1S2GA

Purine 2'deoxyribosyltransferase + 2'-deoxyadenosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
165
Chain Sequence
b'MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine trans deoxyribosylase
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
total genus 50
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2gA00
1S2DA 3EHDA 3QUAA 5AJTA 6PFKA 4FYKA 1S2LA 4WL0A 3SBXA 3U39A 2NX2A 4NPAA 1S2IA 2IZ6A 3IMKA 1RCUA 3O8OA 1YDHA 4JEMA 4I7EA 3O8OB 2F62A 2Q4OA 4P5EA 2Q4DA 2IZ7A 2IZ5A 4LJRA 4HX9A 3O8LA 2F48A 4I36A 4MCJA 3F5MA 4MEJA 1WEKA 4RH3A 4I4IA 2A0KA 4LJKA 5AJUA 4KXLA 3GH1A 1WEHA 4JENA 1F8XA 2HIGA 1ZXXA 3MAJA 2PMBA 1KZHA 3OPYA 4U1RA 3OPYB 3O8NA 4P5DA 5ITSA 1T35A 2KHZA 2F64A 2PFKA 3K2QA 4A3SA 4KXNA 1F8YA 4FYIA 4JELA 2KLHA 3UQZA 2F2TA 1MTOA 2F67A 3HNOA 4OHBA 1PFKA 4KXMA 3PFKA 1S3FA 4LJLA 3BQ9A 2A33A 4FYHA 4OHRA 4PFKA 1S2GA
chains in the Genus database with same CATH superfamily
1UEIA 3FOWA 4N49A 1QFXA 2NYVA 4B3CA 1I1QB 4PSKA 5LWQA 3LK6A 1IAVA 1IPFA 1NUSA 1RU3A 4OP2A 3ZJ5A 2X1LA 3PPIA 3VDQA 2ZBDA 1BVYF 3RC3A 4W8GA 2Y3IA 3SXUA 1FFWA 1CUXA 4K9KA 4HGNA 4LYGA 4CM4B 1JDJA 3KYDB 4GVPA 3WJ2A 2UYQA 5KBYA 2EJTA 2FSFA 3IP6A 3TW0A 1T1SA 4RVSA 4B4VA 4YPOA 1TCAA 3DPIA 2ZOSA 2NTYC 4M2LA 2B83A 5LMZA 3K0CC 5FPTA 1Q6YA 4R2LA 2ICAA 3F6YA 1CDOA 3MUNA 2J3EA 3AZPA 1DXQA 3C6KA 4M8KA 1Y37A 2RIPA 1V1JA 2X14A 3D7NA 3JTMA 1Z34A 4L6IA 3ZKWB 4LF6B 3WYCA 1P61B 4LJ6A 3P1JA 1N0VC 3AERB 4DR3B 2PVSA 3II6X 4WWHA 3DUFB 4D8UA 4JZYA 5DOVA 2PQ2A 1ESZA 2E4WA 2JDID 2W8BB 4B84A 2VSYA 1NZDA 4WNAB 3JQAA 1LRKA 2H54A 1MOZA 2AOVA 2H00A 1TEXA 2YNMC 5FLKA 3RVKA 4K6CA 3U26A 5JXHA 4MI3A 5ALZA 5FPKA 3HV2A 5FOVA 4BNKA 4KDFA 5F76A 1CE8B 1NXWA 4RNCA 2BFCA 2QN3A 3QF7A 5H0IA 4BATA 3DTVD 3KOOA 3FR7A 3OKCA 3WE7A 4AG6A 2MYNA 1IQRA 4EDFA 4WDRA 2H92A 3BICA 3VUFA 1TRHA 2GJKA 2QVXX 2CFTA 3LUAA 4U1RA 5ESRA 3BGOS 1INLA 4WX2B 1JQLB 2JRCA 3EN0A 1RM3A 3DMRA 3ZWQA 2C0QA 2HQ1A 1X3LA 1NVBA 1MP0A 1W76A 2WF5A 4HDCA 3EISA 4UMEA 1ST3A 3T35A 2C7VA 3HS3A 1QDUA 2AFHA 4YJHA 1VGQA 1G8YA 3I42A 5E6SB 5G40A 4WK6A 3DQPA 4I9FA 1NJ5A 5CEEA 1J0AA 3I5AA 1E7SA 2VA9A 4K1XA 4P3KA 1JYFA 1IY9A 2AYXA 2Y0DA 3A9UA 3NBXX 4OBXA 2FZGA 3O8DA 4KFTA 4Q6WA 1RPZA 2OBYA 1RKQA 4W7SA 3X1KA 3EG5A 1Z73A 2O5VA 2QNIA 3T7EA 3N2KA 2WTNA 1JB9A 4HNVA 1RWQA 2HMTA 3VGJA 2HFKA 3FWKA 1AK9A 3RABA 2HRCA 3G5UA 2XQKA 1FP6A 1CV2A 2Q3FA 1KEKA 1E9EA 4NAUA 4WERA 5DWDA 4P4SA 1L4NA 4BZQA 1PJAA 4KZPA 1UBNA 2VKTA 1V11B 2R8RA 2X9LA 4YRFA 1H4TA 4HKTA 1WCIB 1MB3A 2BMFA 4FFLA 4NJMA 4UHCA 2WHPA 2UVQA 3T7DA 3ZBTA 1DRJA 1FTNA 1M34A 4I1IA 4WN3A 2E1RA 1SUWA 1L9KA 3AQ4A 1MJFA 5EZYB 4BX9A 5KYGA 4LWPA 1P7VA 4B87A 1NL3A 1VLZA 1S2DA 3D4LA 4EG1A 1LNSA 1NMQA 3DAYA 2APJA 2BTEA 2J1LA 1E7YA 5CEJA 4WZAB 5IJ0B 1HQYE 4HEHA 4AJPA 1V4NA 1JDZA 1XX6A 1SU7A 4RWEA 1KKUA 1RXVA 1KP2A 3K0SA 5BV1A 4GECA 4L72A 3QLVC 3HJAA 3IAEA 3W1EA 2ZT5A 3OLVA 1RWXA 1Q7BA 2SECE 4WKBA 5GONB 1I7PA 2WIBA 3I39X 1N2OA 4QPDA 4UHJA 3AF4A 1H93A 4URHA 1JR3A 1Z33A 3K7EA 2YV2A 3R6DA 4QARA 4ARUA 4BNWA 3Q8WA 5C46F 5JSHA 1CRPA 4HVTA 4FTWA 1MRSA 3K70C 1KC1A 4KYVA 4RABA 3GT0A 1FYWA 1YDFA 4KU4A 5GZ3A 1HFEL 3JD1A 1WVGA 4II3A 2Q4OA 3EC2A 3DC7A 4F85A 1O9GA 1ZUIA 2QM0A 4LQLA 1NIPA 4IM7A 4TWIA 4KYIB 4O4JF 4BP8A 4TRNA 4XW2A 2FPKA 3A1CA 1G6OA 4PFJA 3TOZA 1R00A 1T2AA 1C4OA 2QX7A 3DZIA 4M9QA 4CLRB 3LM8A 4CKZA 1T43A 1M1YE 4CKWB 4X1IA 4IIHA 4YJGA 1AMNA 2VK2A 1ZHOA 4F11A 2VYVA 4LZNA 2OMEA 4P33A 1K4KA 1SB8A 1ZWLA 2OTCA 3RTEA 3U4GA 4QG3A 4D9GA 1Z07A 3HE3A 4P36A 4DLTA 3DVLA 1G5QA 2BELA 1OE0A 5F51A 4JT2A 1C3EA 2OGWA 4R3WA 1YZKA 1QE3A 2O9JA 2R1TB 3C3DA 2FKNA 2VJKA 2FCAA 2F3UA 1Z0SA 2A5LA 2NUBA 4ACAA 1TXGA 2NT3A 1QRAA 2X4GA 1TEHA 1YD7A 4JI8B 3HCFA 3IQGX 1V1MA 3F5QA 2FAXA 3I01A 4DCNA 5IZCA 2F9FA 3C6YA 3A25A 1GAEO 4X64B 4B7AA 4D4IA 4POAA 4TKZA 2VDMB 2AWNA 4M0EA 5ITWA 2B3DA 1KMIY 3VU0A 7MHTA 3M2PA 1M7HA 4B3JA 4EM6A 2V0GA 2Y93A 4WLEA 2Q50A 2RGXA 1RZRA 3TK1A 5I8WA 3ZQ4A 2CXRA 1QWSA 1Z2EA 4JD5A 5F77A 3WYGA 4A5OA 1EIWA 2VRNA 3L7YA 4JLDA 1MFPA 1VI6A 3H19A 2AN4A 2XPCA 3HNRA 4DOMA 3Q72A 3GDFA 4N03A 3PVZA 4QU9A 2ZWMA 4C4YA 4L73A 5JAMA 1I7DA 3RS2A 4IGIA 2GD6A 1C4WA 3H5OA 5FULA 1FUEA 4KQJA 4D25A 4N0DA 3U3XA 1SM4A 4B7CA 1O87A 3L4BC 1NULA 4UVHA 5AJHA 1ORTA 5B7QA 1IZ0A 1RS0A 3ABRB 3AUJB 3TAXA 3TO5A 3VNAA 2H5LA 4Y1RB 5HKLA 2Q1SA 4DE5A 2OV6A 4G4SP 3ITKA 4GXQA 4PM4A 2HRDA 3O73A 1K9VF 3PFHA 3FH0A 1VHQA 4GI2A 4TL8A 1F2TA 1HRKA 1USIA 3EIWA 3I53A 1MG0A 2ZSBA 3EIEA 5KVCA 1TQHA 4QX6A 2XD4A 1H0HA 1T4GA 2WP0A 3E5RA 1OFHA 1L5VA 2VEDA 3GEMA 4FGJA 5FOUA 2P91A 2VWPA 5FR2A 2ZSHA 1O4WA 3MC1A 3U7JA 1NQUA 3AKYA 1TZCA 5EPUA 5J58A 5HKAA 3C1OA 1TQ6A 3C7AA 3K9FC 2YY5A 3AVYA 2BRUC 1KZ9A 1JLSA 2C8VA 2GCEA 4PWZA 4R0MA 3LT5A 1N3LA 4LKOA 3ASUA 5I9BA 1EFTA 5D51S 1BQ3A 1DBIA 1V8PA 3L5KA 4MJXA 3AFMA 1U94A 3IPYA 4NJEB 4E09A 4G97A 5FPSA 4IIEA 4GS5A 3E82A 1CQJA 4FN5A 3WSWA 2FFBA 4OLAA 4AZVA 1Q1EA 2FWBA 1ZRNA 4O4HA 3SZOA 3U5TA 3VR5A 5K9ZA 4ZT3A 5C8ZA 5L7TA 1P7PA 2X76A 4NBWA 1QHHB 2JIQA 4D7AA 4MWZA 3N1UA 5BR1A 3BIXA 1GSHA 5LA6F 1ODTC 1Y8RB 1ZZGA 2UZAA 4C01A 3JQ9C 1O6BA 2FSVA 3O3MB 5DK6A 5KQMA 1KQPA 3AKEA 2WU1A 2TS1A 1KP3A 4HDNB 2H2HA 2HCTA 3EUFA 4H18A 5BVGA 5LLSA 3C3XA 1DKNA 1NVEA 2XE7A 3ZS9A 5KYWA 3ER9A 3JQGB 3KXKA 3PL1A 1SCUA 2IUSA 2YRXA 1HE3A 3OIWA 4G84A 3QKRA 5HKBA 4RKYA 4XB2A 3K9WA 3PE3A 4FMCF 5ICCA 1E63A 1LS6A 1U7ZA 1NUAA 2FVYA 2LRHA 2BY4A 3EA0A 1XLTA 1GZ7A 3IVGA 4R98A 2V6MA 3DNPA 3I37X 1VYTA 4OA5A 5LB4A 1JVSA 1NVKA 2HBQA 2FQYA 3B7GA 4JUCA 2AQ8A 1PX2A 5B7GA 1MHTA 3EXG1 3EXAA 3MTBA 6LDHA 4PS1A 2IVZA 3R6TA 2PUGA 1OROA 4TN1A 1Q0RA 4UMFA 2GA9A 2WF9A 2XDQB 4L4SA 3PQ2A 3VUEA 1WD7A 3NG1A 5DM4A 4DY6A 4F0JA 3KU4A 2Q3DA 2UYOA 4W7IA 4Y2XA 3ZE2B 2IT1A 2Z4TA 3RGWS 1E61A 2GRAA 3BXOA 2Z2KA 4LF9B 4F46A 3KVYA 4GR4A 4PTYA 4TL9A 3H1PA 5KNBH 3K9LA 1GGKA 2RHDA 3CW2A 3HY3A 3IERA 1GYQA 1DJLA 4GDFA 2O8DA 4DWVA 3W3AA 3GL9A 3G1WA 5U1PA 1XDSA 4MIYA 3HUFA 4U7DA 4DQVA 1T2CA 3I6YA 1CB7A 4INOA 4ND5A 4YUVA 2VWQA 3ABZA 5FBHA 1SCDA 2QW0X 4GI7A 3Q6NA 1CP3A 3BHNA 3F49S 3N53A 3SLGA 4FYMA 4WCVA 4ZJPA 1SQGA 4F6LA 1C7EA 1G5RA 2GHIA 1QHGA 2C1EA 1L5HA 2EW2A 2IOFA 2FRDA 2YFYA 5DT9A 3L0OA 5TMEA 2C7QA 3LYUA 3ZV5A 1OAAA 3NIBA 3QW2A 4F9TA 4LJLA 3AYXB 4YT4A 3DONA 4X3OA 3VZPA 3U9LA 3B9PA 1RYMA 4EZEA 2EIXA 1CETA 4XWYA 2CYBA 5DRTA 5CB4B 5UKDA 2R62A 3BORA 1DDGA 4LTDA 2GLTA 2ACKA 1BG6A 2J0UB 4Q3AA 1QP8A 3EQZA 3G2MA 3KSZO 4UEWA 3RUFA 1Z5OA 4KAXA 5ICSA 1YT5A 3K0EA 4DMGA 1CF9A 5AI0A 2Q3EA 2YX1A 4RXTA 4P3NA 4IDCA 1PS0A 4UVIA 2QXYA 2VYQA 3KOMA 4DJJA 2FZCA 5JIBA 1RABA 3WLPA 4MHSA 4RHCA 3KBOA 4JMPA 4OBWA 3PEYA 1IN5A 4IIDA 4XLLA 4ZDJA 1G3RA 4E5VA 1DQZA 1EBBA 2JEYA 2FPPB 4G67A 2PNJA 4DMKA 5KWIA 1PFWA 1VJRA 1VYUA 3D6VA 3EEYA 2RARA 3PDJA 4M3NA 5JE8A 3EOZA 2XRMA 5IC4A 4FWTA 1SOUA 3KS9A 3VI3B 3HJHA 4ZOCA 3LLSA 3CZAA 4MW0A 5JR3A 3C5HA 1B14A 5IUJC 2WTAA 3OH8A 4DCCA 1ABBA 5ICGA 1K8ZB 1KYIA 3A4VA 1YR7A 5AVXA 1Z3IX 1F06A 2JRLA 2PUVA 1QLWA 5BUQA 1NI4B 3NASA 3N0WA 2IS1A 4V2IA 4O2AB 4CMBA 1PJLA 2A9OA 2VF4X 4HDQB 4TV9B 4HDSA 2W2TA 5H4HA 4RFVA 4XFDA 4EJMA 5ES4B 4BMVA 1XFAA 5A6VA 2EWMA 4BKRA 1YB1A 1T5OA 2B5VA 3AI1A 1K5PA 3HKCA 1JKMA 3F5MA 3SZMA 4WECA 4EYOA 2VSXA 5E1DA 2IYPA 1ZD4A 3WK4A 5AVVA 3LYLA 4E5NA 2V96A 3JRXA 3BJIC 1PGQA 1MABA 4IIJF 2GF9A 2HSDA 3GFRA 4WDQA 3KR2A 5H82A 4BAUA 1DE0A 1NJ8A 2A0KA 3C6XA 1SXHA 2EP8A 4DBZA 2VTBB 3ER6A 2BN4A 5A71A 3W06A 4DPMA 2CNDA 4GHWA 4Z7OB 1DCMA 1IEVA 1R0YA 3CG4A 3G7NA 1M66A 4IYRA 1KXZA 1IQUA 1DELA 3DOIA 5TQ0A 3WDMA 4C29A 3ZNOA 1CR4A 1ZYUA 4BV2A 1EK5A 3WL4A 1QO0A 1U0GA 1CIVA 2PVPA 5LQMA 4J8PA 6ADHA 4JI7B 2CY0A 3NYRA 1PT6A 2IHJA 4O25A 3WGUA 4TVBA 5JZBA 5KTOA 1N9GB 3L9WA 2GFHA 2O7QA 3KE9A 4MYUA 1IWBB 3WLJA 2VPPA 3QWAA 3L2OB 1QH8A 1Z5PA 2ZTMA 3TL2A 221PA 5CK5A 1O95A 3HL0A 3LCMA 4MW7A 5EINA 4PY2A 3NTLA 3DDOA 4Q0MA 4J0KA 3GHYA 5EZQA 4BU1A 1NN0A 3NANA 1BMFA 1PAUA 3ZWOA 3GW8A 1XEFA 1K8QA 2A0YA 4XQ0A 3E1KA 1D1TA 4KXNA 4PYQA 1MJGA 1R12A 4R6XA 4QDJA 4CUKA 2YHUA 4YN3A 3TMYA 3FMIA 2JAQA 4MVWA 4NZNA 2C03A 3GN2A 1M67A 2PWAA 5AKGA 1Z37A 4Z86A 2XOEA 5DNEA 5IULC 2XMPA 1KJYA 1FYDA 2GGSA 2WYUA 4PQYA 5B53A 5TVKA 3F78A 4QQ8A 5BRAA 2O8CA 2AXNA 1X7WA 1A9RA 2JIOA 2IYQA 1AKTA 1P2TA 3L0SA 4B6PA 4DNFA 1J2RA 4LJ7A 4MW5A 2OLEA 3CXRA 3IP3A 1J1IA 2A0WA 3GOHA 3TL3A 4UREA 4D41A 4Q7QA 1GNPA 5A3SA 5JT1A 4UXHA 1TJ3A 5HF5A 3H4VA 2P78A 2WMNB 1VL5A 3DXXA 3QVLA 4BO5A 1FDOA 1DUSA 2QRVB 2G36A 4YI5A 3R5SA 2OGTA 2VUSA 3D02A 3L0YA 1G55A 2L19A 3KQMA 3KYCB 3RK1A 4OXKA 3SIRA 3IEUA 4EI7A 4IUDS 4MQMA 1E8DA 1MZVA 2OD2A 3AG5A 3WI7A 4QHYA 1OFGA 1T8WA 1YVUA 2FFAA 2PCJA 2YJ3A 4LVOA 4MKIA 2JFOA 4D82A 3RARA 3C3WA 1PYDA 4W1QA 2C97A 4L50A 3ZWMA 2GNPA 1MB2A 5K3BA 2PXCA 1DHRA 4TYNA 3IUNA 3KIPA 4PZCA 4M7OA 2FP4B 4BNXA 5KINB 1B42A 3IIMA 3OCCA 4GMKA 1EVZA 4IZHA 3ZCPA 4B44A 4J0FA 1XZHA 2YWFA 4NU0A 3EAFA 2H2GA 1AKNA 1IRXA 1DIOB 1RNLA 2LPMA 4NH4A 1E79A 2MR5A 4XPZA 3S7ZA 1QV7A 1S6YA 1VE6A 2AL7A 2OD9A 3H1AA 4RZXA 2VHCA 1SHLA 1TM4E 4MW4A 2QD5A 4UPDA 5FO1A 1PEKE 2FVXA 4CV1A 4L22A 4BVBA 1SRRA 1ZM7A 3AETA 3WJAA 4WW0A 2QX8A 1ZJ4A 1MNAA 3ANMA 3LW8A 3EJ6A 4JFAA 5FYDA 4F92B 1ZQ9A 3I09A 3WDLA 5MN6A 3ZDXB 1P7WA 3IRUA 3AUXA 1CQZA 2W2QA 1SUIA 5BYJA 1GOTA 3RUDA 5ALXA 1QIGA 1XEWY 1Y1QA 3ZVNA 1PN3A 2AJ8A 3N9IA 2F1OA 1GNSA 1ENPA 2IUYA 3C74A 3K73O 3PGKA 5IAJA 3FUCA 3RYFB 2A4KA 4JLBA 5KOHA 3QBDA 4CUJA 4R81A 1TIBA 1V2HE 1VQ1A 1ISJA 2VLIA 2Z4SA 5FT9A 2GYVA 3TINA 1OFUX 3QE2A 1XD9A 3IAUA 3QWHA 4V2UA 4PZYA 2JFWA 1R7RA 4LDRA 2QVYX 1WEHA 4ZEWA 4ARZA 1KAHA 4O02B 3EIFA 1Z4NA 1DEXA 2ZYWX 1IZZA 1GIAA 1VA4A 2XMSA 3AHGA 3NKLA 4FLFA 4YP0A 3ZIDA 3PA6A 1IXYA 4RF5A 1GGJA 1NMZA 3PENA 4PAGA 2DWCA 4PBSA 1KZHA 4A1FA 2R65A 1DOAA 4Y6LA 2EL7A 2ETXA 1NT2A 3MS7A 5H70A 1I5EA 2OCXA 3EEBA 4Y0AA 2O2SA 1G5HA 2ZQZA 3ER8A 3K5IA 1HY3A 5JSZA 1F20A 4LHVA 4MDHA 3A9VA 3PC7A 1QYWA 5D5HA 3SZGA 4ON9A 5HX7A 1ZVVA 3R09A 3I5MA 1NBEA 3AR6A 3IJRA 2AHOA 4WZBA 2BHRA 4WBNB 3VKHA 4D5EA 1ZGAA 1NTOA 4M1WA 2DOKA 4E94A 4Y2TA 4GR5A 2QQ0A 3ZY6A 3PDIA 1YJAA 1OXXK 1QVAA 3VR6D 3O93A 4TV8A 1V0JA 5L3ZA 3V2IA 4JLAA 4B1FA 5ALJA 5E8JA 3S8MA 4M9RA 1M6NA 3THYB 2A14A 2EHJA 3TUIC 2C82A 1F0NA 5CVJA 2QLBA 3LC0A 4FHFA 1Q1GA 3DV2A 3BMQB 1MTOA 3E3MA 4LJ4A 3H4MA 2FE1A 5C52B 1HSZA 1IK6A 3AVWA 3HCNA 2AMLA 2NADA 4BO8A 4BTLA 1LKZA 3OZBA 2WSSA 3I9KA 3WKEA 4REOA 1M8FA 1ZQ1A 1GY8A 2GPAA 4JOSA 3EIOA 3GFVA 5EWJB 4D0NA 3A3KA 1PUXA 4HX5A 1CRZA 2ID4A 4BIMA 3U44B 4MGYR 1OAOC 1R3UA 2QSYA 4L9AA 3VYVA 1A8PA 4ASUD 2D74A 1W0JA 1JSZA 4TTSA 1SD2A 2EGHA 4XCVA 3WGMA 2Q27A 2RKBA 3CLHA 3ICEA 2BKAA 3QJ5A 2J45A 1C9KA 3ONWA 4KZKA 2G08A 4NMMA 5AR1A 4YRQA 4D80A 1X6VA 1L5GB 5JBIA 1NBHA 3NMUF 4R1TA 3W2FA 3IAAA 1BFDA 2UUPA 1CDZA 1ZGJA 4LZLA 4D74A 2QJOA 3ZD6A 2XCQA 2JJQA 1GGEA 4YAJA 1QMPA 3IKTA 3LTNC 2X0JA 4HH3C 3VHXA 1QK3A 3WAKA 1HNXB 1PGOA 3FMVA 5DLEA 3SXUB 2XGOA 2XB4A 3PVCA 4HO1X 4KKVA 4BO9A 5EE3A 4FFWA 4JR2A 3IJEB 4POOA 3BJRA 4BO6A 3C5WP 3B1JA 5H68A 4BGVA 4DW8A 3FMGA 3U4HA 1UT5A 1DO8A 2HGZA 2AB0A 2Y92A 3DBHA 2NVBA 5A7HA 1OC2A 1QVZA 5MHTA 3PUJA 4G2TA 5D86A 1ZSVA 2ECKA 1KDTA 4HWRA 4Y98A 5IWAB 5BQ3A 4BXOA 4MPJA 1E9RA 2YZMA 1SC4A 1Q1AA 1V8DA 2PZLA 4XASA 4E31A 4OQFA 5ILQA 4ZZ1A 2QLJA 1PR2A 3QU5A 2R2AA 2BLNA 3L43A 5CX1A 4KHZA 1GNQA 2ZRJA 1XLWA 1R6DA 4PLWA 1QX4A 4EPTA 2Y1DA 3HO6A 4FMDB 5H5JA 1Q0TA 1YZYA 3EGXA 3JQAB 4MITA 3B9BA 4DPKA 2GBCA 4AZTA 3PVSA 4FYYA 3SQDA 1QB7A 1HWYA 2HQSA 4WI1A 4YIHA 2VF8A 2ODBA 1QM5A 2HCJB 3OMWA 4OHFA 2IRWA 2Z08A 3BC1A 3EXHC 4CLDA 4KQ9A 5FO0A 3WWZA 3MCVA 5EHXA 5DM0A 3GJSA 2FN7A 2Z6VA 1DNPA 3EQ2A 3JYNA 2F1RA 2Q7OE 2HHCA 4OI4A 3T38A 1E1RA 3VOBA 2BFCB 3ELBA 2NSHA 5FR1A 3PNPA 1E3EA 1FLNA 5ALMA 3GXBA 3DS8A 3M6MD 1ODKA 2XKAA 5E3HA 5LJIA 4JGGA 5EKTA 3EDYA 3NDBB 1N1MA 1TA9A 2H16A 2W43A 3H5VA 2QLMA 2DVMA 3IURA 2FUCA 2D8MA 4M9ZA 3LIPA 2GK6A 4Q12A 2A4MA 4S2EA 3SJUA 1OXTA 3ELYA 1REQB 3HBLA 4IJQA 1CEQA 2EHDA 1N25A 4RXMA 5GM1A 3A27A 4BY9E 2J6CA 3B7WA 1C4KA 8ADHA 5ITZA 2AFHB 4YJHB 3D7LA 4OO3A 3S8YA 2Z2YA 4X84A 2RGRA 2EJBA 2NZJA 4J6FA 1VE9A 4RJLA 1PGNA 1DCKA 2W71A 2SICE 4XVRA 3IAS6 3T4EA 1TYZA 5DVZA 3KT6A 1XROA 4OF4A 5DISB 2ZRDA 5HIJA 1KL7A 6REQA 1A9ZA 2HHLA 5I7HA 4YJ3B 4BN4A 2IYZA 5EMJA 4KPEC 2PO7A 3A26A 2LCQA 2E2WA 2Z6QA 3OO1A 1RZUA 3OOEA 4JU9A 2VRBA 3AL2A 3N2KB 2WAMA 4TTTS 3BD9A 1VG9B 5EUBA 2L18A 4M22A 4AF8A 1G8GA 4CR6A 5A4DA 5I7EA 5T4BA 4LMRA 3UV7A 1ZJZA 4XGIA 2H29A 1DG1G 3L8ZA 1LFAA 2IHBA 2QD1A 5ALKA 5LMUB 3FHTA 5C2JB 2QWXA 1O9BA 4IMJB 4ZODA 4C0SA 4F1KA 4D0SA 1V7ZA 2CL6X 3A11A 4P4SB 4DDHA 1H2EA 1SXJC 5B57C 2V4ZA 8OHMA 4GGPA 4PN7A 5E1OA 1EH5A 1SZJG 4X65B 4NJMB 1CYEA 2ZJ2A 2O05A 3LBHA 4K9QA 1QH0A 5C3MA 3KZOA 4IQ8A 3DBOB 5IF3A 2VKQA 1Y6GA 1A2KC 1M34B 1VP9A 4JWTA 1XTVA 4OA8A 3C98A 3JY6A 2XSZD 3OWXA 4KVGA 4MKFA 4P08A 3VZDA 4MXDA 5ADWA 3KPJA 1JKXA 3KTOA 4FK8A 3VNRA 4GLFA 3OOSA 4DXDA 2R47A 3TW8B 3MD9A 2ATCA 2JAHA 4UU7A 1BE6A 5DBEX 1S2LA 4EAAA 4E0BA 2C4WA 5AP9A 4ZMRA 1V8FA 3HUEA 1ZAKA 3UVEA 4DEYA 3O8BA 5GJCA 4DV6B 1SIWA 1DIHA 4L9RA 3IQEA 1OR8A 1SG6A 1DC8A 1VKZA 3UK6A 4BNIA 4ZVPA 5A5EA 3IDSA 5JNLA 4FGUA 5BSHA 3KQLA 3ENZA 2HWXA 3IT2A 3AP1A 1YCFA 3GRCA 4XE5A 1NMYA 4MWBA 1CFZA 2ZBGA 4JEHA 16PKA 1U28C 4PLZA 3FDJA 1HKUA 3K1TA 2OORC 1AKEA 1RADA 4COKA 3NYWA 3L4JA 3PC8C 3QU2A 4PZ0A 3RFFA 4ZYXA 4ZIRA 3OLQA 1EDOA 3OLCX 4Y30A 4ZT5A 3EZ6A 2BW0A 4WACA 5C4MA 1R18A 3P9ZA 1N0HA 2RH8A 1NVUQ 4B3MB 3BSSA 4C7JA 1NVXQ 1R8SA 4EL5A 3HYNA 1TC1A 3GJ6A 5JQGA 3OM9A 5CNIA 2YTZA 4FQ7A 2HTFA 5AJUA 3GLVA 2W6CX 3EGOA 4YPVA 3QA3E 2BZSA 3NTUA 2AWOA 1JEQA 4GG1A 4B2YA 3IILA 4X1IB 2PK3A 1E5DA 4YJGB 5CLFA 1U2SA 4ZAWA 2AOUA 4OV6B 1NQTA 3RAFC 1CSEE 1MO2A 5K0CA 3VMFA 2R4UA 1U2GC 4YDHB 3RSOA 3IMGA 1EGAA 1T8TA 4MW6A 2W5UA 2HSZA 3IT0A 1C8LA 4Y2SA 3W5VA 5EE0A 1EUCA 3BZUA 4D56A 1OC4A 4HTAA 2PRJA 5JCOC 1NRIA 4MGEA 1Z0AA 4PC2A 1UWCA 1MVLA 1AA6A 3CLSD 5CDFA 5JG7A 1EAYA 2FWMX 1AKUA 1PGJA 1OTYA 2OAGA 1V1MB 3C24A 3CIFA 3OOWA 4JXKA 3OJEA 4D92A 2PX4A 1H4QA 4CQNA 1T3SA 2F3RA 2V6JA 2Q9UA 1Y1PA 5B30A 2L0XA 1T4CA 5CIYA 1TK3A 3A4LA 1BKYA 2YFQA 4RF3A 5BNFA 3U1BA 1ONPA 4EY6A 2Z2XA 1PWEA 4M21A 5F5XA 3CZMA 3ORHA 2C0CA 3NT4A 1SKQA 1WMEA 3TSAA 4DUGA 2VSQA 3WIVA 4A6PA 1G21A 4CF6A 1IE3A 1W19A 3GLIA 3WMXA 4LQDA 2MR6A 4X8LA 2OWDA 3GLHE 2WYIA 4W1RA 4UEQA 3V4SA 4FGWA 1TQ4A 1NXPA 2WY2D 2J5XA 1ODLA 3D54D 4PRYA 5EL0A 4ESOA 4Q02A 3LXMA 1KEZA 1NW6A 3SKXA 1SU8A 1QP0A 3O1LA 2WT4A 3GFTA 1XQ6A 3LOPA 3ZE1B 1TPYA 3ADOA 1Q0UA 1XJ0A 5SZJA 1QKJA 1JIUA 3UJBA 1CJMA 1I6MA 5T41A 3RREA 1IH8A 3ZE0B 3BK1A 3ACBA 2R96A 1A2OA 4ISBA 1LA2A 1H5QA 4P2GA 4EEZA 4WCFC 3CRVA 5IKOA 1F2TB 1ZJ5A 2YOGA 5ALTA 3VNUA 1TX4B 1J8QA 3LP8A 2XGMA 3W2EA 1XCBA 521PA 2RI0A 1FXWF 3H3XA 5TDHA 5L3QA 2VJAA 4RY9A 2DUUA 3NFYA 1JZTA 3NBFA 4H31A 4JWKA 3C8MA 4Q05A 3HJBA 3P0JA 4QO8A 1C2YA 1CG6A 2FUG6 3QVJA 4GD3Q 2YH2A 4RUKA 4ECAA 1ADBA 3A1DA 3FNHA 1A7KA 1KSGA 1U9IA 3IQWA 5FPPA 5J4YA 4OLFA 2BYTA 3MGGA 1YNOA 3AU9A 1CJUC 1GEGA 1KNXA 2VH1A 4CT0A 1TCVA 1TZKA 3E9NA 4L0MA 5DBHX 4B3RB 4JHXA 1H2ZA 3Q0IA 4FQ8A 3UMFA 4Z9XA 2IYAA 2MOKA 5FF9A 2J41A 2P2DA 1CQJB 2C5AA 5MGBA 2BDEA 2VQFB 2IXEA 4ND3A 5AQ1A 4O4HB 4ZQBA 5BP7A 5H8WA 2ZTHA 5I7WA 1E7WA 4ND8A 3PD0A 1X80A 5TX7A 4MO9A 4OD0A 3DO6A 2IZ5A 3MMNA 5FTKA 2IV3A 5M2QA 3P9QA 1GP2A 4KBGA 1JHRA 1NRJB 1B15A 1DVRA 1RQPA 3OQ1A 4G9EA 4FSDA 1LSUA 1I94B 5BVGB 3I28A 1PJ3A 5JXJA 5KYWB 4DYDA 2Q1WA 1U8XX 2MJLA 3HEAA 1FTSA 1SCUB 2GD1O 2QIOA 2WBLC 3IQFA 3C43A 1AIPA 2XMDA 3A9RA 4PYNA 3QKRB 4WUVA 1LDBA 3S2FA 1KJ8A 4A4DA 4BVKA 1KVRA 4KX5A 5JW6A 1C4XA 1FUUA 1BS1A 2YNMA 2ZBPA 2GS9A 7AT1A 3H84A 4IOJA 4TQUS 4ZQCB 1EDDA 3PWSA 5SY9A 3D81A 3ITDA 1E4EA 4NE9A 1LPNA 4WK4B 4QPJC 5T64A 3UF0A 4L16A 4NCHA 3EZGA 2B1RA 5AXBA 3ZWBA 1UPAA 1YNSA 4P4GA 3L0BA 4CL3A 4YRJA 1AO3A 1D04A 1JBEA 1MUUA 4Q3NA 4O2BF 4FMBB 2Y05A 3AJDA 4AZSA 3T3MB 1UP7A 3TOXA 3WLSA 4LJYA 5C4GB 4BWGA 1OH5A 2V45A 3B5EA 3HHEA 1G59A 2NVUA 1UDRA 3WS7A 3N7AA 4LY0A 2JFXA 3ZZNA 2ZYSA 2DQ4A 1TVEA 3KV1A 3ZTWA 4DLKA 2GN0A 3VISA 3L6BA 1BJTA 2HJRA 3CUYA 3WNZA 2O8DB 5T4HA 2KLHA 4L4YA 3WLTA 2F2TA 3WG9A 2F3PA 4L28A 2ZRAA 4Q9KA 5JASA 2ECFA 3ZQKA 2FTKE 2QEQA 3QJGA 2FXVA 3QUSA 1TK2A 1PTKA 4DJFC 2F67A 3CR8A 3NYQA 4HR7A 1LBSA 2AFVA 2R6FA 1F2UA 2NZ2A 1DADA 2HMWA 3E70C 3RAGA 4RY8A 1L5HB 1T0HB 2Y76A 3LQRA 4HLQB 5TGZA 3MW8A 5CPFA 3KD3A 4Q1FA 3WA6A 2WVAA 2Z6UA 3V4RA 3P0EA 1JG4A 3G8YA 1C81A 1KZ1A 3IBTA 4J43A 4NDAA 4NE7A 4URXR 3WA7A 3G8CA 1YKSA 3NBZC 4IKEA 1UBKS 4NOKA 1QCDA 2KJQA 1SVUA 5IVIA 4KN9S 3RS0A 3CMCO 4J49A 5KTPA 4DLZA 2WUFA 3ZWWA 5IXJA 3PJGA 3AW8A 1YR1A 2FWJA 2QV0A 4IKOA 5HRUA 2UUBB 2IPNA 4RD6A 3UN1A 1Z25A 4L4ZA 2VP4A 5AJWA 5GIPE 2IYLD 3K3PA 2I2DA 1T9DA 4LFCB 1AQLA 1ZK2A 2NXCA 3TGLA 5TF4A 1O8CA 3H87A 2OD7A 3PUZA 3S2SA 4FNMA 1FS6A 4O4LF 2ECPA 4BV9A 2YIDA 3ZVMA 4BMOB 3AJ8A 4WEQA 3THOA 2YN2A 1H6DA 2VPWA 1JDUA 4FM9A 4BEVA 1DPFA 2I9KA 4G89A 1M2OA 2W6IA 3I0NA 4M83A 4IOMA 1BKSB 1VECA 1YR8A 3QLVA 1ZRHA 4QEKA 1K6EA 2I9PA 1E1YA 1XTSA 4Y9UA 4YRDA 5IP5A 2OXTA 5EKUA 2ZUVA 1G9XA 1TFUA 1NYTA 2QAJA 4MOWA 5FOXA 1M6WA 2XUHA 1ZXBA 4DG5A 1W59A 1MEOA 1NG1A 2OM2A 4HDSB 3UMSA 3TYXA 1S0UA 3ML1A 1XMXA 3PC3A 1G8MA 3HKCB 5ELLA 5EEHA 5FORA 3NIFB 4X24A 5TSDA 4S3MA 4BKPA 3G88A 1EE1A 1OWPA 2PPVA 2RK3A 4UM7A 3NDJA 1YBMA 3ADPA 2ONJA 3ZEIA 1MABB 1WMAA 1GG2A 2B7LA 2WJ3A 4IH4A 4IWNA 4MNTA 4QVGA 1X3SA 4RPLA 4XWAA 4DDVA 3QW4B 2QRJA 3I8SA 3ZU2A 4TMZA 3A8TA 1BCRA 2D2EA 4LBVA 2IVFA 5TQ0B 3KQYA 3CLUD 1PR9A 1NDQA 4FDLA 4BGDA 2EFHB 1P0MA 3C7TA 1RLOA 4RACA 4ZALA 5A6SA 1GDHA 5AW8A 5A4FS 1WZNA 2W6PA 3RTCA 3QEMA 1LTHR 1JXQA 1PZGA 1Q3TA 3CEPB 3DKKA 3QFCA 4B85A 1R4MB 2G9ZA 2H5IA 2CNWD 2O2CA 1T3LA 3AUSA 3SYNA 4QFBA 4RPHA 4PO3X 1QV6A 2X1MA 3TFOA 1BN6A 4EFNA 3IQZA 1QH8B 3IAM6 1PE0A 4HDAA 3I4CA 3NM6B 4M1ZA 2WJHA 1UBRS 4NP6A 3W0LB 4GSYA 5AIAA 2HLPA 3FG9A 1JQAA 2CDRA 3EIHA 3KDSE 4PGFA 4H7IA 2P11A 5DEIA 4KL8S 4KQ6A 3E18A 7REQA 3TG2A 3IT1A 3U7EB 4O3MA 4WA8A 2CXNA 3JD2A 3SBOA 3H9BA 1MRNA 3LBAA 1JQJC 2VOEA 4WOPA 5F4ZA 1GPYA 2P9QA 4BE4A 1R6UA 2WD9A 1H8HD 4EYGA 2OYSA 4HEJA 4LJ9A 3R23A 4QNRA 2YIMA 1P3JA 3VTAA 1QNFA 3TCKA 1U5BA 4N0MA 3ZEAA 3RSFA 2PS9A 2AF4C 1XLUA 2PUTA 2IEYA 1G98A 4LRWA 2O8CB 1X7WB 1X14A 1PT9A 5H1YA 3LDFA 3SSOA 1AK1A 2OCYC 4EPVA 5EJEA 5ALLA 4MWSA 4RTRA 4Q9IA 4H4EA 4S1PA 3N0RA 3P9IA 4V1CA 3QYAA 4UOQA 1O08A 4LXQA 5JCZA 3T7RA 1WETA 3HSKA 5BV2P 3FOAA 4MYSA 5I45A 2AEFA 4DGSA 3H2HA 4DLBA 3M7IA 5EY5B 1C7FA 3H5WA 4N5DA 4AY4A 2VJMA 3ZR4B 5IMBA 2DQKA 2D5AA 4IXWA 4W1PA 2C9DA 3AGPA 3RT1A 3ZGOA 4R1SA 4YAGA 2Q3JA 3D8NA 1E5LA 2C2GA 3GLUA 4DVGA 4RTJA 2G04A 3L7JA 1E7RA 1WXXA 3IKVA 3MPUA 1HETA 5TR9A 3FSJX 1YRAA 3P20A 4H1UA 4RANA 1WUKS 3B20A 3GELA 1E59A 5HK8A 2XVZA 3PYMA 2NQ8A 4IDAA 3OSZA 4JS0A 1XJ5A 4NYIQ 1R1DA 3JW8A 3OTHA 2F9MA 4EABA 5FTJA 2QP9X 3RHSA 5KTMA 3CXUA 1BO6A 1GGFA 2AZ4A 2BRUA 2Q2VA 3G3EA 4DQ0A 1EUYA 4LNUA 5HTKA 4ZRNA 1L5OA 2YV3A 5TNXA 1DV2A 4PAOA 3UFBA 3N5KA 2L82A 3QU4A 3FPHA 2RHOA 3GAZA 2PMCA 1HE4A 2ZSEA 4UMDA 3EGIA 2IY7A 5J4KA 7MDHA 2C2KA 3OM0A 2W2KA 4HX9A 3AETB 4DUZB 3VZSA 1MO3A 1SHKA 4M0MA 1II9A 3PWKA 3TW6A 2X8BA 1TM2A 3BTVA 1ADFA 1A5SB 1B0PA 3G9QA 4G5YA 1OGYA 2PZAA 2PUCA 3W90A 1G3QA 3QKWA 5KOHB 5CT4A 2AMYA 4IX9A 4QBFA 1ESDA 4R8RA 1WB9A 2G28A 4YASA 2MSKA 4YCMA 2R4QA 1PJBA 2PWBA 3ZW8A 1GQRA 2IS6A 3V1TC 4ARZB 1Q15A 1TK9A 1IZ7A 4M0DA 5C7OO 4IV0A 2CXUA 2XNDA 3HVRA 1K0FA 3U7GA 2W0MA 4EYSA 2ZIVB 5DJ5A 1ZGCA 3EHEA 4G4SO 3QTTA 4OJYA 1V39A 1CUAA 2CVPA 5KTKA 3EZ2A 1ZNXA 3R5KA 5TV2A 3SE0A 2IQIA 2XYVA 2I55A 2ZWVA 5IKPA 2XT9A 4KXQA 3UV3A 2BPOA 2RJNA 1NBMD 5JSZB 2COEA 1Q83A 2AN5A 1A95A 2CBXA 3MS2A 1J9EA 3EXEA 5K3EA 4MV4A 5EQFA 5FAXA 3M81A 1JG1A 4N47A 1SELA 3ILYA 4LE1A 4WZBB 5G0TA 4F9FA 4D9EA 2C4NA 2IZZA 4I4CA 4QTTB 4R9UC 4W82A 2VS1A 5IW8A 4UQOA 5FYQA 3BK7A 4EO9A 1H2AS 1L5NA 1ZCFA 2I7XA 1C9JA 3BF8A 3PDIB 3BS4A 4I6GA 3K1AA 1EDZA 3OHMA 4IQ4A 4TV8B 5P8WA 3RSQA 4Q3LA 5J43A 1F7UA 1EHCA 1O6GA 3EZ9A 2ZRIA 4YJ2F 2QTAA 4OHCA 4I4NA 5C1IA 1SZPA 4EG3A 4I19A 3NEJA 1X7DA 1O0BA 3PT9A 3MEQA 4X45A 4P31A 1AXRA 1R10A 4OHBA 3KSBC 3B3AA 3ESDA 5BSRA 4Q1DA 5L6LB 4WN9A 1S5PA 3KAJA 4CG1A 1OTXA 2Y4OA 4IR7A 1J24A 5JMPA 4BMYA 1EMDA 1WA5A 1F60A 4BHTA 1T5LA 4LRQA 2QZJA 4CR8A 1U3UA 5K3AA 1PEDA 3SVTA 1WBDA 3FSGD 5FTWA 1B6SA 3UK0A 2RD2A 1POXA 1I32A 2ECQA 4ML3A 1H9BA 3GRVA 1QZXA 4XGNA 2V5VA 4C03A 3JZMA 1JEYA 1L4MA 5CVDA 3RS8A 1K3FA 5HKKD 5DNYB 1E3SA 1QX3A 2JGEA 2IEDA 3FFBA 3IOBA 3IXLA 3ZV6A 1G2IA 3HNPA 2R6CA 4NONA 4MIEA 5K8CA 5FNVA 1HYHA 3T7SA 1FTQA 1QKKA 3OZIA 3Q85A 3VHXB 2YV1A 2IH5A 1KERA 3IRVA 4UUMA 1DEAA 4OYHA 4QFDA 1B6GA 4BC0A 4M9UA 2GEKA 5TF0A 3A31A 1RPNA 4EJ6A 4O63O 4P1ZA 1OIXA 1G5TA 1XAGA 2FWRA 1LPSA 2NN3C 5AOCA 2FI1A 4L0DA 3NBUA 2WJWA 1XRSB 3B6JA 1LPOA 2HDOA 2G4CA 3CVYA 3GWZA 2W6OA 4IMRA 3DBHB 4J29A 4F72A 2YYAA 3NWPA 4LS3A 3C7DB 1FSPA 3N86A 2I62A 5KJ1A 1NPTO 2IY8A 3OF2A 2FZWA 5LJLA 2H17A 3VR4A 2O2HA 4ZOLA 5A5GA 4ENSA 1JLRA 5JNVA 2VHQA 2NZ8A 3O4RA 4DIOA 4MVJH 4J76A 2HU5A 4QEDA 5BXYA 1PL0A 1MG5A 2P4SA 3JR3A 3QE4A 5CX1B 1ETUA 1L8QA 3CZ4A 3BSYA 3HL4A 3B6EA 1EPUA 1PQUA 3EGXB 2B94A 4JBXA 3ZJUA 2EARA 2XZOA 3GMTA 4OJMX 3LK7A 4JBWA 5LKAA 4PIMA 2ESRA 4A8HA 4JFRA 3W1VA 3LH5A 1SXGA 3EGEA 2PMEA 2DXIA 3WBJA 4GICA 4BNUA 2ILTA 2VT2A 5YASA 2QJRA 1J1ZA 2AEJA 2BGIA 4RDHA 2PRKA 1WP9A 1C41A 1CQXA 3D3QA 1E6LA 4ZO9A 2TMGA 2ZJ0A 5AVOA 4P35A 2OBFA 2J3LA 4PR0A 3KALA 1NSFA 4G9BA 3VR3A 4DLAA 1UP4A 2LDBA 3DHNA 3PIDA 5GZ6A 1Y5IA 5EMLA 2IA5A 1RXUA 2O59A 4P0TA 1H1LA 1TJNA 4DDKA 5ITZB 3AHJA 1HZZC 1XZQA 3KZVA 4XYLA 3AQIA 4AJ1A 4IHJA 1PV1A 4HNAA 5A0FA 3AR7A 3W34A 4G36A 4I08A 1SBTA 3WGYA 1TM5E 1YRLA 4UE6A 1D8AA 1XO1A 4GT1A 3JX9A 4S0XA 4U2CA 1GU0A 2JA2A 3N58A 2LD4A 4JYMA 4YQZA 5DTMA 5LZ7A 6REQB 1CUIA 1JQEA 4BFZA 2QE6A 4HFRA 2Z58A 5JNSA 4CF5A 2PKQP 1L5SA 2DETA 2XAUA 2YMLA 4Q7EA 9GPBA 1M76A 1DBRA 1NVVQ 2PYZA 3DHYA 4BJ5A 1L4UA 1DHTA 5THKA 2HLDA 5AM3A 1GM5A 3B2EA 5JJKA 3ISVA 1NP6A 2BD0A 4LE0A 2FK7A 2NTEA 1P3DA 1DAEA 1D4FA 2XA2A 3AB3A 2ZTUA 3CWQA 3A6HA 4ZOAA 2I66A 1WPXA 2OHXA 1M5UA 1ZA1A 4GP6A 4JVMA 2R1VB 3RB8A 3I5XA 3E4CA 5KNLA 2I22A 2V7PA 3JQFA 2ORWA 4GEGA 4KFRA 3RNLA 3EVTA 3U3KA 3BRWD 3DDWA 3S3TA 1PV4A 5C4IA 3GEIA 1NX9A 1GFIA 4KHPB 5H16A 2D0DA 1XTTA 2KE5A 3RUCA 3WGTA 3OG9A 4BCBA 4ZQFA 3VQTA 1KSJA 3VR0A 1E9SA 5T57A 4WXPA 5ECGC 2H4JA 5D85A 3WL8A 1LW7A 1XQWA 1OV6A 3AFGA 3EOAI 1K27A 4NR0A 2BC9A 2DHRA 1ZJWA 4NDZA 2VUHB 4N01A 4YJKA 3KP1A 3FPBA 4YS6A 2PNFA 2Y1CA 3DE5X 5IHXA 1MCZA 1RYBA 2P6NA 1CUEA 1UQTA 1QAOA 1JAXA 1JUDA 1GSIA 1SUFA 1FMFA 5C8YF 1GQYA 1CLUA 5KYKA 1L2TA 4ATNA 3ZVLA 4YIKA 3WNVA 4Q9HA 1ZCBA 1UKZA 3MCAA 1VHWA 1Z56C 3CA8A 4HI0E 2G0TA 2V7EA 2DC1A 4V0QA 1F1BA 1SQ5A 1UPXA 1EFRA 3O8LA 3P9SA 4M4SA 4QIHA 1Y6JA 4TT3A 2I3ZA 4MVJI 5KC9A 1KO7A 3F4BA 1FQOA 4ZIRB 1L4FA 4FMPA 5I7SA 2BTOA 3JPWA 2D1YA 1XTBA 1DQNA 4HLUC 2ATIA 2G5TA 4QU8A 4ESHA 3TX6A 4K88A 5C7YA 5HJ5A 2OT3B 5KHLB 2GASA 1SBIA 3IIKA 2VA8A 3LIIA 5JQGB 2DBVO 5BSFA 6AT1A 5HIIA 5JJCA 3GLGE 2Y0EA 4JENA 3NOXA 3OCVA 4Z4FA 3OQOA 1SCNE 3REFA 1JEQB 1MH9A 1R27A 1Q7TA 1J99A 1DV1A 1N8SA 2XGSA 3EXIA 3LY5A 3PICA 3Q7PA 4AVYA 3O2QB 1N32B 3KRTA 2AOUB 1YVRA 2WB4A 4AT1A 5L95A 1FNSA 1MKYA 5FFFA 4DJTA 1I80A 3I45A 5IK2A 3CNOA 4R3NA 4KTTE 3SLRA 2HU2A 1TIKA 2Q6IA 5ED4A 4B17A 5PGMA 1KQOA 2GCPA 3GGSA 1EUCB 3DV9A 5FTMA 3SHTA 5JUWA 2GM4A 4O1IA 1NJSA 3OJXA 3O2JA 4OP3A 5AVWA 2BGMA 1XBTA 1YCHA 2RGGA 3LTEA 3MMXA 1B8UA 4TWAA 5IT5A 1CVIA 1SGWA 1JFTA 1JA0A 2F6RA 2H4YA 4PONA 2LXNA 4FCCA 4AY6A 2F8TA 3PUWA 2HPVA 1T4CB 1B41A 1YIAA 5AOBA 2IUEA 3E84A 1DRWA 5BN1A 4DHWA 2ZWAA 2RJOA 5E6RA 3WLLA 3KB6A 1RXCA 1E6CA 2F00A 1ILWA 4IHQA 4K9LA 3ETNA 4MZXA 5E9WA 3TGPA 1G21B 3QF4A 1P33A 2YR0A 3TRFA 3GLIB 4R01A 1P0IA 2XQVA 4D97A 4FKBA 3TTWA 4ZKDA 1GADO 4KVAA 1KQGA 1VSUA 2JGAA 2VZEA 3DNFA 1GNLA 3LC1O 3WTCA 3G02A 5CB8A 4JI4B 3R9XA 2YOHA 5DNAA 1CIJA 4FX5A 3DE2X 2HNBA 3UJHA 2OV3A 2JBWA 3CLTD 2WMDA 4EHHA 1LTQA 3HCEA 4IO1A 3ZU5A 3QIAA 5CXSA 4PLCA 5DNWA 2C9BA 2I8CA 2AE1A 2JK1A 2RH4A 5TMBA 1GA4A 4H1HA 4YRMA 5CNMA 5TJ9A 3UWOA 2WSMA 1SAYA 2AFIA 1TKCA 3LT2A 3ZC3A 4G0UA 4LIPD 1TMOA 1NW8A 2BGNA 4RKFA 1S3IA 4AMBA 2LVBA 2BEWA 1U1DA 1CJTC 1WMSA 2ZE7A 3PX2A 4N7JA 1NUHA 2BIFA 1NBOA 5L3QB 2C8KA 3W9UA 4RHXA 3K0HA 4MGKR 5JD3A 4AI6A 5J59A 4HNSA 3A6LA 3K1JA 3TFQA 5D7BA 4F4JA 4MV3A 2R79A 1G60A 3A37A 1C3JA 2WE8A 4RGVA 2QMUA 3LY7A 1DKQA 3B9RA 5EVCA 3ZLBA 2YXLA 5KOIA 1HXHA 3FCSB 4MV5A 1P2VA 1ZIXA 2VQ3A 2XXBA 5AW4A 5J4VA 2BUAA 1RCUA 5CBPA 2GQ0A 2IIVA 1EYZA 2WFLA 4LGMA 4ZRMA 5EXXA 3PHJA 2CK3D 3EGVA 5INTA 4A03A 1ECPA 2ZB3A 4TKUB 5AKLA 2FSPA 4QULA 1NHGA 1FUKA 1JT2A 3NJRA 4I5IA 2ZB2A 1FVFA 5EIBD 3E9YA 2OV2A 3A3PA 3NNDA 4C0QC 1P9WA 2BJWA 1XU9A 5K8IA 4XOIA 1AMOA 3IR7A 4MRMA 1IHXA 5JO0A 2VDPB 3CISA 1HFKA 3RVPA 1X80B 3BZWA 3V1MA 4GZ3A 1QDEA 1WZEA 5IKMA 3OE7D 3FVVA 4XDYA 3VVBA 3V8BA 2VP0A 4S1NA 4K1LA 4ZPXA 1SVSA 3IEXA 1ML3A 3PRHA 2HB6A 3CBQA 4UD2A 3FF4A 3FWNA 3ZW7A 4ESEA 3KXPA 4DMMA 5LP6F 4EMBA 4JBIA 4DSNA 3ADBA 4MS3A 4WIAA 3PLRA 3DZJA 3T1TA 4I5EA 1R0ZA 3ZZTA 3RC2A 1E9FA 4ACBA 1KYQA 1SC1A 4MPPA 2G67A 4YONB 5CYOA 4HN9A 3C6QA 1RXEA 3HACA 5G02A 1C2TA 4H15A 1ZVKA 3A0UA 5LBTA 3T3PB 4EHFA 1N2CB 4B6OA 1E4EB 5EIHA 5K3CA 4IHAA 1DT5A 3WKDA 3B3FA 4CKXA 2O2XA 4W5QA 2G70A 4M1OA 4ETMA 5MN4A 2R7LA 1JG7A 1RJ9A 4KSBA 4OYYA 1XZJA 3VGPA 1L4GA 4YRNA 2BH2A 1U3FA 4RTSA 5AI9A 1AF7A 2V65A 2HCRA 2VP2A 4NF2A 4PSAA 2NVUB 4TWJA 1GA1A 5A4KA 1KIFA 1RI5A 2C3YA 1KEEA 1V6CA 3AHCA 2QPOA 3FBGA 4YJDA 5HCNA 3ZYCA 5MFPA 2I4RA 1XZKA 3DC2A 5LC1A 3PEFA 4EY4A 1K1EA 2CHFA 2A1TS 2VWGA 3BL6A 4HZUA 4HP8A 5A5VA 1EB8A 3BIOA 3LSTA 3OEED 4QVKA 4ZANA 4B81A 4Q7JB 2X7JA 1RP1A 1O0CA 5F3RA 3Q7SA 3JQ8A 4ZU3A 1OX5A 2J0VA 1N9KA 1NMEA 2WM3A 3FJYA 1Y1RA 5CURA 1F2UB 1SVKA 5K6AC 1ULZA 2BEUA 4Z3KA 3KCNA 4M88A 1YC2A 5IAGA 3JD3A 3UAOA 2JIMA 2UYGA 4HEQA 1ZH4A 4B3HA 1PR0A 2IKSA 5EXDA 3AY6A 3CVJA 3HHPA 4YP7A 4RETA 3AT1A 1M2GA 1YQEA 2HJSA 4PPYA 1DIRA 1KYTA 4H16A 4NXMB 1U2PA 5L7WA 1S8AA 2WZBA 3ZG6A 2DPYA 2FSGA 4LY9A 3HXMA 1SXJA 2Z1MA 1PJZA 1O58A 4LDAA 4EQ6A 3HVJA 3ET5A 3RIYA 3I76A 1K6MA 3UO8B 4ITUA 4JR0A 1Z2OX 3JPYA 3T9CA 2JFNA 3ZHZA 2JLYA 4JI2B 1F9AA 1WV1A 4H1TA 2KBEA 1ZUD1 3T4UA 1KDYA 3MTDA 2HSWA 4FXPA 4RAOA 4EUEA 3EFEA 5KSZA 2X15A 4EL0A 1XTUA 4QJ5A 3UGQA 1E69A 3V7NA 3RRBA 4CODB 1R0BA 1RE0A 4KO3S 4QOJA 3O0TA 3MCZA 2R6GA 4ZV7A 3STTA 1JPUA 1SCKA 3QVKA 4C7VA 1P9OA 1I4TD 1UC5B 3HU5A 4PZZA 1D2CA 1Z88A 5I7AA 3V80A 1PLKA 4ALKA 1NLZA 4DNOA 1U28A 2Z09A 4P22A 3LDGA 2OORA 1O5TA 3FDZB 3UT0A 2AFHE 4F21A 3K70B 2XWSA 3BJMA 3H0EA 3PC8A 4NECA 2O0KA 1PBNA 4YAUA 2X5KO 4ZI7A 4DNQA 1E2JA 5K4GA 3TZQA 4QGHA 1G66A 2YRWA 4TLCA 4F2GA 4ZVVA 1PS8A 2YQ5A 2HA6A 4JYPA 2UYHA 1WMBA 5C37A 1Z8HA 1DJNA 2ODEA 2Z1DA 4MIOA 1BCRB 2Q9AA 1I51A 4TMYA 4AKEA 1EWTA 3D64A 1QGZA 4TVOA 5LXTF 2MDTA 5A6SB 4JJFA 4KPUA 1AHHA 4TZTA 3M8KA 4H4CA 3OCUA 1THGA 3QEMB 4RKEA 1A8SA 1UMBA 1ZDMA 3ETDA 2C7PA 1D2RA 4CNBA 5I7OA 1XRPA 1BDMA 4XX0A 4P3XA 1A77A 5EXPA 1PVOA 4U6NA 1Y7TA 4YHBA 5IBQA 2PS1A 3GFGA 3H3FA 1TU0A 4CQJA 2ATVA 4ZT6A 3T7KA 3ZGLA 2D2VA 5EERA 1H9CA 3BGIA 1IWPB 3KL4A 2REQA 3RODA 2GXUA 2ZRBA 5J2UA 3CC8A 1TIPA 4JQZA 3QX8A 5CW1A 5FBLB 3BDAA 2LZ0A 3DULA 3GRPA 1W8DA 4D4HA 4EY3A 2BMWA 1U31A 4F3YA 7REQB 2WIDA 1J9ZA 1XA3A 5G1NA 2IPXA 2MCFA 3PXXA 3GFPA 1FYEA 2PA0A 3LCVB 1OAKA 1QOPB 4FEGA 2GT1A 4GP7A 4ILKA 1ZN8A 4IV8A 4J75A 4JL8A 4UQPA 3TN7A 2K7FA 2K2QB 5JPCA 1XE3A 1A4RA 1C7ZA 1DAHA 1U5BB 1Y89A 2H2FA 3O03A 4RCYA 3RG8A 5J4LA 5FV4A 1HE2A 2IZ0A 2XQJA 3HYTA 5CHYA 1MOPA 4QGAA 5F33A 3DE4X 1AO0A 1QGYA 4FS3A 4L4UA 5DMHA 1JR3E 1NXSA 1NHWA 2PZJA 2E82A 1Y1TA 2IPAB 2XOKD 3C14C 3DBVO 3E7WA 3N7UA 3P9NA 4OGKA 1WXGA 1XZ8A 3L93A 3Q7TA 4BFWA 2Q21A 4LMPA 4V1CB 3WB2A 4P3YA 1LK5A 1EFKA 3AR3A 1GD1O 2IXFA 2VDLB 2VPQA 4ARCA 1NONA 1QQBA 2PEZA 3AFOA 4IEIA 5ALHA 1U6JA 3DAFA 3LT4A 5FI5A 5TMDA 1QFYA 3AJAA 1AKWA 1ULAA 2VJMB 1DFHA 3MSCA 4PHGA 1M0TA 3TQOA 4B82A 2RI6A 5J1SB 4M0CA 3P4XA 3PEEA 2M32A 4RVNA 3GAMA 3H9JA 2QN1A 5HOQA 2B69A 3KTFA 4L5YA 3I01M 3GLQA 2RB5A 4HG2A 4P83A 4RCVA 1GL6A 4IDQA 2DFDA 2Q5JA 3H5TA 4JP1A 5DW0A 1QCZA 2Y66A 1U7DA 2FETA 3LQFA 2QW8A 4B32A 3GJTA 4LHZA 3RS9A 5AJXA 4AICA 2PUAA 3G13A 4AYWA 3E61A 2OQRA 3Q5GA 4NXNB 2HMAA 4IILA 2Z5LA 3AEZA 2DWOA 1WKBA 3O4VA 2QA5A 4LNUB 4MTCA 3WOVA 1EDEA 1FNMA 1CC1S 1VMAA 4ZT7A 4DDUA 3SGLA 3AUUA 4W9RA 2D3TA 5GOTA 4R5HA 1N78A 4R71A 3MLAA 4OB6A 4AUEA 2ZITA 3DJFA 5K05A 4OKNA 2P3OA 3N2LA 1ECGA 2PMDA 1TUBA 2W2KB 3KM0A 4IIGA 2GZMA 5FIUA 3W7AA 1UT6A 3OWOA 4GBGA 3HWWA 2C29D 2VT3A 3V3KA 2JLWA 4U3JA 1VJGA 3DWGA 4BU0A 5GIOE 2A2ZA 1KY2A 1J5PA 3HWRA 1MVNA 2DQSA 3OUTA 3QITA 4KTVE 4ZQIA 5DXJA 5EMNA 5TEWA 3ZH2A 3W5DA 4HNUA 3EC1A 2OENG 3R40A 1OXMA 1KDZA 1NDHA 4A0SA 4EKYA 5ENZA 1N2XA 3L6RA 4D0RA 4LAFA 2GYYA 3KWMA 1D7AA 3HVKA 1NN1A 1RRFA 2Z5FA 4UNQA 1KOFA 1OGJA 2I1WA 3DEYX 3OZAA 7ABPA 3LD9A 1L7RA 2IXTA 1K06A 3VVLA 1ORRA 1YJXA 3PXUA 4IJVA 1RBQA 5D3ZA 5F1YA 3HBFA 2I4TA 4EG8A 1MVOA 1ZC3A 4JUIA 2BISA 5BUZA 2ZRMA 1LK0A 3CGWA 2OV1A 4EJSA 1IUOA 1P44A 2PA3A 4XUEA 3D7KA 3LVQE 1VMKA 4DAEA 2QLNA 1E1KA 4BO3A 1JW9B 2ONZA 2P2NA 4F8EA 2AJLI 3LUGA 4TZKA 4PWYA 1C30A 1Z35A 2J6IA 1JDBC 2OEPA 3DFMA 6ABPA 4ZVKA 1J9GA 4P8RA 1KI7A 4YMSA 4G2NA 2VJOA 5JYCA 3OECA 4YMGA 2WU4A 3K1AB 5AVZA 3L1UA 2QUKA 3UFXA 1KZ6A 1P1FA 3TRHA 5TS2A 1H65A 2CJYA 1PR6A 2G25A 1WBJB 2WWHA 5B1DA 3O2SB 4Q39A 3UHAA 3WGHA 1TGYA 1JALA 1LQ2A 4IJWA 1YFJA 3K15A 1G9TA 1KTIA 1B8PA 3BXZA 3JWEA 5CU7A 4J3JA 3U9SA 4E1AA 4A15A 3NNNA 1PFUA 3UJ7A 4WN9B 1FFAA 3FPEA 2QUZA 3DOJA 3PHBE 3RT9A 4EA6A 1JG2A 1I0LA 1O7JA 3IH5A 2PZEA 1PUIA 4WKGA 4D9BA 4ITVA 1DG3A 4RCZA 5BUCA 3WK5A 1KZYC 1EM8A 3ICCA 3LT0A 3NNSA 1Z7EA 4LHWA 1PL6A 4QXOA 1WW2A 5AK5A 1CUHA 2WF8A 3CF6R 4J4BA 2IX9A 1GPDG 1R5OA 1TUIA 1XXLA 3CV3A 3GJYA 3KKKA 3LVBA 4MWDA 4NK5A 5HUQA 2XUJA 4EJ2A 1QGOA 2WTBA 2AK3A 1KJ9A 4D9IA 4URVR 1NN3A 1Y6RA 2FPGA 3HQ4O 4BCCA 4BRSA 5JJIA 1Y8CA 4PTLA 2TMDA 3EWNA 3OHPA 1W4BA 3BIFA 4ZQHA 2QP4A 1MXFA 2E4VA 3OESA 4ZI3A 2D0OB 1MV8A 5HM8A 2QM8A 4IQ0A 1R8JA 1HTWA 2HHAA 3C85A 5FNVB 4AKTA 2IHUA 2VBIA 1UBFA 2G9QA 3NOVA 1W4ZA 2J5BA 3G2QA 5CLGA 1JLMA 2E85A 1ZMXA 3DTTA 1P19A 4ND4A 3TD9A 1FFXA 3DAPA 4BNDA 2FCRA 3HA5A 1QIJA 1RMTA 2GEFA 3QVMA 1KI4A 4DBLE 4LDQA 2O06A 1YK0A 3D1JA 4J0DA 3AHIA 3FHOA 1N7IA 5CNKA 4C7MA 3FUXA 1II8B 1R6AA 1YQQA 1S89A 2PSDA 2M1ZA 1Z6GA 2EJWA 5FUWA 3CPJB 3HFSA 3DD1A 2LUOA 1KAOA 3FYTA 4B3DA 3D8UA 3K05A 1W5TA 2RGUA 3FUVA 3LDUA 4KSYA 4ZOLB 4G0VA 1U1CA 3V1UA 3E58A 1JKIA 3I9FA 1BS2A 4ARBA 4E2WA 2YN4A 3BM5A 3SM3A 3DPUA 2OHVA 4Q9AA 3ETCA 2G8LA 1GPLA 3GGPA 4HSGA 5A9SB 1ZAYA 1KRWA 4RSMA 2XCRB 1RWOA 5G4KA 4MVJG 2PQ6A 2DEUA 2TECE 4ENTA 5BOSA 5C35A 4FZRA 3R3SA 4U9UA 3D8SA 3V1NA 2X9QA 1XDGA 5JEDA 3CZRA 3COJA 2JLAA 1XDBA 1Z7GA 2VK1A 2NTJA 4DT1A 1G3MA 2ZRLA 5GPBA 4ARIA 1ZNQO 3W7VA 2J87A 1F17A 1CPYA 1FNNA 4K8RB 4V0KA 4ZVSA 4ZWNA 1TFRA 3ONEA 4XYMA 2I33A 5ALFA 4L3VA 2O6LA 4LPSA 2NO6A 2ZM5A 4A91A 2PQMA 1J42A 4S1WA 4ZAGA 2PFKA 3HA7A 3HKDA 3HYLA 3V1KA 1NVDA 4EMUA 2PGOA 4UTPA 4IVPA 4JA0A 5MN5A 1QU2A 5AD1A 1E5QA 1W2WB 4ZJZA 3X43A 1XVAA 3A2KA 4PE5B 2ZKLA 2E4ZA 2H52A 1AHPA 5DTEA 1T4MA 2HM7A 2PL3A 4YB8A 2ZJBA 4QVIA 1H1LB 2IYOA 2WHRA 1EQUA 2VZ8A 3FAKA 4F5DA 1TVCA 5BW5A 5TVGA 4QTXA 2BH9A 4IHJB 3ELWA 3G6WA 4HNAB 2OFOA 1AS3A 5ETJA 1S8FA 1IDN1 4IDOA 3AR2A 4JEIA 5JISA 4OU5A 2C4UA 2E5LB 1Z4JA 1SUAA 1J1UA 2G77B 2ZS7A 3IX7A 2W6JA 3BUSA 4RK1A 3UHOA 1P8JA 3WKCA 2ZIWB 3L01A 1JKFA 3ILSA 1L3IA 5EP1A 3FTCA 1FCJA 4FYHA 3WGZA 2PH7A 1CXZA 2Q7DA 1PDOA 2O5RA 5AQEA 4ZVLA 1UFQA 1N1EA 1X9IA 3KK0A 2XDWA 4IIUA 3V8PA 3OO0A 4CM9A 1XUOA 4PG5A 3TLMA 4D99A 3G2JA 3CM0A 4ZYUA 1O1YA 2ZROA 3E2MA 1RKXA 2HUNA 4LXTA 3UAZA 3UA4A 4ND1A 4AP9A 2PCLA 4FE7A 5K8JB 2C57A 1N5OX 4MO2A 2PANA 1C29B 3CPHA 3ZJYA 3BKWA 3P2JA 1TCBA 1TZBA 4EOGA 2PL9A 3GEBA 4IVNA 3TBHA 5CVCA 4ENQA 2O19A 3ZE6A 4MQEA 1Z7BA 3ZCXA 2B4TO 1QLJA 3SBXA 3ZDEA 5EQDA 4PR3A 5AI6A 1KORA 3O4IA 4TUYF 1ISFA 4LWZA 3NX4A 1QTNA 1YFZA 3FBWA 4GKAA 4P58A 4NBTA 4BLUA 3UAXA 5A03A 1OH7A 4LNAA 4H1WA 1DFIA 5CDUA 3MB5A 4L74A 4EFMA 5G0UA 2CLIB 1NFRA 4NHOA 3OQVA 1OV4A 1UKCA 1SUCA 3KAPA 4WTOA 1K9SA 2AV6A 3RIGA 1BX1A 3QPWA 2WUEA 3ZQJA 1MJGM 1U5CA 4FYWA 1WL8A 4MWOA 2J7PD 4LSGA 5D00A 3PQ7A 5FFMA 1GPBA 4IDEA 4YYEA 2L69A 1X74A 1FJXA 2Q4DA 3OI7A 4XVQA 4D02A 4BP9A 2REBA 1GZ6A 2FX3A 2H0RA 3ZWAA 4CG3A 1NXOA 4TRRA 5A5DA 1ZK0A 5FWNA 3MUFA 1NWCA 4RYLA 3V97A 4EG4A 1WU7A 2I1LA 4TYPA 2Q2WA 2XRYA 2RGWA 3E48A 4EUKA 5M04A 1RPJA 4K5QA 2ZZKA 4KC0A 5H3CA 2EBWA 5IAKA 4BB0A 3NV7A 1V5IA 4ND2A 3ZNPA 4I4IA 3SIXA 1I6LA 5EMKA 2B4AA 3WIOA 3O9MA 1ZN2A 5HXAA 4JMLA 4MUBA 1UWLA 2BMJA 2HRRA 3O95A 1HYQA 4I50A 4KPGA 4C04A 4ZCIA 5SZKB 4KVZA 2H2AA 2HCFA 1JHPA 4G0PA 1XHEA 4HNGA 5IFLA 3G2NA 4PICA 4N6GA 3WICA 3TD6A 1JE1A 1UEJA 4HAWA 2A9KA 3EY4A 4Y9DA 3ZWXA 1PBTA 4OSOA 4ALJA 2GYUA 3CCBA 3HP7A 1G8AA 1DWOA 1GTL1 1FS4A 4GOND 3UOAB 3EXIB 3IDZA 2BM1A 4H0NA 2EKLA 4RD0A 4XX1A 4YFVA 3TJZA 1L7EA 2XITA 3Q3JB 4TWBA 4RADA 5FI0B 2X6RA 4DWOA 4NFYA 1Z4PX 4M60A 2P3QA 2EBHX 1NF3A 2WKRA 3MTEA 1Y0BA 2VEOA 4N39A 4KR3A 4C4XA 2A3RA 4RORA 2WILA 4GI5A 2AJTA 3V9PA 3F73A 3CUEF 3WBFA 3LC7O 4UC0A 3SKVA 5F1KA 2DG2A 4E46A 4S0ZA 1EM6A 5JROA 2CZQA 3Q5DA 1UBUS 5FL7A 4E1VA 1CU1A 1D6JA 5CH8A 2EL9A 4MQFA 3C5VA 3O9ZA 1G17A 5K3FB 4HXGA 4I55A 3VPBA 3C3JA 2C20A 4DTIA 4YCLA 3C6ZA 3D6MA 3NV9A 3JARA 3VTFA 2GSDA 2RAVA 3ROQA 2YIVX 1OZFA 5K09A 1X7ZA 4M0KA 1OXBB 4KYUA 4ZAYA 2DKFA 4KDEA 3K8OE 5CNJA 5E6RB 4PG8A 2C2WA 3SIPA 4JI6B 2D00A 1XVUA 3QF4B 4MI9A 1PQYA 5F1PA 1M6VA 4XSGA 5EGSA 4BBAA 4GVLA 3RJZA 3R9XB 4HQNA 4BASA 1KJJA 1WUJS 4C07A 3T7IA 2UV8A 3K09C 3DMTC 3HP1A 1KQ3A 5K2OA 3LBNA 4OGFA 3FDIA 1Q1NA 1W52X 1EE2A 3E3LA 2DJ5A 1X1QA 4R51A 1DX6A 3UB4A 2XVXA 4OUKX 3NW9A 3UK2A 3HU1A 3P19A 1O6ZA 1QHFA 1OT5A 3MJSA 2AFIB 1YRYE 3P71T 2Z8YA 3DEHA 3H6HA 2Y1XA 3PCTA 4OXQA 3CF0A 3KB1A 3KR1A 3MINA 4ZREA 4MUFA 1YAJA 3ZWKA 4ZVQA 3DF9A 1HL3A 3NTQA 2VF2A 2VNAA 4PYMA 2BEWB 1W4AA 4BAGA 1CY6A 4MR8B 3UUGA 2EFYA 3MM4A 4YO8A 2Z5VA 4D8YA 4G0WA 1V3VA 4PYLA 3CO5A 4KLAA 2IOHA 1P1BA 4QOGA 1OA1A 1H6BA 1HF3A 4W99A 4O0MA 5DNVA 3FFWA 4CKEA 2PKCA 2FHPA 3LBFA 3DBIA 3NH9A 1PJ8A 5D3QA 4AJOA 2Q9CA 1NQWA 3L02A 4F8JA 4JYBA 5CBPB 1U9CA 2WFLB 4BP1A 5B37A 5AK3A 1PLLA 4JT9A 3TW8A 3GJZA 4P82A 4Q03A 4BS9A 1VSQA 5B6PA 5CM2Z 1OQAA 2ID8A 4KRGA 4BV8A 1EG2A 2Z95A 2O1WA 2HU7A 4MUMA 3UMCA 4ZZIA 3WHLA 5CAEA 2XD9A 4UUNA 4WVFA 3HU2A 2BKVA 1P6UA 1T3TA 1X8XA 4V02A 5BN4A 3CU5A 5T6BA 4BVGA 4MRMB 1Q7RA 3L7OA 2O3QA 4WZBE 2C9CA 3R3UA 3H7AA 2BE7A 4M0FA 1KIMA 3T5TA 1Z0FA 2PD6A 3QEOA 5BURA 2VYVD 2J7KA 3RU9A 3A4TA 4NYJQ 4CEHA 4U02A 2FJ0A 2X9NA 3NHKA 1TYDE 2BUCA 1QYXA 1IBKB 4U2KA 3QTLA 3UOGA 3W5IA 2PH5A 3WNDA 2CYCA 4L08A 3ECSA 5A9TA 4O08A 4CI0B 3B3GA 5DULA 4GM4A 4MS3B 4XRRA 4Z0NA 4XJVA 5JWHA 5DHAA 5E95A 3PNKA 3T0FA 2O8BA 3MXOA 2AKYA 2FKAA 5IM4A 1BA3A 2ZIUB 3TLBA 2CFSA 5GTDA 1NW5A 4Z1OA 1CERA 1L7VC 1SA0A 5D2CA 2EYQA 4MQBA 5FCDA 3HWX1 2C9ZA 4AROA 1CUYA 4YTEA 3KV3O 2NP6A 3P0HA 4ZYTA 9LDTA 2G7ZA 3G6KA 1AG9A 3QKTA 3RAPR 3VU9A 4LJSA 2GO7A 4F04A 1LF5A 3PQEA 4YRTA 1BC5A 1VE1A 3ONVA 3S81A 3T52A 3I6MA 4JXXA 3AHFA 1W5SA 2HF8A 1IZYA 2CSXA 2Y6VA 3RVNA 1L8AA 1KEEB 5AM4A 1E3DA 1U3CA 4ZC8A 5LUBA 1D5WA 1KI9A 1Y6FA 1WP4A 3M9WA 5DNDA 2BE9A 4LNHA 1Y4UA 1HZZA 2ENUA 2HYDA 3HG7A 3AVOA 3KPVA 3S44A 1EX6A 4HZUB 1AQIA 1EVLA 1R74A 3M6AA 4RL6A 2Q6OA 4UM8B 3ROPA 4EECA 3EZFA 4DC0A 5CGQB 3LUPA 1HPLA 3QPUA 4HEA6 3JQ8B 1A8HA 2DFLA 2YWRA 5KNBD 3FZGA 4RMIA 3EVGA 4JJ6A 4RHEA 1L5YA 3C3AA 4E5MA 5DH9A 2FXIA 4JIGA 4HUTA 2BEUB 2QNBA 3DMGA 3IESA 3EODA 3RUAA 2IFTA 3GPDG 4BGUA 4FNGA 1JZSA 3MT9A 3PI6A 3WP1B 1DZ3A 4N18A 3B3JA 3J7TA 1VPTA 2H65A 3ICWA 1R0XA 5DGTA 4KE8A 4HQRA 4M37A 3PXDA 1GNTA 4WLFA 4I3HA 1HG0A 5E4YA 3WC4A 1C1YA 2IHVA 4Q3KA 1NDUA 5KUTA 1XMOB 3OEHD 4Z1MA 4TLBA 5DM70 1M1ZA 5JS8A 1L8XA 2IU3A 1SXJB 1XZBA 4QGSA 4WL0A 4AO7A 1PCXA 3F1LA 5DSZA 3LPNA 4EQ6B 2JI6A 1Z0DA 4MUEA 3W5UA 4R68A 1KPIA 2ZSDA 4I66A 4S12A 2SKCA 4ZKEA 3TZBA 4E4TA 5M34A 3CF4G 3IIIA 3O74A 4ZXFA 4Q1BA 4CTMA 2J3KA 3KWJA 2A9QA 1SCQA 2BF7A 3OA0A 4IGKA 3BRCA 4WPGA 1COWD 3DL7A 4L3OA 3A9CA 2GPTA 3RHZA 1J0DA 1UZLA 1I2AA 4Q1CA 4YV2A 2NO7A 3MUEA 5K8TA 4J7AA 2ZT8A 3D3EA 5CHEA 3X0DA 1BGWA 4CTNA 2PRIA 4QJBA 5BWCA 1VG8A 2XVYA 1Y3CE 2ZR7A 3D0OA 2VPZA 4RD4A 4D44A 1G1AA 2BEVB 3LX4A 3S1LA 4E3ZA 10MHA 2JCVA 2VCHA 1SG9A 3N0VA 3OQPA 3MFYA 1GZHB 4KIWA 4ZEOA 1WY7A 5IDYA 1RXWA 2VTVA 4NYMQ 3T0IA 1GLGA 1P2FA 5E7QA 1SOMA 4AY5A 2ZUBA 3T94A 2OSVA 2OO7A 3KR9A 2GD0A 2X0IA 3NALA 4I4TA 4O5OA 5EHIA 4ZI7B 2QU7A 2R8OA 2HR1A 1KH1A 3PNQA 1GCUA 4HLUA 4XUDA 1J0BA 2IEBA 3T0GA 1FMJA 1KVUA 1VLQA 1YWGO 3OIGA 4RJIA 4ERNA 3L7DA 3RAEC 1Q12A 2R44A 3UPDA 4DIUA 2X2EA 4YRSA 2PJRA 2ZBVA 4CRWB 1PNVA 4KPUB 4EEXA 5TIIA 3PT5A 4FBMA 5F7OA 4WXMA 1UMBB 1HFWA 3TNLA 1H4VB 3OMLA 4WKPA 4FR2A 4F86A 4CEIA 2FX5A 1E9DA 4RLQA 4PQFA 3G2HA 4XX0B 2O4UX 4LDPA 4YCDA 1LPAB 1OFVA 2OO5A 3WK8A 4AC9A 5BSWA 4ZO7A 3M3HA 4FEYA 4P84A 3VYUB 4LK3A 1W25A 4GEKA 5BT8A 4HUQA 3EF3A 4J4TA 4C22A 3X1DA 2WVJA 1D5CA 4FHGA 4KQGA 4A8TA 2REQB 4LXXA 2VFAA 3WOHA 5J2UB 2P4EA 4R2KA 5C5DA 2NO5A 2I3AA 1C50A 2B8TA 3PA8A 1L5FA 4KV7A 3VKUA 3D0KA 1UMDA 2ALJA 2GKGA 2OE2A 1AURA 3HBJA 4CTOA 4PX3A 1RP7A 3QXGA 2XNCA 1IQPA 3ZDQA 2PL5A 1Y3BE 2BKXA 1A7JA 3OICA 4JLOA 5EKSA 1ZZEA 4PLFA 2ZI6A 3TPFA 2PJUA 4AJLA 3W5JA 5BR8B 4IRUB 1JQKA 5ESWA 1QWOA 1NOKA 5CEFA 2VXYA 4N4AA 5J2TF 5CDYA 2WU8A 1UFOA 4CMCA 3OQBA 2XXAA 1W6RA 2B7BA 3T8YA 5HCIA 1GCGA 1DCTA 2H4XA 3B6MA 3AVUA 2ZRQA 5ALOA 3KHKA 5CXUA 2IYWA 4FNAA 821PA 3DOEA 4OMCA 1TF7A 3SX2A 5IJXA 2GNAA 1T0IA 4Y6QA 1UMCA 3T7AA 2WKWA 3T1YB 4QOSA 4PO8A 4RVCA 3RC7A 4REMA 2JW5A 2YFHA 1O6CA 4X7RA 5K7SA 1LU9A 2K2WA 3IOYA 4EPWA 5HFNA 1GGNA 1A3CA 4YQEA 1VFNA 4QHTA 1YJ8A 1UKYA 1XD8A 2JAPA 4CV2A 1CUZA 3EBPA 4LSZA 1Y1KE 4D9HA 4EJFA 1K7XB 3S7TA 4GKKB 3IE0A 1K5HA 4WNYA 5DHTA 1E99A 3SKYA 3GDGA 1TJ5A 4YRRA 2WPNA 5F5NA 4ILEA 2XRZA 1L4KA 3L49A 3PHLA 1DBQA 4ENWA 3ZHYA 5C1PA 2CL0X 1X2BA 1RI1A 4MA4A 4QYXA 4NMLA 2GDJA 1HT0A 3DD5A 3O3CA 4GNKA 2C58A 4E88A 5BQXA 2C7RA 4D3XA 2MU1A 4I8DA 3AEXA 1E77A 3LFUA 3EAGA 3HUTA 4DLPA 1MOSA 1PLJA 2BVNA 2DYKA 2OAEA 2X5OA 4L51A 4XWGA 5AI4A 5DO9A 5I5GA 4D43A 1YUBA 2VP9A 1H4SA 4RD3A 4JYAB 2Q2QA 3B3QA 2DFNA 4UOEA 3H13A 3OCJA 4R3UC 1V45E 2XMGA 3E15A 4LYJA 1ISHA 5LZ5A 1BVUA 3BMXA 3COYA 3AWIA 4LK2A 2BR3A 2DHEA 3I2FA 3G0BA 3QA9A 4N3BA 4UXJA 2C07A 1TUBB 3ZHOA 3ZGVA 2ZJZA 4A0GA 4DSOA 4WV3A 4I3FA 4YDQA 2G5CA 4KI0A 2J33A 4KDRA 4JLVA 2Q5QA 4U3JB 1QO0D 1HDEA 4B3IA 3BJEA 2WE7A 3RASA 3OD1A 4L02A 2X2FA 4INAA 2HIGA 2HU8A 1YACA 3G68A 3JV7A 4FYJA 4L9SA 3U39A 2VNKA 3RSZA 4F1JA 4AY2A 1SUEA 3P94A 4IS2A 3IB3A 4N82A 4LXHA 3SZLA 1G21E 3CF2A 4RVGA 3GLIE 3SEAA 4A0QA 2V3WA 5AHWA 1PKEA 3NGXA 3ZIAA 2MSDB 1ULBA 3R76A 4QLAA 3KOYA 1BMFD 3V9AA 1EINA 1F6DA 3PQ5A 1DUVG 3FNEA 2B1QA 3DDHA 5CCBA 2XMQA 2DHDA 5FOSA 4GBJA 4L27A 2O2GA 2WT9A 4JKOA 1LX7A 1M2WA 5E1MA 1CUUA 2VJNA 3TZ6A 4PYOA 4EJSB 1E1MA 1K4MA 2A35A 3C4VA 5B6JA 3A1EA 4Y6PA 3GX1A 1HMYA 1WUYA 3OCZA 3WLOA 4ZEMA 3GMIA 2LBPA 2RB4A 4MH0R 5KVAA 4QSHA 2XGJA 3W4KA 4TLDA 1WUIS 5TGDA 1FDUA 1C30B 2VPYA 2VXOA 5AVTA 3GLSA 4HN4B 1JP7A 1P4JA 1G2OA 3OC0A 3HVHA 3MLBA 3RVLA 2TMKA 4JH0A 4OQQA 1T0JB 4BMXA 3EXFA 4A0FA 2AKAB 4CYMA 3LG2A 1J06A 4RBNA 4NESA 1E3QA 3S55A 3ZV3A 1TTHA 1J20A 1EFUA 3UFXB 3V7YA 2QTVA 3LOQA 4BCDA 1RE1A 2Z56A 3FHJA 1BXGA 1DJPA 4PO1A 4Q4CA 3WKAA 3V00A 3BQ9A 5FA5A 5IKEA 2J85A 3REQA 1V4BA 2AG6A 1YZGA 1G5PA 2HJ9A 2UZ1A 1QGED 1ZI6A 2ADFA 2QAGA 2YVLA 3CRNA 2P9ZA 1C7QA 1ZI9A 3KUDA 1HZJA 2XB8A 5CH5A 5KQLA 1JWBB 2WINI 4HFMA 1VA5A 4F4CA 2E48A 3RFCA 5EJIA 3FCAA 1EM8B 1VHTA 4WLUA 2CBGA 3R6GA 4MKGA 1O94D 4V0LA 4CL8A 1G1MA 2R8BA 4EF5A 3GBPA 1VBKA 3EDMA 5AM5A 3S2ZA 1W48A 2YHIA 3UMGA 3UWPA 1ZR4A 2WJ6A 2Z9BA 3DM5A 4J1NA 1U1IA 4JC0A 2F1KA 4RPKA 2FPGB 3HM2A 3UICA 3WHPA 5C8VA 4HTFA 5KX5A 3TOCA 1GKLA 2VSFA 1RR6A 2P62A 2CL7X 3AM5A 2P2LA 3DOHA 1CBUA 1YJQA 4DV3B 1PRYA 4F96A 1N6KA 2EVWX 2O7SA 2FLVA 4JJZA 4L8FA 3GRZA 3HN7A 1MW9X 2XXJA 1G64A 4XM0A 4IDGA 1HQDA 4JLSA 4P4NA 1E89A 2N42A 4L6CA 3UK1A 4FW8A 2H31A 3E27A 1APBA 1FFXB 3OX4A 1DEHA 1DL5A 1TQ2A 3L46A 4FYXA 4MQUA 2GCIA 4BNDB 2VHWA 1PJQA 1U98A 3N2YA 1N2CE 1O97D 4P54A 3SJAA 2ZXEA 3EUAA 3SMVA 1WXDA 2ZB7A 4V0MA 2MT9A 1H22A 4PC1A 5CYFA 1YDEA 4GM1A 2XF2A 2PWPA 4G25A 3ES9A 4GLJA 3TCXB 4OQLA 1NZJA 1RLIA 3K1ZA 421PA 2IHZA 3WR5A 4NU8X 1EJ6A 5K4HA 1SHTX 5HJEA 2FPXA 3D2AA 1XF9A 5JZ9A 1CUSA 2IWHA 2Q5CA 4PCLA 1EGMB 4QYIA 4ZAZA 5ICFA 1F1JA 4OP1A 3RI3A 5AKJA 3EGDA 1S4MA 2IBSA 1N6HA 2HJGA 2NLOA 3ABOB 3FJ1A 3IS3A 3L0IB 4RJJA 5G4KB 3QPDA 2IUTA 2NPFA 5AVYA 5A3VA 2PU7A 1FF9A 1YA8A 2ANCA 2HA7A 2ZBEA 4PZPA 5GV7A 1N6LA 3UT5A 3C8UA 4PYKA 2GSWA 3WB1A 1RKVA 2ZBUA 2VAPA 3RVQA 1KO1A 3TAHA 2HXYA 4DT1B 1G8KA 1XZPA 2DR0A 2PGXA 4C43A 4TXHA 4M99A 3NEPX 5BUSA 1ECCA 2WTUA 3ZK9A 1P2SA 1NW7A 1U0FA 4MB6A 4TTQA 4B7ZA 4D9CA 2XB9A 5JZOA 1B0AA 1NU6A 2JCSA 2CDBA 1J8VA 2HRBA 1K7YA 3HKDB 1VRWA 1IDOA 1PSZA 3FNGA 3LF1A 4D26A 4J7CA 2P30A