1S2DA

Purine 2'-deoxyribosyl complex with arabinoside: ribosylated intermediate (araa)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
164
Chain Sequence
b'MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
molecule tags Transferase
source organism Lactobacillus helveticus
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
total genus 50
structure length 164
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2dA00
3EHDA 1PFKA 4LJKA 4RH3A 4U1RA 4A3SA 1F8XA 3O8LA 4FYKA 5ITSA 3PFKA 1MTOA 4I4IA 1KZHA 4JENA 3UQZA 2F67A 3O8NA 1S3FA 2A33A 3OPYB 4I36A 3BQ9A 1T35A 1ZXXA 4WL0A 3U39A 2Q4OA 2F64A 3K2QA 4OHRA 3F5MA 2NX2A 4FYIA 4LJLA 4LJRA 3O8OB 2KHZA 2IZ5A 4FYHA 1S2LA 2A0KA 1WEHA 3IMKA 4KXLA 3MAJA 2KLHA 1F8YA 4PFKA 4MCJA 4HX9A 2HIGA 4NPAA 4KXNA 1WEKA 2F2TA 3O8OA 4P5DA 4KXMA 3HNOA 4OHBA 2Q4DA 2F48A 1S2DA 2PFKA 6PFKA 2IZ6A 4JELA 1S2GA 5AJUA 4MEJA 4P5EA 3QUAA 1RCUA 4I7EA 2IZ7A 2PMBA 3OPYA 2F62A 5AJTA 3GH1A 3SBXA 1YDHA 4JEMA 1S2IA
chains in the Genus database with same CATH superfamily
1KL7A 1E63A 3QEKA 3WAJA 4GH5A 2J32A 4RD2A 2YKGA 4KQFA 3RYFB 5ALWA 3E9CA 4G1EB 2DQ4A 5DLEA 2VQDA 1KI2A 3NNSA 1S7GA 4R8SA 3LP6A 3PC3A 2H2IA 4Q21A 3X2SA 3KVOA 1E2EA 1SOMA 2YNMA 5TGDA 2XQKA 5JO0A 1JKJA 2ZEJA 5AQ1A 4J6FA 1WXEA 1IHUA 4O4IF 4YWHA 1JQAA 2JBAB 3PFKA 4EJ2A 4GW3A 1A96A 3WG9A 1JG1A 1WOYA 3FSRA 2XT0A 3BDIA 3LO5A 5B6IA 3NYWA 2CVFA 3EXEB 1VC2A 2GHQA 2L2QA 4B5LA 3CA8A 3LOPA 4M1EA 1THTA 1X92A 1R6AA 2AFIE 2VXYA 3FRIA 4ZDJA 4LMRA 1B26A 3S2EA 1Q1NA 2MU1A 3BIJA 4CQMB 2QA5A 4CYMA 1FTGA 2HF9A 4D8XA 3O83A 2YFQA 4YUWA 1IPEA 1W96A 3MD9A 3ZVLA 1ZWKA 5AOAA 3OUUA 3HVJA 2Z95A 3OF3A 5KKAA 3J81k 5DWQA 4UNQA 5LFAA 3SVLA 2YWRA 3L8MA 1AU9A 2OAQ1 5FI3A 4CMIB 3WLFA 4Z2YA 1DO0A 3B48A 3D7SA 1R50A 3LVRE 4TQAA 1RQ2A 3GLTA 2Q07A 2Q6IA 4ATNA 2QQEA 3IO5A 3QLEA 1V16B 3VH3A 5JISA 3L0YA 4LUCA 2W2KA 1W581 2X1LA 3HRHA 3GD5A 1JG3A 5IDQA 1WCYA 4PFKA 3DEJA 4IHKA 1LDMA 3GP5A 4QT4A 3PHLA 3BERA 1A4UA 3HP7A 3Q9LA 3U1TA 4BFCA 4B47A 1USWA 5TB5A 1T0JB 2OXRA 3NHUA 4TL8A 2CCJA 2VTKA 3QE3A 5EJ9A 1E6WA 1FLVA 2YXPX 4IRUB 1Z15A 3ZGZA 3G59A 4REOA 1LSSA 1L4HA 2I9PA 3A14A 1OA0A 2GFIA 1KBQA 1KAQA 1RC0A 1UJ5A 4MW4A 1T36A 2XXAA 1MQAA 3ZK9A 1JJBA 3GLHB 3S2GA 4KXQA 2ZU0C 4RLHA 3K9NA 3AM3A 1UPBA 2C5SA 2P6PA 4Q3NA 3B13B 2F8TA 3VR5A 1Y9JA 3ELUA 4DLWA 1SVLA 4WZAB 2CL7X 1KTVA 2A3NA 6Q21A 2Q4TA 721PA 1NHWA 2QV7A 1V8PA 3COYA 4ALLA 1MV5A 3FH0A 3CY6A 4O3MA 2HTFA 4ZHQF 1NM5C 2CDCA 2EZ4A 1JTEA 2C4VA 2FPWA 1V37A 1V5EA 3C85A 4M8SA 4CHGA 4CKYA 3GLIB 1H1LA 2QX6A 1QCDA 3CONA 4Y8VA 3WNQA 1Q0ZA 3SZUA 1DJQA 4R68A 3Q3IA 3T3HA 3CPHA 1D2RA 1PGOA 2P7HA 4OB7A 3RB8A 3WOHA 3ZV5A 1JR2A 4HSEA 3VR6A 2PGLA 3F6CA 5ADWA 1N7IA 1J2RA 1XAGA 4ZWNA 3H5NA 3M3DA 2HMUA 3T3IA 3KKEA 3E81A 2B2NA 3HEBA 4DLTA 5F7OA 3ZDYB 1BXGA 2J9FB 2VYCA 5BSHA 2GK7A 3BMNA 5K8TA 2XR1A 1QFXA 4NSNA 1T1EA 1DAEA 1XL1A 1RTTA 3N53A 5E8JA 3HJTA 3E9EA 4ZOEA 2W43A 2P27A 3VU3A 1IM2A 4YJ2F 1YASA 1P4GA 3EXFA 3IC5A 3QXSA 3E7FA 1DC5A 4O2BB 2JFVA 3CV3A 4QA9A 5AKZA 1CU1A 5F21A 3ZH2A 1E7SA 1RP1A 3DEKA 1IXKA 3QXGA 4FJ2A 5EN4A 4C7JA 4F9TA 2J4CA 1BO6A 1NVVQ 2KWIA 3KLOA 2W8BB 4F97A 1ACLA 2H2HA 2ZBRA 4HR7A 1YS4A 3IAFA 2H0RA 4HB3A 4CU2A 3N2ZB 3NRCA 1H1LB 2H0AA 4EK9A 2IIBA 2KBFA 1C9YA 1UBOS 4Q93A 1XU9A 3EG9B 4F2GA 2ECFA 1HYBA 1O08A 3EUEA 4ZI7F 1W93A 5ENVA 5I4CA 1KYTA 4GLLA 1XEWX 2X5XA 4MV6A 2GPYA 3TIFA 4JP1A 5C9ZA 2O2JA 4XE5A 3EULA 4G85A 4CJXA 3DE0X 8GPBA 3W6PA 2VJOA 3PVCA 5FL3A 1Z6PA 2YJ4A 4WA8A 3RD5A 1OFUX 2ZJ8A 2M6LA 4C2UA 3CNLA 3A70A 1JDZA 1KJNA 1P6QA 2H7YA 4YROA 2PWBA 4RZUA 4DMUB 4E5MA 3N6XA 2IEYA 4NTZA 1OKKA 1DQZA 2G7ZA 1GO2A 4J7CA 4LXQA 4V39A 3GH3A 4CWAA 3BH6A 3CUEF 1MH9A 2FWAA 3S8YA 2P67A 1YL6A 4ALMA 3P9PA 5G53C 4J0JA 1U7XA 3MA0A 4R8LA 1B7GO 2J9GA 3OEYA 1QAOA 2A8YA 1CDZA 1AK2A 4ETIA 3ZPXA 5KJFA 2WF8A 4J0EA 5CEFA 4H6PA 5JXJA 4PYLA 1WZIA 1LB1B 4KO4S 1JALA 3W3ZB 3DFIA 5C35A 3RC8A 3KT6A 3B6JA 1YE8A 2XZPA 1E9SA 4R5HA 2HDWA 1R5JA 5KOHA 4UVHA 4AWBA 1T5DX 2PM8A 2ZJAA 3MT8A 2IHKA 1NW3A 5JRZA 4M9ZA 2C3PA 1GR0A 4RD3A 1NBHA 1EFDN 1VJRA 2FW8A 2OHJA 4LXGA 3GT4A 4U2EA 4XCXA 2O8DA 1XDBA 2OQIA 2WHXA 2ZRHA 3G5AA 3KJQA 4HDSB 4YNBA 1BS1A 1LTHR 4FMCB 3WISA 5E3HA 5JALA 3NDJA 3WKAA 2JBWA 2NSDA 3BBLA 1U3TA 5K4GA 1XNJA 2HRCA 4L4XA 3GGGA 1D1TA 4KZPA 3UY4A 3WWDA 1L8XA 3Q8LA 2HA7A 1FFYA 3PPYA 1D2GA 1SKQA 2AVDA 2OO3A 3WGLA 1IEXA 3BYZA 5D7NA 3MCAA 2XNJA 1ULTA 2PVCA 4CCYB 2X0JA 2WPDD 4NFYA 1MO6A 2QP9X 3OFVA 4HDOB 3V3TA 4KN9S 2V9ZA 1O4VA 3EISA 3I01M 3HDTA 4WOPA 5FPHA 3T35A 4CF6A 4U2GA 3NASA 5L3QB 2YHIB 2HUPA 3IS3A 4KI7A 2H6EA 3V4LA 1UJMA 3T8YA 1LPAB 1XA3A 2ZI3A 3OWXA 1KOFA 2QY9A 3OF2A 3B3JA 3BMOB 3WIVA 5FWNA 3A2KA 1S4MA 5K6TA 1JPJA 4RJTA 1CZKA 1Q1QA 1TKAA 1ZVQA 2I29A 2OBXA 4L2IA 4ENSA 3CX8A 4I5GA 2R7NA 1XTSA 4NZ9A 5FBVB 4AKGA 4F11A 1AF4A 2BE7A 1AXGA 3SQLA 3DF9A 2NXWA 4QBGB 2MSCB 3MRVA 4AF8A 2ABWA 5HOEA 4HTFB 3GPLA 1NHGA 5HJ2A 5CP8A 4V38A 2IS2A 3BWXA 4Q47A 3MBOA 4AJPA 4INPA 4LZNA 3BE5A 1MOQA 3KUUA 4LWQA 1DU4A 4J91A 1JDSA 4WBXC 3FOZA 5JIBA 2QNRA 3A6PC 3K9LA 3VPAA 3LPLA 1ORWA 1U9JA 8MHTA 3B82A 5E7QA 4M38A 1ONOA 2P6UA 4NPHA 2PLRA 4Y2QA 5AI8A 5FL7D 1CP2A 1MQ8B 1MAWA 2PO7A 2CCGA 3JQ9C 3OLWA 4HVCA 4CIAA 3WAGA 4BPRA 3AF6A 1UAYA 1WMFA 1J21A 4UU1A 3Q11A 1JX6A 4RA6B 3W5HA 2H51A 1UC4B 1ZISA 4FYIA 4RKFA 1RXEA 1IOVA 4IDHA 2R1TB 4Q39A 4XPIB 2BD0A 5B12A 3GFVA 4FDVA 2ZKLA 3CW9A 4AZSA 1G64A 2XMCA 3I6MA 4MO2A 5ALGA 3DZFA 1U11A 2ZB2A 4JLAA 4OJKA 3FWHA 3COZA 4TZ0A 2BEUB 1GZHB 4HX5A 1DMSA 2N9UA 4L3VA 2WU1A 4X6YA 3T6KA 4TLMB 4HH4A 4K1LA 2K7FA 1EPUA 2VWPA 4YQEA 4E7OA 3G2OA 4RK4A 1QTRA 2AZ4A 3IALA 2BZGA 3H2GA 3PRHA 2DPGA 3PE4A 5HFAA 1M2VB 2PSJA 1W46A 1FUKA 4DZRA 3LDAA 1L5QA 2V3WA 3JYHA 3U9TA 1J2EA 1XCBA 2XZOA 4WHMA 3BFJA 2WTUA 5BQXA 2G06A 3HB0A 3MMPA 3X43A 1ILEA 2COEA 5T67A 3H87A 3LKZA 3TQSA 2RC5A 3DUFB 3LGAA 1AA9A 2ETXA 2ZYHA 3AL3A 3NGXA 4IIJF 4M88A 3S2YA 1PGPA 2YIJA 2BKUA 3NKLA 4C0XA 2H3EA 4FYWA 1RVDA 1RWBA 4IMPA 1X7XB 3PRJA 2EL7A 1X86B 3ZEAA 5BURA 5D85A 2P9TA 1T6XA 4RLQA 4ALIA 2XB2A 1PYOA 3S7TA 4P54A 4W5JA 2O9JA 3DJYA 3QELB 4MS3A 3VH1A 4JUIA 5HCNA 4JFRA 1EFHA 2ZWPA 4CLDA 3AF4A 2BELA 4RVCA 4UTRA 2I34A 3W6NA 1UEXC 1Z4IA 1QK5A 1U0RA 1TIBA 4MVJH 4P80A 4WECA 4EHIA 4C4XA 3TB4A 1ATIA 5CITA 1II0A 4M36A 5EJ8A 5K6RA 4YRAA 1YNSA 2OILA 5JASA 3G9UA 4RKQA 2WJZB 3SLGA 2G82A 1T8SA 2O14A 4QUJA 3MC1A 3FOBA 3TQFA 2AC2A 2XJ4A 3R44A 5TDHA 3K71B 3N76A 3NHFA 4JAVC 1OLUB 1MNQA 1VBMA 3GJ7A 1A9SA 1XQWA 4QLAA 1KH2A 1OREA 3UMVA 4DHEA 3UBTA 2BONA 2R1VB 3CPSA 4HNHA 5KTPA 3KZXA 3O4GA 3HYSA 3LCJA 3W2HA 3WGJA 3E8XA 4L8GA 1QRDA 1QQ5A 2PVSA 3CSSA 3VZQA 2JAOA 4B3IA 5JZSA 1LFAA 3TQOA 4Z4IA 2F55A 4GIBA 3BOSA 3CUUA 1R74A 2UUBB 5BXYA 5JNWA 3RTEA 5IC6A 3H84A 1XTUA 5TS2A 2F4NA 1J00A 1XNHA 2H48A 1DPFA 5AKJA 2OKCA 1B8UA 2GJ9A 1Q1ZA 3WYCA 3EVGA 2Z56A 1ZR4A 4A0RA 4JY7A 3OHMA 1LV7A 5EWMA 4CZ2A 2I3BA 1BCSA 3LZCA 4BO0A 5LU8A 2YX1A 3WXBA 1GWNA 4AYWA 1ISMA 2FG7C 5HBGA 2COUA 1OB5A 1J9EA 2YJ5A 4Y0VA 4EECA 3ILXA 3CWCA 4G23A 2GBPA 1FIUA 1CFZA 5KYUB 5CD1A 1ZWLA 2XYGA 1U7DA 1PD1A 3GOHA 1IM8A 5DMXA 5MDHA 1WA5A 1N6PA 1O94D 2ZPAA 4EG4A 2MYPA 4FFOA 5EHIA 1D2AA 4HVLA 3HB4X 1FW6A 2C2MA 2Y1CA 4MNTA 3GRPA 1H5UA 4BMNA 1LS1A 1VRWA 4FI3F 2QZJA 4X90A 1TTQB 1ZPDA 2JCBA 2HT1A 3NHLA 5E0KB 1BDBA 1R9NA 1XCOA 3LGSA 1IK6A 1V9CA 2AF4C 3L7AA 5BW6B 2CE7A 3TW6A 3OIUA 4NQRA 4Y3UA 1N5KA 3KOZA 3AGQA 3AR2A 1Z2EA 1DINA 1BRMA 3VI4B 4BGDA 2VPPA 2WSLA 2DR2A 4PR3A 3BE6A 4RA6A 2CJXA 3BJMA 3I37X 3T34A 1YRYE 4BDTA 2EQBA 4KUGA 1GQFA 4DHWA 1Q95A 4I50B 4ECAA 1ZIYA 1Y5RA 4ERXA 5ITZB 1CZHA 1ZNXA 2NXEA 1PNOA 3L9XA 3I4FA 2F9MA 4EH1A 2FV8A 2V5UA 1GU0A 1PJBA 2WM3A 3PXAA 4IMRA 1DHRA 3VR6D 4KXUA 2BMDA 4RAQA 3DVLA 4CIWA 2ENUA 3FPFA 1XYYA 9LDBA 1GEEA 4UEKA 5EP4A 1FLDA 2GJKA 1G8KA 1T3ZA 2NZ8A 4BRUA 1OXBB 5ALNA 3TOCA 3USCS 2VCYA 1XTZA 1AHIA 4L5AA 4RKWA 2FN3A 4O33A 1TMOA 1VJCA 3L8HA 1N7JA 4H17A 4K9LA 4KQ9A 2KI5A 4KAXA 1D5CA 4MGHA 2WJVA 3HN6A 3DZKA 5ALTA 2VF4X 3D0KA 4MVJP 2IXGA 2J3DA 1J90A 3EGOA 3RBZA 1JR3A 5HKOA 2C7RA 4PFQA 1HDCA 2W90A 3QYJA 2CJYA 2VJKA 3TEFA 3ROKA 4YP7A 3OZIA 4WD3A 5A4AA 1UR5A 2HEGA 3EYAA 2PLAA 1SOWA 4WEOA 3EXIB 3K15A 3QUAA 4ZJYA 4O2AA 2B1IA 3R8CA 3AK4A 1UDBA 1SQSA 3E2MA 3OZEA 5BV1A 3PQDA 3L4BA 4TYPA 1CZUA 2HNKA 4PYQA 4EBFA 2G28A 3GH1A 2C7VA 1KA9H 1UH5A 3V9PA 4KNWA 5IPFA 3BL6A 3JWJA 1E3MA 1MVLA 1Y5NA 3BZUA 5IP5A 3ZE1B 1JH8A 2GM3A 3MG9A 1NX9A 2JFWA 4YAEA 4JFAA 3BTUA 1L5GB 3MXTA 1T0UA 3O91A 2Y68A 2LKDA 4PLWA 2BRUC 1JDPA 5EJGA 1Y4DE 1NFRA 1YS2X 2GEKA 4H4CA 2O19A 2ZB4A 1XFDA 3DZGA 2I6UA 3NO4A 1WNTA 4GD3Q 1F0YA 4Q4HA 2QRHA 1ORIA 1Z07A 4OGFA 1T5LA 5EUCA 4XVUA 2ZANA 3IBSA 2P5SA 1GPH1 5E4TA 3UB2A 4AMGA 1L4LA 1VJTA 2GFQA 1PW7A 4OK5A 3UANA 3V32A 3ROFA 4A73A 5AJHA 1ULAA 1L5YA 3B3QA 1YVEI 1B8NA 4UHBA 1FYVA 3PYMA 3LQYA 2KJQA 2CYCA 5ILQA 3SYTA 5B3AA 4Q48A 4BNNA 1Z17A 3DR3A 1PE0A 5LZ5A 5K0EA 1RAAA 3C8MA 4RHYA 2C83A 1V7PC 4C4PA 4E5YA 1UL1X 4HV4A 3DLCA 3QF4B 3S44A 4B9AA 2GF0A 3FYUA 3MGBA 4JWKA 3B8EA 5C5DA 1SHLA 2AZXA 3FYTA 4MP3A 4BCDA 3KPJA 2W6QA 4WNIA 2QIPA 5AOVA 3ZX4A 4YLYA 5K0GA 4J1NA 1J2JA 4YH1A 4JJ6A 4QSMA 4AMYA 5B7GA 1L4FA 1Y8QA 1A9TA 3LNCA 2XF2A 1NFFA 1XZAA 2IYLD 1UK9A 1N0HA 3MQFA 3TX6A 2QUKA 2W2QA 1SZJG 3KHTA 4CF4A 3QA9A 4MV4A 2WI8A 1T34A 1EAYA 3VVLA 2CV2A 3R41A 4XLZA 2VQFB 3VPHA 4CN8A 4IFEA 3HCCA 3ESYA 4DWOA 2ZJ5A 4KYUA 2P3OA 3UBMA 1CHDA 3D6FA 3ZVRA 1W4RA 3ITNA 3U3DA 1QIIA 2DQZA 1UMDA 3N9IA 4GQIA 4LSGA 1KDOA 1Z8NA 1VHTA 2GK4A 3N2KA 1G3MA 5F5XA 3W2FA 4ER3A 4EYQA 1SBZA 1Y4ZA 4OA5A 5FEMA 4JI8B 2Q8QA 3K94A 3ZNNA 3PR1A 4M7PA 4F3YA 1T1SA 4L8LA 1FP6A 2NYAA 3ETGA 1TUGA 5CR9A 3V34A 4FU0A 2R8BA 1XT6A 2X0FA 2J6CA 5FA6A 4ARSA 4C0QC 1MAHA 4LHWA 2PJRA 2AEJA 3NHMA 4Q19A 4B76A 3PEWA 3F73A 1IUPA 1UFRA 3DMDA 3IDQA 4EF6A 1WLYA 3BE4A 5I7OA 2PUGA 1Z7YA 5JU6A 2JJ2D 4YAGA 1EB8A 3IP8A 4PXAA 3A05A 4L0CA 4TQUS 2IZ6A 2IBTA 4X71A 2H1FA 1LC0A 2A30A 5EL0A 4B3MB 1TYZA 2E4ZA 3FI0A 1P0IA 1UP4A 4D6YA 1DELA 2V8OA 3QLJA 1RYYA 2DFLA 4RVOA 3TL3A 1GT91 4OLFA 2QL6A 4NK5A 2FWBA 4KQXA 2CHGA 1U0NA 4YAFA 4ZXFA 2C2YA 3EDQA 4IMIB 1LWOA 4LQ4A 4NF2A 4K1XA 3SBXA 3W5AA 2YVUA 5BRNA 2AZTA 1CVLA 1JSCA 1ZU4A 4IIUA 2R8RA 5EXEA 4DV7B 3IEVA 3FNHA 1QWOA 4L4UA 3MQ4A 1Y81A 3N8NA 1QIGA 1GD1O 2R5NA 3ETLA 3KTFA 4N0PA 2VTEA 3BMQB 1PL7A 2IHVA 4ZAYA 4JA2A 4PFSA 4BC0A 3L84A 4D9KA 3K1JA 2IYOA 2HLDA 2ZSIA 3KQYA 5DGHA 2QAGC 4QHTA 3NC0C 4NWIA 4QREA 3RU7A 3VYVA 4C0JA 4ZCRA 5CFMA 2D1QA 3JZFA 4W5OA 2QKYA 3R7WA 1XSEA 5JWRA 3IL2A 4TXHA 4GXRA 2JJYA 2QLTA 3ZWXA 3SF8A 3UGQA 3EGVA 1FXWA 2NP6A 2OXFA 3NWOA 5M5BA 4D4KA 2PFGA 3G9TA 2FZKA 1ZP6A 2ZBGA 3G7NA 4BATA 4DNPA 4WDRA 1N6KA 3C7AA 4RMJA 2IBMA 1YS9A 3IVMA 3K5HA 3EEOA 5J2UA 3TBFA 2FMFA 2H0QA 3ET5A 1PEAA 2IEBA 4FDMA 4WCDA 1PJAA 3OE7D 2AOWA 4UEOA 5KVQA 1VCNA 2P0EA 1BW9A 1Z0ZA 1MJHA 1H05A 4GVXA 2VH1A 5C7YA 9ATCA 3K9GA 3P0FA 1CY0A 2OB2A 1F1BA 1R00A 5LIRA 3T5BA 4NECA 3SEZA 5EJ5A 4DC1A 2J33A 4HMPA 4NL4H 1EP3B 1E6LA 4OXKA 4Q3LA 4BNTA 2ARKA 3PB3A 3P5BA 4LKOA 2OVFA 1G2OA 1VB5A 2CVZA 2VFAA 3N2IA 4RH1A 5D3MB 3CYFA 3EGDB 2IYFA 5AJVB 1JMVA 2ZUDA 1QF6A 3H16A 4DMHA 1ULBA 1EH5A 4IGAA 4C1NA 4EVRA 1T6BY 4A0GA 5DLYA 4F6LA 4ENPA 1BOOA 2PQMA 2OGWA 4LC0A 4DVJA 2O0LA 5EIHA 5JZOA 1SVMA 1YOVA 2BRUA 3A1UA 4PCLA 1IK4A 1QE0A 4LF4B 1O95D 2LWIA 1NUSA 3UG6A 5EHZA 3QVUA 2WAMA 4Y0AA 1C7ZA 2FPXA 5CXSA 2OHGA 2QVYX 3FDZA 3OX4A 2IUSA 4FTWA 4LBYA 4NEGA 1KC3A 2RHBA 2I67A 5G3YA 3T9FA 1N9GB 4GKVA 2CEKA 4DNOA 3WDLA 1RLJA 4D4MA 3EOAI 2QN6A 2WVJA 1F38A 1GZ5A 2HFJA 3ABZA 4RHFA 5K5EA 4RMIA 3W78A 5K8LA 4DIKA 1DEOA 2DULA 1U0EA 3O9MA 2SKCA 2GD6A 4IIEA 4F96A 2VQSA 1JQEA 3VNVA 3V5NA 1GPMA 1KF0A 3EXHA 3GNTA 3GRVA 4HF7A 4Q00A 3ICOA 4L2IB 1ODJA 2JEZA 2RGGA 2PK3A 2Q1UA 3CKMA 1JDBB 3OM1A 3KDPA 2V6BA 5LQMA 2C8JA 3IAHA 1S0UA 3FCXA 3JQ7B 3UWPA 1PK8A 3PPWA 2BM0A 2AXPA 2W0SA 3HYCA 3IAXA 4N5IX 5IN4A 5A06A 4Y9DA 4EDFA 2XCQA 3OFND 4PO8A 3UMYA 1FTWA 1OE0A 2W4QA 3CF0A 2GH1A 5JJCA 1GZ3A 3SDZA 3AG6A 3UW3A 3PC8A 5F7ZA 4ZDIA 1RXUA 5DEIA 1H69A 3NM5A 3TVYA 2ZRNA 2PNJA 3JQQA 2OK7A 4V1CI 2AL7A 5ELXA 3STTA 1XEXA 2NGRA 4I55B 3PHHA 4KAFA 3MLEA 4I5IA 1H5NA 4BMCA 1K8YB 1XMOB 1YBFA 3W2IA 1PCXA 3WJ2A 3LG2A 3GYGA 4AO8A 4BNLA 1KEKA 4RTJA 3B1JA 1JEYA 4U1RA 4PC1A 2IPOA 2WEKA 1P77A 5C51B 2UXCB 4PAQA 2VH2A 2Q8PA 2WUDA 3MJRA 1UM9A 1C4OA 1MOPA 3NU1A 3WGUA 4ZVTA 3RHSA 3AONB 1JN0A 3H4MA 4KX5A 1BW9B 2BN4A 2QTZA 2QX7A 3A27A 4KFSA 5DHQA 2O0JA 4EF4A 3IEXA 4UJ3A 3M8KA 3D3NA 2QRUA 1F0PA 4FM9A 1NVEA 2AJCA 3A3YA 3IPRA 3I2HA 4LE0A 5KOJB 3O2QB 4B6QA 3RUIA 4M49A 5FDFA 3EEBA 2HXSA 4GDMA 4EKIA 1AC5A 4TWJA 2D0OB 5DU2A 5I7WA 4MVJD 1NR1A 3S0JA 3BWEA 4XRGA 5JI3E 3PFCA 4Z4GA 4FMDB 4DY6A 5JJBA 2UDPA 4PZZA 3G5MA 3IEMA 2OUIA 2FUG6 3U80A 2Q5JA 4DLSA 2IUYA 4H0FA 1M1ZA 3UHFA 4RDHA 4JI0B 4X7RA 2YMPA 1E2IA 1MB0A 4BFTA 1UOOA 2RJ3A 4A8JB 1OB2A 2PQ2A 4ZVMA 3UH1A 1EUCB 4OA8A 3ITEA 5FUWA 2EP5A 1E60A 2OE2A 3PTZA 4M83A 4X20B 4FYHA 2JASA 3KHUA 2PX6A 4MKZA 2EFJA 3P4UA 2F7SA 2JGNA 3H5OA 4WPGA 1UBJS 1CBUA 2AX4A 4P38A 1TIKA 4P4NA 3FZGA 3ERCA 1E2UA 3BXXA 1YO6A 1V39A 4CEJA 2O8CA 5TIIA 1HQCA 3DBHA 1DC4A 1KARA 1SCAA 1XZEA 4UXIA 4BKOA 4Z7QB 2CB0A 3THRA 1XZNA 1F7VA 3L0PA 1YQ9A 1NVTA 3AOGA 1N4AA 3U3KA 5ALLA 2R0QC 1Q0UA 1M0EA 3NHAA 4ARCA 2WC1A 1QIHA 1ZXLA 1M2FA 2X0RA 4LK3A 3NMUF 6NULA 2JS7A 3VFDA 3TGPA 1N25A 3HKCA 1ORTA 1V1RA 2C5EA 2FCRA 3R6WA 3JWHA 4KPUA 4LBZA 4MH0R 4PX5A 3LHSA 4KC0A 4CIBA 3Q7QA 2PUJA 4LJ6A 2HMAA 2Z8YA 4H6XA 2FWRA 2EJWA 3A1EA 4HDNB 1TRKA 3ASYA 1EP1B 2PH7A 1TJ5A 4X0EA 3VJMA 4CTJA 3D8TA 2FPPB 5I4KA 1GKIA 1FU4A 5C3MA 1LQ2A 1T4GA 3CFYA 4DR2B 3KPWA 3NANA 3N2KB 1AMNA 3WLMA 2B61A 3BX1A 1ZGZA 4HK4A 1P29A 3RIGA 1WG8A 2HJ9A 2JGMA 5EKDA 2HLPA 1P5ZB 1RMQA 2AB0A 2QROA 4WY8A 2OZEA 5FTJA 1MV8A 4BNVA 2IYWA 5D00A 2R751 5KTKA 4BB9A 121PA 4QAQA 3T99A 3S2ZA 2E6UX 5T6MA 3UB4A 2VP0A 2EWVA 3CKKA 3LY9A 3Q6IA 4MKXA 4X7BA 3KT3A 1W52X 3JPYA 2WIFA 2VHJA 3ND5A 4NENB 1K4YA 1RABA 2RIRA 4DG5A 1LBTA 5GJVC 1SU7A 2FMUA 1OZFA 2I6FA 5LPNA 4KSCA 2X5NA 2B8NA 4Q4CA 4NBKA 3ED1A 2GPTA 4C88A 3T9BA 3ABSB 1F4LA 2XYVA 3VX4A 4DUGA 5LKAA 3ESDA 2C9YA 3NM4A 5U4QA 2LCFA 1XVAA 5AK0A 2EFHB 3OZBA 4C20A 1SC3A 4EYGA 4WLEA 4TLBA 2NU9B 3LWZA 3V7WA 5EXPA 1SG0A 2FLKA 3HUDA 2J59A 4M46A 2QMOA 3CRNA 4EJMA 1TT5A 1X1BA 3FVTA 3IHTA 3OMLA 2ZKIA 5H02A 3MJCA 2PUTA 4N0QA 4OREX 5B64A 1H9CA 5LC1A 2ISCA 3MM4A 4RZSA 4HYQA 4TTIA 1Z36A 2LTAA 4IDEA 2F17A 3KZMA 1DKQA 4JK3A 3GG2A 3RVOA 3M7IA 3QGMA 4Q3EA 1TQ8A 4DLKA 1JDJA 1W4BA 1RQXA 2X9GA 3FNRA 4K9SA 2G5CA 1Q74A 1TUEA 2JNWA 4D26A 5J2TB 5AP9A 3ANNA 3BHJA 4KXFB 2XQIA 3GB9A 1SUIA 1FVOA 3ZE0B 2GM5A 3ZOZA 4HYYA 4BFUA 4C5CA 1W87A 1KDYA 2O1XA 1F2TA 5HCUA 3F8TA 3HVKA 3TLBA 5A5VA 1CUYA 1GKKA 5ULLA 1L8LA 2PZ8A 1PFUA 3RCBA 2UU9B 2ZJYA 2DP4E 1ESDA 4GPBA 1J07A 3VI3B 4HDQB 5COAA 2C0CA 2W2MA 4MWTA 1W4CA 1U3CA 2AA3A 4JDUA 2EJUA 5JS1A 3I8OA 2MINB 4JLUA 1JSLA 2ZR0A 3DH0A 3A6ZA 5EIBC 3U3MA 5BOSA 1IY1A 2G4LA 1Q3HA 3B7GA 3ZWMA 4OUKX 4C9BA 2Q46A 2QUAA 1DX6A 3JTMA 3WGOA 4B6RA 2EYUA 2W4IA 3K5PA 4UXHA 2BR5A 3D02A 4IS2A 3JAMA 1I36A 2QP4A 3EVFA 3TOZA 5E4YA 3O5AA 2HRQA 4OIMA 4B84A 4MWDA 4YRBA 1W2GA 3LFTA 3O2JA 3NWPA 4WZBB 4P0QB 3DZHA 4EMUA 3VKHA 3NW9A 3Q98A 4DIEA 1M1YA 1OILA 3QXJA 3A4NA 2GLXA 2O1WA 1B8OA 4ZT3A 5G1NA 4BEVA 5E95A 1BMTA 1NUAA 4HH1A 4REMA 4G81A 1HPLA 2EW1A 1AS0A 3A6JA 3L49A 3TRHA 5IJ9A 1A8SA 2XUPA 4X64B 3RT7A 4CR8A 5FORA 5BYJA 1GAWA 1P60A 1ZGJA 1TEVA 2UV8A 3ZDCA 2D4AA 3L7YA 3RSFA 1TGYA 4Q34A 2XYPA 3LHDA 3K8ZA 2GESA 2BEVB 1ESMA 3KQVA 4G84A 4NZZA 2J4FA 4RY0A 5C8YA 3CLSD 1TF7A 3ML1A 3MRXA 3H97A 1UQUA 4JLJA 1C9EA 5GONF 3U7HB 3HB1A 2CVQA 3A4YA 4C2BA 2CLMB 4UHCA 1ISGA 2YXLA 1KI6A 3ANXA 1P9OA 3QVMA 1KAMA 1MTZA 3R5JA 4JQCA 2AG5A 1T2VA 3FOCA 3QEJA 4JLNA 4TKUB 2GCGA 1Z4QA 2WF5A 3PNPA 3OLYA 3HNPA 4CF7A 3M6VA 4FKZA 5ALQA 4EB3A 4WZAA 1PZFA 2R7KA 5JZBA 2Q7XA 2V7TA 5E7IA 4DB4A 2JLSA 1AHNA 2Q5QA 2B1RA 5E4FA 3CJRA 3QZUA 3UAXA 5H5JA 5AJXA 3JWGA 4JITA 4BVHA 4FNOA 4GI7A 2Y66A 1KRHA 2YRXA 2ICAA 2VJPA 3AZOA 1Y3AA 2XXAB 3REQB 3MJFA 3D1VA 3GFQA 2K4MA 3BB1A 2XNKA 3QVGA 1KYIA 3I04M 3O26A 3OTQA 1HFEL 4KMMA 4N5MA 1W36D 4PLHA 2OCGA 1W7AA 1LTKA 4BVFA 1PNVA 1JRLA 2MTBA 3PV0A 4JCOA 4YQZA 1RKBA 1HEIA 3WWPA 1JMKC 3OJEA 2QLMA 4GZ6A 5DN9A 3OQNA 4RF5A 3HXKA 3LUCA 1P62B 3NHSA 5A3QA 2PMDA 3LUDA 3TOXA 5THQA 6AT1A 2X1VA 1Y37A 4EG1A 4I9UA 3KJGA 5E9AA 3ZDBA 1UMBA 2ZIXA 1LUAA 1XAIA 1NY5A 4IHJB 4NDNE 5DIZA 3KKKA 3RJ9A 1QG0A 4WOCA 1XTBA 3RAGA 4HNQA 1PVOA 2YYZA 1Q7RA 5BQOA 1ZC3A 1SUBA 3SSAA 2UVPB 3DAOA 3LRXA 4LHEA 2W6IA 1VG0B 5G2OA 5FADA 5EEGA 2Q50A 3E82A 1E6EA 5AXCA 2ZI9A 3BIFA 3VBEA 4NCBA 2WRZA 3JZDA 4ZT2A 1D4FA 4AG5A 4LJYA 4ZPXA 3PEVA 4TXLA 4PPGA 3QVJA 4WLOA 2UZIR 5F33A 1NNSA 2CNLA 2O59A 4WESA 2Q3MA 3HGQA 2X42A 3SZGA 4KQGA 5LBTA 1P3JA 2EGHA 4CUZA 1O5TA 3KEGA 3W8FA 3B5JA 3TXAA 2J6IA 4YCNA 1XJ5A 3PLRA 2Y77A 4BV8A 1FC0A 1H8HA 4IEFB 3JAKB 4LTDA 2REOA 3H0EA 1DT3A 1VCIA 1OOEA 4H0CA 2IOFA 5FFFA 3Q0IA 4E5UA 2Y4OA 5G4KB 5IJZA 3IQXA 3KSMA 1VYTA 5DTIA 5C2JB 3H7AA 5IVIA 5CA1F 1XN1A 2EG5A 4GYWA 3FLMA 3FPAA 1X19A 2FW9A 2KLBA 1W0JA 2OFOA 1DIBA 2Q27A 4OYLA 1VKZA 4Z9AA 5FOUA 4E6EA 3UH0A 3HB5X 3RFXA 4BN0A 3OZUA 4QUKA 4C7BA 3OCXA 1OZ0A 3QIAA 4RSHA 4OAQA 3HG7A 2VDMB 3W3AH 5HFNA 2PGXA 2OGTA 3OOEA 1EIWA 1IN8A 2N3ZA 1RZ3A 3QFTA 1QGUB 3PF8A 3W2TA 3H04A 1VKJA 2V6MA 3N39C 1GPWB 1NUPA 2C1XA 4QLOA 1Y3DE 1X87A 4XQEA 3Q88A 1SB8A 4N18A 4Y6LA 4AAYA 3K6SA 2VYQA 4V0KA 1F9EA 1IAVA 1BCSB 4R01A 4CEHA 5ECWA 4OYHA 1JNYA 1NI4B 3NAGA 3R4VA 1XB2A 1G5HA 3FGNA 2GN9A 1JF8A 3IUYA 1K5DA 2A0UA 3EMBA 1B15A 3F98A 5A3SA 2ZM6B 1CR0A 3ZHZA 5I7HA 2POQX 3WLRA 1QP8A 1MJGA 4OKSA 1V5IA 2C7GA 1L1FA 1LX7A 4QOHA 2X9VA 4NMHA 5HZHA 3G1WA 3HNRA 1CVIA 5I9BA 3SX0A 2H9AA 3E70C 1IBMB 1K0UA 1DJLA 2OP0A 5EEHA 5K6AA 1Z7WA 4MI6A 5KQSA 2YZ2A 1A76A 1I7SB 2Z4TA 3HB7A 3HBFA 4G0PA 1RCUA 4C30A 4YT2A 3KB8A 2JFBA 3TI9A 1EK2A 1GYPA 1J8VA 1SXIA 4EM6A 2WHPA 2E2WA 4AMVA 2I78A 1X7HA 1WW3A 1JBEA 2QTRA 4HS9A 4FGSA 3AB8A 3AETB 4L50A 1VG1A 2IQ5A 3A2LA 5F1YA 5DP2A 4EYSA 1HE1C 1P0CA 2OGUA 4PTZA 4X3OA 3R7SA 4RGBA 3MHTA 2RHTA 1VLHA 4I8XA 3HDYA 3VR3D 4FKBA 4DCNA 5FTKA 1O54A 3X2FA 4MIOA 1NN0A 3B70A 2L18A 4HXYA 3RSHA 1G55A 3WB9A 4HNAA 4WZ6A 3ZUPA 5IBQA 5CDSA 4WFJA 3IPCA 3QVGB 1FMCA 2F1KA 1Z82A 2ZQYA 3U81A 2FSIA 3ECCA 4K7JA 5GAJA 1ATZA 4AMBA 3IPLA 3ZEIA 1PZXA 3JASA 1FCJA 4AQ7A 2AYXA 3DE5X 1ICIA 1JAIA 3WKBA 4ZEVA 5AW3A 3RFTA 3WK7A 2KQUA 4TM7A 5AQEA 5NULA 4UARA 1E62A 3H1EA 3OCVA 1MP0A 4BFLA 4B3RB 1JU9A 4QJIA 1N5IA 4HAYA 1FRFS 1N2IA 3DXXA 4MW6A 5DYTA 4DQUA 4N6OA 2XODA 1HXHA 1R8SA 1X74A 2ZJ2A 4IM7A 1E7MA 4F5DA 1OGJA 3O7WA 2QTBA 2X0EA 4ETWA 1RWKA 2WMNB 5J40A 2VPQA 4JEUA 4PNHA 3R7AA 3WQHA 1U0FA 2ZR9A 4E07A 1FSGA 1J2TA 5AVSA 1SZDA 5M34A 2IHUA 4QTUB 4HAOA 5TPZA 1LBHA 4U5QA 3WJAA 1NW8A 2GRJA 4ZDWA 4B3FX 4D41A 4C1BA 4AG6A 2Y8EA 1TPYA 4FGWA 1XZIA 3VSCA 1PJSA 2GFHA 4ZOLB 1V3TA 2WHRA 2DR3A 2BUBA 3LCMA 2PD6A 1SRRA 4NCKA 1JHPA 3OFSA 2ZBUA 4UQOA 1G6Q1 2Z2JA 3HL4A 4JZYA 5LQNA 3DXYA 3O2SB 3QX7A 5IWAB 2IS4A 4DR1B 1CY2A 1MRZA 4M1TA 1WY5A 2FYTA 4X97A 2P65A 3MUFA 3V42A 1N32B 1XRPA 3K9FC 3R6DA 3C2QA 3V2IA 5FNVA 1B23P 1YRWA 1KBOA 5EJEA 5A2QA 3FNEA 1AE1A 1NVBA 1ISPA 1IXRC 2OZPA 2RAFA 3WBKA 4KN6A 1R0SA 2JC3A 5IJAA 4MVXA 1T8WA 4IQFA 1KY2A 1YXMA 1DT5A 4KDRA 4ZCIA 3GEIA 3ZY3A 3CT4A 5ALSA 3RVKA 1E2BA 1ZL2A 2ES4A 2NTYC 3M3HA 1BQ3A 2HA3A 4ZN6A 4JYZA 1DUSA 1SH7A 1IVNA 2X4DA 1I3OA 2ZYVX 3Q6MA 3GJSA 2RG1A 5TQ2B 2J5BA 3IE0A 4GBMA 2ZS7A 4L07A 4EB6B 4CEIB 1G2QA 4DMGA 3K72B 3SM9A 5FOTA 5FKJA 3T9DA 1ORDA 1CYEA 2XX3A 5T4EA 1A5AB 1KXJA 2L17A 4BQIA 4ZGWA 4G65A 1XZCA 1XP5A 2RI6A 3I09A 3M3PA 1URPA 4J1TA 4YJ3F 5G0WA 3U4HA 4LF5B 5CHYA 2H54A 2I76A 5DOVA 5EJ2A 5DGTA 4EY4A 2VKQA 3Q41A 4QO8A 2C3YA 1VB3A 5I7UA 4B48A 3E23A 3EWAA 1Y9EA 4JL8A 2EDCA 1K7FB 2ADOA 1UZAA 3R3HA 3QEMA 2IDMA 4X6UA 3RHFA 3WFJA 5HKAA 3HV2A 4CMEC 2P6MA 3DTNA 1FFXB 4H3HB 1A7JA 4D97A 5T3UA 3DT8A 5CK4A 5ICGA 3VTKA 4IJQA 1Z37A 2GZ3A 2OYSA 1UWCA 3AP1A 3RREA 5KZMB 2C2WA 3AZPA 3PENA 1WSWA 1P9RA 3M4JA 2C8LA 3Q2OA 2REQB 2BEVA 3IFSA 2BZ0A 2FF7A 1KP9A 1G5TA 3DE6X 3MLBA 3NFYA 5K0BA 2WP8J 3BC1A 3GZNB 3L5OA 4CE6A 5C1IA 3GNSA 3UMRA 1V5WA 5EFZA 5A1TA 2YV1A 4FGLA 1NAIA 4JENA 4DIUA 1T5IA 1VLLA 4NMMA 1I3LA 4BO1A 3Q8KA 4FI3C 4RS3A 5CCEA 3R0IA 4LK2A 4Y6SA 3N0TA 1NUUA 3AR3A 1MO2A 2WQ7A 1QNFA 1V4VA 1VYHA 1W5SA 1VM6A 3O3NB 4DJDC 1CEEA 1ZEJA 3DV9A 4M6WB 5JAZA 2DWQA 1LCIA 3DLPX 1UC8A 2R6R1 3R0VA 1XTVA 4M89A 4UD6A 4KV7A 2H17A 1DO8A 2Q2QA 2RJOA 3HVUA 2HR1A 4W7HA 2C5GA 3H2SA 4ETNA 5ABPA 4B7CA 3SE0A 1JSXA 2YBDA 5IYZB 2AOVA 3BWVA 5JEDA 3IBFA 5FNVF 4G5XA 2JJ8A 4O25A 2BFDB 1WHTA 4TUYF 4M21A 1BROA 1P81A 5A6SA 2VIIA 3D6UA 3EF3A 3WLQA 5ESXA 5KYNA 2WB2A 1V3QE 3DL2A 4OBBA 4HDRA 4Q9HA 2W6MA 2NPFA 3TD9A 1P1RA 3EG5A 4IH1A 2XTNA 1QZ3A 4ARUA 3AVVA 1M33A 1V4BA 4WUTA 1ZCJA 4F3RA 2N1BA 3G8YA 3QEOA 3VNQA 3BREA 4CV3A 1I9GA 4A10A 4BJ6A 4DIMA 2O7VA 4KTVE 2ZRPA 4R0NA 1RJEA 3RFCA 3T5MA 2A92A 5KNDA 1KO1A 2NUPB 2O2CA 2XIJA 4CEJB 3W6OA 1FP1D 2QDXA 2QIOA 1AJEA 3B7PA 1ZYUA 3C8DA 5J23A 1PWXA 4BUCA 4YRDA 1BGXT 1U3GA 4IEIA 2ATCA 2V6GA 3DMHA 4JA0A 3QQ5A 1H2FA 4H4EA 4NPAA 1BHSA 4R6XA 1FFWA 4JVNA 5UKDA 4JLVA 4RJJA 1HQDA 4G8BA 1H1TA 5EXXA 3S27A 3DL7A 1KI4A 4A2PA 4PONA 5JY6A 1SPBS 3IDFA 4A15A 4EG8A 3GZTB 1RAFA 3KHKA 4IDDA 1GAXA 2QN7A 1MO5A 1SA0A 4NVRA 4EZEA 3CB4A 3ESXA 3UKDA 2O2ZA 1FJ2A 2UAGA 4FLMA 1W9HA 3TNYA 2ENWA 4QGFA 5TMPA 4MUKA 3C1UA 5DASA 5DTMA 2RBEA 4DIFA 2F9LA 2PKCA 3NHWA 4TL9A 5DYYA 3VX3A 3IMEA 4PN3A 5FHRA 5L7WA 1STOA 3NJ4A 2W2KB 5BSMA 4DCMA 1PJRA 3R09A 3KX2A 5ARDA 2GK3A 3EQ6A 3EUFA 3IQFA 4C0LA 3L8ZA 4P4TA 2YDXA 1AKMA 3S1AB 2XE4A 2BFCB 5AM4A 4BFSA 1V9LA 5KTMA 2VDLB 3COWA 4ZMBA 2VRCA 3ZY6A 4BFZA 1T4CA 4BNIA 1POWA 2XMBA 4LTMA 3R0JA 1JFVA 1F7UA 4MUMA 2JI9A 3G2HA 1C4WA 1UP7A 1PAUA 2BE9A 4OSEA 5E1BA 2VDWB 2W11A 3O8LA 1G8AA 1Z7GA 1US8A 1LZKA 3ANTA 4M37A 3AJDA 3H6GA 2QTFA 3IYLW 4P8RA 3V80A 4B35A 3PKJA 1IDN1 1QBKC 1N3IA 2Z1NA 4CTKA 4NQZA 1UBEA 1EFVA 2HWXA 3CZMA 1GQRA 3CUYA 4MR7A 2B34A 3GLHA 3MWJA 5LA6B 4CKZA 5IXSA 1C4KA 3Q3VA 2A5JA 2YWXA 3W4IA 4GI3A 3ZDQA 2H8KA 1MABA 3QE0A 3W3AA 4L4ZA 2R6GA 2SCUB 5DNEA 4F3CA 4GKKB 1TD9A 4RVHA 3IXLA 1N1DA 1NVXQ 1VOTA 2GPWA 3O84A 2PYIA 3ORFA 4OFBA 3SHTA 1KZ1A 1H2YA 4MIYA 3E0XA 5G1OA 2UXBB 2ZWIA 3HZRA 4G5HA 1BKDR 1V6SA 4Q1BA 2VAMA 4X8OA 2VG8A 1NXPA 2YXEA 5IFLA 4RM2A 1Y3IA 1RMYA 2XUHA 4FNMA 3R9KA 2BH9A 2P2GA 4ESEA 2FMXA 2GR9A 2JCVA 3BEDA 3UHJA 3DKRA 4NMXB 1TLTA 1X7XA 1I5OA 3DLTA 6REQB 1GM5A 2NYUA 5DHAA 3WBBA 1ZCZA 1ZUNA 2WE8A 2ZRCA 2A9QA 3IMKA 3EC1A 4DMCA 1NX6A 4W8OA 2R2AA 4Q9IA 2Z98A 3ZDDA 3QY0A 2WA1A 1Q3TA 2NP7A 4KREA 3FPKA 3VYSB 4EENA 4CR6A 2P6OA 1JQLB 3FMOB 3MYRA 3RSSA 1EM6A 1EJ6A 1NW5A 1XG5A 3WRYA 5B4UA 1A8QA 2F3RA 3WR5A 2VJDA 1SC4A 3IVGA 3PQ8A 3LT2A 3LT4A 5AW5A 1ZQ9A 3IAUA 4KB5A 5J47A 4K87A 3CIFA 3EASA 4WXHA 1Q1BA 3LQRA 4CMAA 5IAKA 4DSUA 3OE4A 1NG1A 4MZDA 1B14A 1D6MA 3E22B 4RMNA 4P7BA 3MN1A 4IIGA 1BE1A 4O4HA 2V4ZA 2ZBDA 2WM9B 1GN9A 1H6CA 2VF8A 2J6HA 4G1CA 4IFIA 4IOJA 4PRYA 4TMWA 1UBMS 4RIEA 3ZNPA 2Q49A 2CHEA 1QGZA 1L7DA 2XUJA 3JYOA 4QSHA 4K86A 4WINA 5BOVA 3BVPA 3R7FA 1SVWA 2X22A 4MW1A 5HMLA 1DIHA 1CSEE 1L7OA 1DRKA 1V11B 4LSZA 2V6IA 1MA3A 1PTJA 1C1DB 4I66A 3I2KA 1JP7A 5BN4B 1U0JA 4MEJA 3A10A 3AFOA 2WJ6A 2EW2A 3K9BA 2VJQA 3OIGA 4IDPA 5ADVA 1A2OA 3L0BA 4R2KA 3WS7A 1NN5A 2DKFA 2O8BB 3PVZA 1U7WA 2Y0EA 2PIDA 1SVKA 1YDHA 3UK7A 4RQUA 2WJGA 3JARB 2GPNA 1WKCA 2JIZA 1ZRHA 3D0OA 2QD5A 5DGCA 1JILA 1FE8A 3MUOA 3MSCA 4Q3CA 3S8EA 4XVCA 2HHHB 4AZ3B 1LDEA 2NAPA 2ZSJA 1KIMA 1M5TA 1XMVA 2V3VA 3LBFA 5AOBA 4E3WA 4I99A 5I9IA 3BRSA 1HE2A 5C4GB 3RVQA 1U3DA 2C94A 4EJ6A 4G0NA 3O3OB 4AJ4A 1JMYA 3I1YA 3OJXA 4G0MA 2D8MA 5HDBB 5J4VA 1MTOA 2D8AA 1USGA 4LJ7A 2AJTA 4OAPA 1QCZA 2ZRKA 3DOIA 3E6AA 4M53A 1L5RA 2PAAA 1JEOA 2I2FA 1H2XA 3HGMA 1IEVA 1U7PA 4BLRA 4IUYA 3PHGA 3LE8A 4NYMQ 3VO1A 4OI1A 1E2DA 4OVKA 2B4TO 3DE3X 3FDXA 4IRMA 4LWZA 1ZOIA 1D4AA 4U6NA 1F14A 4MVJG 5PNTA 1SG6A 4L08A 4DWVA 2F3QA 3DMGA 1R8XA 3BB3A 1BJKA 2E48A 1X7ZA 4LTNA 4AP6A 4MRAA 3QFSA 2QN1A 3ZHCA 4ZCTA 1DEKA 2ZQZA 1ZUNB 3D7RA 2WKRA 3M2TA 4HWPA 4LE2A 1P2SA 4BWVA 1G7SA 3L79A 5DTQA 4LJRA 4BVKA 4IKPA 3OT5A 5TGTA 4Z9XA 1O8CA 3LJKA 2JAPA 2PZGA 3GCZA 5DB4A 4ZOBA 3ZH9B 1OYVA 5CDHA 3A1SA 3A9SA 2R4TA 1ZK3A 2C9MA 1QOZA 1PV2A 2FEXA 4QFCA 1G5QA 2XB4A 1DWOA 1NVFA 1VHLA 3DAGA 4BX9A 4ALJA 2VUTA 3GELA 5JV5A 4OFZA 3RRYA 4E12A 5CJPA 1WLSA 4FT2A 4NFHA 4GGPA 2Q9AA 4JI1B 4I55F 3OIYA 1C41A 2Z8ZA 1T9GS 3I6ZA 2WLSA 1I1HA 1JR3E 2HBZA 1U6KA 3IQEA 3OO0A 4KCGA 4U8HA 5FYDA 1Q5PA 1U8YA 3CS3A 4C03A 4CDMA 1PT7A 3ELWA 3QUQA 1ZM3A 3N6RA 1H8ED 3IIJA 4X61A 1MR3F 2QT0A 3FZQA 4GI5A 1A5TA 5K03A 2OFWA 2XUKA 2PCJA 4PCUA 3AYXB 4HAVA 1O8BA 1VI6A 3OF5A 4I1SA 1L5OA 5ALKA 4A2CA 5KWJA 5BQPA 3OLXA 3RRXA 3JQPA 1R0XA 2HA6A 2ZRGA 5CIYA 2Z9CA 1DWQA 1JI3A 1OU0A 1D0VA 2PBRA 3BGVA 3JSAA 4PPFA 5H3HA 1VL5A 3L40A 3T1NA 4BYGA 2PL1A 3UHPA 1I9CA 2HZ7A 3GW8A 1JHVA 2VI5A 4HYTA 1KVRA 4F3NA 4G01B 5FAKA 3USES 1RM4A 1J23A 4HZIA 3V7YA 5HZKA 4IHQA 1GSIA 1X7YB 4YJ2A 3UPDA 5EIAA 4MQEB 4XGKA 2WTXA 3GPIA 5EVCA 3TLMA 1CZOA 5KVAA 1X0VA 3BXZA 4X95A 2JKVA 4C43A 2RE8A 4FBGA 3L7IA 4UVGA 1AH2A 4HEQA 2NN3C 4HT3B 3A9RA 2XUQA 3UHOA 2JCXA 2Q5LA 3LLMA 3NHZA 1JT2A 1ZW6A 1P8JA 3K4PA 1NP3A 3RIYA 4XKJA 4BKRA 3DLBA 1YB5A 2Z57A 2HCJB 5HG0A 3JQEA 3P32A 4O0LA 3AKZA 3T54A 5CDUA 2EF1A 1ZK1A 5BR7A 4FZ3A 3COVA 4E2FA 2PWPA 1V5FA 5BV8A 5CVTA 2H3HA 1I3KA 2P90A 4EYEA 2P1RA 1FYXA 3R8FA 1DE0A 1JDVA 4S24A 3STHA 3ENQA 4CLRB 1Q77A 3T38A 2ZT6A 4JXXA 4FFPA 4OI2A 4HGZA 3KSAC 1OV6A 1EXDA 3ZCQA 5EQJB 1B1CA 2EC5A 4U9HS 2WSMA 2WICA 3U3OA 1N2CA 3QEAZ 2X9LA 4C0BA 3ESQA 4LQCA 1QHNA 4L78A 1MJFA 3AEKA 3H1FA 3P20A 3AP2A 4QQFA 3L41A 4JLDA 4QDOA 4TRJA 3LCVB 1B1AA 4LZLA 7ABPA 3AI7A 3ORHA 1IN4A 4MJXA 2HQRA 3DO6A 4J16A 4TKVB 4RPJA 4BNDA 2YUIA 3E7WA 5COQA 3ZHSA 1U04A 5IBPA 4N8SA 5LUAA 4OP3A 1HLDA 4UUQA 4KQWA 5KUTA 1G5FA 4H7IA 3FMIA 1R0LA 1K4KA 1VMIA 3FOAA 4J0DA 4ZAGA 1BQ4A 2NTJA 1ZD5A 3IHKA 4NYIR 2NUTA 3I9V6 1K75A 1BGWA 3ILHA 2W37A 1TKRA 1OZAA 3IT1A 4DA6A 3MRTA 3GT3A 1XYGA 2RIPA 3U4QB 1Z2NX 1G1MA 4RHUA 3V46A 4DV6B 1Q19A 1Y1SA 1LWNA 3I6IA 1KPGA 2DKNA 3HJUA 2QJTA 5B2ZA 1E1RD 2IZ5A 2RBKA 4F4CA 1CYDA 2W6ID 4PBRA 1S2LA 2NXJA 1E0JA 1QBGA 3TD2A 5JDIA 2XECA 1DDIA 3RYCB 1GDDA 3HJGA 2EF0A 3NM6B 1LNZA 1B2RA 1X80A 1UXJA 3BA1A 2OZLA 3BDVA 4PYOA 1LD3A 3K5WA 5H7XA 1F2DA 3DSRA 2PH5A 4YMHA 2JRCA 2QZ9A 3DONA 1YB7A 4JYCA 5H8WA 1Y82A 1QZTA 5JJLA 2IF0A 1RZRD 1L4EA 1OSNA 4KPEC 1Y7TA 3S3TA 4DKXA 2HFKA 4MWCA 4WSOA 5KDOA 1USKA 5AVOA 3R3YA 2WD8A 4UDOA 5KYVA 2Q6OA 3QG5A 4AJ2A 4DRXA 3WDKA 1G8GA 2GVDC 1QYVA 3N70A 4XIGS 2NXCA 4ZO9A 3TLEA 3VJLA 5IKOA 4EDHA 1BAPA 4DLUA 3G8CA 3K1AB 3V8QA 3FVRA 3JALA 2GPBA 5ITVA 1DJPA 4KXVA 3IJ5A 4AJEA 2H9YA 5C7IO 2YJ3A 1OLOA 3LKBA 3UB3A 1ZJ6A 4CVNA 1Y98A 1A69A 2HDOA 2BGRA 4HQ6A 4L73A 4UZSA 1R2QA 2C84A 2HA4A 3ZW9A 5JRJA 4AQYB 2PX3A 4TKZA 3W5JA 4GT1A 1IPFA 2PL3A 3IRVA 5GZ3A 4JYAB 4HWSA 1UT8A 3H9CA 4BX8A 4D4GA 2AR7A 2HF7A 2J9XB 2OHFA 2P2YA 3E61A 4JMLA 1Q7TA 4M7RA 3NVMB 4O1IA 3MTQA 5FOWA 3TOVA 1BDIA 5K01A 1QTQA 1GUYA 1O57A 4FC7A 1WQ4A 2PMBA 1P1CA 2WYIA 3CG0A 3EZ6A 5B1IA 2BP7B 3OEEA 1CUVA 2YBEA 1MT0A 3MBIA 5IMBA 2GILA 2EYQA 1DZ3A 1RWVA 1W0CA 3A3PA 3QPAA 5T6BA 3WV5A 4EEKA 1KRWA 1PT8A 1SWVA 2QR2A 3N8HA 4DDHA 3WLJA 1MNAA 3FG9A 1G0OA 3N7AA 4K81B 3JZIA 1AXEA 4LDAA 4QNMA 3VMFA 4GDFA 4X1KB 3OD5A 3QJGA 5MGNA 2QZPA 1M73E 3WWCA 4KDFA 4R71A 4A3SA 2PS1A 4BZPA 3QF7A 1TVCA 3B7WA 2JB9A 3LC7O 4EY3A 1OFTA 4BU0A 1PNQA 4H7DA 5JD5A 1BMQA 4F0JA 1QP7A 4KMSA 3KZVA 4X1IA 5GADl 2XKKA 1U8UA 2GTHA 2TECE 3FNFA 4H7JA 4I8DA 3TQTA 4Y2GA 2IYSA 2GZRA 2V7VA 2HBYA 2PDAA 4BKMA 3LH5A 1QB7A 4MIEA 4GF5A 1R88A 2AGVA 2NU7B 1A8IA 4Y2UA 5CUQA 5CFZA 1OGYA 2J0VA 1S3FA 2X76A 3BD8A 2HSEA 4AWXA 2FZCA 2G72A 1LH0A 4WKNA 1G291 2W2NA 4I1VA 3WL4A 1KIAA 3DOUA 2PY6A 3WIUA 4MB6A 3PGVA 2QQ5A 5CTJA 4WL0A 4YAIA 1IN1A 5FXMA 3R6TA 1HZJA 1XDSA 2JLQA 2Y67A 2ZETA 3NEAA 3ZS8A 5IG2A 1ZI9A 4RPIA 2D7CA 3PX2A 1XELA 4G24A 4HUQA 5D5HA 5GTDA 2F00A 2Z1MA 3H0CA 4DZTA 1UZNA 3NGLA 1HT0A 1J1ZA 5DI3A 1HRKA 3H99A 4EPXA 1E66A 4C6RA 4H2DA 4Q18A 3G1UA 2ZB8A 5HF5A 3WLNA 2EIXA 3MZ0A 4EQ6B 3IAM6 5CBPA 5LJLA 1XQ9A 1XX6A 1ZNQO 1SXJE 4A1FA 1JQBA 4OQPA 4UQLA 1KI3A 3ZK8A 4L4RA 4F60A 2OHXA 3DBVO 4NCJA 5HKKD 1JXAA 1Q50A 3WGNA 3JQGA 2GXAA 1HQYE 4DRYA 5I7SA 5LP6A 1GPJA 3EFOB 4TTJA 2R25B 5JVDF 4TS3A 1WSDA 1TZJA 2CEAA 2LE0A 5F73A 2PCLA 2WY2D 4JVLA 4TSFD 4LY0A 1J0AA 4QWMA 1PEYA 3H9QA 2H1OA 4XTCS 1FNBA 1OT3A 1GTMA 4ABYA 2XUDA 1XEXB 4KYTA 2AQIA 2XMPA 5FLYA 1N36B 3RUEA 4U00A 1GARA 3R24A 2HMWA 1U9IA 3M49A 2HA5A 4JXZA 4ND8A 1YACA 2YHAA 3DFFA 4DF3A 4RE6A 4I4TF 4RHEA 4RKYA 2I1LA 2OG2A 2Q6TA 1E1DA 2BW0A 1AOXA 5EJMA 4X44A 4UE6A 4LV5B 5TPZD 1I6KA 1OIWA 2HX1A 1I6LA 3GJYA 1HI9A 1VE6A 3KYDB 4PGFA 4GPIB 4RYLA 4ENUA 1FS5A 2ZIZA 2BFEA 1GQYA 4FBLA 4ZYWA 1YT5A 5KNBH 3B1XA 4HNGA 2RGYA 1NYRA 4MPDA 1W75A 4NCXA 2JGDB 4OHVA 2J7PD 4G25A 3KK0A 2JA1A 3C7CB 3WL7A 2C2GA 3FMPB 3AO0B 3SOPA 4F1JA 4IP0A 5IJ9B 2BTEA 1TU0A 3FPBA 1TTHA 3M6MD 1Y8ZA 3AEXA 1Q12A 4PG5A 4Z49A 2B4RO 2A0XA 3ELYA 4JASB 2GAJA 2P77A 1QMPA 2ZDHA 3E1KA 3EVCA 2L42A 3KEOA 4IXNA 4AN1A 2GLUA 1P2TA 3GIWA 4W9RA 1ZUD1 3O1JC 4MAAA 3WGQA 4ZZ3A 5TGZA 3UJ6A 1I1QB 1XQ6A 1OKKD 3AL0C 3AUYA 4QYWA 4LMAA 3AYZB 1BDMA 3RIMA 3EZXA 2JA2A 2X0KA 4WLUA 3EXAA 2FDRA 1FYDA 2GXSA 2IKSA 1LZLA 3WHLA 1XZQA 5E1DA 1TB4A 5LJIA 4GSYA 2Q3CA 2BFBA 4OM7A 2P9QA 5IDYA 1ELOA 5EYPB 1GY8A 3ZXXA 1T8PA 1DZIA 2ZITA 2C9BA 5G4LA 4GPAA 3VM6A 3WQSB 2G67A 3E58A 4BO5A 1YHYA 2C54A 1E18A 1IUKA 3PT5A 2NYRA 4RFLA 1L7QA 3S81A 2PVPA 2IS1A 4IAOA 3QPWA 3V4VB 2FZGA 3LSYA 1OX4A 3PX3A 1DP4A 1EWKA 2PFSA 4LZAA 4ZT5A 3SLKA 3T61A 5HQ3B 2AWNA 4WBNF 3QU2A 4BNGA 5LQJA 4Z0NA 2HYDA 1QFYA 2ZR8A 3EARA 4LI0A 3G8DA 2NTVA 4ZAWA 3KWJA 2C9CA 3N3AC 3ZV6A 3DTVA 1SUFA 2V7QD 3G0IA 4A2QA 1J0XO 1OHHA 4DQXA 3ZU6A 3OOWA 2GHIA 1XQYA 1U2GA 1JEQB 3KLPX 5KJCA 1JZQA 3SF8B 4NBUA 1FYWA 4EPTA 5HXAA 2FGJA 3H3FA 3VQTA 2GUWA 2VK8A 2CCKA 3CR8A 5EGNA 1JYEA 2X3UA 3ZE2B 4A0QA 3QOWA 1WCV1 1DQYA 4U7PB 4JI3B 3WMRA 2VSQA 3IKMB 3OZSA 3WWZA 1KFEB 3ZWNA 2XMSA 4QJ5A 5JG7A 1TQ2A 3HO1A 1SBTA 1WABA 4JROA 1P7PA 2JI6A 3WGGA 4OHMA 4ZOAA 3SJBA 2JLRA 2ZIVB 3AIOA 3FCYA 1QC5A 5E3IA 1DMRA 3AG5A 2FX5A 1HSZA 1DC6A 3UW1A 4RX1A 2OCXA 3OAAD 5EAIA 3ZHUA 4BIMA 2OCLA 2GN0A 5CRIA 3NWJA 3U3ZA 2CY0A 5IMSA 2ZREA 2LV8A 3EWIA 4M8IA 1FRNA 3D8SA 3EBOA 4Y2JA 1OC4A 2PRJA 4JLKA 3QVKA 3VGJA 4A03A 5JMTA 1VI5A 1DOZA 4JJ8A 4ZTZB 2DQKA 3QY9A 1KFKB 3WLEA 1RYNA 1V6AA 2F3UA 2AE1A 2CZCA 3SI7A 2WG1A 4YV7A 5MFZA 1H2BA 2IPNA 3VSDA 1T6NA 3NBZC 5IKPA 1EDOA 4BCBA 2CZGA 4X54A 3NIDB 1HLGA 5T8KC 3ZN2A 3UWDA 5C8XA 3O38A 2RHMA 4D45A 2I8LA 2H92A 5SYNA 2PS3A 2FI1A 2NT4A 1ZGBA 4NNOA 5DVZA 3EA5A 1DKPA 4O2AF 5L9AA 2WTBA 1DAPA 3MTEA 4OP1A 4O4LA 1EVYA 3I23A 4HVTA 1DBWA 3U1VA 3M4YA 3C39A 3KTDA 3VZRA 2X86A 4GO1A 2H00A 2ZRFA 2PWYA 4NI5A 3EH2A 3H1AA 1S4QA 3B60A 3VO8A 5HWSA 3BK1A 4UUOA 4Q3BA 5LYJA 4XB1A 3DAFA 2N46A 2XDYA 4LHVA 1ZJZA 1N3BA 4YRIA 2EZ8A 5CB4B 2JLBA 2J3KA 1L1QA 3MGCA 4LS3A 3DEHA 5H4GA 5EUQB 3I32A 1JJIA 1YJ5A 5FQOA 1A98A 5CB8A 1N8NA 1UMCB 4UHFA 4RY8A 1HYQA 1IL0A 1HDIA 1W49A 4YB8A 5DN6D 5AKEA 5J43A 4IX1A 1EESA 2ECKA 4AF6A 1QQ6A 3LC1O 3WDMA 2D2FA 2QW1A 4EA9A 2I0FA 2YASA 3G5LA 3UZUA 3GT0A 4L0DA 4P58A 4CRWB 5CDTA 5A2GA 2QVGA 4G4SP 2P7IA 3U61B 3KE8A 2UUAB 2QSYA 4Z0TA 3PWZA 5IAEA 1XFAA 1DWPA 3MWFA 4YJGA 2MSDB 4B71A 1P9LA 3L7NA 2WVAA 3DO5A 4HGNA 4DRXB 3FGZA 1AUQA 3LCRA 5DYGA 3W9SA 3RYIA 1E6MA 2RHGB 3JRWA 4FWIB 3QKTA 4ASUD 4GL4A 2R7AA 2FPKA 1L8QA 4EHLA 2K2WA 1Z5GA 1PG2A 2YOGA 2FETA 1N3LA 2XEXA 1L4MA 3AKCA 1JAXA 3FYUB 4JJZA 4Q7QA 1FJGB 4ZKDA 3C45A 5B58T 1ZVJA 4IIVA 1SVNA 1Z7BA 1EWRA 2GD1O 1CRQA 2QXYA 4ITUA 1HDYA 1H0HA 2A5DA 2IT1A 2XNDA 4MKIA 3X1JA 3D3WA 3HB9A 3LXUX 1SHUX 4CLOB 1RYHA 4R84A 4QDXA 1SKAA 1BXGB 2J9FA 2OOKA 4C7KA 5I9NA 1AHPA 1O6BA 1UBCA 1PTKA 3AF2A 3BSSA 4WASA 4RKRA 4WVFA 2VYND 4CLRA 4EELA 4JIMA 3KUKA 2DERA 4OL0A 4Q3KA 1FFAA 3RC3A 2A84A 3LWDA 4C2TA 1IOLA 5FPKA 1P2VA 2ZE5A 2VKTA 2X5OA 4UHDA 4XFJA 3NWEA 5KU7A 4Q4HB 2XCUA 3JZMA 3LLUA 3D4LA 3GA0A 3SZOA 3G2QA 1KQ3A 4I5FA 2KS6A 5LMNB 4OHPA 3QVLA 3AVUA 4L16A 3OCZA 3IKJA 5FR2A 2TMKA 1YJ8A 2UUOA 1LVGA 4WFKA 3LK7A 3T1HB 2X7HA 1UK6A 5LQAA 2H4FA 4OOFA 3R23A 4BCCA 1KFCB 1GRVA 3GVIA 3IHWA 5TF0A 3TK1A 2GBCA 5F76A 4OQQA 4ROSA 4QEDA 1ULUA 4URHA 1C9KA 3SYMA 5J4HA 1HDZA 4JP2A 4BN4A 5EXDA 1IRIA 3LXXA 1LDGA 1U8AA 1U2RA 1YFZA 4J76A 4MICA 5FUXA 1HH4A 1XVTA 2PS9A 5HJ7A 4KR7A 5T57A 3G9QA 1MF7A 1SY7A 4G0XA 2F8MA 4HNRA 2JD0A 5IVHA 3H2YA 3SBEA 4OF4A 4JJ7A 4S1TA 1A50B 2Z2ZA 3AH8A 5CVJA 1XTQA 3AUKA 3SXPA 4X8MA 2AVNA 3U3RA 5LUBA 1J39A 2EZTA 5KTRA 3DNPA 2AE2A 3EGXB 5ALRA 3R5SA 1SKUA 4EB6A 1QJCA 1IMOA 1TCUA 4LDNA 5AJUA 4C89A 4DBLE 5AM2A 2PZJA 2NV2B 3VTZA 1C1XB 2FGKA 3NH9A 3P8ZA 1SXJC 4D80A 4LNHA 2QYOA 1EM8A 2MYUA 1RLTA 3V8NA 1E9EA 3U56A 2GN8A 3OKAA 4FN4A 4N01A 1WTAA 2QJWA 1AZTA 3GFTA 3BMCA 2IU3A 4N47A 4TX1A 2WOOA 2XOKD 3JAWA 3B20A 2NZ2A 3ASUA 1G19A 2OYRA 1QHSA 5I51A 2QEQA 3A31A 4YAOA 1WVGA 3U49A 3QJ5A 3L2OB 4M76B 4YJ2B 1MIOB 1JR4A 4B2YA 5BN5A 3W06A 3M4XA 1OWLA 5HKKA 3CO0S 4I50A 1BVRA 1AGRA 3I6QA 2QRVB 5AM5A 1L5MA 4WNAB 4MA0A 4QPNA 2WV9A 2VDNB 2XA9A 3HBLA 4WZZA 1OROA 1GRRA 1P5RA 1X8KA 3EIUA 2A9RA 2NYVA 4LJAA 1HQKA 4WADA 1JLRA 2HIMA 1Z5PA 5JLAA 4DT1B 3ADDA 3IT3A 1DSSG 2W2LD 2WJ3A 2XWBF 4MPTA 4PQRA 3R7BA 3FUXA 2Y1XA 4MCHA 3IUSA 4YIKA 4HMOA 2JK0A 2IS6A 1N2OA 5BQ5A 1WIWA 2HDNB 4YASA 5KU1A 1CR1A 4RIHA 5IM4A 1NVKA 4AI6A 2H16A 4AD8A 4P53A 3TNFA 5K51A 5HJ5A 3HE3A 4XUEA 4IPTA 2VK1A 1AXRA 3TZ6A 1TLFA 1YZVA 3NC1C 1K9VF 2C96A 2HI0A 2QBYA 2WJJA 3ADPA 4U7JA 4MX8A 4IXDA 4JOBA 1U1CA 1V26A 5TF4A 5U4XA 1QKJA 4DPMA 1HFJA 4EUNA 1KRXA 5H70A 2WSIA 5TEVA 2FMIA 2VPWA 3CRZA 3VNAA 3ZHRA 3F4BA 2CSUA 1TYCA 4JJGA 4XM2A 3NIFB 5JSKA 2V7GA 5LZ2A 1WP9A 3KG2A 2JPDA 4XJXA 5IFKA 5MN6A 3ABIA 3JQ8B 4PN7A 4DXHA 3PDWA 1ECBA 2B0JA 1IIBA 5T41A 4R83A 2TS1A 5I7EA 4B6JA 1SQ6A 2FZ5A 3NP9A 5CA0A 2FSPA 4LHZA 4PY2A 5HM6A 1B8PA 4GOKA 3LLSA 2OD9A 1O6GA 2JBHA 3TM4A 2IH4A 4LG1A 3KP1A 2GWRA 3BFXA 3H5LA 3QXHA 1Z45A 4Y6PA 5CB4F 1L7BA 2YOHA 3SDSA 1KGDA 2H06A 1T4BA 1RQGA 2WKQA 3JVVA 3T7IA 4BLPA 4DLBA 1JKIA 1LJUA 3EXHB 4YCAA 1HOXA 4CG0A 3WHIA 2AEEA 2BLNA 3P9NA 1FDIA 1BMFD 1RADA 2JF0A 2IYZA 3GJXC 5J5VA 3TTXA 2G88A 4IY1A 3U4IA 2BSQA 4FMPA 3OIDA 5KWVA 4HZGA 1E61A 5KNCH 3DZJA 3P0JA 3AU8A 3ZWPA 5GONB 1PS8A 4YBRA 5E6UB 1E7RA 1QH0A 1T8UA 4GBED 5ICSA 2BC9A 4N49A 1U94A 4AZ3A 2VUIB 5LQDA 3FOFC 1LPOA 1CVRA 1AQ6A 3GLGE 1Y9DA 1C1HA 2ZSAA 2CBXA 4I55A 4FEEA 5TMDA 3W7BA 2XNDD 5HIJA 4F4FA 3DW3X 4UW9A 1NC1A 1IMJA 3W9UA 4CIDA 4R7TA 1N7GA 1NLYA 1UZUA 3PBKA 3OPXA 4KGXA 2F62A 4X94A 2ZS9A 1XCJA 4US2R 3SK0A 5L3SB 2LIPA 2P78A 3C97A 3FDJA 1HE8B 4L6CA 4EYOA 4H3VA 2UZ3A 1MAVA 2WIGA 1X1TA 2WTNA 3IP9A 1UINA 3MB8A 3QKUA 4U0KA 5IUKC 3RT9A 4YRQA 2R7MA 2AZMA 5EMNA 4AJ1A 4HTAA 1M8FA 3SR3A 5AKLA 4L28A 4LJKA 1QQ7A 5JARA 2IDJA 4KLAA 5FEUA 4YI3A 3CBGA 1EUDB 3B1WA 2QM8A 4RSRA 5C0OE 2VYVD 2E85A 1U0BB 1YMUA 2OFXA 2WK1A 1WW8A 2VP6A 4R16A 1THGA 3RSGA 1RWQA 5IT9A 4AS2A 5DBFA 4YMTA 4GR5A 1JA0A 1LF0A 3H11A 3OUTA 2WD7B 5ALEA 1PJQA 2G04A 2FR0A 2NO4A 5SYMA 4F4UA 3MCVA 4M8NE 2V98A 3HDGA 4JLMA 5EINA 1RJDA 1Z6YA 4JKOA 5EMKA 5I5EA 1MABB 5DN6A 4ZYYA 4IXMA 4EEZA 1J9GA 3SS9X 4UOZA 3S5UA 4LWOA 4R8KA 4U3JA 4M1KA 5KB3A 4MI3A 4JQSA 1GITA 2VHTA 4IBOA 1J42A 4N7BA 4UAVA 4ZV7A 3VR5D 4Y2XA 2JFQA 2LGJA 1SC6A 3EBLA 4G9EA 3KPVA 1Q84A 4M87A 2PU7A 3COJA 4JP8A 4XPZA 1XK6A 2CGEA 4MW9A 4N4AA 1ZNZA 3NI2A 1AKTA 3IV6A 5IHXA 2BBOA 3GDOA 5AK3A 4P4UA 5DFAA 3TMYA 1BN6A 1YQQA 1VPDA 3QTTA 3O03A 1WD5A 3H5WA 2HU2A 4K5QA 5G40A 5EJ6A 3RANA 2NU7A 3OQPA 3OZRA 2WE7A 3F6EX 3W8NA 1MLDA 3IDOA 5CXUA 1M1NA 1W44A 1A1VA 4BL5A 2P1ZA 2DPLA 2P3QA 4GRIA 2IU4A 4K9QA 4R40A 1OLXB 1YS1X 1PQWA 2P40A 4ZVQA 1Y34E 4HNUA 8OHMA 4EG6A 2QBYB 2PKQP 1YR9A 4D9NA 2PA3A 4V2IA 4X5OA 2X0DA 3AHFA 4WEQA 1FNNA 2HMVA 5P21A 3EIOA 3STVA 4ISBA 3O3MB 1XTKA 2YZGA 2W93A 3KJEA 1NRJB 2ODQA 4RS4A 1MG5A 2XVMA 3RK0A 1Z0FA 1XI2A 2IW1A 4QG7A 3L4EA 2C5LA 4YUAA 5KYYA 2SCUA 4YDRA 3S68A 4FB4A 3O8CA 1FBTA 2DPYA 4Q7MB 4DQ0A 4MYRA 3W6ZA 4GMGA 3NHJA 1I7NA 4OJTA 1NBIA 2A59A 4PRKA 2OV4A 4WCFB 1NT4A 3M9LA 5CM2Z 4ZEWA 2ZUTA 1JA1A 1YU6A 1GCUA 2XAUA 5FULA 1KETA 1RYEA 1NPTO 2VSNA 1KC1A 3F6YA 3B9BA 3CEAA 3NUGA 4N0MA 4QDJA 4ND7A 4TUYB 3T7AA 2FRXA 3HJHA 1DAGA 4PXSA 2JGRA 1U6IA 5ALDA 2UYGA 3WP0A 4EKGA 4DC0A 4P7FA 1ZNYA 3A28A 3EUWA 2BFNA 4P98A 3RYHA 1IM5A 3KSDO 3VYWA 5EKSA 2BMWA 3EJ6A 3F9RA 1FUYB 3ZCTA 4FFLA 3PXGA 2A1IA 3V2HA 1VZ2A 1V95A 1AV7A 4YMLA 3N58A 1E2NA 1UOPA 221PA 2G80A 4K8RB 3KWMA 4N6NA 1CUFA 2ZYDA 1M66A 2QTMA 4IG4A 4R1MA 1FY2A 4KU4A 2AXEA 3H86A 4V0MA 4ZK6A 4NCHA 4DA7A 1FNCA 2JCYA 1W5BA 1V2HE 1E5DA 1KI7A 1SCJA 3CT6A 2BFDA 2G09A 4MROA 1H2RS 3CO5A 4DABA 4WJLA 3ZQ4A 2W83A 2H08A 3ZGYA 5SZJA 3GVCA 2P5YA 3ZDXB 5DRTA 2VJNA 1XROA 3R6LA 1KS2A 4DYHA 1CLUA 5FLXA 5HRAA 4ZICA 3JSXA 1U8XX 1F0KA 2ACEA 4JUFA 1FSFA 1G8YA 4OHFA 2Z04A 1MC8A 2FPLA 1TKCA 4I9FA 4JWTA 4MRSA 2O2SA 1I3MA 1OBOA 1XRSB 2EL9A 3CZCA 3HHEA 5TQVA 4ILKA 2O8EB 1M9NA 2IYYA 5FWAA 1CCWA 3AUFA 4YMVA 1N2XA 3OI7A 4FOLA 3MOIA 2EGGA 4TV9B 1BXZA 4S0ZA 1E9BA 4BQQA 3VR5H 3NRBA 1M0SA 1WDLA 1N92A 1K5PA 2HRZA 3P2KA 3N2GA 3PHJA 2CLOB 3L43A 1WBJB 3KKZA 3ZE7A 2BCEA 5BRAA 1GGHA 4MHOA 5JDCA 5L6MB 1XO1A 4PGGA 5LKRA 4TT3D 3LF2A 1PFGA 1T3GA 1C8VB 1T35A 1ZXXA 4OMFG 3WZMA 2PL9A 2WAAA 1W5TA 3D81A 3NUZA 5L7TA 2HPHA 4AJHA 1ENYA 1K27A 2EW8A 3AF0A 2ZCJA 2XE8A 1OI4A 3A25A 1PSZA 2FSUA 3LBIA 4UCXA 4DBLC 2IHTA 2ESRA 1M6VA 1H2AS 1IBRA 4Z1MD 3VR2D 3SJUA 2EHJA 4D44A 2GYWA 3I9MA 3CURA 4DWWA 1WB9A 4ZQBA 1VKOA 1QQAA 2DWCA 3M5CA 1ODTC 1K88A 4LCBA 1VE5A 1CQXA 2EJTA 4C7OA 1ZMTA 1R7RA 2J5RA 2Y71A 2QTHA 3RWMB 2CF6A 3HCFA 3O8QA 4QXRA 4R3UC 5TQ0A 2GK6A 5HP4A 1XZPA 3PQ3A 1GILA 2AOUB 7MHTA 3LDUA 3FMVA 2R6DA 4AB1A 4ER6A 5TJ9A 4DCGA 3G5TA 2GBLC 3IB6A 2GYYA 4KLCA 4YONB 2PT5A 3DVRX 4MGZR 4BQFA 1J9ZA 2C5BA 2FPUA 1YQTA 3BMNB 4ZYZA 2QSZA 3PNQA 5JW6A 3OT1B 4MVJF 3TWOA 4RPKA 1HLPA 4I19A 2PJUA 5TPWA 4A26A 4MCAA 3CCBA 3KRTA 2QRLA 4PX2A 2F8LA 2ODWA 2AYZA 3SJAA 2OCKA 4L5IA 1A2QA 4MGKR 2FQYA 1N33B 2F1RA 3K0AB 3INNA 4X84A 5FAXA 4ENTA 1MW8X 3M9WA 4IJMA 1WETA 4AYTA 3DOOA 2GYVA 2C77A 2DFPA 3HCWA 2HL6A 2YQ5A 3OSUA 2J31A 1QQTA 4YRGA 2M6SA 1P44A 3OOJA 4TLEA 4D9IA 2Z58A 1LPNA 4PNPA 2QD3A 3V1NA 5KREA 3F4KA 4AX4A 3ROQA 4KG7A 4N39A 3PC4A 4BO2A 1G8MA 2I33A 1V43A 3EIXA 4ZVRA 4G86A 2W6JD 1T6ZA 2QTGA 4OHXA 1O5OA 2I80A 3REOA 2WF9A 2VHXA 5FNVB 3DT9A 1Z12A 3F5FA 4K9DA 4LDZA 4LJ5A 4D02A 4ECEA 5CB6A 3EVBA 3QSYA 3ICEA 4CMJA 1GCGA 1SD5A 2QRGA 5LP6F 2Q45A 3JVDA 4QARA 2FPPA 1MO3A 5CMLA 4QUBA 1NJ2A 4H1VA 3PGJA 5JS2A 4LYEA 1KDVA 4BV3A 5LYJB 2ZLBA 2P8SA 2QRMA 1U9CA 3G02A 4ZP1A 1WM1A 2C42A 4HDNA 4PSDA 5KPDA 1NU6A 2BHTA 5F4BA 4JCCA 1ZM2A 2I71A 3WSVA 1YDWA 2FN4A 3BORA 1R3UA 2C59A 5FH9A 2V65A 3I04A 1DQSA 1FDOA 4MIKA 4XVHA 4YAJA 1DG9A 4ZI2A 5IZCA 4JVOA 3KPYA 3U62A 2H4JA 4Q9JA 3R76A 1FP4A 4MZXA 2XSZA 4WK2B 3TL6A 3TZCA 2KPOA 3HI4A 4YXFA 2RH5A 3KBBA 3VMMA 4GC5A 2L82A 2NU8A 4P6VF 3RS4A 3OZAA 4XR9A 1QIDA 2OAGA 4BTVA 4ACAA 4J4TA 5LWHA 4YY3B 4LYHA 2V0GA 1E2FA 3CNNA 5I4BA 4RQAA 3KD3A 2W98A 2QTAA 3FXAA 1D5WA 1JLSA 2XOXA 3AXTA 3SYLA 3UUEA 1C0KA 2H5IA 1KI1A 1R0ZA 3CNBA 3VKVA 4ZT6A 5C5IA 4KBGA 4KIUA 3BH7A 4PSUA 4UATA 4N7JA 3QNWA 1IZYA 2C3UA 3S2UA 1Z06A 4HN2A 5IJXA 4INOA 2CHFA 1Z6XA 4RVGA 3MWGA 4X20A 1F2VA 3E05A 2PL5A 1CY7A 4P36A 4A8JA 4HUTA 2F6RA 1G5RA 3CE6A 4BZQA 1L4NA 5F3RA 3DEYX 4EHAA 4C07A 1K7XB 4P5PA 3V1KA 1PHPA 3OIVA 4UHKA 3Q12A 1IN5A 2UZ0A 1FSZA 4K05A 1G8JA 1VCHA 3SXUB 2GD0A 3W8EA 3KXKA 4E09A 4YMGA 5CA0F 2ZTMA 3G23A 1G7TA 1X3SA 4GGMX 5DJ5A 3W5SA 2GKOA 1KI9A 1X0XA 2AFIB 3I8SA 4UCWA 5G41A 1CTQA 2XYHA 4D9HA 3H9JA 4TVSA 3W9BA 4CGZA 4RNDB 2A0KA 5JJIA 1M2OA 3JU3A 3K05A 1VLZA 1A5ZA 5AHRA 3JQBA 5IDXA 3LLVA 3AEQB 1RR6A 3P26A 1T15A 2BKAA 4EHBA 5JNVA 1NZJA 2AQKA 4GR4A 1OAAA 5BMVB 2QP3A 4I5EA 2NIPA 2Y0DA 3ORQA 4ZALA 1YZHA 2KLHA 4NJOA 4YMSA 1NJ6A 5ILGA 3WNDA 4DOMA 5HIIA 1GNQA 3QUTA 1HYGA 5LD2B 3JD2A 4FHDA 1T8RA 2ERXA 5AR1A 5LLSA 1GPYA 1ZZGA 1VFNA 5JPCA 1J8QA 2BYTA 1GPDG 2JKZA 3WJ1A 2R79A 4UBKA 1HDOA 1IEWA 4HOYA 3R7NA 3VAYA 2Q2WA 1I80A 3LA8A 2ZTUA 2HSGA 1PW5A 4URYR 3WYAA 5BRJA 2PUCA 1KYQA 3E7DA 4KO1S 4OQLA 1ZGHA 4RD0A 3TX2A 3OO1A 5DMHA 4AUNA 1X94A 1U8ZA 2JCSA 1BKSB 3DEIA 5REQA 3JR7A 2D0DA 4X7PA 1QAMA 1R27A 5A3JA 2A6PA 2OLKA 4PQEA 5SV2A 2R11A 4YT5A 1NY6A 2XE6A 5BN4A 4TMTA 1LRJA 1WCWA 1LI4A 3LUFA 1CUDA 3PYXA 4ZAVA 1OAOA 3MYYA 1JHRA 4Q15A 4LHSA 4QGHA 5KVVA 3ZNQA 1O94A 2H5EA 1I0IA 4UNSA 2AMVA 4B8WA 4D4HA 4MVYA 2JH8A 1ZMXA 2LD4A 3OQ1A 2UYYA 2BEUA 4FDAA 3ESBA 1P19A 1K89A 1XHLA 1YQGA 2ON6A 2WHPB 4QE3A 4ZV9A 3R5FA 1RIIA 4LAFA 4WCFC 3TIXB 3GI1A 4EIWA 3T1YB 1XPJA 2PQ6A 4TRRA 2G9ZA 2YIMA 4PICA 1E3EA 3AUUA 3IQDB 1RS0A 3ZD9A 3MMNA 1HK7A 1SBYA 2RH9B 1GV1A 3BWDD 4YP6A 4OY3A 4HEA1 5JYCA 2CXOA 5JPDA 1BWQA 3AUAA 3C6MA 1DFGA 2BPOA 1QS0A 1CC1S 2Y92A 3JRNA 4I1IA 3VKWA 4D9CA 1M8JA 5HFJA