1S2DA

Purine 2'-deoxyribosyl complex with arabinoside: ribosylated intermediate (araa)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
164
Chain Sequence
b'MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 50
structure length 164
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2dA00
2F48A 2F62A 4OHRA 4A3SA 4PFKA 1S3FA 2KLHA 3O8LA 3OPYB 2Q4DA 5AJUA 2IZ5A 1KZHA 4LJLA 2NX2A 2HIGA 4KXLA 3BQ9A 3OPYA 3MAJA 4MCJA 3O8OB 3GH1A 4LJRA 4OHBA 4NPAA 4MEJA 2PMBA 3SBXA 4FYKA 1ZXXA 2F64A 1S2DA 2F67A 3IMKA 4RH3A 2A33A 3O8OA 5ITSA 3U39A 3HNOA 3EHDA 4U1RA 3UQZA 3K2QA 1YDHA 4P5EA 1S2LA 5AJTA 1RCUA 1WEHA 4JEMA 4LJKA 2IZ7A 1MTOA 2F2TA 2IZ6A 4I7EA 3PFKA 2A0KA 2PFKA 1F8YA 3QUAA 3F5MA 1F8XA 4P5DA 1S2GA 4HX9A 4KXNA 2KHZA 4FYHA 4JENA 3O8NA 4I4IA 4KXMA 1S2IA 1PFKA 4FYIA 4JELA 2Q4OA 1T35A 1WEKA 6PFKA 4WL0A 4I36A
chains in the Genus database with same CATH superfamily
2BTQA 3EZNA 4P4SA 4RDCA 3SXUB 4MWCA 1KQ3A 5CW2A 4BZZA 3DBLB 1NI4A 1WAMA 2FPWA 2FB9A 2GZDA 3DPSA 5AOCA 3HA7A 3TB4A 3ZQJA 8AT1A 3W2GA 1BOFA 1Q0SA 2I8LA 3GA7A 4EG5A 3NBFA 3REFA 3IP6A 1EEXB 1H8ED 4QARA 1JG3A 5JZOA 2OGZA 1OTHA 2ERXA 1F5SA 2RAVA 4XB6B 4WY5A 4EKEA 1G5RA 2HPZA 2RH8A 3E7FA 3MWDB 2R66A 4JLWA 5ENDA 4QDKA 1RRFA 4M9QA 1TEXA 2VUHB 2AUTA 4QTXA 3OLVA 3X1KA 5A4FS 1RKVA 5DK4A 1NYQA 3X0DA 3HTXA 1ZINA 1UXJA 2GAFA 1X19A 4Y2HA 5EHQA 1JF8A 3ZH9B 2PXXA 1AY0A 1YA8A 3AUYA 4BWGA 2WHQA 5FLXA 4L4UA 3ZE8A 4P4UA 1CIJA 4I66A 5AICA 1E2NA 4TV8B 5ECDA 5JRZA 1JWLA 1EX6A 4GEGA 3IAAA 3MEQA 3DZKA 2VRNA 2OXFA 4QU0A 5EGSA 2O8FB 1AS0A 1UKBA 3H4MA 1SIBE 2BHLA 1Y1LA 1Y7PA 3ASUA 3SR4A 2P0AA 2Q27A 3TLGA 4PGAA 5JG7A 3I01A 3TKAA 4YWJA 4NENA 2P8SA 2PZ8A 1NVXQ 3L7CA 2I3DA 4CMIA 4Q3LA 1OHHA 1X7YB 4MKGA 4POOA 3WB1A 4X3OA 2R6FA 3VC1A 1HE4A 3MUNA 1E3IA 3RIYA 3HZOA 5JO0A 2QTNA 3IP9A 1SQ0A 4ON9A 1MV8A 4C08A 4C7XA 3LS2A 1IVSA 2VQ6A 1Q3HA 3VC2A 4YRRA 4B3GA 3C85A 4UPVA 1MU0A 1RIIA 1FP4A 4Z2YA 3WLHA 4C4TA 2HL6A 4XEUA 5H68A 1YNSA 2ZB3A 2XDWA 2HT1A 3ROQA 1TLFA 1F51E 4A15A 2Y2VA 1EDDA 3K2QA 2OPHA 4KEAA 1N7HA 1UBLS 4LX0A 2XHZA 3W7VA 4CTNA 1E5QA 5BNTA 1WCIB 2PRIA 4UREA 4YCLA 5EGNA 1G5HA 2G06A 4L4SA 3ADBA 2FMTA 2GCPA 2QTRA 1KYYA 3H16A 4RJLA 1PRYA 3JRXA 1X1CA 1WEHA 3ORSA 3PT9A 1RI2A 5DGIA 3PB3A 4WLFA 4KDFA 1XN4A 3H5RA 2QT1A 1E1KA 2PL1A 5A04A 2JBWA 2PVSA 2DBVO 1UK7A 2I2AA 3RLIA 1FXUA 1QBKC 4HAIA 5JV5A 2O07A 3LLUA 1P75A 3D3QA 1ZM3A 3PNBA 4MWSA 5CYPA 4C21A 1AB6A 4YCDA 3VU0A 3EGIA 2PX6A 5L95A 1X13A 4KPUA 1JNYA 4CM3A 4FOOA 2ZS8A 3TPZA 3GLVA 1YFJA 5JSQA 1YJ8A 3TOXA 3UGTA 3WRYA 4DV1B 3TQTA 4KQFA 1JA1A 1E3QA 2JJ1A 3DONA 3ONVA 1OFUX 5KOYA 5E1DA 1GCUA 3FDZA 3GHYA 4HGRA 2YHIA 3OUTA 4MUYA 3WYCA 2WLSA 4ALIA 3M6VA 1K0FA 4MUJA 4ENWA 2IYPA 3QLEA 2QG6A 4PAGA 1WD7A 2B98A 4PR0A 4QGGA 2WWYA 3FGNA 3DSRA 1DKMA 1TUGA 4H4EA 4WK4B 1XROA 6YASA 5IJZA 1NXOA 2CD9A 3DM9B 5K51A 1SO8A 4MVJF 4YV2A 1XN1A 2CJWB 2VSOA 4Y30A 5EP4A 5HZKA 1W29A 4MGEA 5ED4A 3W8NA 3C16C 4GBJA 2ZFUA 2DTXA 3L6OO 3BBLA 3T7DA 1DEOA 1RABA 4B4UA 1YZTA 4P80A 3TNLA 3P4UA 4YCAA 1NR7A 3L6BA 3D1VA 3DMRA 3SZRA 1RLJA 3CNBA 3ABOB 3I45A 3VKFA 5B2EA 1XDGA 2VF5X 3RWBA 5H4GA 1AKVA 1XAJA 3Q1LA 1D6JA 1H3FA 4TSKA 4HWRA 1GGJA 1T9GS 2N1MA 4MOWA 5AK3A 3A6GA 5DYYA 2FMUA 1AN0A 3DJFA 4P93A 1Z16A 5GINE 4CTJA 1QJCA 3DE4X 1AQJA 1XG5A 2D5CA 2Z9BA 3VZQA 3EQ2A 1X70A 1CF9A 1D2HA 2C2HA 1YVEI 1HLPA 2RI0A 4M89A 4D4KA 3SHOA 2XCSB 2GD6A 2ODQA 1EBUA 1C3LA 1VE1A 2GERA 2V7GA 4V39A 4GVXA 1SZJG 1WUYA 3N2YA 2WOOA 4E5YA 1B93A 5C1PA 1YB2A 1G3MA 1RFGE 5ALIA 4KVGA 4A91A 5GIPE 2A0WA 4PG7A 3DR5A 4K7JA 4X65B 3GP5A 1PE0A 4L5YA 1TMOA 3PQCA 3S8YA 3A10A 1YQDA 5FP0A 4FNGA 3BTVA 3FDXA 3JASB 4UTXA 2PVCA 4MRNA 2GYVA 3DO5A 4LE2A 3S68A 3HEMA 3IUSA 4E7OA 5J2TA 1TTTA 3AKEA 4IKOA 4HDKA 4BNVA 2BEVB 3UWOA 3DMYA 3NP9A 3RYFB 2EATA 3OTWA 4XFKA 4B83A 1VXOA 2IYSA 2SKCA 1OAOC 5FBWB 1B0ZA 4RWZA 4WCFC 4F38A 1AOXA 4CIYA 1A5TA 3LHSA 3FYUB 3QVJA 4K9NA 3H2IA 4JBWA 4XSVA 3BD8A 5JNLA 3RSSA 2OZEA 1R0XA 3E35A 3G1TA 3ZE7A 3ZDDA 3I23A 3IKMB 5G02A 2IYZA 1V6SA 1Z4KA 3NT2A 1IXYA 4ZGWA 1WW2A 1TCBA 3IUPA 4DV0B 1QQTA 1LNZA 2H16A 1MJNA 1X87A 5G2OA 4DZRA 3MUEA 4M76B 2ICAA 3EVAA 1J5EB 1D1TA 1AURA 1NR5A 4XEHA 5AMXA 3Q3HA 3P94A 1KZ1A 1SVLA 2W8ZA 4XDGA 1QVWA 5JALA 4J2OA 3QKRB 5D8DA 1NRJB 2V6MA 4B4WA 3CWCA 3PXUA 3LHIA 4KAAA 3U7GA 3DO8A 4HUJA 3IPRA 3FY4A 2Z1NA 3EEOA 5TPZD 1BX0A 1VPVA 3MGCA 1ZBDA 5EHNA 3E48A 4U7PB 5JW6A 3CPEA 4NOLA 1DG9A 3MMSA 3RFVA 2FZKA 4Q9HA 4MLCA 1EE9A 3FD8A 1GARA 3H3JA 3IAHA 3KKEA 2YJ5A 1P7PA 1ZISA 3PUHA 1ZNYA 4AG5A 3ER9A 4Z4QA 5FHQA 5LZ2A 1RXWA 4QGSA 3EXG1 5ADWA 2O3JA 2JLAA 1N6NA 2E55A 5A4KA 4AM8A 2WBLC 5CK5A 3BJRA 2AOUB 2NV6A 1WUTA 3WJ7A 1E1RA 3ZGZA 1RC0A 2IHYA 3RJZA 1ZR4A 2DWUA 1N4AA 4R2JA 2V97A 3FHJA 5C7YA 4JWKA 3WC4A 2JFFA 1PJSA 2FW9A 1VSVA 2RHJA 2JGRA 2P2GA 4H35A 5AQEA 4Z0PA 3FNGA 4BJ5A 5KVVA 3NUZA 2JCXA 3BHIA 4L2IB 2A7XA 4ACBA 4FFRA 4NBRA 4YEDA 3UJBA 3JYOA 1WBDA 4GX1A 3TAUA 1UM9B 2BH9A 4ZO9A 2Q1XA 1WS6A 5JRDS 5FI0B 1FP1D 1KK0A 4Z7JA 1MB0A 4Z3DA 1B3RA 4JDUA 4A1FA 2BFDB 1JFVA 4BASA 1X3SA 3L1IA 4DC9A 2Y99A 1HNWB 1TT5B 2C1ZA 5JAMA 1JQ3A 1NBMD 3UMSA 5C1BA 3NB0A 5C53B 1W9HA 1KYVA 3O31A 5DJ5A 4F2PA 4ENPA 3MHTA 3JQ7B 3EZLA 1DBVO 3B7GA 2ZUUA 4TMZA 1FMJA 2I1LA 4BVHA 5CT9A 1RZ3A 1VYVA 2PL5A 2N9UA 2QRJA 4OI4A 4YQZA 1AMUA 1Z0FA 1KYTA 2C97A 2ZI5A 1IM5A 3C3EA 3EGOA 5DBFA 5BSUA 4CKCA 1W36B 2BRUA 1BDIA 4LFBB 3AR2A 1SCJA 1JHXA 5TXGA 4IGFA 3VR0A 4Q4CA 4I55A 2QZSA 4YRNA 1FJ2A 4I1IA 2SKDA 4WFKA 3WMRA 3E3AA 4F3YA 5HIMA 4BFVA 3OF2A 1G4UR 2GXAA 5HMMA 2IYVA 3F8TA 2H1OA 2I91A 1OIVA 5DM1A 4U63A 5CVJA 4X5OA 4CM6A 1C9YA 2NSJA 4LFAB 1XZEA 3RS4A 1QLJA 4YAFA 1NE7A 1KOJA 4X1YB 3NANA 1ORVA 2QL9A 4JU9A 2DXIA 1Q2XA 3O8OA 1UBGA 1JZSA 2JHCA 3DMGA 3P4YA 5L3SB 5FFFA 4YRQA 3CT4A 4MCIA 9MHTA 1MN6A 1R12A 3BOSA 1YU6A 3CUUA 3PT5A 2IZZA 4UZFA 4W1SA 3SBOA 3BQNB 1Y80A 1Z13A 5FOWA 1T25A 1NFFA 1V9CA 1NRXA 1E64A 1WQ4A 1ZK4A 2P6NA 4JS0A 4LXHA 1TCAA 2GAJA 4PZUA 5ALRA 1N2IA 2G08A 2V58A 5IJ0A 3Q6IA 5CB4A 3B36A 4ARCA 4NU8X 4PPNA 1Z4IA 3DMHA 1N3IA 1VBMA 5EESA 4ZHQB 1WSBA 3Q3VA 1XZGA 4MYTA 1GDTA 4G4SP 5JHHB 5IS2A 4G0MA 1NYTA 1RQLA 4UVIA 3UKDA 4R16A 5AKKA 2FTKE 5BN4A 1MF7A 1UDWA 2C2WA 3AEUA 1Z0KA 1W34A 4IXNA 3F2VA 3RQSA 1CX9B 3ICOA 3QOFA 3P2IA 1HE3A 3C8MA 4RGYA 4E5KA 1ZVMA 3QJGA 1Y48E 1I3LA 4W1QA 4Z9YA 1DX6A 5J5CA 4B6QA 2FQWA 1V1JA 4EY7A 3ZH2A 3KQVA 1G4HA 1O2DA 4ZU1X 2FFHA 1QZUA 5DWVA 3WIUA 4EBFA 1VLVA 5KNDD 4FMBB 1NKTA 2QMOA 1PGOA 3EH2A 4HLUA 4J7AA 1FFBA 3F8WA 1WPXA 1H2FA 3FVWA 1RAHA 2GVZC 3KEFA 3L4BC 4D57A 2CHEA 4L08A 3ND8A 5E9JA 1L5NA 5BUQA 2I34A 2W83A 3IO3A 3GJ0A 1ST2A 3D4PA 2A9KA 3QMMA 4X9XA 1N9GB 4JU8A 1VG9B 2Z6QA 3COYA 1KP9A 1G0OA 2ZSDA 1GL3A 1U9JA 2X1MA 3C4JA 4ENUA 4QQ8A 1XFDA 2A9JA 3AIKA 3ZHQA 5JEDA 3FWPA 4D1YA 1YB4A 3CW2A 2E4YA 1Z18A 1OYYA 2VAWA 3BDIA 1A9ZA 2AW3A 4HGOA 4IGEA 1YHYA 3K9NA 5FLEX 2Y1KA 3MJRA 5BUZA 5K01A 1CUDA 4RJTA 1H0RA 2FPIA 2IXEA 3WB2A 5LYJB 2IS4A 3N0WA 4GQAA 3D4OA 4BJ3A 3FVVA 2COKA 4CDMA 4NYMQ 1H5QA 5AH0A 2EWWA 5AXBA 5AKGA 1L9XA 5KC8A 3EXHA 4PO3X 3INTA 1OLXA 3OX3A 2A5YB 4ZO6A 1T6YA 3EMDA 2REQB 4B3JA 3D3WB 5BSMA 5ENVA 2CNNA 4CLHA 1LPMA 5CLLA 1VRVA 2D0PB 1AKRA 1GGFA 3EB9A 1Y3BE 1UJMA 4X1IA 2IYRA 2H7XA 1RJ9A 3AVOA 3GZ4A 4HH1A 1CY4A 3KR1A 4IHJB 4FXOA 5LIPA 2I8CA 4WZ6A 3RQIA 4XUEA 3BFVA 1L4LA 2XTZA 1XJQA 5GVSA 4F9GA 4DVJA 4EG7A 1JPVA 3K5HA 4KVZA 1B43A 4UD6A 2RAPA 4GVLA 4ZAYA 2OYCA 1DJLA 4TKVB 3HY3A 2F8SA 2ZUEA 3RYHB 1G17A 4EJMA 5CFLA 3PJRA 3KIPA 3HJAA 4F3RA 4AJKA 3NHSA 4RVNA 3CGGA 2RK4A 3INYA 4IHAA 5CDTA 2OCLA 2GPYA 1L8QA 3VPXA 3K4QA 4WGFA 5ITSA 4REQA 7AT1A 2CMDA 2VJYA 4UNIA 4K8OA 2BFOA 2EKPA 4OUDA 2VJMA 2IRWA 3ETLA 3GG2A 1ZZGA 3FTDA 3KHSA 2V98A 4WXPA 3THYA 3DGEC 1XPRA 4GKAA 4H3KB 2EAUA 3USZA 2NAPA 2D5BA 3DE3X 4CR8A 4G25A 2G4LA 1TZKA 5GGYA 4Y9DA 2KM1A 1G20B 3A6EA 4J7XA 1YHZA 1JLSA 2QM3A 2XMRA 3M3PA 2FRXA 4V2IA 2NP6A 2QJFA 5TARA 3HGQA 5KJ1A 3M3HA 4OD0A 3QEJA 4C9BA 4EEXA 3TM4A 3IC5A 2WF6A 4GE3A 2QAJA 5ES3A 3PFKA 3TLCA 1YWGO 5B1YA 3ZCQA 1RTTA 3BCHA 3G2PA 4J9UE 3BMQA 1N9KA 2GEVA 4I8DA 3NHFA 3NIGB 1P73A 4S24A 2IS2A 1D1SA 2H1RA 1R0CA 5F5LA 3WFZA 2OXEA 2PQ0A 1ZUWA 2Z5VA 4XASA 1QE3A 3U7JA 5HZMA 2O19A 3UB4A 2D2FA 1FUKA 1RR6A 2XZTA 1U11A 4N6GA 1I4EB 2NO1A 2Y92A 1ZD3A 2WK1A 1ZJYA 3C43A 4FVTA 1S02A 1R5JA 1SQSA 1L0BA 3PC7A 3EIXA 1PR6A 2NPOA 2WG0A 3LBAA 4WERA 3TBKA 5JBIA 1CB7A 1Q1AA 2GK7A 1WL8A 2ZUSA 3AZQA 3MGAA 3PFHA 3PIRA 3WNQA 2MCFA 1SXJE 2W2NA 1TUBA 4JELA 4Q9IA 5KOHA 2HA5A 2RCYA 2W2LA 2VYVD 3LC1O 1PDOA 4AIIA 2GYUA 3WA6A 2PJDA 2GBLC 4ECEA 3KPUA 3L06A 1JH8A 1KYXA 2J08A 3AR7A 1ODLA 2R9VA 4X41A 3WWEA 2VNHA 4JVSB 3ANLA 4AX4A 4LK3A 1AKMA 2H65A 2H2WA 1N2OA 1V8FA 1GFIA 1HFEL 2KLHA 1IHXA 1HYGA 3DV0B 4HGNA 5WRFA 5DTQA 1M10A 2E5LB 4JC8A 1KHTA 1KMCA 3A7EA 2ZYIA 1UBFA 4K3UA 3W4JA 2ZQZA 1GN9A 4BRUA 1W4AA 1YAHA 2HRQA 2J4CA 2WJIA 3VH3A 1U1FA 2X2PA 4ALKA 3G0BA 1HEUA 4GR5A 4OM8A 1LNQA 2FX5A 1Z38A 2J31A 3S1AB 4DBVO 1G59A 4LBWA 4NBNA 7MHTA 4BJ1A 5E6UB 4ND4A 5BPFA 1YI8A 3DCNA 4N9QA 1H42A 1HOXA 4PGHA 1E2HA 4UUMA 4CBVA 2IT1A 1JG6A 1FVOA 2J5KA 3C7CB 3TR0A 2P4HX 3ZYZA 4EECA 1ODIA 3GLFA 1RRCA 2PUGA 2G0AA 2KSQA 3AR5A 1XXHE 2FQ1A 1DKPA 5CT5A 5ER6A 3BA1A 2PUJA 1YVPA 1IBLB 4AP5A 4RTMA 1VBNA 3AI1A 3TLZA 4BNUA 4CT0A 4LHVA 16PKA 3TLKA 3VDQA 2BFFB 2OM6A 2QXTA 3T0FA 4RPKA 3UXMA 4ZT7A 4CT5A 2P65A 3DVLA 4MWGA 3ZCSA 1LNSA 2EW2A 2L69A 3KCNA 1IAVA 1RQ2A 4I4TB 5I7VA 4B7UA 4JUBA 1P7WA 5J43A 4HNAB 1UBOS 4F2HA 1ATZA 5FAKA 1AD2A 1HEYA 4YCJA 4KHPB 1G2PA 3IBSA 3IDOA 3L4SO 3L05A 3SPXA 4Z2AA 3DEFA 4X20A 4FGJA 4RULA 3UJAA 2QN2A 3JTEA 4F2DA 3HMQA 2PVPA 3LRXA 1C9NA 2V7PA 2V55B 1YBAA 1B1CA 3NASA 3E4CA 4PQGA 5L45A 2JLUA 4MCAA 1YJBA 3O91A 3REGA 2IE8A 2J48A 2Q4EA 3CNHA 1Q74A 3O3CA 4LZNA 1O97C 3FETA 3PD0A 3WOVA 4HTAA 2BKEA 4JYPA 3ND9A 4J6EA 4PIPA 3PUKA 2ODPA 1MB4A 2Y6VA 5BV1A 2XXAA 4RU1A 3KR2A 1BCRA 2IUUA 1VKNA 1VZ2A 1Z0JA 3PCTA 1VE5A 3H8SA 2H4YA 3T5CA 3KQMA 1GRCA 4W1RA 1E9EA 2H1WA 2JAWA 3P0FA 2NU8B 4ER6A 2Q2QA 2PWAA 2VDPB 2VBFA 3KXKA 2JG3A 4B4OA 4MR7B 3T7EA 5FTJA 2B78A 1YKFA 3MBKA 1FFWA 4RADA 4KMRA 4B81A 5EJ6A 1HYEA 1E9VA 1HSZA 4RJKA 2VHVA 4C0LA 3FM9A 1GTMA 3L02A 3ZLUA 5CH8A 5KQPA 4XWWA 4AVYA 3G23A 1U2DC 3PBKA 1DKLA 4DDWA 1DKUA 5AKJA 4RELA 3UHFA 1QFSA 1VJ0A 2FJPA 1CUVA 1TU4A 1T6NA 2F3SA 3GUCA 3HR8A 5I7AA 5A4AA 5KC9A 4JEIA 1QH9A 1TCCA 1AUXA 2GUGA 3DBHA 4DREA 2C98A 2VTBB 4LYAA 2C83A 3FYHA 1RMTA 4JLBA 1NDUA 2I6FA 2PG3A 5DCWA 3EXEB 1Q1ZA 3FA2A 3K09C 5M7EA 4DG5A 2UZ0A 3ER6A 1E6LA 1D3AA 1M1XB 1D2RA 1UBHS 4TRNA 3L8DA 5DP1A 5TMDA 5HYVA 1AO0A 2NU6A 3H5VA 3W2HA 5I7FA 1AS3A 3R8CA 3DAFA 2NTJA 3OZWA 5IM4F 4V0LA 2RARA 2WG2A 4KG7A 3CONA 1O0BA 3LCRA 3ZW9A 3R1IA 2CXSA 3B6ZA 5COBA 2XWBF 2FZ5A 4BGIA 2PJRA 2H4HA 4HY3A 4J3NA 2B2XA 1C4OA 1NVFA 1MEEA 2B83A 2CF5A 2J8ZA 3B5EA 3HBFA 3NMUF 2EXXA 1TC1A 3UWPA 1JBKA 3JQRA 5G0SA 1M0WA 3OCVA 2J07A 2WT4A 3FRHA 3MTEA 2NX2A 4FR0A 4NQZA 4X7RA 2FWJA 4ZYUA 1YA6A 3UICA 2GESA 2A0FA 1EFHA 2QB5A 2WHRA 4RLFA 4JYZA 1KPIA 2XMZA 3I9LA 3OPYA 1FFYA 3DDCA 1IHPA 3KVYA 3T9BA 2GAAA 2ZW9A 1V9LA 5JSZB 1CLEA 2NQ8A 5J23A 1OTXA 3PJGA 1W0JD 4HKTA 4MJXA 2PH5A 4FJ0A 5LD2B 2IIBA 3IAS1 3QNUA 3V8BA 2CBGA 1ZGAA 4BO2A 4QDXA 2QX4A 5CLGA 2Z57A 2EFYA 4LYFA 1V3UA 2AL7A 3Q5DA 4QJ5A 1RIFA 3EQ8A 4FOLA 3NHAA 2VNJA 4B80A 4Z51A 1IZ7A 3TAXA 2PMCA 1EA5A 1EFUA 4LTDA 4UVGA 3HY6A 2X1HA 2FFAA 2FWPA 3NOQA 4IDGA 1PUXA 4UCQA 4YUYA 2FW7A 2P3LA 2SCUB 3D7KA 4DIKA 3EFOB 1XHFA 2QI9C 1BGVA 4XYMA 2PUCA 1U8FO 1XA0A 4OYYA 2B8NA 2GTIA 1R6UA 5K3EA 1DEXA 2JIZD 3BB4A 2PZAA 2O2CA 2PFSA 4MRAA 4PAWA 2AZXA 4DA0A 1LLQA 1S5PA 1TZJA 3IOYA 1BHQ1 4UJ3A 1XHEA 3WGLA 5KTOA 5EJ9A 3TAHA 3MGKA 4TYYA 1KIAA 5ETJA 3HXQA 1JG7A 4EF4A 1QE5A 2OQRA 1F6DA 1H1LB 3EZ9A 4J75A 1UIRA 3EDOA 3PGXA 2LBPA 4YO8A 5AJTA 4AMVA 4XOUA 3HRIA 5LBIA 3SYTA 5BSWA 2IEYA 2OVBA 5A9RA 1T26A 3PDWA 1AGPA 1WCV1 1KS9A 3ZS9A 3DBOB 4DA4A 4MGYR 3HU5A 4IF4A 2IP4A 1A82A 1HDIA 1RJDA 1Q1BA 3CMMA 2J9ZB 3HP1A 1KDZA 4MR8A 2VTKA 5I7UA 5LR6A 5LM3A 4X85A 4X8HA 3G2LA 1L5OA 2O0JA 2QUZA 1I2CA 4LY6A 4QYMA 2OESA 5JDIC 3O7WA 1OJLA 1VFPA 4PSCA 5EE1A 1T9ZA 2OD7A 4JXZA 4GPIB 2BF7A 4LG1A 2P9BA 2IVFA 2F43A 2F1IA 2GFHA 1E8NA 4H7KA 4JP1A 1KDPA 4TQGA 1GGHA 1T9AA 4L6AA 3WGOA 1RYMA 4QOSA 4RA6A 3LLCA 4W8HA 3CR3C 4KBYA 4M0UA 3HP4A 4KN5A 4X45A 3E2IA 3H9UA 1DMSA 4PLTA 2QM7A 2BAGA 3HYRA 4LYHA 3DG9A 2P7HA 2VUSA 1M1YA 2H54A 2XX3A 3M70A 1DXHA 3M4XA 2YTZA 4BP8A 3I2GA 2DWQA 1FYWA 2CFTA 2VJNA 4QTYA 1ZUD1 1SUFA 3GEDA 3T1HB 4F3TA 2PWPA 3NONA 5D6NA 5DI3A 2F9MA 5JXGA 1L8OA 3CUTA 4XZ3A 4YQEA 1SPBS 2WPDA 2O7RA 2HN9A 3E5NA 2CVOA 5CUQA 1JHVA 3H2KA 1PF7E 2KS6A 2REBA 3B6IA 2IXAA 4Q4LA 2W2OA 4YUVA 4KQJA 1ZUNA 1UDCA 3ASVA 2CVPA 1SXJC 1XK7A 2XDQB 2FHSA 4LDJA 2QXYA 4MVJH 4URVR 3K9CA 4AF8A 1VPWA 1YSCA 4XE5A 2AEFA 3QUCA 4YUAA 2PZEA 2GJAA 2P30A 3O8RA 3GBVA 3QYJA 1B7GO 3RIXA 4NJEB 3B78A 4EMBA 4I1SA 2Y1OA 2PAAA 1E8MA 4AICA 3TL6A 3ITDA 3WIDA 1AK9A 1AUPA 3CSSA 4F3KA 5J1TB 5C37A 3BAZA 1RM5A 5EE9A 3WA7A 1CZUA 3AO0B 3L1HA 2QGNA 1FJHA 4N18A 2Y4NA 3UH0A 1QX3A 2J9GA 3FNHA 3OFNA 4GBMA 4B3BA 2YC2C 2PUEA 2A86A 3G6KA 3RW9A 3NEYA 3ZV5A 3KLPX 1QOQB 1VI5A 1DBPA 3EIEA 2JF0A 3N6RA 3NETA 4UC0A 3ZXSA 1XKTA 5EJEA 1AV6A 4X62B 3PQ6A 1NKVA 1RXCA 2WJYA 1OXVA 1X8JA 4LXIA 1KI8A 2Q5IA 4GSKA 5KYTA 1E3DA 1QCCA 1TU0A 4LRTB 1E5XA 4O8ZA 1TM5E 1YIDA 2X76A 1DFHA 3CRRA 4PG8A 4KRGA 4PHTA 1OFHA 1O95A 1L2TA 1VHTA 2J09A 3O4VA 3C6ZA 4IIHA 4TRJA 5CLQA 3RPEA 1W2WB 4QRIA 3KXIA 4P1ZA 3HL0A 4C1BA 1P0IA 4KRXA 5FR1A 4FC7A 4LNHA 3TL2A 1AGYA 1U90A 2X40A 4ITVA 5TQJA 4P5PA 3GP3A 3O47A 2B1JA 2AFIA 3IELA 4EUHA 4LCBA 3G9XA 3KZMA 4MW0A 2HMWA 3HJNA 5D3MA 1LI4A 1EZZA 3WNCA 5BNFA 1M72A 2BEWB 2IYFA 1V1MB 2HYDA 3KEOA 4KGVA 3QKTA 4R54A 3VDNB 4JR2A 1EJ2A 3VTAA 3QKSA 4P3NA 2XUJA 4AMYA 4UQPA 4CM8B 1RWBA 3UPTA 1BXRB 2HMYB 5AP9A 2ZE8A 3BB3A 3EBPA 3LVBA 3MJCA 4RXUA 4ZP1A 5JLJA 2PFKA 2XD9A 3JQCA 2LNDA 4IO1A 2F8MA 2PZMA 2HSWA 1H2EA 5REQA 5AQ1A 1T9KA 2XB4A 1O57A 3F3KA 3LQKA 4ZZIA 4D9FA 4DCOA 2OT3B 5H80A 4BNHA 4DL9A 2H9YA 1JZTA 2WFAA 3S2UA 3U1TA 1H93A 3AW8A 4US2R 1LY1A 1QYRA 4HUQA 1FTNA 1GYRA 3OEWA 1NJSA 4YP5A 2I67A 1QB7A 2WG1A 3N3AC 5DM0A 1E6MA 1PFKA 1IPEA 1CCWA 1P77A 1W4ZA 2FJ0A 3D2LA 4FEYA 5J4YA 2PGIA 5CPFA 1R74A 3UUWA 4LDPA 2QM0A 3NHLA 1S6YA 1RW4A 1IOWA 1UZAA 4LI3X 4R8LA 2XXJA 4CM4A 3C6BA 2Z4TA 3JAWA 2PQ2A 3AF3A 1NXXA 5FOSA 5H02A 2UYHA 4TGLA 1LDNA 4IFBA 1NM5C 2PPLA 1PT8A 4HQOA 4RF2A 3M1LA 4D0NA 5JZ9A 1HR0B 4L28A 1UJ4A 4XGNA 2PD6A 4MYCA 3DD1A 3K35A 4A82A 1T1GA 1T8TA 5DV9A 3U4AA 2JGLA 2HK8A 3OF5A 4ZYXA 5C4MA 1TQ2A 1DCKA 3E5MA 5EVCA 4FGSA 1XU7A 4CM9D 1CVIA 2RKOA 5BV2P 4RY9A 3X2FA 5AOBA 5C7OO 1PG5A 1Y8CA 3QBEA 3NCTA 1NA5A 4KQ1A 4BRSA 2I7CA 3NVDA 1JLLB 5ALZA 3QU4A 4MRPA 5CVCA 4DEYA 4QQFA 4ZVSA 3A1NA 1JJAA 5G4KA 1XEXA 2WF9A 4GMKA 2I54A 4CLEA 1IOZA 4I1PA 4EFMA 2F55A 5D6OA 1NATA 4YRAA 3IIIA 3UENA 4IDAA 3I9KA 1JRLA 1GEEA 1KP3A 2RGYA 5TMBA 1EGQA 2C4TA 1BKDR 3GK3A 4E7PA 3EGCA 1OX5A 3KL4A 3R5XA 4JP8A 3CF4G 5FRDA 3VBCA 3T4UA 4G2TA 3Q11A 3CUKA 3O4GA 2FR8C 3C3DA 3E5HA 2MU1A 5F3DA 3ONWA 3OX1A 1T4CA 5AM1A 2NWQA 4OLAA 3FBGA 4LQLA 1AA9A 4ZT5A 1M0SA 1XTIA 2B92A 2CY0A 1Y9EA 2Y93A 2FG5A 4QAJA 4COOA 4Z53A 4F6CA 5AM4A 4KVFA 2Y1XA 2XKBA 1V7PC 4JC0A 3RANA 3W3AH 4Q3EA 2D7DA 1L7BA 2VSXA 2ZG6A 1LV7A 4GL4A 1HDOA 3M1IA 3VZSA 2W4IA 2X4DA 4FMCF 4E1AA 1YDHA 2RE8A 2WJPA 2WZQA 3ANMA 1Z22A 4CMHA 5C8YB 5ITZB 1HT3A 1JDBC 2AT1A 5ENZA 1TK2A 5F1PA 3NUQA 4RMIA 3M5PA 4LQCA 1NLUA 3AZOA 3VNBA 4JKOA 4YPFA 1XDSA 3I2FA 4N4AA 4LY0A 1H4SA 4YVFA 1QHSA 2DY0A 3OU7A 5JATA 1DZ3A 4YAJA 3WLTA 1OD6A 4TV9B 4S04A 2CFRA 4EYQA 3PIDA 1EP9A 2B0JA 1WXWA 1MBZA 1G19A 2DWCA 1RZUA 3HEBA 3ZDBA 2ZTSA 4UQLA 4FYWA 5T64A 3UJ9A 5DXJA 1E77A 2FU5C 1D0IA 4Y2UA 1FLNA 4Z4IA 3D5QA 1ENPA 2WI8A 2WJJA 1KZ6A 3H75A 1TK9A 2QD3A 3MRTA 1L8AA 2DBZA 4FEEA 5D87A 4D5GA 2V4ZA 1GP2A 3F3YA 4FJ2A 5EMMA 5HEKA 3BGWA 4ZIRA 5D7BA 3OQOA 3IFSA 4L16A 4RVCA 4BX0A 4BVFA 3IBFA 4MVJA 4NFLA 3ZBPA 4BNYA 2K5UA 2J3JA 1US8B 2O2JA 1KEWA 3KEGA 3V32A 3DYVA 1RQXA 4WI1A 2W4QA 3BDAA 4W8OA 4TMFA 1YVDA 3PKZA 1A8HA 2DCMA 1THGA 2XVYA 2ZBVA 3GVHA 3KCQA 4J07A 5B7QA 3IBYA 4OHXA 4EL0A 3MPUA 1N5IA 1YNOA 4RD2A 1U63A 3MWKA 1VL1A 1A9OA 1YB1A 2ISSD 3OC6A 1X7ZA 4O2LA 5TLSA 1XFAA 1UWCA 3JATA 2UZ4A 4D3DA 1VFNA 3OO1A 3ZZUA 2Z04A 4QGHA 4B85A 3UVEA 3PPXA 4F06A 4HEA1 3ZCPA 3BIWA 3PL1A 5EWJB 3TNFA 4HS4A 4ZAWA 4O2AB 4E0BA 1VHLA 2YRXA 3MTBA 2OWEA 4LZAA 4ZI3A 4MMXB 3RGWS 5CB4B 4AZ0B 3RC7A 3W2FA 1Z63A 4P38A 4CLOA 4IMPA 1X7HA 4DRXA 2C4UA 1P2DA 3CX8A 2J4FA 3MAJA 3ODGA 4KE6A 1PAUA 2AG6A 2CLCX 1EGVB 1JFRA 1VTKA 3DV2A 4JJ6A 4MP6A 3LQQA 3DLPX 4NMLA 3LP5A 2ZI4A 2FN4A 2D62A 5FFMA 4IDNA 1DBQA 4F56A 3DAPA 4TX1A 4CMCA 1YZGA 3NV7A 4X6XA 1RC8A 1M34E 1DHRA 5AYVA 1MH9A 3BWYA 3BSWA 3OQIB 4M49A 5CXXA 1CZNA 1SC3A 3BFKA 5KOIA 3H6KA 2HAEA 3B6JA 1NX6A 1P2SA 2Z30A 4KN9S 5IT0A 3KLBA 3QE0A 1FC0A 1TM4E 3S5UA 2IXDA 4B6JA 5ALWA 4HT3B 1ZSNA 1CJMA 3HNOA 5E2BA 4YQYA 1N0HA 3L2OB 1ZNZA 2HGSA 2PHZA 4H2DA 4J91A 5CVEA 5K0LA 1X9HA 3TRIA 1CP3A 3UYLA 4YAGA 3S27A 1W30A 1Z17A 3AI7A 1ZH4A 5KJ6A 2JIPA 3BRCA 3RYCB 1AGNA 1HOTA 5BN1A 3EXFB 4YPOA 2QENA 1W0CA 1JW9B 3MRVA 1M5RA 3S2YA 1X1EA 2RGNC 1HDCA 5KPDA 2GCEA 2PZLA 4IO0A 2OD2A 4RZXA 5DH9A 5JH7B 1QIIA 5HUQA 1IBMB 3VR6A 3UAYA 1P5JA 1CY0A 1QDEA 2NIPA 2V7VA 2BZGA 4TWAA 1C4KA 3DT8A 3QA3E 3KC2A 1D9XA 2Q8QA 1HG0A 1PX0A 3K9GA 5DDIP 3MFQA 4IX9A 3HA5A 3EIQA 4FQ7A 1T10A 2GT1A 4LJYA 1VB5A 4DCNA 4OIMA 3QVSA 4ILKA 2PSJA 1J09A 3AM5A 4N7JA 1SZDA 3VPSA 4NBTA 3VBEA 5EMKA 4B45A 2PD4A 1PJZA 3E9CA 4P7GA 3G59A 4EUEA 3UAGA 1E2DA 4XR4A 3UCXA 2ODWA 3SZUA 5A3JA 4QREA 3W5CA 1L5QA 4AJJA 3RHFA 4CG3A 4D0SA 3PGVA 2CZGA 4IBOA 4MV4A 1XJ5A 4LSWA 3TS1A 3VR3D 5LNK6 1GL9B 1GNPA 1ODKA 3EPRA 2QVXX 4IXTA 3NIFB 4UBOA 3RC1A 3EBLA 4QL3A 4ZO8A 5KAPA 4AYTA 2WAAA 2QPLA 2F48A 3AR8A 3GMTA 3OPXA 3DZDA 4N3NA 1U3GA 1C0KA 1II8B 2H5IA 2OZPA 4JGGA 2Z9CA 1QTRA 1WXGA 2ANBA 1A5BB 3MN1A 1OLSA 4RFLA 1XCJA 2BEUB 2I76A 3EFBA 1C2TA 1IN7A 2R1TA 4RPLA 7ADHA 3MS4A 1MJHA 3PFBA 4W7HA 3PHHA 5HKAA 4N0DA 1XRRA 3DZIA 3CJRA 3FCSB 4ZT4A 4CFSA 4F45A 4BDSA 3FSRA 5CNMA 2ZITA 4BFCA 4JJEA 1NSTA 2YUTA 3A1DA 4OSEA 4HZUB 4QBIA 4RS4A 4GC5A 4Q1VA 4U0KA 2ZATA 4XFDA 5CAEB 4DARA 5J2UF 3AM4A 2YX1A 4HAXA 5D5PA 4ED9A 4TXHA 3ZQ4A 1DJOA 2P1RA 1CRWG 2XYPA 1F8FA 1KMNA 3W5VA 2FA9A 2I7XA 2Q07A 3ZCVA 4B3MB 1QS0A 3BYZA 5JS7A 5DGCA 2CFSA 3W3AA 1ZEJA 2VSNA 2R2AA 3F47A 3EA0A 1ZD8A 2X5NA 5AT1A 5TSDA 5J4KA 2ZDQA 4TTRA 1OB2A 4G0PA 1RYNA 3W6UA 1KTIA 1V8OA 1DOHA 3ENNA 5EWMB 5BSFA 4QUKA 5F9HA 1Y1RA 4Q1BA 1Z2CA 4UDYX 2X86A 5B7GA 5FH9A 1LC0A 1KVQA 1O94A 1P91A 3K05A 4DC0A 1E69A 3MMNA 3AV0B 2PLAA 1QIHA 1HV8A 2B2CA 3SLKA 5FUVA 1AKEA 2BKUA 3H2YA 4MPJA 3AU8A 3TLAA 2YW9A 3PWZA 2IOYA 1PJ8A 2ECQA 1H1DA 1QXSA 4YA6A 3N2GB 2CHFA 2NZJA 4L22A 2BV3A 3FFTA 2ETXA 3I2HA 4DXDA 4U1RA 3UMFA 2AMLA 1SXHA 1TOAA 3ZE0B 4BEVA 2HQBA 4NY1A 3C6QA 4L9SA 4OP2A 4XA8A 3VYTB 3LECA 3HCWA 1CB0A 1E7MA 1QIDA 2JEZA 4FWBA 5CIQA 3ID6C 3V1TC 3INNA 2COEA 3WGVA 1G2OA 4JJKA 1QAOA 3SBDA 2BUAA 5KO2A 4Z4GA 1TGYA 4B8ZA 4RTKA 1NGSA 3TKLA 3FXAA 3THRA 1JHQA 4XFJA 2ZAGA 4AULA 3LQYA 3S8EA 1ZA2A 2AZTA 5DRYA 4DY4A 1ECJA 2FWAA 2HXGA 1SUDA 4UHCA 3IX7A 3S6JA 3X2EA 3AF5A 4ESHA 3ZVKA 2ZJ1A 1O0CA 2ZSUA 1B26A 1Z5UA 4EY6A 1MB3A 3CH7A 1T36A 2ZQYA 4HO1X 3TDMA 2E4XA 1N4DA 4A6EA 1E1CA 2O48X 3BREA 3UWMA 4JQZA 2QLBA 3GELA 4ITUA 2IEGA 1FDRA 5AVXA 3HI6A 3I4CA 3K0BA 2VK4A 1ZNXA 4QD3A 4RJ2A 5IDVA 5JE8A 3ZNQA 4C0WA 4LXGA 4L76A 5I9SA 4EW6A 4GT1A 2Z5FA 2NGRA 3TTSA 1CQJB 1UBUS 1USKA 2E6KA 1S8AA 4LDQA 2GJ8A 4Q5IA 1Z82A 2ZYSA 3T3EA 3URMA 2C3UA 1T5IA 2ZUBA 1KTVA 2D59A 2O0HA 1JZQA 3CH6A 1LDEA 2DWOA 1HXHA 4J76A 2ESRA 2Q4RA 2WT8A 3BL5A 1OMOA 3QWBA 5ARDA 3RVJA 2PL9A 2BR3A 3SEAA 3ZTTA 3QXCA 5HM8A 5J2UA 2NU7A 1M83A 1GTG1 4OG2A 3CO0S 5AJZA 4CI9A 4WJLA 4MH0R 5IMBA 3FG9A 4MWEA 3VHXB 2OWDA 4KOAA 1EWVA 2IOHA 5CBPA 3V7UA 1Y9ZA 1FTGA 4EA6A 4XGKA 4CKBB 1UEIA 2O5CA 1FFXA 4EARA 1PD1A 3T7JA 3MTIA 4H08A 1GADO 2YY7A 2QQEA 1WDLA 2HTEA 4FJ1A 3V9AA 3VVCA 3AUSA 4J0KA 1U8XX 2ZCUA 5LXTF 4AN4A 1MLDA 3IA7A 3RDPA 3W04A 5A03A 1N2XA 1Q0PA 1UJ2A 3BWMA 1XXHB 1UBJS 5GM2A 4URYR 3I0MA 3JVEA 1DPGA 3G7SA 3GLRA 4G56A 5EHIA 2HIGA 2JGMA 3L4KA 4ZCSA 1N6RA 1IY1A 2Q9UA 3DWFA 2NP7A 1SD5A 3ZDCA 1YA4A 1N77A 3RFCA 4V0OA 2HBYA 3GFFA 3NOOA 1P60A 2VT6A 1D5WA 4QQKA 4S0XA 3A9WA 4UOEA 4MAFA 1QGOA 3PR1A 1NG1A 3PEFA 1P0CA 3AYXB 4R84A 4WAUA 5JCJD 1JDUA 1FW8A 1PFVA 2DBRA 2GLXA 4G07A 3KL2A 4EJSA 1Z88A 2WWGA 3K1AB 4JQYA 4LGYA 3F1LA 5DSZA 2IU0A 1U98A 4R5MA 3KZCA 4Z7QB 4MTCA 2AZMA 2VF7A 1QG4A 1Z35A 1DC4A 1ZC3A 4U8HA 3G5MA 1F2TA 4G4IA 4KLCA 3O8QA 5B64A 1XVLA 4J0FA 4IMIB 2OA0A 4CM1A 2R4QA 3QMVA 1AQUA 2YMMA 3O74A 2ZDHA 1SHUX 1TQHA 2DUJA 1HTTA 5FF9A 1UFQA 4O8CA 4EO4A 2PV7A 1AQLA 3VPCA 3TBFA 2HSJA 1I10A 2P5UA 2Q3DA 4QJIA 4UDOA 1WETA 3LO5A 1GGVA 4R7TA 2VP4A 3GDHA 1DT5A 1JB1A 3HLTA 3QVWA 4OGWA 3RSOA 4C4RA 2JANA 4DLUA 3DDWA 2CHVA 3G8BA 3ZW8A 1Z6PA 1WMAA 4DIEA 3TJMA 2WV9A 5GP1A 1EFKA 2LCQA 1Z4OA 2GX6A 3OKFA 2OVFA 1ODJA 1I36A 2ASEA 2XWSA 2H3HA 2VYCA 3ONFA 3DWIA 2ZQ5A 4P53A 3AF1A 1GUAA 2JFNA 4DR6B 4R9NA 3LV8A 2VFAA 3RVBA 4PWZA 2IWRA 3HS3A 3WJ1A 5IJ9A 2A9VA 3DXYA 2LDBA 1I0ZA 1SEVA 2CWDA 3AUXA 4MZXA 3IQIX 5DM4A 3J81k 4F6RB 4L85A 2XLBA 2GPSA 4P7KA 4HFMA 4PF1A 5AO9A 2QRMA 2OBFA 2IGBA 2WHYA 1JX6A 3ITKA 2FLKA 3GLUA 2ATEA 2RBEA 3LXRA 2OO3A 4OYLA 4PPQA 2G9RA 1F0PA 1U3CA 2C3YA 4X94A 2FP4A 5CR9A 4D4IA 5C8ZA 3C3KA 1B8VA 3V2HA 2WJAA 2WIAA 4MITA 2NT4A 4PZAA 2JCGA 4BNNA 3UMCA 1O0SA 2FNAA 1EBBA 2YW2A 4A3SA 3QZUA 1BU5A 2REXB 2P2ZA 3GX1A 2GKSA 4G81A 1WUJS 4OX9Y 4KIGA 4KH0A 2G9NA 4H7FA 2R5WA 2O3SA 3AEKA 3GDOA 3ROEA 5I9LA 3U0VA 3VU1A 3OEED 4C14A 5JNSA 4J0QA 3SOPA 3A6DA 1UIMA 3D6VA 1T4MA 1VGQA 2CC2A 1AU9A 1CD5A 3I5UA 1T9GR 5KINB 1V5IA 1G4AE 1KJNA 3HKEA 2CVFA 1KRXA 3CTMA 3C74A 1GRVA 1MB9A 3JYHA 2IY9A 1LPNA 2PX5A 4R41A 4IYJA 2QBYB 1T0UA 2EF0A 5KCZA 2PKQP 3VU9A 3ADKA 4O4HB 5DSTA 2EKZA 4I6GA 4TWBA 1C0EA 4YIKA 1MZVA 1ZRSA 5SY4A 4MLPA 1JAYA 1SBQA 3IUEA 1W36D 1RVV1 1VA5A 3DUFB 4IQ4A 3T3OA 3DV9A 3L6DA 3RT1A 2QSYA 4UM5A 1J56A 5JXWA 1PZHA 4JQOA 1XEWY 1AQYA 2D1SA 2YOFA 2WVGA 1G42A 2BGRA 1XVVA 1T1RA 3GJ5A 7YASA 3OZXA 3A6LA 3CB2A 4F0JA 2X9LA 2D2XA 3P27A 4DSNA 3EGDA 1QGZA 4GDMA 4YRTA 5GMOA 4B6OA 4C5BA 2W22A 2ZBQA 1DX9A 3BH0A 2P62A 1K7YA 4MUNA 1INLA 3CQ9A 4UHKA 4H0NA 2EJCA 4FCWA 4GZMA 3NDBB 1SKYE 2B5VA 2GBFA 1OILA 2I2BA 3CNEA 3OCWA 4GOOD 4L1KA 1PKEA 1KI6B 4PGGA 3GUYA 4QODA 1XTRA 2VWHA 2YS6A 4Y2YA 3TW8B 4PG4A 1ZYUA 3KWFA 4FFBB 3VAZA 2DERA 2BE7A 3CKLA 1B00A 1FP6A 2B5OA 3T7SA 2J3QA 4J49A 2F67A 3RFTA 3SSNA 1C50A 4RH3A 2P0YA 1W0KD 2NYUA 2AG1A 2VUUA 3CIFA 4JYMA 4MV7A 3HYCA 3RWMB 4ZJUA 3ZHSA 2IE0A 2BMEA 2MMCA 4O2BF 1G21A 3G2NA 4H17A 3OTHA 2Z4RA 2A67A 4YUXA 4LF4B 5EZYB 2IH2A 2GQ0A 5A5EA 3SFTA 2BMAA 2YFKA 5KJEA 4E30A 1FRQA 1W47A 3CT6A 1M8GA 1GVNB 3WYFA 4MW7A 4X7BA 3OPMA 1CK4A 3K32A 2DTEA 2XKAA 3JX9A 1F12A 1K4MA 2EZTA 5D84A 4JBXA 5EQJB 5JISA 4WH0A 5THXA 1DWPA 2IPLA 4XD7A 2PUDA 1SY7A 2PQ6A 4EG8A 1DL5A 1M1NB 4NZ9A 2FMKA 1DAPA 4JQSA 3BRWA 3GARA 1EWRA 4O02B 4EA7A 4KXWA 4Z1MD 5CA0F 2HGZA 1SM4A 3EVTA 4TUYB 3ACDA 4Q12A 3I73A 4Y6GB 2JFQA 1HYBA 5ICEA 1GPJA 2R6CA 3OLZA 3QIAA 5I4CA 3BMCB 5EXXA 5C9ZA 3U81A 1A7AA 3B1VA 2CMHA 1VHWA 2I4TA 3KXLA 4DKJA 2P4EA 4IPTA 3ESDA 3AONB 2FW0A 1J2RA 3DBVO 3IJEB 4J3FA 2W2XA 3ME5A 4KSYA 4YRFA 3SYRA 1OLOA 3OTQA 4IDHA 4L6IA 3LA6A 4G1CA 3HXMA 1XCBA 1S0UA 1HEIA 5HE9A 4CIAA 3D2CA 3DCYA 3VKWA 2WB4A 4FI3C 4KXFB 5AJWA 3OHSX 4M3NA 1TRHA 1SXQA 1AHNA 3QLUC 3ICVA 4HWKA 2ZVJA 4NG5A 1UBNA 5SZIA 4EJ2A 2O8CA 5HDQA 5K0BA 2GH1A 3BXPA 3WP0A 1R50A 4DRZA 5E6RB 1KMQA 3NVKI 1JT2A 2IDJA 4L75A 4M36A 4O1MA 3U5TA 3H6GA 3IT2A 1E79D 5FADA 4LKRA 4MW6A 3WLSA 1FLDA 2Q41A 4WN9B 5KVSA 1BH2A 3B9RA 4MWBA 2HBRA 2ZDGA 2FKAA 1R8JA 1F20A 4XWYA 5EIBC 3I6BA 4AIRA 2XCTB 3OSZA 3OTOB 2HZ7A 2QTVB 4U2FA 4A10A 3KUCA 2WJGA 1HMPA 5BVHA 3OA2A 1O9HA 4DLXA 3UOWA 5EUCA 4HDMB 1SCUA 5D3MB 2D1FA 4UCWA 5TC4A 2H9AA 5BQPA 2EBUA 2JGIA 2B36A 3V7NA 5CXUA 4BXOB 1KFJB 4WXEA 1E5TA 5CVVA 1Q21A 5F7JA 2JRLA 4ZMRA 3HCNA 1OA1A 2GARA 2BD0A 4IS3A 3M6IA 3EPLA 4TTTS 2NUBA 1YTLA 2HCTA 3ZUGA 1U3DA 4MNTA 3HVJA 1Y1PA 4KPGA 2H31A 3V4PB 1EIZA 1H8EA 4JOSA 3ZDXB 1ISSA 1DIAA 3ZWQA 1FS5A 2NZWA 1XUOA 2IPXA 3DFIA 3I0ZA 3IP7A 3QFFA 4LISA 4RCZA 3EEYA 2EOAA 4LJ8A 4FGUA 1RP7A 1V0JA 2RHLA 3CMCO 4H59A 4OGFA 4R1LA 5CEEA 1K4KA 4JB2A 2TSYB 3KQNA 3WKBA 2B4QA 2NSYA 4M87A 5E1BA 3WGHA 4BO3A 3QLJA 1JIKA 4PPGA 2V4UA 3W90A 4KE8A 5C4IA 3N59A 1ZS9A 2GHRA 3HDGA 4E4RA 5DM2A 3WR5A 4DLRA 3IRVA 5B55A 1OH8A 5FQOA 1S7CA 3KBBA 3RK4A 1TW3A 1PJQA 4RJJA 2GN0A 3HUDA 3JAWB 4A0GA 4BFTA 5K45A 3B7WA 1RRVA 1XR3A 1ZRNA 2UZ1A 2QNRA 3NHYA 3NM6B 4OTZA 1WTAA 5BO5A 3TIVA 5K0FA 3KPWA 2JLSA 4PQYA 5FOTA 1CY7A 4DMLA 4REMA 1TUIA 2ZWMA 3GN2A 1XVIA 4DJ5X 4FFWA 1OXUA 5CXQA 1KI1A 4G5SA 3R0QA 1VCHA 1LF5A 1QIGA 4I6JA 2RD2A 1U0FA 2XZPA 4DBLE 4XUCA 2LDXA 2RHTA 2TMGA 3GHHA 4DMCA 2FV8A 4LXTA 5C0OE 3BGVA 4V0RA 2HJ9A 4N0MA 1B4DA 4Y2TA 4YRIA 2QE7D 2QR5A 3NAMA 2ZVQX 2DPHA 2RGDA 3GLSA 1DTSA 4NL4H 3SXJA 1QF7A 4M2LA 1MJGM 3LMKA 3QUAA 5CTJA 4AW9A 1DTWB 4CIXA 4JXXA 3SJBA 1I1OA 3PFCA 5F98A 3SC2A 2DP4E 2CCJA 3GGGA 3KR0A 2BONA 4CMKA 2FDCA 2JHAA 5JCOC 4UHEA 1THTA 1FBTA 4JXJA 1L5KA 4F04A 2JLCA 4QPNA 3CSDA 3WGUA 3K94A 3VJKA 1GLVA 5IEBA 1U0TA 5LUBA 1N3YA 1V7QA 5FEUA 2G0TA 3A1FA 1Z7GA 4CUKA 2IIPA 5H4HA 5B4TA 3AVWA 2MR6A 3G1UA 1K6JA 1R66A 1SUIA 3K30A 3DC2A 1A8QA 1MX5A 3ND5A 4FMPA 1I51A 3LYAA 4KH1A 3KALA 2OXTA 2WFMA 4OI1A 4ZDIA 2FEKA 3KHTA 5L4SA 1EX1A 4BNDA 2YCBA 1NQTA 4OLHA 1N5JA 1ORTA 2C5HA 2DFNA 2PRKA 1PNRA 2BFMA 4IIVA 4M1OA 4O3FA 2C9CA 1K8RA 1T0IA 4FB4A 4B09A 1E2MA 4XARA 5BWOA 4FE4A 1UWKA 1RP1A 3C7KA 5FNVB 3R3WA 4KX5A 1FIUA 4TSFD 4RE6A 4Y6RA 1RC1A 3HVUA 1Z4NA 3FJYA 5E1MA 3VPFA 2AN4A 1ES9A 2ZIXA 2IYUA 3AIIA 1DAOA 3MT8A 3U3XA 5K8CA 1Q77A 3PUWA 2C2MA 4MHOA 1N2SA 5T4HA 2D1TA 1Z8DA 2OK8A 4KIUA 2UVQA 5J47A 1NTRA 3I30X 4D80A 1ULSA 1Z28A 4C6TB 3VSEA 3DVAB 2AF4C 2ZJBA 3DOHA 4PZCA 3EOZA 3L0DA 4EKYA 1AN9A 1VL6A 4BFLA 3JAKA 2Y9PB 5JWRA 3QPUA 3QWHA 1BSVA 2O5VA 3WRYC 1ESCA 2FE4A 3EX7C 1YDMA 3STVA 3VJLA 3MTDA 4XQ9A 3UIEA 3Q8LA 3N2KB 1TVEA 4NBWA 1QONA 5HQ3B 2I7TA 3KQSA 4ZHSA 5TS3A 1M6VB 1T8SA 3U7EB 1N2JA 5DNVA 3DFKA 2QTLA 4G8CA 3HSYA 4HWGA 4R0VA 4L57A 2WF8A 1EM6A 1PQYA 2IEDA 3KYIB 4TRRA 1L5FA 6REQB 5ALYA 1EAMA 4HLDA 2VL7A 3PYMA 3WLIA 1XRMA 1U5BA 1WP4A 2HRCA 2NN3C 3F9IA 3UMJA 3W06A 1TVKB 1FL9A 2YWXA 3WMXA 2FK7A 1MAWA 5E4TA 2JFVA 2N0SA 2Q3MA 4UHHA 2BZ0A 1D4ZA 2VZ0A 3A06A 4QATA 2HEIA 4Q34A 4BIIA 4FTWA 3R40A 4NX2A 2NUTA 4AZTA 1N8SA 1GDHA 4JITA 4FZ5A 4I5IA 5E4FA 3T5GA 1UQUA 2Q4TA 4F97A 1A50B 5F7ZA 1FLVA 2OB2A 1N7IA 5IC5A 4MWZA 5HS6A 4G0WA 2IY8A 3WRWA 3SE0A 1ZW1A 1HETA 4HNVA 3W3ZB 4RSGA 4RESA 1G8GA 3ABQB 3L7NA 4BN4A 4D96A 3S5JA 1X7ZB 3KKQA 3UMMA 3O94A 1HNZB 5LPNA 3TI7A 1RLTA 3M8KA 4KQXA 3SHFA 4A4DA 2ASVA 1T3HA 1VIMA 3DH0A 3DWEX 3O7MA 3KUUA 1XA4A 3FX2A 4KSBA 2J3HA 2SICE 1M2FA 4CL8A 1ZM2A 3QQ5A 3A4IA 3J7TA 4OLFA 3QUTA 3HYSA 2WAXA 4V03A 1MRSA 1LEHA 2KMLA 4D9MA 5KTKA 2QPAA 1LZKA 3EWIA 4OO3A 421PA 2CE7A 1C29B 1EHYA 1SK9A 1S3SA 2GN4A 2WKSA 1CUBA 1F0KA 1PEAA 2XUZA 1X7XA 4Q0MA 4IEFB 2IY7A 3KOUA 3CUWA 4AF6A 3OPQA 3O1JC 4QJ3A 1Z5WA 4N12A 3R76A 4D3SA 3K96A 4DLLA 2W58A 3WJAA 2EYUA 1DI0A 2CN1A 3AU9A 2PJUA 5DBOA 1U2RA 1HQDA 3CH5A 3B6MA 3T1YB 1G6OA 2IU4A 1JKJB 2B8EA 3ESQA 3N6XA 4RY0A 3WGYA 1JWAB 4H3HB 3T3MB 4HSGA 2P11A 3DEYX 1R4NA 1L4KA 2FE1A 4F8JA 5B3AA 2QYTA 2WPNA 3OT1A 1M1UA 4F46A 3EWAA 4HWOA 4NE9A 1J8MF 4ME6A 3V4RA 4NYJR 5TPZA 2XGSA 3JALB 4D44A 3STXA 1QRUA 2QSJA 5G1NA 1NYRA 1W87A 3HSKA 3KSZO 1V5WA 3B8EA 1A8PA 3JZMA 5TMEA 3QE2A 1LK5A 1YL6A 4IUDS 4KLZA 4JASB 2IDKA 1JSZA 1TYBE 1LSOA 1YS1X 2O0MA 3EVDA 2YDXA 2YHSA 3JQAB 3NIDB 3PSHA 1KR2A 1JPNA 5L3QA 1UBEA 5EPEA 3RVRA 3AR3A 1RMQA 3PZRA 4OJNA 1QVVA 3BICA 1FMCA 5SZKB 4D9HA 4E07A 1FU7A 1H66A 1SC1A 3EULA 5KU7A 2PSEA 1HUQA 5D00A 1JQBA 1G18A 1UC8A 5ALHA 4DLSA 5AVJA 1XCMA 4C6HA 2E5FA 5D5HA 3NC4A 3U7RA 4YXFA 3A37A 2CEAA 3ZJUA 1OIXA 5CM2Z 1P2VA 2AD5A 3FMVA 4KXYA 1Y7HA 4BB6A 1OFGA 2BCEA 2HQSA 2VSYA 3FSJX 3BCRA 3PHBE 3LY7A 3V9PA 1QH8B 2BHTA 3ES9A 1M34B 1MFPA 4M54A 4RZ3A 3S2FA 5BN3A 8LDHA 5CFNA 1JXMA 1NW8A 1T0PA 2X0EA 4N5DA 4EVSA 4MB0A 3CJQA 1SGWA 4DMRA 1RAIA 1OZFA 2BGLA 4N40A 5DXAA 2GTHA 4CCYA 2HQOA 2AFRA 1T5TA 2GZ1A 4RACA 1SC4A 3ZDFA 3OT5A 1H2XA 3K9LA 2CXXA 5FDFA 3OETA 1NBMA 2VJCA 1ZOSA 3RBZA 4YLYA 1DE0A 1KYWA 4YT2A 4LW8A 2ZPUA 4GRDA 4HP8A 1N8TA 2ZIGA 4Q3KA 3NRJA 2MHCA 2F8LA 3IE0A 3NUGA 5COAA 4KN8A 1E9AA 1TPYA 4JLOA 1D7OA 2MT9A 2C9MA 3L07A 3DNFA 1MDBA 3O21A 4PZ0A 3FUXA 3O6VA 5EXEA 3RF7A 1OJ7A 1UFVA 2LE0A 3R20A 4IUCS 3E5RA 1BS1A 1RPJA 4QXAA 4UE2A 4DBZA 5JO9A 4IF6A 2X8JB 4EFLA 3UXEA 2PKEA 1JE0A 2RGWA 2GNPA 3ZZNA 2PBLA 1NN5A 2C20A 4OJTA 1N5OX 2GEDA 3SM9A 3UK7A 4IDQA 1R4AA 3ECAA 221PA 4N3GA 3T41A 3DKIA 1SUCA 3BXGA 1O6FA 2VDJA 5EAIA 2Q0SA 2I99A 1FP7A 1ARZA 3T0GA 1Y6GA 2WU1A 2WA1A 2Z1DA 4LDRA 1KEVA 2WIGA 4PR3A 4Z3KA 2WSSD 1ONBA 1RCUA 2XUIA 3HVKA 2OHFA 5IUKC 3A3OA 1GOTA 1QYIA 1NSYA 3BWDD 4N6NA 4B4VA 4MWDA 4ZC1A 1S3IA 2A1UA 1MZPA 1YE3A 4RDIA 2F00A 2YXDA 2Z4SA 3EVBA 2Y4OA 4BDTA 4EDHA 2A0KA 3Q9SA 2FZ4A 3K73O 2I29A 3TQSA 1Y3FE 3EVCA 1BX1A 2W0MA 5HW0A 1GYPA 1B76A 1R10A 1XF9A 3TRKA 4FEGA 2ZR8A 4ENTA 3QW2A 3ANTA 3HBMA 2Z2IA 4R01A 5EIHA 1FRNA 4TTVA 5AM0A 2ZI9A 1D9ZA 4NEQA 5JARA 1N25A 1QK4A 2ORIA 3VZPA 5EZ5A 1TM3E 2IV3A 2NSLA 2R6ZA 2WOJA 4M1SA 2D5IA 2WKQA 3L1JA 3OAAA 3WYBA 1ISFA 1RM4A 4LVNA 1JEYA 1CXZA 2R7KA 4OXNA 4L8FA 4DBLC 5I9NA 4UE3S 1L7VC 3EA4A 4G01B 4C4XA 1L5RA 2RGGA 3E58A 2C7BA 3FPBA 4R51A 4Q7KA 1KQPA 1TM7E 5EQFA 5H9VA 1YZUA 1G7RA 4E31A 1FUIA 2G8NA 4Q3NA 1E2QA 3B5IA 1NV8A 4IOMA 3N0TA 1JILA 4GSYA 5GV7A 2JDID 1CYEA 4YXWD 1GLGA 2NO7A 4PC3A 2NG1A 4Y8VA 4WIAA 2JLRA 3RO7A 1R0KA 3MCUA 4DYVA 1JKXA 4JAVC 1VIDA 3SS7X 3T94A 2ZTLA 1N6LA 1YACA 3JQDA 1ZLXA 2CD7A 3MQFA 5KNDA 1YS2X 3F4BA 1W73A 1XYVA 2R8BA 3I52A 3IIKA 3DW3X 2ISCA 1DQSA 4M8IA 3LSTA 5LQDA 5B1DA 3WLOA 5DVZA 2MSCB 4X44A 1VE7A 3CHYA 2GHQA 1GNVA 5FOVA 2B34A 1GCGA 1CR4A 1DPFA 1WO8A 2R751 3FOWA 4O29A 1QQ5A 4M8NE 1AKQA 1WMEA 3MJFA 4B3IA 2P7IA 2PZJA 4UAGA 4TM8A 1GT6A 1M2NA 2R8YA 3IIJA 4K46A 4RNCA 3L0BA 1GPDG 4X84A 4E13A 3QEBZ 3AKCA 2Y1WA 1X15A 3VDRA 3GUZA 5E9QA 1SRRA 3H7AA 3UUGA 4IIBA 4HAYA 2HMAA 3DVQX 3E82A 4L3WA 5BXYA 4XD2A 3D9QX 1VKOA 2C0QA 2OFWA 3VU8A 3OTGA 1XZNA 1HDEA 1N92A 2Q2NA 2YV5A 3GL9A 4OA5A 1GFSA 3LX5A 4Z1OA 5HGXA 2ZSJA 2F3TA 5CRIA 4BQSA 4X8OA 1UWVA 2IHTA 4B6EA 1GUYA 1YVUA 5CMLA 1LPPA 1K9VF 2OFPA 4BMNA 1Z45A 3ASYA 2W2QA 3KSRA 1VKRA 3CLVA 3G9ZA 5AI0A 5JY6A 3BL6A 3NTOA 1QYVA 2Q3CA 4JUFA 2OYSA 4MGHA 2ZOSA 1IJKA 3LWBA 4R3NA 2XDAA 2P3OA 3TSWA 3V46A 3KEQA 1YQWA 1JEDA 3GFGA 3JARB 1XD9A 2EVWX 2XNJA 3MJ4A 3QU7A 2CMFA 1G5FA 2A0XA 3SX2A 2ZGVA 1BMFD 4OREX 1NVBA 1T5SA 3NRCA 4JEMA 4L8WB 3MQ4A 4PZDA 2OAP1 1R0ZA 4P31A 2DFKB 3QKIA 4Y9UA 3DHEA 3AESA 3KM0A 4BCDA 3LC7O 2BUCA 4OFWA 5JJKA 2QTHA 5DNEA 4AN0A 3FCAA 3GFVA 4MICA 1EFTA 1Z74A 3P9QA 1QYXA 3JAMA 3U4MA 2G63A 4LA4A 1TD1A 1U2QA 4MQBA 3RHTA 2WWXA 3A1CA 4RDXA 3ZWCA 2Z3ZA 1JTFA 4MQ6A 4OQ4A 3EDYA 4MB6A 4ZRNA 3U4QB 4QU8A 1W1IA 1UXGA 1Y4SA 4ZOBA 3TTWA 1CULC 3FNFA 2RK6A 2XT0A 3S40A 3UYKA 1IC6A 2AZ4A 2NUPB 5CPBA 2AYZA 2XNDD 4YJDA 4FYIA 4QLAA 2W11A 3G13A 2F3RA 3CZPA 4HAOA 4C4YA 4ZEVA 2PYDA 1BXZA 5EIXA 1EXWA 4K1XA 1TVMA 1XV5A 4ZMBA 3IQEA 3O84A 4V1CA 3ZHXA 1J7KA 2ZWAA 1I6WA 1M5TA 4DV5B 1IN6A 1DDGA 3R3UA 1RPTA 2A1TR 2J0UA 4YAIA 5DTJA 4CIVA 3WO0A 2A4KA 1P74A 4K9KA 4KTTE 2KBFA 3N6VA 3RSFA 1NFQA 2EEPA 4DE5A 2YH2A 2DKNA 2C00A 5JMPA 2ZLBA 3VUEA 4YMWA 5ITWA 2IZ5A 3BHNA 1E2FA 2UUPA 1KC1A 2B9VA 2XGMA 4PS1A 1JDPA 2R3SA 4JL6A 4NK5A 4PFQA 2GXUA 4ARBA 5JSUA 1M1YE 1WOMA 1JG2A 4P8RA 3UFXA 4CVNA 3CLTC 3V4LA 1BN6A 2FEPA 3HU1A 2D7CA 1POWA 1PK8A 3NTQA 2VYVA 1ZITA 1GPWB 2GZRA 4QU5A 3H7IA 3SEFA 3TEJA 1I5EA 1RHKA 1GIAA 2CNKA 4ILEA 5DI9A 3JQEA 3TVYA 1X1DA 3EY4A 3K8QA 3L7DA 2AWOA 5NULA 1KXZA 1G9XA 2YZ7A 3OM0A 1SKQA 1I4LD 4WN3A 2IYLD 1YZHA 2H52A 3OMLA 1EFDN 3FHCB 2OHOA 4HGQA 4ZZ3A 3EDRA 4OB7A 1FJXA 3RIHA 3PDJA 5A0TA 1OY1A 1BZYA 1SBNE 1X38A 3B89A 4GQBA 3JRNA 4XJSA 1XELA 5CNKA 1URPA 1GPYA 1X42A 1AC5A 2PBFA 2VBIA 5JDCA 4AT1A 3T61A 3G9TA 4AKTA 2GN6A 1C0IA 4N5HX 1K5HA 4W9NA 1D6NA 3DP9A 1U3VA 3ANNA 5ALFA 3E27A 3W5IA 4LGMA 4LUCA 1DRUA 2PS9A 2X2OA 3WOHA 1CEQA 1RRPA 4PU0A 5DRTA 2QU8A 2B82A 4J7UA 4D25A 4AKSA 3H11B 2QN7A 4XW2A 2L42A 1VJGA 2Z08A 2DUWA 3ETJA 3LUFA 4OA8A 7ABPA 3WKAA 2IS1A 4YLGA 3AF6A 3GLQA 4DYHA 1IN5A 2CYAA 4I5DA 3HUEA 4A0RA 3ILYA 5IVHA 3PEUA 2R8RA 3IQXA 4EHLA 3F73A 1JDVA 2GCOB 2HLDD 2FUEA 1W4RA 2XUDA 1CETA 4I8XA 3EVZA 2UXCB 1PGPA 1WZCA 1XEFA 2IEIA 2YIJA 1CIPA 2AN5A 5DHQA 5BV7A 1PNTA 3T7IA 3BC1A 1KMMA 2GWHA 5TF0A 1G3IA 1KEEA 1ABEA 1PJBA 3JPWA 1JIQA 2J9RA 2C4NA 2QRPA 4PRYA 4HVCA 5IVKA 1SC9A 5IXSA 2NO4A 1GFWA 5EJIA 4ZAVA 4OP1A 4EFKA 4YMTA 3DYBA 1FMTA 3O3NB 2WNSA 4UNRA 1HO3A 4FQ8A 1PL8A 3E7XA 3SOZA 1VL8A 1CEEA 1Q7TA 1AZWA 3V4OA 2O1SA 1NL3A 5FTWA 4PZYA 3GRZA 1YZNA 1QFXA 2JBHA 1AB5A 1BXGB 3CX4A 4RFVA 3GPLA 4LYDA 2HCBA 4QELA 2O2IA 2LVBA 2BSXA 2G04A 1MD9A 3DKPA 5AKXA 5KWEA 2V3WA 2CLLB 3DAHA 4ENRA 3U4DA 1XNHA 1W6RA 1S2IA 1V1RA 4X7MA 4GMGA 4ZHQF 1A8UA 4BMVA 4YMUA 1SNYA 2EU8A 4EPWA 4IW3B 1UJ5A 1EQ2A 5BOVA 1A9TA 5TJ9A 1UEJA 3GMSA 4JT8A 4N3BA 2GETA 3DEJA 3GC6A 4DUGD 4J1TA 1TADA 2GPBA 4GLJA 3VYVA 3W5AA 1B15A 3PLRA 3BERA 1UDXA 1YTUA 2R6R1 4PBSA 4JJAA 2H1LA 1BQ3A 5HILA 4G36A 1NP6A 2ZU6A 3DBRA 5EJFA 4EHKA 2OV4A 3LW8A 5ALDA 4RS3A 3ZWPA 3L7LA 3DVRX 3ZWXA 1MABA 3GEEA 3FE2A 1C1YA 1P19A 1YS7A 2GZ3A 5EJ2A 4BWFB 2BCJQ 4CDRA 1E3SA 5FD8A 4XVCA 5KYUB 1BQ4A 1YU9A 1PJ3A 2E4VA 5LJIA 1E4VA 2C04A 1P4JA 1EP1B 1IVYA 5LXTA 1AGRA 4WZBA 1IBKB 2C58A 4YR9A 2HRDA 3B1XA 5CM8B 5PNTA 2FEAA 3KSBC 5ALMA 1TL7C 2AG8A 1XZDA 4GF5A 3OTIA 3RBAA 3C98A 4LV6A 5C35A 4P81A 1GT91 3T9CA 5H3LA 3RS8A 4ZDJA 2I3GA 3A25A 1ISHA 2XYVA 2VNAA 3E15A 4TWIA 1NBEA 4DQKA 5AJYA 3L77A 3QVKA 1MPXA 1XP5A 2X5KO 4EG4A 3JQ8A 3MCWA 1KYZA 5JNWA 1SKYB 2ZEJA 1CC1S 3RU9A 2P41A 4RV9A 2F1KA 4E94A 2Q6OA 1IB0A 2ZVDA 3ZLTA 4FDVA 5MHTA 2CLMB 4CG1A 3WWCA 2VPXA 3OZUA 5HM6A 3EZ7A 3TQRA 1OXBB 5BR1A 1XLTC 1EG7A 4JJIA 4NV0A 4WVFA 3BJZA 1XL0A 4ZVKA 3WRVA 1DAMA 3BPSA 1K4YA 2VCYA 2J87A 1SIUA 3NWPA 3QBDA 5ALOA 3QU2A 2QX7A 3T34A 1PDWA 2GJ9A 2ZRNA 5IKXA 4UU1A 3QVOA 1VJRA 4R8SA 4ETIA 4JP5A 4MKXA 4R2HA 3G9QA 1BS2A 3IJ5A 3KWMA 4AQDA 1KARA 1H2BA 2XMSA 3OIVA 2YJ4A 1BDMA 5L8VA 3MYRA 1AHHA 2OYRA 1T5BA 1BX3A 3CIOA 3A3YA 5FUXA 3M83A 5AXDA 1KDYA 1M2OA 3S1SA 3HCAA 3K8ZA 3FPSA 2YWEA 5CW1A 3D6JA 4ZA2A 3PNLA 2XF8A 1W0JA 1L7RA 1QVRA 4G8JA 3SZ3A 4BFUA 3NHPA 4NIMA 3F98A 4Y2JA 2QTGA 4J4BA 1FNNA 3AG5A 3RS0A 2MSWA 1J6UA 2FG7C 1T2AA 3R9XB 1GV0A 3CLUC 5AJVB 2XEXA 4V0NA 2P5SA 2PO7A 1I0LA 1G8FA 1O5IA 2DFTA 2EP7A 2F2TA 2GKGA 3G9UA 1K5PA 5JPIA 4GZ6A 2W6PA 4BNIA 1Z06A 2RJNA 4FBMA 3NHUA 3AT1A 1U31A 3KAKA 2LUOA 4UXJA 4YJ2A 5JJIA 3QVMA 4G8DA 4C0HA 5IKMA 1DUSA 3KKPA 3EUWA 2OFFA 4JBGA 3D7NA 1R0BA 3BH6A 4U7JA 4B48A 2XNSA 3AJ8A 1SZPA 1ZGJA 3U48A 4E2FA 1NJ5A 2JIZA 2WD7B 4H1UA 4HEQA 4TOIA 5CA1B 5M34A 2XWQA 3L1VA 3GT0A 4HDRB 4MR9A 3OEHD 4I3HA 3ROGA 3IQGX 1M8JA 2VDNB 1Q5PA 3EF0A 3E9RA 5A3SA 3F2IA 4RD3A 4DDHA 1B0AA 1TTPB 3CB4A 3UK6A 3E4DA 1SK8A 4NK4A 4AL4A 4MS1B 3R6GA 3F6EX 4CNBA 3WL6A 5K8JB 2O57A 1U8TA 2ZBGA 3ZK8A 3DFFA 4EB6A 5B2FA 3PVSA 1ZWLA 4KO8A 1Q0RA 3ZTWA 3L7KA 2CUZA 3EAFA 1OROA 3CS3A 3ADPA 4PFKA 1PW7A 1S3FA 1QHHB 3K6KA 5DLPA 1SAYA 2W5UA 5EMNA 5CLJA 3ILSA 1NPDA 2CJFA 5F76A 1EVZA 1QF6A 2VDRB 5IAEA 3E2PA 2B3TA 3B60A 5AJUA 2CXRA 3NORA 4GKBA 1NE2A 5IKEA 1KHHA 1J22A 1VE6A 2V6IA 1XRLA 3SNHA 3CX3A 1A5ZA 3F5FA 3KQUA 4AXBA 1KO1A 3DF7A 1EWTA 4GR4A 1KU0A 4XGIA 3KUKA 3U40A 4BLTA 4P54A 4UUPA 2NUAB 1RJWA 4AROA 3QXJA 1EFVB 1A7KA 1PWXA 1C30A 1X1BA 1D8AA 2O1WA 3NCHA 2DFDA 4ZPXA 5FWYB 4DT1B 5K0JA 1PEDA 2Y8EA 2JGEA 2P2NA 4HTFA 4ODIA 4LJ7A 3AFHA 3RJ9A 3IILA 4LXQA 2LR0A 4DJFC 1CP2A 1TYDE 2XVAA 3I8SA 4U4AA 5TT1A 1DDOA 1TQ8A 5H8WA 1ZNWA 2ZK7A 4RY2A 1C3XA 2RHWA 3NEPX 2H08A 3P0HA 4LDZA 1YRHA 2FETA 3MS2A 4LJRA 2IITA 4WESA 3ETGA 3G2IA 5DGDA 1ZH6A 1CIVA 3L1KA 3U37A 1FDUA 3VXKA 5K7SA 1DOAA 2JHPA 2Z56A 3IULA 3K2EA 4C04A 3K0CA 2XPCA 4DZZA 1MA0A 2JA1A 1YDFA 4HCJA 4Y6PA 5JS2A 2BGMA 2O2GA 1K08A 2OORA 3AUKA 1Z2PX 3AI2A 5JMTA 1JQDA 1VP9A 3TUZC 3W5DA 1W96A 2WAMA 2HA6A 3B52X 5E3JA 3JVUA 4P08A 3TQOA 1APBA 2HQ1A 3OEYA 4PVCA 5L7YA 2GDZA 3UJ7A 2W8BB 3H97A 3B2EA 3MCTA 2CXHA 4TLEA 4UUNA 5LKRA 3AK4A 3LLSA 3PE4A 3S29A 2BBWA 1NMZA 4PYMA 4O2BA 3CR7A 2VJAA 3GRAA 3RFXA 2I8AA 5M04A 4I4TF 2O0LA 4GD3Q 5IN4A 1GNRA 5IZCC 3A0UA 1UQRA 3FCOA 4UHBA 4KQ2A 5E7QA 4UBNA 2OHXA 1ULHA 2XQJA 5FTNA 3GJ6A 4FDAA 3H3XA 1PV2A 1LDGA 3MLEA 4F85A 4LRSB 2IZ6A 4HFRA 4UAVA 2R1VA 2C5GA 3I9JA 3QJ5A 4NBUA 1PWHA 1RLMA 4GO1A 1ZSVA 3VHQA 2RI6A 5CA0A 4XIJA 1C8KA 3RUDA 2C07A 4IZ6A 5E2AA 5IDQA 4WPGA 2R68A 3QEAZ 1JTVA 2EHJA 1LA2A 4QYSA 5J59A 2PWYA 2PZGA 3FUWA 4Y2VA 4BZXA 1VKZA 3G8YA 4FT4A 3OZAA 4O4IA 4AZWA 1JEQA 4FYHA 4U6QA 1Q0LA 3WBJA 4BGVA 2AS0A 1F4VA 4EYEA 5BYJA 4Q16A 3R5FA 1A27A 4IQ8A 2X3FA 2G1KA 2QJOA 3PEYA 1E2GA 5JR3A 4D46A 3KAJA 1Q14A 5BYKA 1Z0ZA 4INOA 2ADMA 1JA9A 4MULA 2JK1A 5JSYA 3CNNA 1FFSA 1O95C 3M34A 3E84A 4H7HA 2W70A 2AV6A 5EXTA 3D4NA 5DHPA 4HX5A 4NABA 2OG1A 3KZ1E 4RORA 3CZCA 1IM8A 1TTHA 3LPCA 3O1IC 4Y6SA 4Q7QA 3T3NA 2WU8A 1UP7A 4ZZ0A 3TFOA 3QQPA 2VZ8A 3NWJA 4DGQA 1ICIA 2IU3A 3OVMA 3VH2A 1UMBB 3AGQA 1KAMA 3QVGA 1U0JA 1XLWA 2ZYWX 3IJRA 1J2YA 1CZRA 1U3WA 3Q9LA 5JOQA 3NTRA 3LBFA 4B43A 1KH1A 4L74A 4Q18A 1B74A 4PHFA 3A14A 3U7QB 4Y2PA 4ZI5A 3WISA 5JECA 1Z25A 2J3KA 4Y0NA 4GECA 3JYQA 4XSGA 4YI5A 2QEQA 5K0EA 3ESBA 4EHDA 1WY5A 4DR2B 4ZT6A 4EKIA 2ZULA 1E6UA 3WNZA 4X1OA 4XR9A 4IR7A 2JIRA 1VMDA 5DYWA 4YONB 4YJFA 4B35A 3C0KA 5JTUA 2IH5A 1Y33E 3G5UA 1MXHA 4MW5A 1LS6A 1LJLA 2ERYA 2OZVA 4IOLA 2QP3A 1SQ6A 4IH4A 2OUIA 4GPD1 5AVUA 1X7WA 2XRFA 2C7PA 3JYLA 4FOPA 4HDSA 4D97A 3DKVA 4BRZA 1T8UA 5JQGB 1GPBA 1KKUA 1Z5ZA 3H13A 3PRHA 3SC4A 1T5OA 3EUAA 3HEAA 1GZ7A 3G68A 1IH8A 1U0NA 2ZJ4A 2FPRA 5BT8A 1CDOA 2V5AA 3MJEA 1JR3E 4OHFA 4AQ7A 4CM9A 3AEQA 1XU4A 3CZ9A 1SVUA 1M2JA 3F7OA 5ESXA 4C5CA 1M6YA 3RKRA 5A2QA 4RTPA 3ZKWB 4GX2A 4JL8A 3ZXXA 3U61B 4RV4A 3A11A 4YREA 1NU6A 4WLEA 2NAFA 5AOAA 1XMQB 1M6EX 3QJYA 3OOWA 3CRNA 3Q3GE 4AECA 1W88B 3R75A 5K4GA 1EVKA 1JIXA 2D8MA 3NC1C 5T57A 2FWNA 4K3VA 1RYHA 3KP1A 2MSKA 2V0GA 2OKCA 2H8KA 4ETMA 3VYRB 3C24A 5KOJB 2H17A 3HCRA 3VAAA 5ELXA 2A9FA 2R00A 4P32A 2R87A 5AHOA 3RC8A 3SY8A 4OHYA 2HLHA 2HV8A 1H4TA 3IL2A 1XVUA 2JLQA 4IIDA 1P9RA 1IOVA 3OZSA 2BFWA 1NT4A 3OF3A 4MA5A 5BRJA 4A0SA 3I5MA 3J81A 4Q05A 2XQGA 3N28A 4NJOA 5ADVA 1CW2B 1BMDA 1V35A 2WWFA 4I50B 5FA5A 2ATIA 4IVPA 3FTPA 1C9EA 2A78A 3QPVA 4RD0A 3UCEA 3PUXA 3VSCA 1OT5A 4FGKA 3IA2A 3QU5A 4PLFA 1A8IA 4ND3A 2Z83A 4Q4HA 4MIYA 4POAA 3KD2A 1NVAA 1XMSA 3LYLA 4FQ5A 4PVDA 1BC5A 4Y7CA 2KLBA 3IDFA 2QRVB 4QDTA 1M8FA 3GVIA 1QANA 3KKZA 4PSUA 3K0EA 4NRDA 4NOJA 5FI1B 1E32A 2A0YA 2WJ4A 4V0QA 1U99A 3QX3A 3EIHA 1LQTA 4X60A 5LP6A 3A9SA 2XVZA 3T52A 1XIVA 3FNRA 3OCYA 4LRWA 2DT8A 1CQPA 4E70A 2IEZA 1WTCA 3I6IA 3HV0A 1EYZA 1OGYA 2EZ9A 4OBBA 5TGZA 5LN1A 2ZZNA 3JQ6A 1RRGA 1DXQA 2QV7A 2D2EA 3ELDA 5DT2A 5AHWA 3ZIAD 3ETEA 3U0BA 1GCIA 1O6CA 2CL5A 1K2VN 2IEBA 3AERB 3DM5A 2W4MA 4TL6A 4PCAA 4ESVA 5IJAA 3BULA 1LVUA 4PG5A 4YACA 2UV8A 1G8HA 4FYVA 3OKCA 4IDDA 4P3XA 3A32A 4GXRA 1GKKA 5HPYB 1N2BA 3HKBA 4PC1A 1DNPA 4TS1A 5CFMA 2OKGA 1NMSA 4NJMB 3LQ1A 5B36A 4YO7A 4CMGA 1W5AA 1VSBA 4ZO7A 2HUPA 3B1JA 2FW1A 2DE0X 2AR7A 2FWMX 2YRFA 4FMCB 5ELLA 4WOBA 5ILQA 3HKCA 5B3KA 4M0CA 3HB7A 2DMRA 2V5VA 4A6DA 1XNRB 4P4NA 5GONB 2C84A 3DULA 3QEKA 5J3JA 3CLRC 3LOUA 3OJEA 1HT2E 5CT6A 5IASA 1W7AA 1XDZA 2AE2A 3LOPA 4OLBA 2J0QA 4Q7LA 4N5IX 3E9EA 1VG1A 2BPOA 1X6VA 2O2YA 4LHYA 5DN6D 2FK8A 4XXHA 3V6MA 5JXIA 2DECA 4M8LA 4EPYA 1PW5A 1C9JA 2XKJE 1DBSA 4AQYB 4EI7A 3V1NA 1K8ZB 5TNXA 2HLPA 1VB3A 2I4MA 3G8DA 4GX0A 5G41A 3SHQA 4DRYA 4EX6A 4S05A 1UAAA 1O58A 1XF1A 1A9RA 5LJLA 3VZRA 1ACMA 3GI1A 4IVNA 2CNLA 3HGTA 4OKNA 4U7HA 3WAKA 3KETA 1FLAA 4MS3B 4B1FA 1XZQA 2M1ZA 5DKFA 4BMPB 2ZE7A 3EUFA 4GYWA 4HMOA 4C76A 5C18A 1R5BA 2K7ZA 4XCVA 3IEVA 2GZSA 1JHRA 4DV3B 3HVHA 1U2TA 4RHTA 3KTOA 1I13A 1VCIA 2WZDA 4FGZA 4LHEA 4MUHA 4TTQA 1Y37A 1P39A 4BB5A 2AR0A 1V11B 2YS7A 2ZS9A 4TVOA 3HYTA 1Q3KA 3N8GA 4MKHA 4R2KA 1WDMA 4X8MA 5TV2A 4QWMA 5JYCA 3MJHA 4KL8S 1ACJA 1CQIB 1QX4A 2QSUA 2J3MA 3U80A 1JAHA 1PFYA 5BW8A 4FNAA 4IOKA 1H2YA 4G5FA 3FF4A 3HPQA 1NLFA 1SA0B 2W00A 1PBNA 3PENA 2GSWA 1PTJC 2I03A 1YR2A 4Q9KA 5EWLA 4EGAA 3THXA 2C31A 1Y34E 2GVDC 2GILA 1GKLA 3OJFA 1JG4A 2LP4Y 3VR5H 1MO5A 2JLZA 3ADDA 1V71A 4RIEA 4UOQA 4E6PA 1W85A 2DKOA 3GGSA 1PGQA 4GX5A 1XP8A 4K03A 1GGNA 3UW1A 4JB0A 2X1LA 2CXQA 1YZFA 5AVYA 4YJHB 1HZJA 5A3QA 1WZEA 1U7OA 2VDMB 1B8OA 1AG9A 3IVXA 3UMGA 1KNXA 2CFCA 2CF6A 3MWFA 1PHPA 3RD5A 1W5TA 1XZBA 4ERNA 5JAQA 2NV2B 1HDZA 3VR2D 2A5JA 2X42A 3QV2A 1QQBA 3FPHA 2GM5A