 4TTQA 1PCXA 4UBOA 2R6R1 1RFGE 2P6UA 1YNSA 1ZMOA 2QLMA 2A0YA 4O4HA 4QBIA 5DGXA 3GAZA 3THXB 2GNAA 2WJ6A 3P45A 1ODSA 2LD4A 4QOIA 1E2UA 1BCSA 4MKZA 1IWPB 2J30A 4KQKA 4I3GA 1OYYA 1TMGE 3IKMB 4QD3A 4LFAB 5FBZA 4YRGA 3MLBA 4J4BA 3T9AA 1NL3A 2JL1A 2PKQP 3T1QA 5GIOE 2QA5A 1WVGA 2B25A 3C6YA 3NIBA 1T5HX 4QPJC 4L4RA 3SBEA 2ES4A 2YFKA 3A1FA 3FCXA 4FD3A 3UK7A 3UCEA 2EZ4A 4WX2B 4ZQCB 3CCCA 2B78A 2HD4A 5H70A 4WAUA 5EKDA 2SKCA 2OWDA 4CVNA 1IHDA 4KRYA 5AICA 1WUYA 4K03A 3EIWA 4IG9A 4O63O 4CU2A 5GONA 3UEOA 1KL7A 1QZTA 2O2SA 3QFHA 1QHIA 2I0FA 4KR0A 4K6FA 4NYJR 1ORTA 2I65A 3TCKA 4TMXA 2ICAA 3U26A 5CFPA 4WJZA 1MO4A 4RIGA 1VKOA 2AR0A 5AWFC 3HB5X 2NU8A 5KDOA 4RAOA 3EXAA 3SFZA 4JL5A 4ERXA 3FYUB 3RFTA 1BWPA 2GDJA 1LXCA 3N6VA 4CKEB 1SURA 4R2LA 2ZUFA 3CJTA 3KUXA 4F6RB 4DV3B 1GL7A 4O2RA 1S2OA 1GPAA 4JUAA 4U9HS 4Z53A 4WZZA 3H9CA 2HIGA 3VKFA 3IPLA 1MRNA 1XRJA 3GRPA 3B8HA 4F4DA 2E4ZA 1O9HA 3CXUA 3TNFA 1J9ZA 3B5EA 3JQGB 3LFUA 3KB6A 4OUDA 4E2XA 1E3QA 1KBQA 4ADSG 3UHOA 1PR0A 5MFZA 4EPRA 2CFTA 1XEFA 4YPVA 3LT1A 1RIFA 4G5RA 3SR0A 3AHCA 2Q45A 2H4YA 2ZVDA 5C4GB 2Q2QA 4CLRB 4P7JA 2OZLB 1PEAA 3I73A 1T2UA 3L46A 3LL4A 1XHFA 4KXQA 3KXKA 5EUBA 5KTOA 3RVBA 3IAHA 3EUAA 2JD2A 4KOAA 4NTZA 4FDVA 1SKBA 1UBOS 4I1YA 3TLGA 2GCOB 2WTUA 2R4UA 2AEFA 4R1TA 2ZRLA 2OPBA 3I1IA 5KWIA 1L5KA 2J7PD 4AZSA 4D3XA 1C0PA 1YS2X 3LUAA 2XYPA 2BCGY 3L1KA 5M2QA 1P91A 1X19A 4V1CA 1EE9A 1EVKA 5JZMA 2C8JA 2F3PA 4BX9A 3KG2A 3WICA 3FH0A 4NLLA 5DNEA 1VPTA 4ITRC 2XVYA 3TECE 3ILYA 4RADA 2CT8A 4RLSA 1JZQA 1O97D 3SAJA 421PA 1X74A 4UXIA 5K0SA 3EIFA 2QTZA 3HB1A 4F38A 3C1AA 1F8UA 2H0RA 1TKBA 5BSEA 4BEJA 2V7EA 1N9KA 4G8BA 2P2CA 3G17A 3PXCX 4MDYA 3ZK9A 5F9FA 4DV0B 4JBYA 3AB7A 1NI4A 5BV2P 1LBEA 4TYPA 4IMIB 2HMTA 2P4QA 1G7RA 4M86A 2B3DA 2MWMA 1E3WA 2ZRPA 2F1KA 4QHYA 2CFOA 1GPDG 2QTHA 3ZD9A 1GNVA 1ZD2P 1KIMA 1WEHA 3KOXA 2IDJA 1YCFA 1Z4KA 4MQ4A 3AUJB 2NQ2C 3BH6A 1RZ3A 3BL5A 4QU5A 1CJSA 4BWGA 1EM8A 1SC9A 1TRKA 3IKVA 3CRQA 2AMFA 2IYUA 4URZR 4G36A 4BKMA 4BQOA 4Z9AA 4ZHSA 1U2SA 2VZ8A 5ALJA 2ZTUA 4DUGA 2HCRA 1ZOOA 1DFGA 3B1JA 3VUFA 3BFJA 1RC1A 3ILVA 5JRJA 4RD1A 1PTJC 4R6WA 1FP4A 1M83A 1A9QA 1T5SA 1TCCA 4QVIA 2OB2A 3NV7A 2FFAA 4MO9A 3LLSA 1QC5A 4WNAB 1NNSA 3AO0B 3UAOA 2EKPA 3QW4B 3AIIA 5THXA 4HNVA 5JNRA 3IL2A 3H2JA 1I94B 2AV6A 4AICA 4LJ4A 3RQIA 1SXHA 1S2GA 3ZGZA 1NE2A 5DMHA 1QO0A 1RAIA 2G8NA 4FS8A 1C5KA 2V5VA 3S70A 1U5CA 4FHGA 1JIUA 1KDVA 1TK3A 1B8VA 4QBTA 5BN4B 4A73A 1S8AA 4OYLA 1CE8A 3ZHZA 1IJKA 2VQFB 3U7FB 3WB9A 1RHRA 1NXPA 1V3UA 1MW9X 1SHJA 2QY6A 3EVEA 1GPWB 3B6IA 1Z39A 4PCAA 3SIWA 3GZTB 1W47A 2Z9DA 3CY6A 2NO9A 4HEA6 4I9GA 4NOJA 4F8YA 4QM7A 3RAEC 5JCXA 4OHRA 2PX5A 3NRCA 1SHZA 2AN3A 4GYYA 4EKDA 3ZTYA 2Y1OA 5GY7A 4C3UA 4FC6A 1O3YA 3GWGA 4TM7A 1E7QA 4JELA 1I6WA 2QRZA 5IBRA 4ND8A 3HU5A 2H0QA 3A58B 5FOXA 1L3IA 3MTGA 4JJ6A 1UADA 3DFKA 4N5IX 4E5DA 5JZ9A 5AVRA 3N8GA 5ALSA 1V11B 2C4NA 1COWD 3RSFA 2Q1SA 3QU4A 4RVHA 3NNNA 3UMBA 2O7QA 4D4JA 3CJQA 2G40A 1E8NA 3QWFA 5DLYA 3CX4A 2PU5A 4D56A 4RZ2A 1JA9A 2EZTA 3OEHD 4XYGA 2GCIA 4MOWA 4ISBA 4W8OA 2ZAOA 2GI4A 4YRFA 1GPUA 2JK1A 3HYLA 3Q4GA 4DXHA 2WJVA 3E9QA 1WM1A 3I52A 2VKQA 2BRUA 1RAFA 2WF5A 4NEQA 4RJLA 5BN5B 5KOHB 2YJ6A 3AM4A 4Q0MA 1UMBA 1UXJA 3ESDA 3ZU5A 1QTQA 3OIVA 5JMPA 3GUYA 2IGTA 3ZE8A 2FPPA 4AK9A 5JAHA 2PRZA 4TWBA 4L15A 5U9CA 3FG9A 5CDTA 3ADPA 3ZGVA 1W85A 5DSXA 4DCVA 2Q62A 1TA0A 2PSHA 2XE4A 4GUDA 1CZKA 5H1YA 2BM0A 1I7NA 1YI0A 1E92A 4IDCA 4NCKA 2YV1A 5CVVA 2OFXA 1WSAA 3TWOA 4XASA 8ABPA 3W9YA 2WHPA 1PNRA 3E81A 5L6LB 1IY9A 3L77A 4D57A 2IE8A 5IJ9B 2G28A 3EVBA 1Y6RA 3DDUA 3SC2B 2WWWA 1UXOA 4FFDA 5CTJA 1TA4A 1NN0A 3OEEA 3WBBA 5C7IO 1CYDA 1CEXA 5DCWA 1FUIA 9ATCA 3VI3B 3GXBA 4J7AA 3TB6A 2VAWA 1XQVA 4AP5A 2XOKD 4BP3A 4C4RA 2ZW9A 2QYSA 5LQNA 1KY5A 4XFKA 5EZYB 1W49A 2IEGA 4G5YA 3HDGA 1ZL0A 1FCJA 4HXFB 3O4FA 1G6HA 3UAXA 3ANSA 2ZB4A 1D1PA 4AWXA 1RXIA 3OWHA 1KQ3A 1LPAB 2QPTA 3VVMA 4TVBA 2OZPA 2ZU0C 4WY8A 2GRJA 3K70B 3M6FA 3PYMA 4CDMA 1B3RA 1AMUA 1EVYA 3PRKE 2OLJA 1HL7A 1DWPA 2D0DA 5AKZA 3T6KA 3IAM1 4QDTA 2HW8A 4N7RA 2XLCA 2ZAIA 4LGMA 1C9DB 1JQDA 1L5ZA 4WQMA 1ZH8A 2C1EA 2D74A 3P9QA 2CXPA 1R5NA 2MMCA 1T6YA 3RROA 3X1KA 3CEJA 3SNHA 4LSWA 3C74A 2GZ2A 4P7GA 4PINA 4UTRA 4J94A 1SN7A 5HQJA 4A27A 5LOVB 4ZQEA 1YAJA 2IIBA 2HJWA 3PDJA 4XWYA 5LM3A 1P5RA 2F8SA 3DZGA 5IEJA 2PH3A 3SS8A 4DUYB 2J7KA 1J20A 3ZWVA 4D4HA 3RFFA 3BXGA 5KTKA 4PW0A 3R5SA 4CMEA 1DMRA 2YWDA 3NPMA 1MVLA 3D8RA 5F7JA 5AKHA 3D6AA 1P61B 4QC2A 4MK4A 1G4AE 1KJIA 2TS1A 3KS9A 5BNTA 4KUHA 4WY2A 1K9SA 3VHRA 5JT1A 2LWIA 1HRDA 3FDXA 5DYGA 3N28A 2JRCA 2AXQA 3O4VA 4UDNA 4X9XA 3ROGA 4H6WA 4Z1OA 1FEZA 1E66A 2V97A 2H1FA 5D3QA 3RYHB 3DWGA 4C03A 2NUPB 4DREA 1PNVA 5I7OA 4DDUA 3W5DA 1SC1A 1DX4A 2LR0A 2P1RA 3LVFO 3HYCA 4Y6RA 3ZZNA 1XMIA 5J5CA 2PZKA 4HO1X 4BNVA 1GO2A 5KNLA 2HYIC 1DKQA 4OB8A 1IY2A 2AZ4A 4R2HA 3VDQA 5A9TA 2ZBRA 1N4AA 2DPHA 1AKVA 2FPUA 2IYNA 2P6PA 5DOZA 5KU1A 3N2EA 4WCFB 2E49A 3I2JA 4LNHA 5JQGB 4MV3A 4OQQA 4OXRA 1FUUA 3LQ2A 1N8SA 2G5CA 4JZKA 1BMDA 3FTPA 2E21A 4NPCA 1MA0A 5EVJA 2FR1A 1BE6A 3P97A 2HA2A 4JS0A 4PC3A 5DWVA 3E9MA 3F71A 2A1IA 1NRJB 4IUYA 4QAJA 4F72A 2UUCB 1L9XA 3QBTA 1HQCA 1Z22A 2DHQA 4G23A 1TYDE 2PJZA 2GD0A 2ID4A 1E2FA 2OM6A 1HOTA 1Y1SA 4M99A 5JSKA 4DLUA 3CNBA 4ZAYA 1P2FA 2GBGA 3ACCA 1Y5IA 3KBBA 2AEJA 1YGPA 5AHKA 1U31A 3BQ9A 5ALPA 3RSOA 1YQTA 4HRXA 5MDHA 2I99A 1VZ3A 1VZ2A 2F1JA 4X1KA 2FW0A 1PHPA 4C6TA 4BGEA 1Z8FA 1YOVA 1E99A 1BEEA 4P83A 3V2UA 4WBNF 4HLCA 1D5CA 5KYKA 5M3BA 4P3OA 2GPNA 1VSBA 3E61A 5EUCA 1D2AA 4RE6A 2BEVA 3EC7A 2JDIA 4TLEA 3DBHA 1CR0A 5FORA 5G1NA 1LWOA 3ND6A 3RVLA 3WX0A 5F2NA 1PBNA 4BRZA 3HZOA 2XXAB 4FU0A 1PZFA 3QUQA 3ZCVA 5K0ZA 2ACKA 2H2HA 3CEMA 5CW2A 1JQJC 2C9CA 1QUEA 2P2YA 3NVDA 3O2JA 5EFOA 4FLMA 3L8DA 3ZDAA 2ADOA 3R74A 5J58A 4NWIA 4JVNA 3AG5A 5DPMA 2V7UA 3N05A 1I3MA 1VE7A 4PTZA 4RTMA 3J81k 2GTIA 4CEHB 1X7XA 4FYMA 5A03A 1RRKA 3QIVA 2ZG6A 1HNNA 2NZWA 4C1NA 3HO8A 2XSZA 2F55A 4US2R 1TCVA 2OORA 3L7BA 1ICIA 1QVRA 3R7WB 2DETA 5KJFA 1DX9A 4G5GA 1Q12A 1Y1TA 2IW3A 3M6VA 1ZNYA 3LT5A 4A1FA 3HTXA 4C6SA 3E3NA 1N5LA 2RKWA 4AF7A 1PVDA 2YS6A 2PMFA 5GMOA 4UHFA 5CK4A 3AY3A 1BVYF 5EXPA 4R81A 1RQ7A 1YVDA 2C7GA 2VPWA 1XO1A 3GT0A 3L0DA 3JTEA 3PQ5A 5EGSA 4Y2YA 4E5MA 4WZAE 4XWTA 1UEIA 2HK6A 3UV3A 1BGXT 4RM3A 4GMFA 3I05A 3Q41A 5AVSA 2YQ4A 1DHTA 1P73A 5A5DA 3AVWA 2H92A 2RAPA 3K5IA 3T35A 4HUJA 4MKXA 2BFFA 3EBLA 1N1GA 1K3FA 3EEIA 4O3FA 4QAQA 5IDXA 1QGUA 3T54A 1Z28A 2I1QA 3AF3A 3QKTA 1WAMA 1NA5A 5TGTA 4AIRA 3A9TA 2XUJA 2ZJ7A 3ESBA 2G3YA 2FKAA 1FFHA 3IDSA 3RTAA 5LFAA 3V4OA 3VR2D 5M34A 4WLEA 3NC4A 1J22A 2CL5A 3R3JA 4EG7A 5JV5A 1KMQA 1ML3A 1Z5PA 2IXEA 3TM4A 4PRLA 4MYTA 1VECA 1PJ3A 2J3MA 2X76A 3SQNA 3QFRA 1N2GA 2QU8A 3QOXA 1AS0A 2M98A 4JNKA 4OYRA 3GJZA 2Q3MA 3IUMA 5I51A 5C5EA 1VL0A 4MH0R 3EGXA 4C87A 1KY4A 4O5AA 4TQAA 2J85A 1R00A 1HDYA 3KE8A 3MUOA 3NWPA 2M2IA 2XW6A 1ZHOA 4OHFA 2GETA 3KOOA 4Q34A 1US8B 2BFDA 3HHPA 5EJ4A 2ZRGA 1Y1QA 3TDNA 4QATA 4LZNA 5DBIA 1F9EA 1RYFA 4E21A 1QB7A 3I61A 3G2MA 4P81A 3O9MA 1KFCB 1KI7A 1NUUA 2QMUA 4MARA 3ABIA 4WXPA 5DX8A 5JH7B 4B3RB 1LI7A 1UODA 2P5YA 3CV3A 5CG2A 4C0QC 4CQNA 3DV0A 2DBVO 3E9DA 1NV9A 1CJVC 1DARA 1IJFA 3EDYA 1XVUA 4PHFA 1I5EA 1QH1B 1RQXA 3UKOA 2IUYA 2N75A 3P4XA 4BRUA 3MTAA 1GAWA 3FPFA 4RKQA 1X15A 1QYXA 4JB0A 1VFPA 4TMTA 4ZOBA 4RE5A 1ISJA 4B3TB 2VJYA 1KHTA 2IHZA 4M0FA 1A27A 2G1JA 1UC5B 2O14A 3F97A 4MCJA 6YASA 4RULA 1OWLA 3MRTA 3EPKA 3VYRB 3BYZA 3R7AA 2CNNA 2O2GA 3P32A 4BLVA 2EFGA 3HXMA 1KOLA 1Y7TA 1GUFA 3NNDA 1RKBA 3HY3A 6REQB 3C4VA 3I09A 4IGIA 5D1HA 2EJCA 3E84A 3LY7A 2ZYAA 4GX2A 3UT5B 1EFAA 1OPXA 2QS9A 1AF4A 4C3VA 4K1XA 2YMMA 3OT1B 5C46F 2ZB2A 3K6JA 4YR7A 2H1IA 3JVDA 4WD3A 2EX1A 2QROA 5IAEA 1G9XA 4L5BA 2VDQB 4U2KA 5FV4A 3TR6A 3E5RA 1DQSA 2X19A 4GBMA 3ZQ6A 2WWXA 1QORA 3DAOA 4QFDA 2XYGA 3F2IA 5DZSA 2WU4A 4TV8F 3D81A 2C92A 1J1ZA 1P0FA 1E9BA 3TRJA 4MLDA 2OYSA 1YACA 2XUDA 4RNDB 4GI2A 5A4IS 4J0KA 1VL6A 1I2BA 5FTLA 3UJHA 1N75A 3WTCA 1ZX1A 1F8FA 3RG8A 3R3YA 4X97A 1SZCA 5DO9A 4N4AA 2VBGA 3EFBA 2BEWA 4BVJA 3HGQA 5AR1A 3ZI7A 3AY0A 1W6RA 4LWPA 2OV8A 4ZWNA 1M8KA 1KK1A 2E4XA 3OSZA 1F8GA 2IF2A 2G9ZA 2R6FA 2EQAA 3K5PA 4PONA 4AAYA 1SQ0A 2O5VA 1QYVA 1FTNA 3LHFA 2WFLB 4FGJA 4GZMA 4QQ8A 1H9CA 3HXPA 4KSCA 3KD3A 2H2WA 3HY6A 3DYVA 3NTRA 4J0CA 1GG9A 2EGUA 3U7GA 3IT3A 5CX4A 3TW8A 1XZLA 3LSTA 2OAEA 4L9WA 4ASUA 4BY9E 1E79D 2PYZA 3KTAB 5EZSA 2EF1A 3SHVA 4ZGBA 1R6DA 1ML4A 1TC2A 3JWEA 1EWYA 3RSQA 1II8A 2B21A 1KRHA 5G41A 2X8AA 4RETA 3TZHA 1OU0A 4YK7A 1DJPA 1Q0SA 4MI6A 1PEDA 5TQVA 2I78A 1J8MF 3LRXA 3NU1A 4IIBA 4XM0A 5KAPA 4YWJA 3UJDA 4BMPB 4Y0VA 1XZNA 4BP1A 1T5IA 4AJEA 2G1PA 2EC5A 3B2EA 3A6HA 2EIXA 4TL7A 3WXBA 5T4FA 5ELMA 5CDFE 2O5CA 4TVKA 3ZK8A 3ZE2B 3E82A 1RLIA 2GF9A 1SU4A 3FGPA 1OTXA 5E6RB 5BN3B 2GN9A 5TPZA 3SJAA 5IUJC 3WYEA 4GPBA 4JJGA 1HFEL 2VS1A 3NYIA 5LXTA 2Y05A 3MWYW 3BPSA 3GLSA 1P75A 1X9IA 4ZXPA 4Z1MA 4AMBA 2QJOA 4DCCA 1QRAA 4CQJA 3AKZA 1V1MA 2E4YA 4YI3A 4EJ2A 1YBVA 4R0VA 2CSXA 4RL6A 5L3SB 4I1SA 4CLDA 4LXIA 4LPKA 1Q16A 2QGFA 4YPOA 3VU8A 4M4SA 2GJAA 4G0QA 2IOFK 3QJYA 5BPHA 2PUFA 4Q3NA 3VKGA 1B74A 5KO2A 1E2LA 2NX2A 5JFTA 4BN5A 1O95C 3S29A 4AM8A 1HQDA 4PQEA 4Z0NA 1N2CE 2HK9A 4I8IA 3BFPA 3PR3A 5EN4A 4YAJA 4J3NA 3KZVA 3ED5A 5B3JC 1YL7A 3HG7A 2DBYA 1JI3A 2ONJA 5IC5A 3PHIA 1DV2A 3H8VA 5F2OA 1QFJA 3SE0A 3AT1A 3OPYI 1U8TA 2ST1A 4MI9A 1KI3A 1WKBA 3DZCA 6Q21A 4NH4A 1O1YA 3GVHA 2BM1A 3PQ6A 3TQQA 3PFHA 2SNIE 3LPCA 4O08A 3GPCA 4IUDS 4CFZA 4UNQA 2D2XA 1N6LA 3QRWA 3LT2A 3DPUA 5KOYA 1FW6A 5H59A 4IH9A 4BXOB 4Y2XA 1NDQA 1PE0A 2B8WA 3AHJA 3EQZA 3GB9A 1LD3A 2R8YA 3HJAA 3M1IA 4FNOA 1NXSA 3IQXA 4TMVA 4YB8A 4GDFA 2YBDA 3D3JA 1Z06A 5A3QA 4G0OA 2EZ8A 1QIGA 4QJIA 1KVQA 2VKTA 2PK3A 2B0CA 1V9LA 3E6AA 1GM5A 3BIOA 3KB2A 1BVUA 1E3JA 1U5BA 1FJ2A 2FSVC 3IIKA 4UUNA 1A5SB 3RU3A 3D3WB 1V4NA 2B5VA 3UJAA 1JDTA 1I6LA 2QXTA 2WW8A 3W8EA 5AW3A 5E6SB 5JASA 2YBEA 4RD2A 1VG8A 1DB3A 1D2CA 3FGOA 4Y9UA 4UTXA 4D9KA 2B20A 2GR9A 4LZZA 1WQ4A 1X8LA 1SQ5A 3PDIA 4Y1RA 1RKUA 2ANBA 3HWSA 3RB8A 1FOEB 4KAJA 3PGXA 4YP5A 4QGSA 3O95A 1CQPA 1U0TA 3B89A 5KQPA 1T1IA 1PT9A 4OSEA 2VSQA 4OHKA 3B85A 4LNAA 2VZEA 4CM9A 3E9NA 4EKEA 1FTYA 5DNAA 2CL0X 1R0SA 2XOXA 4D9GA 5IRCD 1SULA 3LG2A 5TB5A 4NCBA 4Y9DA 1PO7A 1KWGA 2WZCA 4H60A 2A0WA 1M2FA 1EM6A 1W44A 4MS4A 3IOMA 3UA3A 1QO0D 1KEEA 1Z13A 4BAGA 1WMBA 1FJXA 1Q7GA 3AEXA 3OZSA 3AF5A 3FN4A 1E6KA 3G2OA 5JC1A 4B4WA 2A6PA 3TQRA 4GWGA 4YC7A 5B7PA 4TTIA 3E3LA 5LYJB 1JG2A 2FXVA 2YWFA 1LBSA 1DC8A 1QQ5A 3ANTA 2M6KA 4A0HA 3SEZA 1KI6B 1N0UA 1IZ7A 5F3DA 3TIIA 3RCBA 4U5XA 1PSDA 4INPA 3UG7A 1GL3A 3I62A 1YRHA 3FVVA 3NR2A 4IXDA 2IWHA 4D9NA 4MP3A 1IC6A 1PQUA 2EIHA 1TLLA 3DKKA 3FUUA 1JG3A 3IB6A 3MM4A 5DHAA 5EIHA 2NO7A 2PMKA 5LB2A 3TINA 3NNSA 2FE1A 3ZWYA 1LU9A 3L7KA 4CCSA 5EUMA 1MV5A 3OZTA 1ZIOA 3KPVA 4E5VA 3LUFA 5HWSA 2ZBEA 1EINA 2BHLA 3TZCA 4K6MA 2Q8QA 3Q98A 4MCIA 4ARBA 1F2VA 3G59A 1X1RA 3SXJA 1UDCA 5BV7A 4LOAA 1A4IA 2X3FA 4HAVA 3GDFA 3WIEA 3CE9A 3D8SA 1E77A 4OMCA 3AEQB 4PYJA 2I71A 4WWHA 1AT1A 3KYCA 3Q0EA 4M1OA 1FTQA 2HQBA 3LCMA 1L5YA 1RJFA 1ULAA 4FIDA 1IPFA 4E4YA 2Q49A 3J81A 1Z4IA 4UASA 2PLFA 1CR6A 3VO1A 4CDGA 1N7HA 4OHPA 2BGRA 3D6UA 3PV0A 1DMSA 3HQ4O 4I9UA 4JWKA 3WL4A 2YWCA 4N03A 4FX2A 4BIMA 4FKMA 2AEEA 1NPYA 3ZXSA 2VP9A 4QQNA 4IIVA 4CQLB 3N74A 1XMVA 2O0HA 1EFLA 1JIXA 1V1RB 2CF5A 4KGDA 4MGKR 4UTNA 5AW6A 2UUAB 4MGZR 4Z4GA 1M9NA 1K3TA 1ZJJA 1XZ8A 5G4KB 1GYQA 2NQ8A 1E1LA 2EYQA 1L9KA 1YZUA 2F4NA 1GU7A 2R48A 3LFHA 3M5WA 3AWIA 3OEED 5CHYA 4MP6A 1DGQA 2AQ8A 2P4SA 3PA6A 5DYIA 3C41J 1A98A 3C4QA 2G36A 3HXLA 2AG8A 3LW8A 4G09A 4H4EA 1LFAA 4KJXA 5FL3A 3KQOA 2VN8A 4R1MA 2CB0A 2JJ1A 1C0KA 4DCJA 4ZAGA 2SBTA 2WAYA 4C3OB 3CMCO 3PGVA 1SG6A 5ICFA 1G2IA 4AP9A 4OP1A 4TVSA 2QRNA 2P9CA 4YMVA 2JCSA 1QLHA 3T3OA 2WE8A 3HLTA 2CJXA 4HSGA 1XBTA 4OQLA 3THXA 2VNIA 3UJ9A 3KL4A 4U7FA 3LWZA 1EQAA 1MUUA 3ZYCA 1H0HA 4YN3A 3AU9A 4QDXA 3RSSA 4ARVA 5B3KA 1RRCA 4I6JA 4TXMA 4MP8A 2C5AA 2B1QA 1WSBA 3R44A 4DGQA 2PMDA 3DNPA 3JQ8B 1RYZA 5BXYA 5FA8A 4HEJA 1RD4A 4UAUA 4IO1A 4DRXA 4ER6A 4XQCA 2ADFA 3GJ6A 2WIDA 2XMBA 4RIEA 2C31A 2Q0XA 3RUFA 3VSEA 3WOVA 4GKVA 5ALYA 3STTA 2J0SA 1GZ6A 1MJGM 3DE1X 4BUCA 2RD2A 1CK4A 1HDIA 1R12A 3RARA 7REQA 5G1PA 2BONA 1ZEMA 2Z4RA 3GNSA 4NNJA 3CPJB 4RHYA 4IOLA 1N2OA 4NV1A 3ZNPA 2CJWA 2FMIA 3HSKA 4KXYA 2GN8A 4OX9Y 4ZREA 3N59A 2GA8A 2GERA 3EC1A 3L3BA 2C95A 4WXYB 1W9HA 1WZIA 3DNMA 3LW7A 4Y1GA 4XEHA 4WNIA 4EHHA 3FI0A 4OA8A 1W88B 1ZBDA 3I4FA 4EVQA 3BZUA 1YD7A 2RGEA 3OTGA 3TZBA 1IOVA 5ALOA 4CMJA 2V7QA 1L6RA 3AHFA 5HG0A 5LB4A 1NU8A 1OBOA 1XQYA 2AFIB 3LGSA 2EATA 4TSRA 3ZLVA 3FYUA 2AG0A 1CYEA 4B9AA 3SIRA 4CKEA 2QAGB 1U04A 2DSNA 1UEJA 2O1XA 3G9UA 3TW6A 4YCAA 2X9NA 3ZY3A 5CB0A 1IN1A 2C59A 4O5OA 4F9FA 5TS3A 2IEBA 2G9RA 2GZ1A 4LJLA 3TJZA 1YDMA 2WJZB 2X9QA 1MN6A 4ZZ0A 1YMQA 4EL5A 3B12A 5AI9A 1ZI8A 3KAQA 3QY9A 1NBWB 3BMCB 2A7QA 3JQGA 4GSLA 2Q6TA 4H7KA 5ESDA 1GFSA 5C3UA 3U40A 2UXDB 1JVSA 4C4AA 5MFPA 5CCDA 5DGHA 2QZ9A 3OCVA 3EZLA 5AW8A 3RFXA 1Y81A 3BIXA 2ZJ8A 1GNSA 4M88A 5GTDA 3PL5A 2F43B 2PT7A 2ACWA 2UXBB 1YJAA 2JBHA 3CTPA 5KHLB 3F7TA 3QQ5A 2GCOA 5KTRA 2AJCA 4HI0E 1XVTA 2NU6B 3RIHA 1B16A 3OZVA 1CRLA 1T6XA 2IQ5A 3Q88A 4Y98A 5E7IA 2FSGA 3URMA 1GN9A 3EXHB 5GJVC 1SVKA 3ZIDA 3BX1A 1W2GA 3G13A 3DE6X 3FY4A 5FO1A 3MF4A 4Q3CA 3KZCA 2PZ8A 5A5FA 2YWEA 1M7HA 2HAEA 1SVSA 2EP8A 1WKCA 4B7ZA 4RTLA 1M6NA 2HXGA 3WDSA 5J1SB 1CS4C 2PV7A 2QP4A 4DDHA 3ANXA 1E2DA 4CLHA 3CJRA 1JSLA 1OV6A 1I80A 1QWSA 2N9UA 2V9PA 1U7WA 4GM1A 3HKBB 4H2DA 2O0MA 2ARKA 2YR0A 2I4TA 1YFJA 2JGLA 4C01A 3V46A 2HCBA 2WWTA 1MOQA 2GBCA 5HBRA 5HIMA 3A6EA 3K9FC 1X1SA 3DQZA 3NCHA 4RA6B 2FPGB 1I0ZA 4HXYA 1DJQA 4H9GA 4PIMA 2N46A 5AM4A 5EJ9A 1JALA 5TARA 2OXIA 3J7AC 3ADDA 1MZVA 1CT9A 2QLJA 3DO8A 3MW8A 3UOGA 3ZKWB 1QYCA 2JANA 2GZRA 3CF4A 4TKVA 3OFSA 4JP1A 2X3UA 1I6MA 3G2HA 3OG9A 4HDMB 2C4VA 4J16A 3DB2A 3I6BA 4K8OA 3ITKA 4C7XA 2BVNA 2HMWA 1EFPB 2Z6VA 4DA9A 4DZZA 3IIEA 1SUEA 2F9MA 4WNAA 3EXIA 5FYDA 2YRWA 1P0PA 1D2GA 1X1QA 3G2NA 3URKA 4C5BA 3OCYA 1UP7A 4PG8A 4LZPA 2ZVJA 3DHNA 3O3MB 4MPRA 1VIVA 2VWQA 3OJOA 2BTQA 3HRKA 2JI9A 3U49A 3ICEA 1TMKA 1CNFA 1UJ4A 1YR2A 4H1UA 1MOPA 3C97A 3UWKA 3SJ7A 5BN4A 1LPSA 4KMRA 2EL9A 4NFSA 2QB5A 2BGLA 4DLXA 1QP0A 1UANA 1H4VB 4ZCSA 1C2TA 4X20A 5HKLA 2XTAA 3IEMA 2J0EA 2R6JA 2PH7A 4B7XA 1EK6A 3AVVA 1G1MA 2P9EA 3EG9B 2GK3A 1NU6A 2X4GA 3HU1A 3MJSA 5JSHA 5D1NA 4MRRA 3S81A 5JYCA 1GFZA 5BSMA 4E51A 4U8GA 1SAYA 4MVJI 1X77A 2HA5A 3IXMA 4ES6A 5JW6A 4UTPA 2XB8A 1I4TD 1CJMA 2YMLA 5PGMA 4QODA 1V11A 3KT3A 3OC6A 4LGVA 2PWYA 1KETA 2LXNA 3DOIA 4QGGA 3DFUA 2F6RA 5IHPA 1WZCA 4CMHA 3BM5A 5CCXA 3MBOA 1HGXA 5DCLA 2J08A 4C78A 3NC1C 5LDGA 5CT5A 5JO0A 1D4OA 2ORIA 1GGKA 3IA2A 1PQ4A 5BN5A 3GLKA 3FOEC 2PUBA 2E2WA 4NHEA 1AQIA 2AW3A 2WFMA 3H8JA 3LCRA 5EWJB 1QQ6A 1ZVKA 1KGDA 2VJLA 4LHZA 1Q57A 1LVHA 2VYVD 4JOSA 3JRWA 3GXOA 2NTYC 3CRW1 1K8YB 3Q9SA 4IINA 1GQFA 3F6CA 3IS3A 3ZJ5A 3ZCUA 4A2QA 1T5LA 3C5CA 2WIBA 4DIBA 2WV7A 4J0IA 3DTNA 2RIRA 1A1VA 5CMLA 1P4HA 1YZFA 1UZMA 2QUJA 4EI8A 3U4QA 5FF9A 1KVSA 3IH5A 3DBRA 1R0YA 4E13A 1JBKA 1UBJS 2JA2A 1R0BA 2OCDA 2BRUC 4OX9B 4UE3S 3ZHCA 3SC2A 4MUEA 1EGVB 4IM7A 3GFPA 3R7SA 2I2BA 3L18A 4D6XA 3LNTA 2ZROA 3WLPA 3WHPA 5J2UA 1XTUA 1AZLA 2FR0A 3H6HA 4QECA 4C0KA 1WSDA 1OR8A 3NLLA 4M87A 3I83A 5EZYA 2Y1WA 3I01A 4GRAA 1B15A 1C8VB 2AFHE 4WTOA 4XIYA 4B3IA 1DAHA 4LJ9A 1O57A 3S1LA 2JIRA 2MSEB 4XFJA 4RACA 2JHGA 3T7RA 3RKRA 1J9EA 2IUUA 1WQ3A 3GEBA 5LIRA 4GOOD 2JGEA 2ZIAA 4MUFA 5FUYA 4D96A 1HV8A 4DJDC 1KO7A 1S8FA 2YN2A 3N7AA 4LE0A 4X0EA 2JRLA 1NASA 4IR7A 3ER9A 2H5LA 3WWCA 2VHZA 5K0NA 4LFBB 1Y1RA 2DPLA 5L45A 1ZYUA 1Y5NA 4KJZA 3ZW7A 1GA1A 1PJZA 2YH2A 3UMVA 4DJAA 1WOMA 4Y6GB 1VA4A 4TXHA 3HZHA 3RYCB 2JH8A 2C29D 3LPDA 4ZVVA 1FC0A 4X54A 4DCGA 4UVEA 4M6WB 4NYMR 2ZE6A 4KG7A 1LSSA 1QYDA 3FDFA 5DXAA 4EZEA 3FUVA 5A4MS 4WKNA 3QKSB 3DKPA 1QIMA 1WXEA 4EHBA 3H9GA 5JIBA 1R0RE 3D5TA 2LCQA 3UPDA 5MN6A 4LK2A 4C20A 4ZAZA 1G5IA 3ZV5A 4EJSB 2OVFA 5T7BA 1U0SY 2Y2VA 4TMZA 1AV6A 3L7MA 2WE7A 1SM4A 2ZTSA 2IKQA 1SCBA 1F2TB 1NQ5A 2PUWA 4HSEA 3ZG6A 3R0VA 2QVBA 2CNWA 2DPMA 3CCBA 1NVWQ 4OQZA 5FKJA 3V00A 2GVNA 1AZTA 1ACLA 2O8VA 4Q02A 3W7BA 5C31A 1CPYA 3LC7O 1OXVA 4LMRA 4TWJA 2X41A 3VVCA 2DUMA 2W4QA 3TZLA 3BD6A 1VE9A 2O0KA 4L2IB 3RK1A 3RYHA 2NTVA 2NUPA 3CW2A 1JHZA 3KQVA 3PIIA 1BS2A 5I9SA 1YS7A 4GD3Q 3L4SO 5LP6A 2RHLA 5IYZA 1JMVA 4FB5A 1E2QA 3PDWA 3H2SA 3S55A 4AJHA 5AVUA 4PZCA 4AZ3B 4D4IA 2ZUBA 3AQ4A 3HJUA 1JDPA 4N47A 4EX7A 3WGNA 3AERB 3CLRC 1W87A 4IX1A 2A1UB 1O5IA 2PD6A 4OL0A 3TW0A 1EX6A 5DCUA 3LYHA 3U6KA 3RRZA 4IIJB 5IC6A 4G9GA 2LE0A 2OUIA 1RRMA 2I7XA 3E3OA 3RHZA 4ZCMA 5CVTA 1K7FB 3GH1A 4LE1A 4UE6A 2QTBA 4TS4A 2OO5A 1TM7E 3TNDA 1ZHFA 3OOWA 4Z1MD 1ZMBA 2Z6UA 4MQ5A 1YJXA 3D2BA 3KETA 3JQRA 3ZCPA 4YRMA 2W11A 3FUXA 2ZUVA 4HVLA 1WULS 2XNJA 3IQFA 5F5LA 1QR6A 2R96A 2WBLC 3K09A 4RCVA 5TIIA 1DV1A 2DHEA 5FWNA 5D51S 1E1KA 2Q07A 4YDSA 1JQLB 2GJ9A 5ITWA 1U2DA 4JC0A 1KO5A 2XNCA 3RT9A 1ZK3A 2WT4A 4TMFA 2Q1XA 4ZT4A 3AFHA 4XFDA 4Q3AA 3GLFE 3C98A 3WLKX 2BMAA 2LP4Y 2V6JA 5KNDA 3U4MA 1VHWA 3LLMA 4AKIA 1J2UA 4B75A 1SRRA 2Y93A 4J9UE 1OVGA 1YTLA 1FYVA 2ORYA 1VKHA 2PZBA 2QKYA 1YT5A 3K9BA 3N3AC 4JT2A 1RPJA 4MITA 4CF4A 3EIOA 1Y8ZA 5F4ZA 2HK8A 3CEPB 4S0ZA 4Q19A 1VL8A 1IHUA 2XX3A 5B2ZA 5A4FS 3L4KA 4H16A 1P4AA 4DR5B 5ALKA 2FW8A 1I3LA 3BERA 3OKAA 4L3VA 4UHBA 3RC9A 4ARUA 4H1WA 3BWEA 1G8FA 3IQEA 2CEKA 2GJ8A 2GZDA 1SXJB 2YN0A 2W48A 4DTCA 4B4KA 2GVZC 3FRIA 1JEAA 1Y3CE 1H66A 2C99A 2VDJA 2ZP1A 5LP1A 3TSAA 1E1DA 2VJMA 3LZCA 1D0IA 2NAPA 3ZDBA 5LKAA 1N1EA 1PFVA 3WLTA 1GZHB 3EIUA 5K0GA 4GGMX 1XRQA 2HWWA 3V8VA 2MSWA 3GU3A 3G0IA 4X00A 1T35A 2O20A 5IDYA 4EK9A 1H9AA 1GOTA 4DVGA 2OHGA 1D1TA 1KFEB 5HF5A 4TWAA 2ZE5A 1EWQA 3CNEA 1I24A 1CFJA 2AS0A 4QUAA 3RVKA 1SC6A 2YINC 1PR9A 1Z2NX 3KELA 1T5TA 2WFZA 3FWZA 4JUCA 4BMVA 4R40A 1RJ9A 3IPAA 3M2TA 4YFYA 4HS4A 1NVDA 2OORC 2X9LA 4YRJA 1JKMA 2I55A 2XTJA 4RJKA 5K4AA 4EAAA 5K05A 4NFHA 3H6GA 5KVCA 3AEKA 4FZVA 4YP7A 3IEPA 3HXOA 1XCGB 5D6OA 4P32A 2IPAB 1U0JA 3ONEA 3FRHA 3B20A 5JAOA 2WU0A 2W6JA 4N6GA 2RI1A 3EG5A 2XYVA 1EEHA 2E9SA 1A71A 5DW0A 3KVNA 3MCTA 3W5CA 1WUHS 3K72B 1Y82A 4MNTA 1PG5A 4IGKA 3O31A 4QHSA 2R5FA 2YX1A 4KO8A 4QJ4A 5EIBC 4XVUA 2IXTA 3LUPA 3S5JA 4FYIA 2AUTA 3JU3A 1JILA 4M8NE 1GWNA 4GBGA 5ENVA 3RS9A 4B3MB 4K6HA 2P2GA 4UM8B 3G6KA 4CV2A 4EA7A 4AN4A 1MVNA 1V8ZA 1GGNA 5CDGA 1H3EA 4CMAA 1DRWA 2A35A 1WDLA 2IT1A 1BXKA 1JR3D 5AI0A 3ZWWA 3KQTA 1US8A 4FFBB 2NYAA 4NJMB 3CR8A 5FOTA 1RQPA 1E1CB 1QX4A 2NSLA 1BXRB 4RVNA 4WL0A 3IT1A 1EK1A 3O3OB 2Y9MB 3GMSA 4IRUB 4GVXA 2VA9A 1B00A 2PKEA 2VHUA 5E8JA 5JH7A 4DC1A 3U6BA 3PEYA 1DJMA 2IYFA 3WL7A 4ZOQI 3A1SA 1NVFA 2BE7A 2M1XA 2JFVA 2C2ZA 2F62A 2QENA 2VDNB 4W5JA 1B26A 3ZDZB 4EO7A 3LXRA 3K6SB 3DBVO 2VPYA 3GRYA 3DMPA 3H16A 4DT1A 4JBHA 4A2WA 1JEOA 4FX5A 2VRCD 3EDMA 4AD8A 1QCYA 3II6X 2GM9A 3MCZA 3DHWC 2YNMC 3IBSA 1T4DA 5FOSA 5C5DA 5E1DA 5K2MA 2B6NA 1ECJA 1KPGA 3OPQA 3GR6A 3PNBA 2Q3FA 1GZ5A 1U3WA 2BR4A 4DBLE 4AXXA 4MEAA 3X1DA 4YT2A 4TV9F 2CN1A 3UO8B 4GL4A 5BNZA 1V16B 3AJEA 5CFLA 1IFXA 5C1DA 1Q20A 3K8YA 4GC9A 1J5EB 1KEKA 1JZSA 2FGJA 3CKKA 2B3TA 3DAPA 3F9RA 3JQQA 5LBUA 2RG1A 2J59A 1VDZA 1DQYA 1JHOA 3G89A 4QE3A 3HBAA 2ZJ5A 4RHTA 3G82C 4JLKA 1NZJA 1XD9A 2QORA 2MMGA 3I6MA 3U3RA 2ZIXB 4IJ5A 1BX3A 2FEKA 5KYUA 4R8RA 1R16A 1XFDA 2HA6A 3IDZA 1EXVA 4KODA 5B58C 4ENPA 1ONOA 1EPUA 4ARZB 1XMQB 1H0SA 3RVPA 4XVHA 1NZFA 1P7WA 5TVGA 3W5VA 3PC8A 4A0FA 3JAMA 1OYVA 5JD6A 1XL1A 1XMSA 1HKHA 2OA0A 1FFGA 1MRZA 1RYHA 2NO6A 2UYGA 3MC1A 3Q7EA 1AHHA 1E5TA 1LW6E 2HOQA 3F6EX 3QMMA 1U8XX 1HT1E 3EWIA 3Q5EA 4LOIA 4E2ZA 1TJNA 4E6EA 2NXEA 2BWJA 2YYAA 3IJPA 1AQNA 4J2OA 4RMHA 3K94A 1HO3A 4MWGA 5IABA 4AYTA 2ZUDA 2AQKA 1ZXLA 4B3JA 4EMTA 3V42A 1LLUA 1NQTA 4DCNA 4YRRA 4JOCA 5EP1A 2FW6A 1G6KA 2DMRA 2V58A 1GR1A 1RRFA 4CIDA 4C4XA 4V2IA 5B1HA 5KTTA 4AFNA 1VYVA 2XB2A 1IEWA 3NXSA 3L7IA 3KTAA 3PPXA 3QBVA 4RDHA 1T0JB 4AECA 1IAQA 1ZO8A 3ZX4A 1Z4PX 1MW8X 2MYPA 4B3GA 2BZ1A 2YRFA 4M2LA 4L3WA 4P4SB 4ESOA 4X94A 4DUZB 3R3WA 2RC6A 2C8VA 2V6FA 4V3BA 1N2JA 3O6VA 3OOYA 4QLOA 4BOYA 2XCTB 3R41A 1EDEA 3MOIA 4JC5A 4P3NA 4IHKA 3ZI0A 2JGRA 4S35A 1GNTA 3ENNA 4K88A 2XI4A 2DQ4A 2OQVA 4WACA 3RVRA 1C4XA 5JAUA 2AA3A 1G4HA 1ZC3A 1UBKS 2WTEA 1EBUA 1W94A 3M83A 1MO6A 5E2IA 2E4AA 2K7ZA 3GLRA 2DTXA 3COYA 1ULTA 1RBZA 1ESZA 5I4KA 1Z3CA 2SICE 1ZVQA 1P60A 4BVLA 3QUSA 1NI5A 3ITNA 2ZAGA 3WHLA 3EPRA 4ZK2A 1QLJA 4C5CA 1K6JA 1GITA 4A10A 3OO1A 2Q3JA 2CYCA 3QX7A 4D44A 4F1KA 2AUMA 1P9RA 5A2GA 1E8DA 4ER7A 1C8LA 1X1BA 3NJ8A 3P2JA 3V4LA 1DT5A 4JT4A 4DDVA 1RRPA 2H2GA 1RXSA 4C21A 4FYKA 1JAXA 2RGWA 5E1BA 4YQEA 4BO7A 1OXTA 2AQIA 3DCYA 1VXRA 3QLUC 1DCFA 3VR6D 2FB9A 3FPAA 2GH1A 4LCEA 4NZ9A 3SX0A 1QU2A 2A30A 1J0XO 1UM9B 2RHOA 3OQIA 3RNLA 5BR7A 1M7BA 1PV4A 4XSGA 3TL3A 3GEGA 3COWA 3PNKA 4OXIA 1MCZA 2XMDA 3TO5A 3RRMA 2WSIA 4GX0A 4XB2A 3U4DA 4YRNA 3HA5A 4HWTA 2B36A 2J4FA 4I4TA 4M3NA 4BUJA 1EXMA 1QH0A 3EGIA 3LRTA 2ENUA 1FK8A 4MQBA 1H8EA 5FUBA 3R7LA 4ZVMA 1Y8QB 5EQFA 1UXKA 3KKNA 4INJA 2I2AA 4XPIB 1ZINA 4CODB 1TM5E 5BV0A 5CB8A 1FIUA 3QXGA 4ABTA 4IKEA 1QIFA 4J1QA 3R76A 1CUDA 2OFWA 1YHYA 5E4TA 3LH5A 4WCVA 4XYEA 3CSDA 2B6HA 3LXXA 5F3RA 3ZOZA 4KGXA 4JC4A 3ELBA 3GL9A 2Z3WA 4A0RA 1E4OA 1SVLA 4XM2A 3SK0A 3GP5A 1IQUA 2IYPA 4B8YA 1ZU5A 2W6QA 4IYJA 1BCRB 3ZEAA 3PE4A 3D3WA 2RK3A 1BXGA 1NUPA 5E6SA 5AHRA 5SZJA 4Y2HA 2FUCA 1XLWA 3HA7A 3KHSA 2C2HA 3PQ8A 1XAJA 4FFRA 3WAGA 1JR2A 4BUZA 4G0ZA 3MHPA 5CFMA 3UK6A 2ZCVA 3RUPA 5CB4B 5KYYB 1DIRA 3JD0A 1GZ3A 1FDTA 3DE7X 3ZVKA 1M6EX 3AFIA 2R0QC 1UFKA 5HZMA 4HWPA 1X7ZA 3DZFA 4FZJA 4MHTA 2Q3BA 1JJ7A 3JARB 3MGKA 2J3JA 1CULC 1HYBA 4HZUB 4W63A 1H2YA 2QN1A 4J0FA 2P9JA 4LYFA 1MABB 1PLLA 2OG1A 3CS3A 3I4CA 1C9MA 3GFFA 4GFDA 4W7SA 1OXUA 1IJEA 2IV2X 4C43A 2AYZA 3PBKA 2B8NA 4JLPA 3CB4A 5T3YA 5CLJA 4F4CA 1G66A 2ZWPA 1VGRA 3S1AA 4DN6A 3DA8A 4YT8A 3FMVA 3RRXA 4CIWA 4PR3A 2G5PA 4YUXA 1SQFA 2GPJA 5EWMB 3ENKA 3CH6A 4E2WA 4Z99A 3TW4A 2DJ5A 4LISA 4MUBA 1WD7A 1B2RA 3OFNA 5LYJA 2PE5A 1G20B 2WLTA 2OGZA 3GVIA 1TB4A 3BCUA 1WX1A 3OZ7A 4PZYA 3ZDQA 1B23P 3FJYA 3ISVA 3MT8A 4X64B 4D97A 5L6MB 2O8FA 1P6QA 1YB4A 4H7FA 4JBWA 1E7YA 5AI6A 3ZNOA 1SWWA 1ZQ1A 2QPOA 3I32A 3K15A 5L53A 4YXWD 5A04A 3V4ZA 1W0KA 1N9ZA 3FYTA 5EZQA 5IULC 1HDRA 4JUDX 5LDHA 1YU9A 3CYFA 4I9HA 5LVAA 1RNLA 1XE3A 1GGJA 4O4IB 1N9GA 3C6ZA 4QNMA 2EWWA 2K2QB 1GAEO 4OMFG 5ALEA 5DNWA 1RACA 3ZV6A 1HNXB 1E3DA 3Q5GA 3QG1A 4TMYA 5AO9A 2EWVA 3ERCA 2FOLA 3AEQA 3HFRA 2JGFA 1D1SA 4PG5A 5IUNC 3DLAA 4YMHA 4E1BA 1IPHA 3QA9A 4ALIA 5CIWA 2ZZNA 4RK6A 5L95A 3UJNA 3Q1KA 1TYAE 5AKYA 1TVKB 1ZIYA 1ZGJA 5THQA 1U3VA 1FYWA 3DUFB 5BQ3A 1TZMA 3ET4A 3L8EA 4LF6B 2J3HA 3LNCA 2FFRA 4D2IA 1NT4A 3C85A 1DAEA 1IZ0A 2FDRA 3LCJA 4JCOA 4RKFA 4DSZA 3ETEA 3HR7A 3UK0A 4CQLA 4X8HA 3JATA 1V1RA 3FGZA 4IYRA 4NBWA 2Q27A 3MUNA 4PWYA 3TTTA 1BQEA 3T5CA 1JH9A 1EXDA 2RHHA 4A8TA 3EMVA 4QIHA 4TROA 1HE4A 2HMSA 5G4KA 4D4GA 5JS7A 3H2HA 4RJIA 1X39A 3GBVA 5KX5F 1SBTA 4M76B 4LY6A 4N8SA 5BNIA 2ZRCA 5BNFA 3Q7IA 2H5JA 3IHWA 2FQXA 6ADHA 2W43A 1V26A 4C0AC 3QK7A 5AESA 3BWXA 4GX5A 10MHA 1T9HA 2B2NA 2GEDA 4G41A 1GTMA 3QHQA 2CXSA 4HAOA 2BFBA 3WJ2A 1X2EA 4INAA 4IS3A 4B3HA 2RBKA 4M7WA 3VAAA 5JISA 4D45A 2J6IA 1YQWA 2FQ1A 4ZI2A 5KB3A 2W2QA 1DINA 3PTLA 4HCJA 3LOPA 4W7HA 5LJIA 2IEZA 5AM5A 3GGOA 2NO5A 1RXWA 2NOAA 3F9CA 4PLTA 5U4QA 3WA6A 2C7OA 2H08A 2R7KA 4GMXA 3UYKA 1QGYA 2EKLA 5DBOA 2HDNB 4DLKA 3K70D 2C07A 5L7WA 4H4CA 2IU6A 2IOQA 1INLA 4D6PA 2BUBA 1FYDA 2JIZD 3CC8A 3AINA 4R98A 5K0BA 3LYAA 2K7FA 3M34A 2HBRA 1QK5A 1PJLA 3B60A 3JW8A 3BDVA 3OP4A 3U9LA 1ZUD1 1KMCA 2Z08A 3GELA 4LY3A 5ALDA 3H9UA 5FPTA 3KKPA 3T3GA 5KWVA 2R5WA 2OV3A 1KHHA 1RCUA 5DWQA 4BRSA 1ZCFA 4BWVA 2Q9BA 2WYUA 3F7OA 1E5LA 4GHWA 2CLCX 2O3JA 3F7NA 4QBHA 3B6ZA 2A5DA 1AKYA 4QOGA 4CM5A 1YS9A 3IQDB 3M6LA 3P0RA 1JPJA 1I9CA 5AJWA 4W5NA 2CZGA 3WAKA 1SHTX 2B83A 4O29A 4ZVRA 1RI1A 3HXKA 1NKTA 4DA7A 4J4HA 4DDWA 2RH9B 3EFOB 1YQUA 1HDZA 2GAJA 4R7TA 4BX3A 1LLCA 3B7PA 4YASA 4LXXA 3CSSA 2R84A 1P2BA 4FZ3A 5EYPB 3S7TA 2BHNA 1V96A 1W88A 1Z26A 2AYYA 3O74A 4L3OA 1RWMA 2ZTHA 1DDIA 3NIDB 3JQ7A 2Q9UA 2Z8XA 1ODCA 5BSUA 3N2ZB 1IOWA 1M2GA 1Q7RA 3A6JA 2AFIA 3IBYA 5DB4A 5K8IA 3VNVA 3W0LB 4BMSA 2PXXA 4F9TA 4CIBA 2K87A 1QXSA 3RW9A 5JAPA 4ZT6A 3N0XA 2ZI5A 1QRDA 3BRCA 4B3BA 1E1RA 3HJHA 4XX0B 5KMGB 4LJ7A 3WQSB 3D2CA 3LCVB 1ZUNB 3MTEA 1PAUA 5D00A 1E63A 3H42B 1P17A 2X1VA 3JTMA 2ET6A 1MRSA 2IXDA 3NVAA 4G56A 4QO8A 3IIJA 4DMLA 4ZN6A 4ZHQF 2RARA 3BMCA 1PUXA 2AJTA 3TGLA 1P0IA 1WCYA 2I1WA 2LRHA 4GMDA 4KXNA 4AKHA 5BSWA 2Q1UA 3I6IA 2R5NA 4I5DA 2BZSA 3NKVA 3FYUC 2F43A 3A7EA 1G55A 4HNSA 2FSSA 1XRSB 4WFJA 1HMYA 4Q47A 3U13A 2GCEA 1AGPA 4MV7A 1GXSB 3WKEA 1PJTA 1AK9A 1V8FA 4KQXA 3A2KA 3EF1A 2Z1DA 1QQTA 2FDCA 2JLQA 5INTA 2ATEA 2FPWA 5DX0A 1M2OA 1FVHA 5I5GA 5LQKA 2ZSKA 4JB3A 4ZC8A 4K6GA 2DE0X 3ILXA 5P21A 4BNHA 3PNLA 1JKIA 4EO9A 4RVGA 4LG1A 4BLTA 3RIMA 3NBUA 1ZN8A 1YQEA 2JFPA 4O4HF 4Q12A 4EPTA 1JFSA 3K6RA 3TQSA 1FP6A 3NBMA 4R84A 3C70A 3SIXA 4IMRA 4Y6OA 1JMKC 1U6IA 1XTPA 4LMBA 3PX7A 2A0FA 4PU0A 2DB3A 2HTEA 1XA4A 1EAYA 3LUCA 4IDPA 2ZB7A 5DYNA 3Q8KA 1PJ2A 3HKBA 1XT6A 5KNDD 1EP3B 1SCQA 1K89A 1SBIA 1KK0A 4L8LA 1IL0A 3GO4A 4BGUA 5BVGB 3QU9A 4JLBA 1OU4A 4RDCA 3V4PB 1XKQA 2AMVA 2DPYA 2R2AA 2AN4A 5JFGA 2FZCA 4RA6A 1HE2A 5JYEA 2NSHA 4PPYA 4A26A 3ZE9A 1RLTA 1F9AA 2Y27A 2ZU6A 4EPXA 1NP3A 2CNLA 4E1VA 3L4BC 5KJCA 2JLYA 3NHJA 1A4XA 3THWA 1IQPA 4P36A 4OIFA 5GONF 4BNWA 5GADl 5A0FA 1GRNA 2GPTA 3AUFA 4PQYA 3PFBA 4HDMA 2FI1A 5IK2D 3RH0A 2HU8A 2WIKA 3IFSA 3O4HA 3OY2A 4FMDF 4LSGA 5B37A 3SKXA 3WHIA 1J0BA 1EFPA 2ONYA 3EZ7A 5LMNB 4D79A 1GN8A 4C14A 3UN1A 3AJAA 3O03A 4M8KA 2MSDB 2OILA 2ZDQA 1R0ZA 3LU1A 1OXSC 1QHXA 1SY7A 2OZVA 3BRWA 4IWXA 1GA6A 1N92A 1J0EA 3R8CA 1YK1A 1SG0A 3D7RA 1QV6A 4YHHB 3H84A 1LTKA 1DZIA 1ZMRA 5CRIA 1P62B 2AJ8A 4R2KA 1TCBA 1Y9EA 2C5FA 3U4GA 3P9NA 1ISGA 1WDTA 4X92A 2VK2A 2XODA 1XRLA 3DV2A 3TJRA 1DKPA 1H2WA 1N36B 5SZHB 2G08A 1T0IA 1TF7A 1V3TA 3AI7A 3D4BA 3KQSA 3HFGA 2C42A 4JA0A 4R9VA 2I4LA 3ER8A 1KSGA 5AQEA 3R3XA 1WUKS 2EFJA 4P6VF 3H3XA 3BJEA 1TEZA 1HLDA 4MB0A 1NNI1 2HT1A 1F0KA 4MIOA 4MYCA 3VMMA 2J9GA 3ET5A 5DE3A 3TPCA 1YZNA 2YY6A 4MRMA 3TD9A 4BNKA 3EPLA 4FIZA 3MXTA 4NC9A 3W3AD 1QCCA 3WLSA 4WOJA 2CV0A 2VPXA 2H29A 2PQMA 4CIYA 2W6JD 2WMOB 4IJWA 4UEOA 3WGTA 2YMQA 2OMKA 4CTOA 3QE3A 1T0PA 1EUCB 3RUCA 4FI3C 1ILWA 3ZWNA 3DDZX 3PHGA 1R0XA 2D5IA 4UCFA 2BSQA 4TZ6A 1UQTA 2FTKE 4GEKA 2LKDA 4MYRA 4B85A 2DLCX 2CLSA 1T4GA 2VJNA 3L0SA 1WTCA 1AO3A 3T9DA 3WSWA 2YUIA 3A25A 4UAGA 2HUNA 2W8ZA 3L04A 4DM4A 1UZLA 1RRVA 1RCTE 5EIXA 2CKMA 1L8QA 1PZNA 3KKKA 3V8NA 4GQBA 4NPHA 1NR1A 2JJYA 2Y92A 3OPYB 4IOMA 4M0KA 5DBEX 4URVR 1ZW1A 2FN3A 3SP1A 4ZDKA 3C87A 1PX0A 3I9V6 1QP7A 3GFVA 1MXHA 2X0IA 2XB6A 2E4VA 2HA0A 2OBXA 3DBIA 1C3LA 2B2XA 2DQZA 1R6XA 2DWQA 4RM2A 3WIBA 3QEKA 5B1SA 1PKEA 4JYAB 5HKAA 1CUAA 3A3NA 1TCUA 2O7VA 3KZ1E 3WLQA 1TLFA 4PS1A 3E7DA 1PYGA 2VWHA 1NTRA 1OIXA 1U63A 2XUZA 5IKPA 2GAIA 2AKAB 1MGOA 1BEZA 4QRDA 4OI0A 3KWLA 2R1ZA 3IX7A 1JTEA 3QU5A 5EIFA 5A7HA 2Y1CA 1T9KA 2X6QA 1GAXA 3BWMA 3H1PA 4OBEA 4V0SA 2CV1A 1QIDA 1RJGA 4JQOA 5T4EA 4L4UA 1FNDA 3W04A 1CD5A 1E9DA 1THTA 3CUKA 2C7PA 1YZKA 2OKCA 2BFNA 2R66A 4LYAA 2CUKA 1X70A 1E9RA 4FHFA 2HCTA 3QIAA 4D99A 3PI6A 4I50A 2V7XA 1YMVA 2PYDA 2RJOA 3MWLA 4FXOA 3LK6A 4JUIA 1STOA 4FYVA 4JIGA 3TGPA 2VZ9A 2WD8A 4ZGGA 2IV7A 3RT7A 3FR8A 1C8BA 5G02A 3ZLUA 2D3TA 4MDHA 4YCDA 5KSOA 2X86A 5ELLA 2X15A 3W5AA 1P19A 3PDHA 4K3VA 2O48X 1JVBA 3F3KA 3E3AA 4QFBA 4A03A 5C8XA 4UQLA 2GD2A 2QV0A 4IF4A 2CMKA 4BNZA 1C1DB 3FWYA 2PX8A 1V95A 3PGMA 1HT2E 4GSYA 3SX4A 4YT4A 4K9MA 5HKBA 4MQ6A 1S2MA 4CG1A 4ZI7B 2B82A 1G17A 4OHMA 3IE1A 2W6MA 3M1LA 5J4VA 2G17A 4M6WA 1RLJA 4F8JA 3T5AA 1NX6A 1XALA 3SSOA 1ICEA 1YKFA 2IIQA 2Y67A 3HUUA 3UFBA 2A4KA 1QK4A 2WU8A 3QKSA 4WVLA 5D5PA 4DY6A 3AP3A 1M75A 4QDJA 3CR7A 4MA5A 3EH1A 2OC9A 5EERA 4MHSA 5L7TA 4BLRA 4IIEA 2YCLA 4CMIA 2R68A 1ZJZA 1PUJA 1GSIA 1CY8A 5IXSA 3RNOA 4B2YA 1WLYA 1ZCBA 4JX9A 4O8CA 2AX4A 4P4TA 3ZDEA 2QMOA 2BC9A 2HCFA 3KQPA 1ZD1A 3T1VA 3X2SA 2B30A 5C0OE 4P92A 2R85A 2CLIB 1BHQ1 4J1NA 5IKEA 2GO1A 2PKRA 3F5DA 1V9SA 3FOWA 4L2IA 4RY9A 3B53X 1J4AA 2PRYA 3RIYA 7ABPA 3PVZA 3TRHA 3PJDA 1AC5A 2C5HA 5JWHA 5CT6A 4X91A 2CFIA 5DM1A 5B3LA 4D5EA 2X5NA 3OQBA 4NDAA 5FPQA 1G8KA 1UJMA 2K5UA 2EBFX 2FHSA 1LLQA 2I6TA 1G7CA 1K63A 1W8IA 2JW5A 3X44A 1B1AA 4QTUB 4M1MA 1RM5A 5A3RA 1ZM9A 4KRGA 1WNFA 2A1UA 3FNBA 4ARAA 2QTLA 1KZ6A 2H63A 5J40A 3BJIC 1TKCA 3THRA 4EFLA 4IIJA 4JDPA 1V8BA 3LVRE 1T1RA 2XZTA 1FMCA 2ZWAA 2VFAA 3R0JA 1DO2A 2WZDA 5LP6C 2FKNA 4UAJA 1PJBA 3ZXXA 1HNWB 3BTVA 4IF6A 1TKRA 2AN9A 2WJIA 1ENZA 4YCSA 1B43A 2IUEA 4B8ZA 2VRWA 5B7NA 5I9NA 1KJQA 4L0MA 2Y0EA 3GJXC 1UT8A 2WKWA 3C7CB 1GFIA 3STWA 2REXB 3IVMA 4BQFA 4M1QA 4B32A 1H22A 3H0KA 2XRZA 1BFKA 2C77A 3FKSA 3ROFA 3QOFA 1TX4B 4C7OB 3FUCA 4MR7A 3P2MA 4YIKA 4ZJUA 4F5WA 2BDTA 2I7CA 4HAZA 3BF7A 2XUGA 3O8OB 4PNPA 3TSOA 5MGBA 2AT1A 2AF4C 2REOA 3M70A 4KIFA 4K9KA 4BV3A 4BCDA 3E05A 4ZAVA 1UJ2A 2QSZA 3ISJA 4QXPA 4RCZA 5KTPA 2G06A 2X5KO 1YJCA 4DV4B 3F5SA 1ZGBA 4ZFNA 2X1LA 2COEA 1LDBA 4N0MA 5EJMA 1Z6ZA 1I3NA 2M32A 2COUA 2R7MA 4NFYA 1FLDA 4AWAA 4C0SA 4II7A 2QJRA 1GZ4A 4UPDA 3RGWS 3HO1A 1DBWA 4UHDA 1SIUA 4MUMA 3KOZA 1IY1A 4K40A 5GGXA 2GYYA 1AM4D 3CLSC 4NH0A 4E03A 1ZGHA 3PCXA 2CNKA 2R2GA 1LV8A 2RGNA 4FE4A 4DIEA 4B1FA 1VLVA 2WJHA 4ZEVA 1CUGA 4NG5A 5IAOA 1E59A 3GUCA 1KJNA 3IJEB 3EMBA 2W37A 3ORHA 4KTVE 3TCXB 4BFWA 2PS9A 1ZWLA 1AKRA 1JR3E 3PWKA 4B4VA 1N6OA 1SXJA 1SBYA 1C30B 2B92A 2IBMA 1XWIA 1G3RA 3A1UA 4R68A 4BNIA 4WDQA 5JDCA 3PRYA 4GPAA 1S1CA 3EK2A 4UEKA 4YRIA 4BVAA 1EVQA 3PRHA 1NJ1A 3KXLA 1WXWA 2EFYA 2EARA 4N82A 4UEQA 4ZQBA 1T9DA 4CM3A 5C81A 5J43A 3ORRA 1K4YA 4FXPA 3B6KA 2G77B 1WV0A 3D0QA 5DGIA 2BBWA 1G5PA 1M34A 2C5EA 1WZ2A 1GCGA 4C04A 4R8KA 1NJ5A 1V5FA 2JI7A 1UBLS 1JW9B 3QE0A 3BSSA 2O2DA 2VPPA 4BVBA 1E9SA 3G8AA 4MQMA 3M6MD 3IAS1 4XIGS 4BNUA 1QFMA 2IDKA 3Q9NA 4Y7CA 3TLKA 1GTZA 3P2EA 3I3OA 1YS4A 1NAIA 3GJQA 3KJGA 1N0VC 3BJRA 2YVLA 1ONNA 1PZEA 4UOEA 1U8YA 3H3FA 1GFWA 3SZRA 4JI0B 1D03A 1Z7BA 2PQ0A 4WLNA 1KJWA 1EH5A 2NU9A 3N07A 4IZHA 3JZFA 3IJRA 3LZ6A 4BWFB 4HEHA 1EWRA 4F7DA 5JAIA 4BNLA 3GF4A 2OC4A 2H7YA 5ECDA 3V2GA 4GBJA 4RCYA 1W73A 1M72A 2G1UA 1BDHA 4M22A 3M1YA 3L84A 3Q3VA 4UFOA 2V9ZA 1GLNA 4YJ3B 1XI2A 5FRDA 4DHWA 1AUOA 3U81A 1TI7A 4TYNA 2VPTA 1AG9A 3OFND 5FUWA 4Z7JA 5CDYA 1CJKC 4BLSA 1DPFA 3I34X 2EZ9A 1PZHA 3HBNA 4LZWA 3VO2A 4J3FA 4NJMA 1QDLB 5L3ZA 4H59A 1TECE 3NGXA 2NU7A 1E1CA 5C52B 1BXRA 1O4VA 2RG7A 3RJMA 3Q7PA 2E5FA 4R01A 1AZSC 1XTQA 1W0KD 2REBA 1GQSA 2HIAA 3PUJA 4PY2A 5JVDB 4XEUA 3DPIA 1UJ6A 3VU3A 2J6HA 5I8WA 2PIDA 3Q40A 1QUFA 2JK0A 2NPFA 2FW7A 2VUUA 3S2EA 1E2NA 3T38A 3ANLA 4V24A 5FI3A 5JXGA 1Q3KA 4S1WA 4X8MA 5TPWB 2O7RA 3K6SA 1HG0A 4DZTA 2QLFA 5HDQA 1Q50A 2OAGA 3ESXA 3KQLA 4L75A 5F77A 4FGSA 4O4JB 4UNIA 2JIBA 1GSHA 5KYVA 1E3TA 2P9HA 3EGDB 4HPWA 5ESWA 2HQOA 5JLJA 3G9QA 2XDYA 2HFJA 1Z0KA 3E8XA 4K6KA 2P40A 3TIVA 4KZPA 4BMYA 4QYSA 3UMFA 1P2TA 3UWDA 3KLMX 1YRWA 2YJNA 4PBSA 1JG1A 3ODPA 3CZMA 4F85A 4DB4A 1SQSA 3INNA 1ZDMA 2QX8A 1UPBA 5IWCA 1V16A 3LDGA 2FPXA 4P82A 4LNUA 5KVSA 1DG1G 3SLGA 4KDRA 2FH5B 1E9EA 4JI2B 2M6RA 3DUWA 1OZAA 4ZJPA 1S2IA 3OEYA 2IWRA 2WF8A 4IDGA 1MORA 1JBEA 1C1HA 1B4DA 2ZIXA 3GVXA 3GLIA 4S0XA 3JASA 1JB1A 1QV7A 1O7JA 3AH8A 3OHSX 1KQNA 3TXYA 5ICCA 4JODA 3IUBA 3EEYA 2LIVA 4TS9A 1SQGA 3H8WA 1OBCA 1GRVA 3EYWA 2LV8A 3DC2A 5T64A 1QONA 3IEVA 2PZEA 4LZOA 1QOPB 3T5PA 3JQAB 4HTFB 5BR8B 2EAUA 1OC2A 4DSOA 2JFYA 4PIPA 1E20A 2I2XB 3B36A 4Q4HB 1YB1A 4QXOA 3HCDA 2C3UA 3DCNA 2O8CB 2BP7B 3H2KA 5A05A 4EJFA 1DWUA 4K2AA 3IDFA 3KT6A 5E7MA 1OFHA 3B6EA 4EY5A 1LDGA 2PXAA 2W6CX 2YQ5A 3PQFA 2PGAA 4ZVUA 1YDEA 2A59A 2DOKA 4PX2A 3V7NA 4DBZA 2X2OA 4JB8A 1IN8A 4GYKA 4XJTA 3CGWA 3NTOA 5FL7A 4FM9A 1Y9JA 3T4EA 1TAUA 4LSZA 1VHTA 3NANA 5HKKD 1FLVA 3F8TA 2GYUA 4R9RA 1Z73A 1RMQA 3A3KA 3RS0A 4CF7A 1DEHA 1A82A 4ETNA 1V8OA 4O8ZA 2QJWA 1EFRA 4RANA 4EGCB 1HORA 5B12A 2WWYA 1GZUA 2XYRA 3V1MA 5K5EA 1FTGA 1K68A 2EZUA 3IBFA 4BU0A 4I0WB 3SHTA 3SKVA 2C78A 1XRNA 2JLSA 1XAGA 3FIJA 2N1MA 3B2QA 1Q0PA 2RGCA 4R1SA 4D25A 2XD4A 5AK5A 3TN7A 4IJ6A 1OKKD 4EHKA 1FVOA 1N57A 1PW5A 3CKLA 3AHDA 1PR6A 4HGNA 5DTEA 1P77A 4BYGA 2V6GA 1NUAA 3R24A 1N1DA 2YZKA 2OSBA 4LHSA 3KHKA 2WG0A 3K9LA 4G8JA 3OICA 4MI1A 4UDXX 3BK2A 2Y1LA 1E0KA 2RJ3A 3HR4A 2ZE8A 4N01A 3GA0A 2C2OA 1QKKA 4KO2S 1DRUA 2IS2A 1KORA 1XWFA 2CDCA 2FF5A 3L8YA 4LQ4A 3RREA 3O8RA 3F4LA 5FWXA 1E1RD 4Y8VA 3V9PA 2WSYB 1J90A 3DF9A 3VNSA 2ZI4A 2P7HA 2Q28A 3ZNNA 1H1TA 4WNYA 5ABPA 2VC2B 1N5RA 1RYDA 4JYCA 4YUVA 3W7VA 5EEGA 4M9QA 2P5SA 3O90A 4HH1A 4MV6A 2HF9A 2OV1A 1DP4A 2OGWA 3AKEA 3H2GA 9ABPA 1H4SA 3BC1A 2FPLA 4BCBA 4H7EA 2P4EA 4KQ9A 4QARA 3GCWA 1U3DA 4KPGA 3X1XA 1E2HA 1F3LA 1MAHA 4F4HA 3ZW8A 4NPAA 5A5VA 2G7ZA 1MB9A 1JIVA 1UM9A 4I19A 4BJHB 5HUJA 1UPCA 4XTRA 4I99A 3CLKA 2R1UA 4HWRA 4UPEA 4EGAA 4JK3A 1T24A 1GSOA 2D8AA 3QHAA 3K71B 1QF6A 3L5OA 3PRJA 2B4KA 1YB7A 2DRIA 3T7AA 2QGZA 3AF6A 1C14A 1G9TA 2HADA 2PX4A 3DVRX 2HO5A 2DVMA 3VO8A 2HY7A 3KXPA 3HUEA 3HSYA 4XPIA 4XSHA 4AUEA 4G0XA 1FSPA 2PXCA 1AKMA 3E9CA 3JPYA 4G97A 3FPGA 4ALJA 1ZJYA 2JAWA 4F3NA 2H4WA 4ZZ1A 4C4PA 1FRQA 4R9UC 3H11A 4L0DA 3ECSA 1DBVO 2QG9A 2C7BA 4BEBA 2LVBA 4D0GA 1MDBA 4YUWA 4BQNA 4PCLA 5FULA 1VMDA 2GEFA 2HM7A 3GFBA 4PYOA 4V0QA 5T8KA 3SMQA 1NURA 4JLAA 1G41A 3LY9A 5IG2A 3CF0A 3ICPA 3KQHA 1XZFA 5L8VA 1A8HA 4GKJB 4NYJQ 4RK4A 2Q6KA 1F48A 4Z7NB 3VKUA 1MHTA 3HXQA 3VZCA 4URUR 3KR9A 3L01A 3PTAA 1FZQA 4FKZA 1LJ8A 2AOTA 1Y63A 4AS2A 4D0RA 4N41A 1EG2A 1ZIPA 2C5SA 2NZJA 3LHSA 1LBHA 4L28A 4LOLA 5BQXA 3VZSA 2ODPA 1GPKA 1NJ6A 2QX6A 4K05A 4XUGB 4CU5A 1KRWA 1AKWA 2L82A 1K98A 3F0TA 4A0QA 4TOIA 1NKVA 5CB4A 4IFTA 5LZ8A 4ND6A 3NI2A 1IN7A 1D6SA 2W2NA 2WNSA 3HGTA 2RGUA 5JCPA 1OLSB 3COSA 1E2MA 5BW4A 4YJGB 5K9ZA 1RZRA 2XF2A 1C81A 1WXXA 1XLTC 2Z5VA 2ZRKA 3C2QA 3EFEA 3FPSA 4HZUA 4Q3BA 3EQ8A 5LXTF 2FN8A 3LBAA 4UQPA 4PZUA 3VTKA 4YDHB 4XQ9A 1T2DA 4KX5A 4U7JA 3V6MA 1G60A 5IHXA 1KKUA 2BKUA 1J42A 3C16C 4O3MA 2FWAA 4ND5A 1AK1A 3ZWDA 3A28A 3WGGA 1LPBB 1I7DA 2HMAA 1ADYA 5FTKA 1L5FA 2PGDA 4FMCB 4F2GA 1ZIXA 2I7DA 2QNBA 4KQ1A 5KBYA 3KNZA 5HJEA 3JD2A 2KE5A 4HWSA 2II6A 2H16A 1M6HA 5K3AA 3PC7A 4BRWA 1TUBB 2GBFA 5DHUA 4PBRA 2HL6A 5C5IA 1SCAA 2NVOA 5EGNA 4FB4A 1L5RA 5KAMA 4E22A 4OH1A 3PFFA 1J25A 2BCJQ 2JD1A 3ES9A 3HJTA 5C37A 1Y8RA 2D1RA 3ZXYA 5A3JA 3ID6C 3IT2A 3QGMA 3ZCSA 5LQUA 1U2QA 2CVZA 1ZESA 1ZSNA 2I1LA 3K05A 3PT5A 2P67A 4RIHA 4JUBA 3SZOA 3KPJA 5JJKA 1R4ZA 4BAZA 1HFJA 1FUKA 2FZKA 2H3EA 3DL4A 1LZKA 3WYBA 3ZWMA 1EVJA 1G8JA 4DB2A 1CUBA 5EVCA 4O4IA 1C4OA 1OAAA 4Y9SA 5C3MA 1U81A 2H00A 4DNOA 4DG9A 4HB2A 2FFHA 3KQWA 1QHGA 2QPAA 3KDPA 1SXPA 1GZSA 1RYEA 1CUCA 1RAEA 2VH2A 3DW3X 5EPOA 1YXMA 3U9TA 5IJWA 3LJKA 821PA 2C2YA 5KCZA 4DIKA 2DWPA 4PLVA 4JI1B 4LDAA 1GPBA 5E6UA 3DNFA 4EI9A 1U7OA 4Q3EA 1H94A 3D1JA 3UTDA 5FEUA 4HRVA 2IX3A 1Z6XA 2BISA 2J41A 5FR2A 1CVRA 3NUZA 1C29B 4WLOA 2AZTA 4ACAA 3ZHVA 2NZ2A 5I7AA 4Z8XA 2C3YA 3LS2A 4IIXA 5CGQB 5CNMA 3DUFA 3EVCA 1PJ4A 4P0QB 3ICWA 2GFIA 4PPQA 1U0NA 4ARIA 1TZJA 1TW3A 1SQ6A 1Y6QA 1H2HA 1OXMA 3BD8A 1XJ5A 4IL5A 1QYWA 4RZXA 3NHYA 1X42A 3JQBA 2X23A 4E32A 2HLDA 3KSDO 4JP2A 5LNK6 1ZLXA 3ORYA 1WHSB 3AJ9A 4J90A 3S3TA 1Z2OX 4V0NA 5AJXA 5I7UA 3HEAA 4MCAA 4AN0A 1RE0A 3RJ9A 5CA1A 2R4TA 5DI3A 5I9TA 1PGOA 4OQMA 2PPLA 2PU7A 4G8DA 3V2IA 4J07A 3O8QB 1KEWA 2E1PA 3C8ZA 3ABOB 3K8QA 3Q7RA 3FOBA 2P4UA 2OQ2A 2NP6A 1A76A 1AE1A 4KO4S 2H4HA 1G3MA 3L6EA 1M1NB 4PGAA 4TSKA 1PDVA 1HX7A 2CUNA 4K1LA 1HM5A 4NMHA 2FSHA 5KUTA 2AXPA 2HSEA 1JEQB 3IVRA 3QVMA 3ZHBA 3EXG2 1NZDA 1KAHA 1DDOA 3MB8A 4IXNA 2Y71A 3OUZA 4P33A 5TQ2A 5TEVA 2BI7A 3KJXA 1CXZA 3H2YA 4TT3D 5ERXA 4L95C 4HT3B 3ANMA 3HMQA 4ZAWA 4DEVA 1U4SA 4EBBA 4S04A 4OQYA 2XUQA 3HYSA 2GK7A 4JEUA 3DLHA 1GKIA 1KR2A 1Z34A 4EH1A 3BGIA 5KYTA 2JLRA 2XNHA 4WK4B 3SJZA 2WSLA 4Z54A 4HFMA 3RC7A 4BQIA 5EINA 2W93A 1HPLA 1T13A 2OXEA 4FS3A 3BHNA 3D4LA 4MWCA 4HNUA 2IS4A 3ZGLA 2AQHA 3TJMA 2PEZA 1NMEA 3BJMA 1Z6PA 2X42A 3F49S 3F46A 1ZNWA 3GJ5A 4TWIA 1SVOA 4UULA 1W0JA 5F4BA 1LRLA 3TD2A 1J09A 4J1TA 4MR8B 5JJIA 1BNCA 2OMEA 2VHJA 3V4FA 1GSAA 3HB0A 2KYRA 1T36B 2ZRJA 4FE3A 4QDUA 1HYEA 5DX1A 4ZVNA 4A92A 2XUIA 1CEYA 1NC1A 3FDIA 3M6IA 1V8DA 5EYPA 3WB1A 4Z0TA 2P1DA 4KQCA 3PFIA 1NF8A 1WXQA 3H9EO 1UKCA 2JVJA 1VLZA 2YICA 3H0CA 5GOTA 4KO1S 4JGIA 3KKEA 4PZAA 5KYNA 4G2NA 4HQ0A 3KJEA 3W06A 4EG5A 4HN2A 3T9EA 1M33A 3E5NA 1RHQA 4WXMA 4CHGA 4F3YA 3FTFA 4BO6A 4WESB 5KYXB 1CUFA 2I34A 5BRAA 4JJAA 2NW6A 5KMGA 4UUQA 3F8SA 4EVIA 2BTEA 4MAMA 1ZUNA 3C45A 1XN4A 3ICVA 3QY0A 3Q3JB 4RZHA 1ZICA 2VQDA 1K6XA 1USGA 3DWIA 3VRHA 4BVGA 1RVDA 1LRKA 1M1UA 2GZSA 1M2HA 4ARSA 2ETVA 1O6ZA 1VBKA 2G4CA 3KO8A 5JCJA 4NCHA 4QVGA 3PYLA 3T7DA 1USVA 2C9OA 2ANCA 4DSNA 2YWRA 4FMPA 4UOQA 4Z4CA 1ADJA 4OLFA 3FHOA 4JHLA 4PWZA 4W99A 4ZV7A 1J7KA 4B87A 5FH9A 2FFJA 4JXXA 2GEJA 3GFQA 1DXOA 4ZVKA 5BNWA 1YFLA 5EHGA 2CSUA 4I5GA 1BX1A 4Q1CA 1N77A 3QKRB 4WDRA 3DEIA 3SM9A 1ZOSA 4I55B 4RPCA 3S8MA 5H3HA 1E6MA 1DBQA 3CUUA 1H1DA 3I1YA 3JYLA 4H3KB 4N3NA 4FZ5A 4HF7A 5AOVA 1UK7A 3P8ZA 4GXTA 2QL9A 5EY5B 3TDKA 3CZAA 1VJ0A 3EEBA 1UMKA 3UK2A 3PEUA 4QJ5A 4B6SA 3PR2B 4FUTA 4OEHA 2GEUA 4WXHA 3A0UA 5EJ7A 4K9DA 1Q92A 1J7JA 3UUWA 1M6VB 5AW5A 4DEXA 2PD3A 4CI9A 2GXUA 2GYVA 5JD5A 1NWCA 3KSBC 3ONVA 2Z83A 2PQ6A 3CF6R 3H7AA 5TGDA 3DE4X 5I8PA 1DJLA 1WUJS 3DTTA 1H2BA 4FR5A 3U7QB 4EKIA 5I3CA 2R6HA 4JBGA 1T1SA 4IZIA 2OCKA 4HD8A 2P79A 1Z35A 4LJKA 3BL6A 1U9CA 2YZ2A 2JFBA 5KX5B 3CW8X 3MFYA 3ZZMA 4Q4AA 1NFFA 2E6UX 1PGJA 4KR3A 4XVQA 4JOQA 1KZ7B 4BNFA 5D7NA 4G1BA 1IHPA 4B84A 4BZQA 4HMQA 2YTZA 4LPSA 4HDSB 4L8YA 2YDXA 4PIVA 1R9GA 2ZBFA 4S1PA 5CIQA 1ZGGA 3ZU2A 3JYNA 2I3ZA 5ADHA 2Q5CA 4OGWA 3DB1A 3E1SA 4X1IA 1SXJD 4A1OA 2PZGA 2RDMA 4PV7A 2P0YA 3RK4A 3U56A 5T67A 2V5UA 4C4TA 4FZRA 3LTNC 1JXOA 4XR9A 2VWGA 5G0VA 5B7QA 1NYRA 4L51A 4L5IA 4M7RA 4N3CA 5AK6A 3CNLA 3ICCA 2FEPA 2OCPA 2XHEA 3CH7A 4YJ2B 3BEDA 1PFUA 4Z2AA 3HJFA 1A5BB 3DBLB 4POOA 5IKXA 2IA5A 3T5BA 3OM8A 3JQ6A 3QYJA 4OPMA 4DLBA 3E7PA 1DAMA 2OD2A 1QQ7A 2F4VB 4J0EA 2F8MA 3A6DA 3WMWA 1A8SA 4PPNA 3GW8A 3I9NA 1LC3A 4PHTA 4P35A 1JDJA 1GQ2A 3MOGA 1Q15A 1Z2DA 3WMXA 2P6MA 2PEYA 4ESEA 1Y8AA 2O3QA 3OIWA 1NIJA 5FJIA 4W9RA 3RANA 3U16A 4CEJB 1IXSB 3DMDA 2W6OA 4OJQA 4QU9A 5DKFA 3JD4A 1W9MA 2Q3LA 3NYWA 5CH5A 3HWX1 1ONBA 1FFYA 4A4DA 4ATNA 1SXGA 4I7EA 2XADA 5CVUA 2W98A 4FQ8A 2Z1NA 1COZA 2MYUA 3SJCA 1W5SA 5A62A 2E0IA 4RJ2A 2CHFA 5CK5A 2O5RA 1M0WA 4JKYA 3EOZA 4BFLA 3MBKA 4DC9A 2PY6A 1YCGA 3M6XA 1ZM3A 1ORWA 4I2NA 4B17A 4ZDJA 2QK4A 4L6AA 2D8MA 2C97A 4WZ6A 5DYYA 3TL2A 1PK7A 4KP7A 4WZBB 1Y1KE 4G5QA 2DR2A 3KLPX 2P9FA 3N39C 3GRFA 3VZQA 1RKQA 3PGA1 3TUJC 1U8UA 2Q5QA 5DK6A 5ER6A 4EHFA 5BSGA 3PK0A 4KW7A 4K9SA 4AMVA 3SCZA 4EUEA 1HFWA 3DVQX 2JFGA 1A9ZA 2EV9A 4FTWA 4M9ZA 4MUIA 4U7HA 3PGLA 2GPWA 4ZHQB 5EHXA 3IO3A 1PZXA 4ZQIA 4D3YA 3LUDA 3DL7A 5E0KB 2GN0A 2X3YA 3WYFA 2W7TA 1X7YA 2IHKA 2VF4X 4OJYA 3WWOA 3M6AA 4URHA 4TKLA 4E07A 4D41A 4YDRA 1VIMA 4DADA 5GJBA 3LYLA 2Z98A 2ZJBA 5TF4A 5ALNA 5AVJA 4UBKA 2BZ0A 1NVXQ 1QG2A 1YL5A 2WKRA 1ZNQO 4G5FA 3PE6A 4WFKA 1CHDA 3IQWA 1UAYA 3A31A 3HCNA 2HLHA 3U4IA 4CT5A 2PUEA 4OD0A 3HXTA 1TVMA 4W82A 3WR5A 5AVWA 3CNHA 1MU0A 2Q7DA 4IJUA 1SZPA 1I0LA 2B9EA 3REQB 3A4TA 1ZMTA 1P4SA 3GLGA 4S1NA 3FJOA 1O96A 4GPEA 1LX7A 4E70A 2QV7A 4UUBA