1S2GA

Purine 2'deoxyribosyltransferase + 2'-deoxyadenosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 50
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2gA00
4LJRA 1S3FA 1T35A 2A33A 3PFKA 4LJKA 5AJTA 1S2IA 2KLHA 1S2GA 4I7EA 2PFKA 1KZHA 4JENA 4JELA 3O8NA 3GH1A 5AJUA 1YDHA 2HIGA 1PFKA 2PMBA 4RH3A 2F62A 4LJLA 3HNOA 4A3SA 4FYIA 3IMKA 2F64A 4MCJA 3BQ9A 4WL0A 4JEMA 3OPYB 5ITSA 3K2QA 4NPAA 2Q4DA 4P5DA 4MEJA 2NX2A 1MTOA 1RCUA 4KXMA 4P5EA 4FYHA 2A0KA 3F5MA 4I4IA 3O8OA 4KXLA 2IZ6A 2F67A 3SBXA 4OHRA 3O8OB 3OPYA 4FYKA 2IZ5A 1WEHA 1S2LA 2Q4OA 1F8YA 3UQZA 1S2DA 3MAJA 1ZXXA 3O8LA 1F8XA 6PFKA 4KXNA 1WEKA 3QUAA 4HX9A 2F2TA 4U1RA 3U39A 3EHDA 4PFKA 2F48A 4I36A 2KHZA 2IZ7A 4OHBA
chains in the Genus database with same CATH superfamily
1KYTA 4UAVA 1RJFA 3ZE9A 1X94A 2VUHB 1L8XA 1EVZA 1QV6A 5DNDA 4X0EA 2R8RA 1J5XA 4A0HA 4BZXA 1MFPA 4NOKA 5D5QA 2KMLA 3I6YA 4IXNA 4C5CA 4YAKA 1T5LA 3QBJA 4ND8A 1ZP6A 1XRNA 3DW3X 4A0QA 5JISA 1CDZA 1R12A 2ADFA 2FWBA 2GX6A 3CGWA 4EW1A 1JSRA 5AUOB 1USKA 1AZLA 3LCRA 5ED4A 1Q1EA 2A84A 2QROA 1IXRC 4NBTA 2C8KA 3H9CA 4O2AF 5J2TA 3PQ4A 3L1JA 3RS0A 2AEEA 2VBGA 1VE7A 4RM3A 3GELA 4FBGA 3SM3A 5BW5A 1QYDA 2BEVA 3HU5A 4V02A 5AJVB 3V34A 4E11A 4MRAA 5K0ZA 1NVBA 4FTWA 3UK6A 1M6VA 4E3WA 3D6JA 2VDPB 4EKYA 2QT0A 3JTMA 1OLSB 3CVUA 3PXEA 1ZCZA 4LBZA 2EHJA 4HAXA 4RH3A 4E33A 1SH7A 4WMLA 2ZTUA 1LRKA 2AFIA 2DFVA 3F6CA 3QTBA 1K9VF 1LF0A 4DZRA 3HA2A 3GROA 2VJQA 4LPKA 2QTTA 5DLEA 3RC2A 5I7UA 4FHFA 1OVGA 4KBFA 3K30A 1AOXA 3FTEA 4LSGA 1ZFNA 1UFOA 1LJUA 2ZEJA 3BERA 2NO7A 1LEHA 1MX3A 4ZVMA 3AUJB 2WYOA 3KTFA 4J0QA 4FNOA 1PX0A 2FQXA 1AKWA 3OU6A 5EG5A 3HJUA 1RXIA 1E2NA 1J7JA 1ZIOA 5ADHA 5LOVB 3OJ0A 4FGKA 1AGPA 4P4TA 1U2DA 3Q88A 2Z2KA 1YIDA 2HN9A 4AUNA 2H85A 1MAWA 3UT5A 4ITRC 4CDGA 1SUBA 1Z38A 4FUTA 1QWSA 2NO9A 4H6VA 4LRYA 1ZLYA 1MNQA 1R0RE 4GMHA 4E14A 3OTOB 4HCJA 3GHYA 1RPTA 2SCUB 1YB5A 1O5IA 1XMOB 2QW0X 1BKSB 2HA3A 4KXLA 3VKVA 3TQRA 2QI9F 2WFLA 3ZTYA 4HWGA 2GK6A 3VOTA 3CJTA 5DT2A 1ZZGA 1WEHA 4GQAA 4RMNA 4LX8A 4UVGA 3L4KA 4CQLA 4ZXFA 2WKPA 2Z8YA 2B8TA 3HGQA 3M6LA 4QWMA 4BZWA 4DC0A 1RCFA 2F9FA 3AEYA 5IUKC 1NXQA 4FFVA 1PYOA 3SFTA 4EGFA 4UTZA 3DE3X 4NF2A 5IAJA 2IIQA 4MYUA 1CR6A 1I3LA 1QH9A 3O2SB 4CIWA 4R2LA 4OLHA 1UDCA 2VPTA 4RXMA 2EFHB 2OKGA 3BSSA 2FGJA 1KI4A 3DWIA 5AKIA 5MGBA 3D31A 4WAUA 3K0HA 2O2ZA 1CKEA 1ABEA 3UZUA 5IU6A 1HGXA 2HGZA 3AJEA 4DYVA 5BWBA 5JDIC 3EQ9A 1RQLA 1WPQA 4FZ3A 5IT0A 2Q62A 1HRKA 3EDYA 1HYQA 1WUJS 1C1HA 2PEYA 2IS4A 4B7CA 2HJHA 1QTNA 2Q0QA 2PRIA 3I1IA 4GGPA 4N5NA 1MC1A 1QCCA 3HEAA 1ZJZA 4KO4S 2JPDA 4MNTA 4UUPA 1SVLA 2E0IA 3S2FA 5KQSA 1XMPA 1G8YA 1X9HA 5TGTA 3D4OA 3PX3A 4L3VA 5D1NA 1I51A 4OXRA 5JC1A 2BFPA 1OLOA 4N39A 1A7UA 2ZS7A 4JLWA 5FULA 5C46F 4IIFA 1S96A 2ODAA 3CT4A 3OJFA 3EZNA 4JIMA 4MS4B 4ZVRA 1ZIXA 3O8RA 3DZCA 2IBMA 4DV7B 1ZISA 2A59A 3PNLA 3JWPA 5I9IA 1H94A 2DT5A 2YZKA 4G0PA 2J87A 3RLFA 1JAHA 1U99A 3CLRC 1JFLA 4U6QA 5ESRA 4LZLA 4E6PA 1IN4A 5LOVA 5LDGA 3AHDA 1KVSA 1UK7A 3IRVA 1M2HA 4X1IA 3VKUA 2ZT5A 3K0FA 1S89A 4WXEA 4TKVA 4RF3A 3ZCSA 3ED1A 2JW5A 1SCUA 1WXGA 3MWKA 1Q0HA 2DBZA 5A1TA 1NTRA 2VRCA 5AESA 4ZTBA 1ZMRA 4E2WA 1VFPA 3IPLA 3LECA 3HE3A 3DHYA 2HPHA 3C7TA 5HKLA 3B48A 1C9MA 3P20A 4JEIA 2ZR0A 2YIJA 1XDSA 3BXOA 2RHMA 1HK7A 2XCUA 4RFSB 3SDZA 3GLGA 1DWUA 4JWTA 3T54A 1XJ5A 4GKAA 4MGIR 1R7RA 1TQHA 4MWEA 4UJ3A 4B3BA 1TEHA 1QLWA 1WVIA 3VV3A 2Z2ZA 2C77A 4ZI7B 1E1RA 3GPIA 1IBCA 3LHFA 4FQ5A 8ADHA 1XHFA 1YONA 2H2GA 3P2MA 5HF8A 1GUZA 3RAJA 5A1JA 2PU5A 3UPDA 2OKCA 1EDDA 4R68A 4IF6A 2GR9A 3D4BA 3PFNA 2MYPA 3WRWA 3E70C 2UV8A 1HNXB 2H51A 1LRLA 3SYRA 4TTSA 2JH9A 4XSHA 1TOAA 5J2TB 1TUGA 3ANXA 3MQ2A 4AMBA 2FHSA 2GCIA 3G0OA 5SZIA 3ZVKA 3L4BA 5FL3A 2WHPB 4CM8B 3GLTA 3G0CA 5JCJA 2GYYA 3Q8MA 3U7GA 1N0HA 4LXQA 1Z62A 2CVQA 3CKLA 4TSRA 3EW9A 4FNMA 3RUPA 1R0WA 1QFJA 3JD4A 2P65A 5EOVA 3IKTA 2IP4A 3AWIA 3IVCA 3OWHA 3PCTA 4I1RA 4Q4HA 4Y3UA 5FOTA 5FFNA 1F7UA 1AURA 1P4JA 2BFCA 3KEOA 3PHBE 3LLMA 4PM4A 1E94E 5NLLA 5LLSA 3S55A 3TIVA 2ACEA 4HN4B 1PFGA 4PS0A 1YRBA 1SCNE 5DTJA 2AQHA 4G9BA 5HJ2A 2GRAA 2V9CA 3JWIA 5AQEA 4EA8A 1EFVB 1UPUA 3WLKX 1OYVA 3VVLA 4FYWA 3FMIA 4H7EA 1E3EA 5TXGA 2C98A 4U6NA 3KQTA 4NV1A 5AVWA 4QVIA 3HY4A 4EHIA 5CEFA 3WQQA 1E89A 5L4LA 3OQOA 2C3YA 1SCAA 3INNA 2ZRBA 1MRZA 1SNYA 3ZPXA 4FYPA 1NBIA 2P1ZA 5TX7A 2GDZA 4N54A 2YWXA 2J3HA 2BFEB 2CE2X 5CB4B 4TYWA 3WQRA 4P9NA 3ZW8A 3IEPA 4LFCB 2QYHA 4UBMA 1PNQA 1LCIA 3LUDA 2IXGA 2ZYIA 2C94A 3ZWOA 5I7EA 2VDQB 1GYQA 3EMBA 2YZ7A 3DM9B 3ZH2A 3N6RA 4QGGA 1PEYA 3HDJA 3IP8A 3OZFA 3QKIA 5KYXA 1Q0RA 4EG1A 3KKLA 1XTSA 1I9GA 4F8JA 5AYVA 2IYVA 4CU5A 3D4IA 4FFPA 3QEBZ 1MEJA 4YMLA 5A03A 3D3JA 3PRJA 3V33A 1CS4C 4L0DA 2ZZMA 4QHSA 3NHRA 4DYHA 5I5EA 2B99A 4XYLA 5IVPA 3MJVA 4KQCA 5KVVA 1XRLA 2W8ZA 3CH4B 1FJ2A 5CX4A 2PUVA 3IHKA 3KJZA 3BMNB 4NOLA 1TI7A 3M49A 5KMGA 1RAIA 1BYUA 3AR2A 1ND6A 3I52A 4I50A 5H81A 5K8UA 1R4AA 3NBMA 1LH0A 2FPPA 3NJRA 4NCJA 3LUKA 5IZCA 1W29A 5EL0A 2QENA 2QRQA 3WDMA 4IVNA 3N2GB 3TI7A 4QIHA 3FCAA 2YZ2A 3N5KA 1E3LA 1NQ5A 4WT7A 3KELA 2OCLA 3MJCA 3U44A 4YJ2A 1OZGA 1BX0A 2NNWB 4MPJA 2CV1A 2L42A 2NVWA 3CV3A 1P9OA 1YDWA 3NFYA 4OPMA 4D42A 2W93A 4AXBA 3N2ZB 2D54A 1HE8B 2ECQA 3P26A 2BVNA 3QQPA 1YD7A 2PT5A 3OTWA 3CNEA 1NOKA 1Z0ZA 1H3NA 2IGTA 4GMXA 3NC0C 4HBGA 4JX9A 1V1MB 4RGVA 3OY2A 5DFAA 3RTDA 4E03A 4XWOA 1BN6A 1CG6A 3NH6A 1TGVA 3PUZA 4DMLA 3WLQA 2CJYA 3KZNA 3AI7A 1TYEB 1XEFA 2QUBA 1ANKA 3LQ4A 1XD8A 4EVIA 4BO3A 3UMGA 1J42A 3N1UA 1XQVA 3OCVA 3RK1A 1YHYA 1ECFA 4L8GA 4P4SA 5T8KA 4RC9A 2I9PA 2BGGA 4DPKA 3RC8A 3H11B 4BYMA 3UTDA 1RI1A 3K6KA 4X61A 3UMBA 5CH5A 1IONA 2C8JA 1DZIA 2FZGA 4PLWA 1YGYA 5JCZA 1X1SA 1XZFA 1DINA 3TLYA 3RTCA 2HCRA 1F0NA 4UEQA 4G2TA 2AF4C 3K8ZA 1I3MA 4Y6GB 3T5DA 3ITKA 5K8LA 3IDAA 4KXWA 3DUFA 1TIKA 3PD0A 3Q0IA 1YBMA 3GLRA 1KDOA 5U4XA 4BHTA 1OHHA 2IYEA 1JEYA 2P4QA 4QTXA 2GYVA 2QVBA 1RJEA 3PUIA 1J23A 4MS1A 4BX3A 1OREA 4IIXA 1P5ZB 1V95A 3C2QA 5GIPE 4F8YA 1DV2A 1RRFA 3DF7A 4G41A 5JHHB 1QG2A 2JGEA 1YUBA 3OESA 2B3DA 4GXRA 1X77A 2GM4A 2O7QA 1E98A 4HNVA 1LC0A 2Q4RA 1TM3E 2C97A 4ENRA 2GPNA 1TRKA 2OZPA 1PV1A 2YOHA 4IICA 2YYSA 4UUAA 1LPMA 2JASA 4OYHA 1P2GA 1XMVA 4ZI3A 4P32A 4JC4A 1CXZA 1ZUIA 1DC4A 1I3KA 2H1OA 5CIWA 1ZCFA 3KIPA 1XWIA 5FP0A 4G1EB 1B8NA 2WE8A 3IQWA 4RK4A 1Y80A 3LQQA 3SC4A 1TD9A 5H68A 2R8YA 2VJMB 3GT0A 4G56A 2CVOA 2QMZA 1X7HA 1OBCA 1W1UA 1QNLA 4YUWA 2GFHA 4Y6OA 3VZQA 3H87A 4FGZA 2WUWE 1MQSA 2FR8C 1G21B 1WXHA 4A8JA 2XQGA 4CWAA 3AF6A 2QSZA 2YVAA 1UJ2A 1RAFA 4EY7A 3IAS1 3FAZA 4MEBA 4YQYA 2OXIA 1YS4A 2IPXA 4TL6A 1CVLA 3EEOA 4OHBA 2JEYA 4REQB 1L3BA 2AQ8A 4DCVA 4EA9A 2ZTHA 4EFMA 2E4UA 3NZEA 1KZ4A 2CMFA 1MO5A 5JH7A 2C1XA 3BULA 4JLOA 4Z9BA 3SYMA 1U28C 1X7ZB 2P0AA 3EC1A 1DIGA 2XGGA 4HVLA 1EUCA 5HKKA 5JNVA 1IY0A 1Z7WA 2SECE 3EK2A 1VGQA 4HQ0A 5T67A 1K6EA 4FUQA 1E6MA 4MWDA 4NG5A 5D3MA 3TL6A 5L95A 4R6WA 4I9NA 4GP6A 3EAGA 4IGEA 1QFXA 4LNUB 1DAGA 5MGNA 4GU5A 3WK8A 1JG1A 2FE1A 3FMPB 3O1HB 2QP9X 3HO1A 1R0BA 1DKRA 2WSYB 3AF3A 4IIJB 4UUOA 3ANSA 1T8SA 4QYIB 3V7NA 1A2OA 1KMMA 1YDHA 5JS7A 4HWTA 1Z6QA 3AU9A 2NUAA 4IHAA 2O20A 1WCV1 3E9RA 3GBVA 1QK5A 3JQPA 3F7OA 3L3BA 5EWJA 3WYEA 4ZRDA 4UNPA 5I01A 3IV7A 3PHJA 3EH1A 3QEKA 2R8BA 3HUUA 2VRBA 3PNQA 4WK4B 2JANA 2D2XA 1QPBA 1HDYA 5TRTA 3U4HA 4AS2A 4GS5A 3GLGE 3MERA 3PA6A 2DQZA 2NYUA 1QX4A 1ZK2A 1CZLA 1LBHA 1MBZA 4L08A 3QVMA 3ZN2A 5JJCA 2M6KA 2XAAA 4RH1A 2VR1A 2CB0A 1XKLA 1ZIYA 2LGJA 3EGWA 1EVQA 3UCEA 4BB0A 5AVSA 4M49A 1JQAA 3R3YA 5HIIA 5HW0A 1WXQA 1Z74A 2G0TA 2HF7A 4KG7A 2OV8A 4XM2A 4ZO8A 4X93A 5A4DA 1NF8A 3MCUA 1RMQA 4BRSA 4H1UA 4Q3DA 1ULHA 1HURA 3INTA 3EPKA 4LY9A 3W78A 1GNQA 4X20B 1YULA 1KZ9A 1Q0ZA 4WOPA 4WESB 2G8LA 2XZPA 2GI4A 1SOUA 1OH7A 4FYYA 2VJNA 4Q00A 1FRQA 3IIMA 4A4DA 4S1OA 5ARCA 4LK2A 5ALDA 2XX3A 4JZKA 5CJJA 1PZHA 1KWKA 1CUXA 1KNQA 1B7GO 5ESXA 1NONA 2P8JA 4DJDC 3R4CA 1SU7A 3HB4X 4NYJR 4NZZA 4LGYA 2AFVA 3QLTA 4DANA 4V0QA 3VU1A 4LYFA 4Q4HB 3BRQA 4EG4A 2GVNA 4NAVA 1FRZA 1NDHA 2Q4TA 5BNFA 4PAQA 4S1WA 3TDNA 4GI5A 3KQNA 3LUGA 3O8LA 4FWTA 1RI2A 1JSLA 3E4CA 3DFUA 1YR9A 2XTMA 1JLRA 3GU3A 4LDJA 1Z17A 3ZWWA 2PTGA 3ND6A 1R6VA 1ZUNA 4CGYA 2F2TA 1P80A 3JAWA 3ELDA 5J1TB 1LDYA 1I14A 3PHHA 1NC3A 5SYAA 2PV0A 1N2JA 3CXRA 3W2EA 3MAGA 3C4JA 2CYAA 3C3CA 4JP8A 4N0MA 3QFRA 4WRRA 4JFAA 3MRXA 5HZKA 1C7RA 3VBCA 2ZR8A 2Z83A 3C6ZA 5EWMB 4L57A 2J0UA 3E9QA 1MABB 3CX3A 4ED9A 1ODIA 2QMQA 1J8FA 2PSDA 1SXQA 3N0VA 3LPLA 1CYDA 3OQPA 4JP5A 1HMYA 4C6TB 4DVJA 1BX1A 1N5IA 3LY5A 2JRCA 4UM5A 3M82A 3H5IA 3O4GA 2N3ZA 4UBNA 4UREA 1A2QA 4C0BA 5FH9A 2ZT7A 4NCIA 2NZ8A 2WF9A 3L1VA 4UHEA 2RFLA 2C2GA 3O0DA 4ABTA 4C3UA 1FNBA 4Q47A 3FCXA 5HDBB 4F04A 2KBFA 2JLBA 2HTEA 1LQTA 4NYIR 5KKAA 2K5UA 2GBPA 4IOJA 1IK6A 1WF6A 2G3YA 2JI7A 2NV6A 2VP0A 5AP9A 4NMLA 4X1IB 5KTNA 4REOA 3KWMA 4IH9A 4MLCA 3QBTA 5K3FA 3LP5A 2FRXA 5A04A 1WMFA 1G64A 1HE3A 2D8AA 3D5EA 4X63A 5FWXA 2CCGA 3KCQA 4ARZA 4JU9A 3OLZA 1Q1GA 2H8GA 2PS1A 1IATA 6ABPA 4RU1A 2FUCA 2X5KO 2CFTA 3KAJA 2HXSA 4GAEA 4BAGA 3C4QA 1RADA 1K8RA 1QOQB 1ZUWA 3PTZA 3OEWA 1VPEA 4Y30A 4OVKA 4O0LA 2GZAA 3K09A 3W3AH 4PZYA 2JA2A 3RVSA 3V1TC 1X38A 4N3AA 3SHOA 1POWA 3F49S 2NZVG 3OJXA 3PIDA 3L6RA 4Y1EA 1EINA 5K51A 2I87A 2L19A 4PO1A 4D9FA 1SUWA 2ZIXB 5F5XA 1TUIA 2H2FA 4MWOA 2XBLA 5MN5A 3QVJA 2QB5A 1FW6A 3S1LA 9LDBA 3AP3A 5BVHB 3ICCA 2QRKA 2DQYA 1OX4A 1IRIA 3A6HA 3HBJA 3NPMA 3Q40A 3GLUA 1J0EA 3CGGA 3HSSA 4Z9FA 3P71T 1RLJA 2VP9A 3WGOA 3ZU4A 1XPOA 3ZCXA 4UMFA 2RK3A 3OQNA 1SA0B 1GD1O 1GTL1 2OSVA 4FR0A 2O5CA 3QU5A 1ZR4A 1PBNA 5FCDA 1VP3A 3MOIA 3TSOA 3G0IA 1Y9EA 2HA2A 2O48X 1ZLXA 3MMSA 3SJ7A 3FYUC 4YV1A 3GAAA 4GR4A 1CTQA 4GPIB 4LFAB 2JB9A 1P33A 1PUXA 5FQNA 3WC4A 3JQAA 3T35A 4YT5A 1OE0A 1E79A 1VLQA 3EE6A 1NXPA 4JOQA 1DLIA 1WV0A 2J5QA 5HZMA 4H1VA 5IT5A 4J7AA 4YUZA 2JAWA 2FCAA 2M32A 1NULA 3IV6A 1YA6A 5JXJA 3N28A 1E2KA 1U1EA 2H1FA 2XYGA 3A9SA 5ESDA 3EIWA 1B6RA 3TOSA 4BDTA 4QZVA 3OFSA 3HYSA 1ZJYA 2G9RA 4LWPA 2CXUA 4WFJA 3D4PA 4ZT3A 4YMGA 1UWVA 1EZ4A 3DAYA 4W1SA 5EIHA 1F8XA 1O9HA 1Q3TA 4Q7KA 4MA4A 1ULBA 1VCNA 1QFSA 4HB0A 5IP5A 4QHYA 4OI1A 3U3KA 5LP6A 1I1HA 1L7DA 1T13A 3MQ4A 3E7PA 3NONA 1ADJA 3EQZA 2CXNA 1EE1A 1FJXA 1N33B 3T3EA 3PD7A 1X0XA 1X1CA 4FGJA 1I7NA 3MLAA 3ZGZA 3DMRA 4DW8A 1TMGE 3LBYA 3OIWA 1PJLA 1UBTS 4AZVA 5H3LA 1KR2A 3NLLA 4TKZA 3FLBA 4HXEB 1Z7GA 4KW7A 5ADUS 2XLCA 4M53A 3L0YA 1I5OA 2QZ4A 3O4HA 5CGZA 5JI2E 3VVMA 3VUFA 4B34A 4DG9A 2ERYA 1P4SA 1QUEA 1VSUA 2IRWA 1A8HA 1FQJA 1L4NA 2QM8A 2YHUA 2ZSDA 3LP8A 4IQ8A 3WLAA 4A0FA 4DABA 3ZHRA 3KPJA 2H2DA 3L46A 3TRHA 5C81A 4HWPA 4BLUA 1DB3A 4MKGA 4DQXA 4O3MA 2OT3B 3OO0A 4ZARA 1ENPA 1GLVA 2IDJA 2ZB3A 3DZFA 3MXTA 4NH4A 1IRXA 1G5QA 3PXUA 2MSCB 3MFYA 4BZPA 4CKXA 4O2AB 3FYUB 4MW6A 4PLZA 3VGJA 4AMZA 1SCIA 1WDKA 3EA4A 4LFBB 1K4YA 4EG6A 1V1JA 1ZU4A 1BEUB 4RIFA 3VA7A 4KYVA 3KXLA 3KUUA 3ZU3A 2FSHA 2X41A 4ZU1X 2YVKA 1VYHA 1Y4SA 2GMWA 3JD0A 4OMDA 4JXZA 3NJ4A 2B94A 3OCJA 2CVPA 3ZD9A 2OXEA 5TPZD 3L93A 4KSCA 2I4TA 4QFMA 3GHHA 3ESDA 1FUIA 2O0MA 3IUQA 3UC9A 1IHXA 2NQ2C 4RFSA 4WLNA 1FMTA 3V8EA 4IM7A 3KB6A 2FDXA 3Q3IA 5IJWA 3TIXB 5IDVA 1B6SA 1ICIA 4EB8A 3ILVA 4GRDA 4CYMA 1HZJA 1DAEA 3F4LA 4WD3A 5K3FB 4FYIA 4BMCA 1M54A 3GP3A 2JLAA 2QAJA 3JQAD 3X1DA 1KGDA 1E1RD 2H63A 3CUTA 3WL6A 4EELA 3FKSD 5BNTA 5CFPA 2VT6A 3JPYA 1BFDA 2HU8A 4R31A 3SNKA 5AM2A 2BIFA 2IHZA 2IOFA 4KAXA 1N2IA 3E4DA 1E3DA 1T43A 2BHNA 2CL7X 3ZE7A 3WGIA 2H7CA 1DKPA 3M4XA 1FU7A 5FBZA 4G23A 2HF8A 4WWHA 5DBEX 5LZ4A 1XFAA 5E4TA 1TGYA 1C2TA 2I2XB 4J9UE 3F6RA 4KQJA 3KOYA 4RKEA 5JOQA 2ID8A 2OSBA 2YUTA 3GMDA 3LT2A 2QVLA 4W8GA 3TGWA 5EXPA 1NLUA 1YE8A 2CFSA 3GGOA 2J0UB 4I9FA 5DYNA 2W2LD 1HETA 1KI8A 1OTHA 3BGOS 3OT4A 3TAXA 1KJ9A 1A3CA 2BFNA 3HJAA 2V9ZA 4QBIA 4R1TA 2OD2A 5ADVA 3UHJA 3H6HA 4X6XA 1OA0A 2CNKA 5DCYA 5E7JA 1A9TA 4UZEA 1NI4B 2LZ0A 3VGPA 1GPLA 1ZVVA 3VYRB 1JN0A 1P7ZA 2QEQA 4O2BA 4ZCPA 2A9KA 2GRJA 3R23A 3FFXA 5F2NA 3BB1A 1DQNA 5GJCA 3DO8A 1PJRA 1IXZA 5C8VA 1QHFA 3A6GA 3KX2A 4CLRB 1CEQA 3DEKA 5CM9C 4EUKA 1I3OA 3NFRA 3L06A 4DPMA 1SKAA 3FUWA 2IH2A 2F3PA 2YW9A 2Q8QA 3KR0A 3U3XA 1Y5LA 3I0ZA 4FFDA 4W9NA 3WADA 5KYKA 3LCMA 4PAMA 5TJ9A 1P77A 1K7EB 2J32A 4KZKA 1J5EB 1F2VA 5KOHB 4A0RA 2XRYA 3CF4A 2X0JA 5KNCD 3VR1A 4O8CA 2GAFA 3QJYA 6NULA 5LDDC 4I1VA 5G41A 3O92A 4TRMA 4ERXA 3DLHA 2DBRA 2XH8A 4BRUA 3JTEA 3MOSA 3R09A 1Z6ZA 2VC2B 1M6HA 3H17A 4F6RA 3OVMA 1G16A 2CVFA 1XZEA 4D4IA 2C1ZA 3RVNA 1E0AA 1QIGA 3A1EA 2UUPA 4ZT5A 2HDNB 3W8EA 3HC7A 1NRXA 1NLMA 1VPVA 4FFLA 1GRRA 1LLDA 3LW8A 4FMBB 1ZMBA 3P0FA 5F4BA 1NJ1A 1BHO1 1L8AA 3JXEA 2WTBA 5BSTA 1WZEA 4ZOCA 3OX1A 4YJGB 2W71A 3PNSA 4WCFA 3QY9A 1ZC4A 4OSOA 2VUIB 3L04A 1N2CA 2MSDB 2W6ID 2NO6A 1U2QA 3HA7A 5FOXA 3VNBA 1CDDA 3N0XA 1EBBA 2EQ5A 4MVJP 4UNSA 1PT9A 3BJEA 4KQXA 2FEWB 1KORA 3LF2A 1DX6A 4XRRA 4UBKA 2Q07A 5TQVA 1W93A 1JDPA 5A6SB 1V8ZA 1Q7TA 3GJSA 4BJHB 3UMJA 3CZ5A 1Q6YA 4R3WA 3L7AA 4RENA 3H1GA 4LUCA 2BE7A 3T7SA 5G02A 3DAGA 4KHZA 3KAKA 4JV5B 1DUIA 2GN4A 1P75A 3W3AD 3ZWMA 3K71B 2PIAA 2HAEA 2HL6A 3GCDA 3IMCA 4M8LA 3DXZA 3VVCA 3TEFA 3U4CA 1XZ8A 5F12A 4WCDA 1GU1A 1MH9A 3IUJA 1CRZA 2QUAA 3P9CA 4B3SB 1TK2A 2HBZA 5FD8A 5HRUA 5J2UF 4V24A 4U7WA 1E7YA 3OZDA 4O4IF 2HU7A 3SZLA 3VVBA 4MUXA 1L5QA 4JP2A 4ZOEA 4EMUA 4DR5B 3PB3A 4Y1GA 5ICCA 1JILA 4E7OA 3VKHA 1D04A 3K1TA 5GTDA 3VPGA 4BRZA 2H9IA 3OMLA 1ZGBA 3KB8A 4BC0A 7MHTA 2JKYA 4HF7A 4MWSA 4EKGA 4EX6A 4AY6A 1ZZEA 2RBEA 3UUEA 5JFGA 3INRA 4N7RA 5AH0A 1U2PA 2CNDA 3QEOA 1FRNA 4C0QC 3UJ9A 2P4UA 1P29A 2D0PB 4ZHQF 3LYHA 4E1AA 5JARA 4X9XA 4K9DA 3AUKA 1KDTA 2QQ5A 1IXKA 4CCAA 4D43A 2ZRLA 5D87A 4EY4A 4MEJA 3UHPA 2A88A 1D1QA 5EMMA 4MS3B 1C1XA 3NV9A 3S70A 4F38A 1SXHA 2VJKA 2W2MA 3R5TA 4GECA 9LDTA 2V0GA 2P6NA 4R2MA 4P0PB 4KO3S 3L8DA 3CF6R 4QUDA 3L1UA 5LQRA 3OIDA 4PC2A 1KEKA 5JDIA 2Z4SA 2J9FA 1KZ1A 3LHDA 2KPOA 4KAJA 4ARCA 4IMRA 2HYIC 2BGMA 2PY6A 3ZNOA 4C1BA 2NP6A 1E2EA 3DVAA 1UODA 3KT0A 1NXOA 1N25A 1Z68A 3U9SA 1E7RA 1G19A 1NP7A 1Q7BA 3NHAA 3FOWA 3P52A 1TIPA 4IJMA 1DO0A 3M5DA 3GLSA 4R5MA 3IDFA 3ND5A 3O8CA 2V7PA 3HRHA 1YQGA 4EHDA 1OWLA 3A3OA 4Q01A 3AZQA 4B48A 2J3EA 3K0AA 1H66A 2BKLA 3HBLA 4DM3A 2XCIA 4QGFA 2HQBA 1HI9A 3ISVA 3P5SA 2VNSA 5BW8A 2VDLB 5B58C 1C7JA 3JD3A 4W5RA 2N42A 3S68A 3V6LA 5CT5A 3AQIA 1Z9BA 1PUJA 1DT5A 4CM4B 2CJFA 2XJ9A 4YPVA 3WI7A 4HO1X 4BNJA 2L17A 4KXXA 2ILVA 2ZSAA 4PXYA 3GNTA 4OA5A 2M98A 3WKDA 4PBSA 1Z45A 1XZBA 2G1KA 2WNIA 3CUKA 3KV3O 3F7MA 5E8RA 4FMCB 2I7CA 1Y3HA 1RHJA 4G4SO 2DQKA 2XMGA 2ZT6A 3BPSA 5DTRA 4D44A 3F3KA 1GQQA 1RHKA 1DCKA 4CLXA 4Z4HA 4D79A 5C4GB 2FMUA 4AULA 4CLDA 1X92A 3EOBI 3PWZA 4P3XA 1VBMA 2PRYA 3FGNA 1JHRA 2FUNB 1JH8A 1J49A 2EIHA 2Q99A 4M76B 3CEJA 1KXJA 5FXMA 3SSNA 2RGEA 5JS2A 3OZSA 2C88A 1UMDA 2YFHA 4DT1B 5CLHA 4CUJA 4TMXA 3RYCA 5K0LA 2B61A 4DA6A 4CF3A 4D99A 4WOBA 3U7EB 1J07A 2H5LA 2POCA 4PX9A 4EPRA 2Q2VA 3EF0A 2M2IA 5FUBA 3EVDA 3KHKA 2MYTA 5TF4A 5E9WA 2GJ4A 5TEVA 2Y1KA 5A4MS 3C3AA 3ZTTA 1SQGA 4JQOA 4B79A 1A5SB 3DE4X 4LV5B 1IUKA 4Z51A 1XO1A 2NT3A 4FNAA 1W2WB 1V1MA 3NDPA 3BDAA 3WP0A 2JFPA 3K9GA 1D2NA 4HLQB 4MITA 4QNRA 3Q6NA 3WL5A 2YIMA 4X64B 1BOFA 2YCBA 3AI1A 3MUEA 2AOTA 5FJIA 3RBAA 1XE3A 4C6HA 4P3YA 3V8PA 4MRMB 3HWWA 4WOKA 1VTKA 1VOTA 2OE2A 3JAMA 3LM8A 1ZIDA 4KYUA 4RA9B 1U7PA 2DHQA 4E13A 1QVZA 1U3DA 5TE9A 3KU4A 5B6IA 1ESEA 3DBLB 1Y63A 3VU0A 2YCLA 2REXB 4OMUA 5HIMA 4JQYA 5CEJA 1H0HA 1JDUA 1Q1AA 3N2GA 3E9YA 4S0XA 2GAOA 5B3JC 1Z06A 3KO8A 4BP9A 1E7QA 2ZP1A 3HS3A 5DNEA 3MWEB 4YBRA 3TI9A 5E6SB 2NZUG 2PCJA 5IWCA 1C9DB 2FSVA 4X6YA 2NTJA 3MAAC 3OP4A 3T9FA 1F38A 1K08A 1T3TA 2QRMA 1CDEA 2ICAA 3W5DA 3FMGA 1XLTC 4B7UA 2Y8EA 3D6UA 1I5RA 3JQGA 3E53A 3WBFA 5ICSA 2DKNA 4BEBA 3CEAA 4KWIA 4L5BA 3C5WP 4TS4A 3VAZA 3OM9A 5BWMA 1XZHA 1W30A 4RVSA 1TF2A 3CJRA 4TPKA 1H2FA 2C4WA 3UMCA 3VYUB 3ZE6A 4AJKA 1IUNA 3ZH9B 5THQA 4CL2A 3KQWA 3AIIA 2PSHA 1IBKB 2B2CA 2AQKA 3EXIA 4TLEA 3DOIA 1YF3A 1DQRA 1XZPA 4KWCA 2XVYA 3E48A 2WYIA 2ZRQA 2BTQB 1QYVA 2CLIB 2YNMA 4RXUA 4Y8VA 4V03A 1L7BA 2HNKA 4OXNA 3PC2A 1PKXA 2IU0A 2FZLA 4LZOA 1NXTA 5FDFA 1H2ZA 4FE4A 4EZIA 4CM1A 3VU3A 2XA2A 2C20A 3FVTA 4G4JA 2R6R1 4LYYA 5K0EA 3N8DA 1XQXA 1W9HA 1A8SA 1BIFA 1H8HA 1VG8A 4N40A 3QX9A 1OC2A 4MPDA 2ODNA 5T6BA 4Q39A 1U4NA 1XU4A 3C48A 4HKTA 3SLRA 3ZWXA 3NMUF 4URZR 4OLJA 2WFMA 3S2SA 4NYIQ 3WICA 1N5RA 3HCCA 1VBNA 1Y3DE 3CUYA 1AVTA 1EFVA 1Y0BA 1IHOA 3UT6A 2OC9A 1AK9A 2HREA 3A1WA 2XNSA 3A2NA 2QN7A 3C0KA 4YDRA 3U3RA 4ZJYA 5A4IS 1EVIA 3MUOA 3G0HA 1R6XA 4O2RA 4J6EA 3F8TA 3I1FA 2PYZA 2J5XA 1RJDA 3HJRA 1GOTA 4XJVA 1R37A 4EF4A 4BMOB 1N3YA 4O4JA 2Q2QA 4U5QA 1T5SA 2C03A 2ID7A 1MNAA 3O8QA 3A32A 5AIAA 3IVXA 1FVOA 5TEWA 2ZBQA 3TAHA 5B7NA 4DR7B 1GQYA 4JT2A 4RY9A 2DLDA 4ZKDA 5AVQA 4CIVA 2W0MA 3TVDA 5IM5A 3N8KA 3WJ7A 5AW4A 2YMLA 3D3QA 2Y67A 5CVVA 4Q15A 5E6RB 1KMHA 3ZDRA 2A30A 2FWIA 1U8FO 1E3QA 5EIBD 1TCUA 5LLDA 2AR0A 4MV8A 2JIZD 1TPZA 3ROFA 3FYSA 1IUPA 1BRMA 1OXBB 1BVUA 2VOEA 3PJEA 2JI8A 5E2AA 3VSCA 5K3OA 3EXG1 3AW9A 4ZPJA 1G8SA 2UYCA 4J75A 2R0QC 4JUCA 1QHNA 3QG5A 3QVGB 4QPPA 4BN4A 3EY9A 3DGFC 3F5FA 1FDSA 3MD0A 5G53C 2VA8A 3SC2B 4C4PA 1E3MA 3EZFA 5JJKA 3DE7X 5EIAA 1F06A 1VC2A 3QX8A 5ECWA 5DHUA 2G5PA 3RU3A 2YJGA 5ITZB 1E79D 4PSVA 2CLDX 3WK9A 4CNBA 2GF0A 4A8HA 1HG0A 2D2IA 3KZOA 3D1LA 4LJLA 4MCIA 3RC7A 1HO3A 1Z6XA 2G1UA 5ICMA 2DHCA 4NECA 2W6MA 4IOKA 2VYVA 5T5QA 1I2ZA 3EW7A 2VIIA 3QG1A 4Q1EA 1OWOA 1Z12A 3DE5X 3FPHA 3W9SA 4AS1A 2QQGA 4W1PA 1CV2A 1UXGA 3H1EA 1O0BA 5TQ0B 3URKA 3ER9A 1GAWA 3EZLA 4DA4A 3PFBA 2QX7A 3EWNA 5CAEA 2LP4Y 2GAAA 4L9AA 3OPYB 1IQUA 3GCGA 1SK8A 3HKBA 1KEUA 1JXQA 3P2YA 1ZAYA 3ERCA 4OK3A 1OFUA 2JH3A 2X42A 4MUHA 3H3JA 2RHBA 4B6PA 3UAYA 3D59A 3JRWA 4KJXA 1YUNA 1Z5PA 2GLXA 5I9MA 2I0FA 2ZSKA 3LC7O 2Q21A 4M89A 4PC1A 4QULA 4CMGA 3KE9A 5AK3A 521PA 4YJKA 2FP3A 1IBSA 4PYKA 3WYAA 5EWMA 3IBCA 1S2MA 4UAGA 4DLLA 5ITWA 1HEIA 3FLAA 2D1FA 3CF4G 4IDDA 1HSOA 1EFLA 2BEUB 2W2OA 1NMXA 3UQYS 3ZWVA 1MH1A 3RC9A 2C2HA 2UVQA 4PSAA 1EWVA 5IC4A 3VR0A 4ITUA 4RD4A 3INYA 3P0HA 1E7WA 3TD2A 1XEXB 4XIFA 4Y9UA 3ZW7A 3BB4A 4CF5A 2R751 2P3OA 3UM9A 4FP9A 2GZSA 4QOHA 1YR8A 1ZGGA 5KYVA 1YRQA 3QWIA 2AEMA 2NM0A 3ADKA 5HBRA 5H3CA 5LMZA 3BMCA 1YI0A 1JLLA 5L3QB 3QX7A 3ENVA 3RIEA 5ALTA 1AUPA 1L1FA 1TJYA 1IWPB 2QNBA 4HLDA 1KETA 4BASA 3ZZTA 4EHBA 3VTKA 4LRSB 4HWRA 4ZAWA 2ZW9A 4CM3A 3SQLA 3EHDA 1UF9A 1Z0JA 3LGAA 1JE0A 1M2WA 3OZRA 4P34A 5EIXA 3WS7A 3QZUA 3GUCA 5IJZA 2ZJ5A 1XT6A 4MWBA 1SCDA 1LI4A 4HLNA 5BN1A 1P6UA 3FN4A 2RI1A 1X1EA 4KGVA 3TR0A 3H5VA 1U3TA 1O57A 1UPFA 1C9EA 4UM9D 3O95A 3N2KB 4AJLA 4D8UA 3I5XA 1QHYA 1K0FA 4HNQA 2BH2A 2QD4A 3IT3A 5KTYA 3DAPA 2ZBRA 2YFYA 4R1UA 1RXUA 3AEUA 4A5SA 1NMQA 1G18A 2ZU6A 3IAM6 2ZVJA 5FJJA 1D5CA 5HHTA 3WSTA 1K6IA 2FPOA 3BXXA 3IAEA 3IOMA 1GL7A 3W2FA 4Y2GA 3ISJA 5AJTA 4IPTA 4MR8A 3W7BA 1UMCA 2JJ1A 3OQ1A 4Z0NA 1R15A 2WKQA 4HN9A 1SXJA 1LB1B 4DG5A 2YOFA 2EJCA 4O4HF 4EUEA 4EDFA 3HNRA 4DA7A 5BN3A 1M33A 4BO8A 2NXWA 3IL2A 2ZYRA 4FIDA 2E6UX 2FJPA 1U1DA 3OPQA 2I3BA 3IOYA 2ZI6A 5JSZB 2V7QD 1DDGA 1XXHE 3KBBA 5FFMA 5AHXA 4CM4A 4ZI2A 2BRUA 3C87A 5KS2A 2JGNA 3G02A 3FYCA 3O75A 3W9YA 4C7XA 5K8JB 1JEOA 1JSCA 4DR3B 4OHXA 4C3ZA 1ZM3A 5BW4A 1X7YB 3IIEA 4WKOA 3S1SA 2C7OA 3AEKB 1QQBA 1LK5A 1CUHA 4PZUA 1GQOA 2P6RA 1B23P 3WJ1A 1SBIA 5HUHA 4ID9A 5SICE 1H05A 1DCFA 3EG9B 2JD1A 4KZPA 4CLHA 3GT7A 3HCPA 5F3WB 3CPJB 4JKIA 4BO7A 2PNJA 3I5MA 4OXXA 5HRCA 1BVRA 3KE8A 5CB6A 1C81A 2VAPA 4DZTA 4HLCA 4IWYA 3G68A 3U4MA 3MLBA 3RTGA 3BWCA 4RANA 4EIWA 3PNMA 2GILA 4ALJA 3LYLA 4I5DA 1P3Y1 1GNRA 1L4EA 1OBVA 2DUNA 5I47A 4FDUA 1Z8NA 1XDZA 1SKQA 3RTBA 3TTVA 2MSEB 1UWLA 4KXMA 4N18A 4BO4A 4QT4A 1KFKB 2B4AA 1DT3A 3NOVA 2VXBA 4OQYA 4DILA 3E5RA 3ZHCA 1T0BA 4R2KA 2Q5LA 2PX8A 3KKQA 1IXSB 1O97D 5JC8A 5AVVA 3K96A 3BIJA 4HNRA 1U3GA 2COKA 2XUAA 4D8XA 1D4FA 1E7MA 2P7IA 3O8OB 3G9ZA 3EDCA 3IQZA 3QOYA 4OYYA 1C14A 4Z8YA 2D4HA 2IEZA 2O2EA 2IODA 3JAKB 4V1CA 3QWBA 1P9WA 1G1AA 3NT4A 4X5OA 4PZCA 4Y9SA 4NVRA 3ZQ4A 1AQYA 2WJ3A 2HJSA 2YWRA 4XFDA 3C45A 4CMIA 3NDJA 3S4YA 3L6EA 3H5WA 2E4YA 1UDAA 1ODLA 3KKMA 4DDMA 1L4FA 2Z6QA 1B16A 1TLTA 3KLBA 2AMYA 3GNLA 1T91A 1RPJA 4DMFA 1PZEA 5A3JA 4GBMA 2RHHA 1NVUQ 3MF4A 4DMHA 5A06A 3T41A 3WQHA 4B5LA 3EAFA 3JQ9A 3WIDA 4UNQA 4BCDA 1E58A 1U63A 2GBLC 3R0ZA 2X5OA 2COEA 2V9PA 5CDTA 4DRYA 2O8DB 4IH1A 1XMQB 3ZNQA 3P96A 3SE0A 3UKDA 1J97A 5KQMA 2ZIZA 3DKRA 3O8BA 2H1VA 1VB3A 2PZBA 5JCJD 3QWAA 4TROA 2G67A 1W9MA 3ORSA 5F1OA 5DGTA 3ZQJA 3DZKA 1TLFA 1H3FA 3IP7A 1CQXA 3KXKA 4JHXA 4L9RA 4DWWA 4POOA 3CZ4A 1Y9AA 2VTBB 5DXAA 4O3FA 2EP5A 2DKFA 3LT0A 4Q7EA 4ZO7A 5KYYA 1NUQA 3L7BA 4DNPA 5LA6B 2QOEA 4A2PA 4WCVA 4UPEA 1BJKA 1EX1A 2BEWB 2SHKA 2XF2A 1EJBA 1T8WA 3NTQA 3C85A 1Z0KA 4MQFA 3FWYA 3T7CA 3P2OA 1HTTA 2WU4A 3OLVA 1OU0A 4D4JA 1V16B 2E87A 1FX1A 2ZJ1A 3QKRA 2GT1A 3K6RA 1EP9A 5E3HA 2GFIA 4HQ6A 1JB9A 4R0VA 4RDHA 1V48A 3DP9A 3IBFA 3IX7A 3QVWA 2QV7A 2PLRA 1A5AB 3SHVA 2R6JA 1R8QA 5A7FA 3TUZC 3AB3A 4GM1A 3S1AA 4A2QA 1US8A 1G66A 2OAEA 3R6TA 3P5BA 4IDCA 1T0IA 2FF5A 4ER0A 4ER6A 3H13A 2QE6A 3HB5X 3GF4A 3O94A 5DNCA 2NSJA 5DYTA 2HU5A 4G01B 3FCOA 4EZEA 2AMVA 1MB9A 3AL2A 2PV7A 1D6SA 2H6EA 3HNOA 1Z5NA 2HXYA 5BW6B 1GTVA 2FF7A 2HIAA 2D59A 4MSUA 3OA0A 4XQGA 3RSQA 4HNTA 1D1SA 1XQYA 3ZIDA 4PG8A 3HXLA 1Q12A 4FHEA 3VR3A 3GEDA 1RTTA 1Y4AE 4UM7A 3W5UA 1OPRA 1NT2A 4KIFA 1NVMB 3W1VA 1P7WA 3KQVA 3MT7A 1TTHA 3BILA 5E38A 4GOOD 3EGXB 1OZHA 2BM1A 3RS7A 1BMDA 1IDOA 1GZVA 3GDGA 3H65A 3UCXA 2C7PA 1GFWA 2JS7A 3GJXC 4IVQA 2AC7A 1DOAA 2FU5C 4JL8A 2XDQB 1E99A 4H6XA 2YWJA 4CMKA 5COQA 1CZHA 1KZYC 1V8OA 1H3EA 1VCOA 4B3IA 2NXJA 1XSEA 5KYTA 1WMEA 3HI6A 3CLVA 4GYWA 1M1ZA 4Z49A 5F9HA 1DKOA 2V6IA 3OX2A 4OAOA 4AP5A 3P2EA 1E2IA 2XKJE 4FLMA 3WP1B 2P2LA 1YE5A 3GDHA 3HFJA 4PZLA 5KYNA 4OHFA 2R79A 4HMPA 3HKBB 4OA8A 1JXOA 1KAHA 1YS1X 4PLHA 1SVMA 4MB2A 4TLBA 4V39A 4Y7CA 5DPMA 1D2HA 1C9NA 3X3HA 4ND5A 4D25A 1QRRA 1SCUB 1WB4A 2QZPA 3LC1O 3Q85A 3PNOA 1R8YA 4D5EA 1A82A 2WAXA 2A4MA 4PLYA 4UNNA 1YBVA 1XWWA 2R65A 3DO6A 3H97A 3PDWA 4RORA 4W8HA 3W7VA 3HDGA 4PCAA 4DDVA 1T8RA 3JZAA 4N3GA 1NN0A 2YYZA 4NONA 4KXYA 3TIIA 1I6MA 3S1AB 3K1YA 4FXOA 2ZM5A 4WNYA 4DEXA 2KJQA 3OE1A 5I3ZA 5IW8A 1JWAB 3DYVA 4M9UA 3HR4A 1N8NA 1XJCA 4WCFC 4MCAA 3ORYA 2ZJYA 4DQ0A 5KTMA 4F7DA 1FA9A 5GJWC 3QKUA 3LPNA 2HBRA 4ND7A 2BGRA 3BYZA 4IRXA 2ZBVA 2EJVA 1MT0A 3RE1A 3V4PB 3EDOA 1XYVA 3IAFA 1VA4A 2AVNA 1GTJ1 2EQAA 2X23A 4N9QA 1ZI6A 3IAUA 5FNVF 4ESOA 4KBYA 1DUVG 3F8SA 5KCMA 4DPLA 4UUNA 4CM8A 2H4YA 2JAQA 1Q50A 2VAMA 3L4JA 3BFPA 1U81A 2D5IA 2YVUA 5CW2A 4CJXA 4X6UA 1BKYA 2PMWB 3FE2A 3IERA 1A7JA 4LGMA 1JTFA 4O2LA 2HPAA 2Q5HA 5DNUA 5IG2A 1KKMA 4KN6A 2BZGA 1SBCA 2PH3A 2V0NA 1FNNA 1G60A 2IUUA 3KTAA 3LDAA 2VSOA 1UPCA 3VNUA 2QU7A 1EUDB 4W1RA 4YCAA 4O33A 1JEYB 2X2FA 2PZLA 3KNZA 4RFLA 3S5JA 1JHZA 4JI0B 4TLDA 4L9WA 2ZYGA 1KI2A 3R7FA 5KJFA 2IEBA 4EK9A 5C4IA 2LRHA 3QLVA 4CKZA 4G07A 4IFEA 1T9HA 1XKTA 5I7OA 3VDQA 1Z2AA 4L6IA 4RD3A 1XZJA 1DAKA 3C7KA 2G9QA 2WIBA 2O6HA 3A4IA 3B7GA 3FFBA 1QO0D 3B78A 5D6NA 1U7DA 4C14A 4BX9A 3PFCA 2ZR7A 4CF6A 4H3KB 4DB4A 5AJXA 3USES 5JROA 4JXKA 2PX0A 2Z04A 4PICA 1YMQA 2G07A 1UBSB 2EGGA 4RMGA 3T4EA 1YUMA 4BVBA 4EX7A 4KH1A 2FK7A 1KO7A 1PWZA 1Y7HA 4XR9A 3TO5A 4Q4DA 2UYGA 3V55A 3EDRA 4BNUA 1WZUA 4D92A 2UXDB 4G3XA 4Z4QA 3SU8A 1TF5A 4BQEA 2A57A 1QH8B 1SKBA 5BSWA 4NXNB 2PUWA 5K0CA 2QJFA 1JR3D 4RLHA 1A4IA 3ZE1B 3OQIA 3OP1A 4QFCA 4K9SA 3W2IA 3GD7A 2HNAA 1T4MA 2PD4A 4RA6A 4AKEA 1FXSA 2YFKA 3A2MA 5AK6A 1KSGA 4BAZA 2Q7OE 1Z4MA 4XDZA 2IX9A 3R7SA 2CHQA 4BE9A 3IPAA 1IPFA 4FOOA 3W5BA 3TLKA 3H8VA 4BC1A 2ESRA 5E1DA 1YVPA 3ZIUA 2Z09A 3PITA 4WZ6A 2O2JA 2YXLA 4DR6B 1W0JA 3OCWA 2DP4E 2VI5A 5CLGA 4OU4A 5FI5A 2PN1A 1LSOA 2EV9A 1KC1A 2R7LA 1PD0A 1NYTA 4HRYA 4M54A 4UBLA 3GD5A 3FNQA 2MR6A 4MO9A 3L7DA 1KYYA 2XNJA 3Q8WA 4JA0A 1N4AA 1O94C 2BI4A 3L7OA 4PIMA 3VH2A 1H22A 3USCS 2J5BA 1KKLA 3I42A 4WH0A 4Z8XA 3B6EA 3U7QA 2HT1A 1O77A 4C20A 5KAPA 1TO1E 4BO5A 1W19A 4FZVA 5JNUA 2R60A 3DR3A 1G5PA 3G2NA 2PUTA 1S3GA 2IYXA 5A3QA 4K9QA 4BFWA 3RRMA 1RZUA 4ENUA 2C58A 2N46A 1RJ9B 5TVKA 3T4XA 1FFAA 1J8QA 2PKQP 2E4ZA 1I2CA 4E4TA 3GRKA 3PRYA 4KQ9A 4BNGA 1EAMA 5DCUA 4WZAE 3E9NA 5F2KA 5TY0A 1PYDA 2A1TR 4M0MA 2RJ3A 4YC7A 1T1JA 3HXKA 2FEAA 1OXUA 5JTUA 3ENWA 5DX1A 3QH4A 3A4NA 4UU0A 2PZEA 1W88A 3GIWA 1ZGZA 2OD9A 3ANNA 4XEHA 4XIYA 4MP3A 3FZGA 5DHAA 4PYQA 2RGWA 1C4KA 3RH0A 3W0LB 2QG9A 4KI7A 4JGIA 1F8FA 2C4NA 3ER6A 3LX6A 1DU4A 4XWTA 4Q4JB 3T9DA 3W3ZB 3WZ2A 4A0SA 4QBGB 2ZJAA 5J5AA 3CVYA 2EX4A 3DGEC 3IUEA 4LV8B 1NM5A 2QLFA 1ISFA 1VECA 2RHOA 2DY0A 1KMIY 1WXIA 4HH1A 4S24A 3UXYA 4JB0A 3IO5A 1W8DA 4CTOA 3DZDA 2I7VA 2ZUVA 2MHCA 2X2PA 1NN1A 2ARKA 3EZYA 4CM6A 1PS8A 3RF7A 3R5SA 4PZ9A 4JYPA 3CNLA 1UANA 4D8TA 4RIEA 4BKOA 1TM1E 1I6LA 1ORTA 1Q2UA 1YSCA 1Z28A 4LQ4A 3LP6A 1CZUA 4WK6A 4ZZ1A 3D0RA 1RYZA 3LUHA 4LECA 3GPCA 3K32A 4JX8A 3ZE8A 2CLFB 3RPEA 4D7AA 5ALOA 4JROA 1LLUA 1CE8B 1QGUB 2LV8A 3SFZA 1QZTA 1MN6A 2O1XA 3T5TA 4MINA 5FTWA 3SS7X 1HPLA 4TX1A 2FWPA 1B8OA 1KYVA 3KJHA 4YDQA 4U0KA 2OV1A 1KYQA 2F1RA 3DFFA 4QBTA 3JQFC 1Y5IA 1CJTC 3PNBA 4PYRA 2BSXA 1XNQB 2FKNA 1OB2A 4AC9A 1GSAA 3ILXA 2ZJ4A 3B5JA 2J08A 6LDHA 2WZDA 3AIOA 2VSYA 3SYTA 3SN6A 1R4NA 2EJWA 2GERA 3A1NA 5DI3A 4RA9A 4D4HA 3KYCA 1I4DD 4D9NA 3VZSA 2Y1EA 1XTBA 3U3JA 2H8KA 3CH7A 2P9EA 2I8CA 4BMXA 5HXAA 2A9FA 1Z4JA 3ABOB 2C92A 2R1ZA 1E9RA 4PTZA 2HMVA 2IUTA 4TTAA 3TOCA 2XXAA 3E1GA 2FE4A 2KSQA 3AR4A 1WS6A 4IHQA 4NJEA 5JMPA 4FINA 3LZCA 3RS3A 3AILA 3L8ZA 4M8NE 1OXTA 3DKKA 3LJKA 2CNWA 1I30A 3EB9A 1T9DA 3LCCA 4AUMA 4YMWA 4QXAA 4O08A 2FW8A 1U1IA 3HDHA 4JP1A 4LCBA 3V7FA 3UMMA 2NVOA 2WJ6A 1J09A 3RYFB 3EMKA 2O7RA 4B46A 3NRBA 4LWQA 2VQ3A 4UPVA 3WWZA 3THWB 3ZNNA 5MN4A 3R3XA 2ERXA 2I3ZA 4C43A 5CRIA 2VKTA 4EF5A 1U4SA 3HK2A 3QI2A 1I7SB 1DELA 1YHNA 4S05A 5ALUA 4BPBA 4C5AA 5KREA 2ZSJA 3N53A 3FTDA 3G0BA 2FQ1A 1EUZA 1PFQA 4ENPA 2GZ3A 4I6GA 2EOAA 2Q50A 2QPLA 3V7WA 1MLDA 2ZB2A 4YYZA 5FEMA 2O8DA 3WAKA 4PRZA 4UTRA 3E7FA 4P08A 1QDUA 5EE0A 3ZU5A 5BMOA 4LXXA 1H4SA 1T2CA 1VHLA 1J8YF 4NPHA 2OHIA 5E6RA 2C7RA 3DQZA 2GARA 4RCVA 2JFXA 5B2FA 3ELYA 2VP3A 3KPVA 5DK4A 2W2PA 3GPLA 1DI0A 2XF8A 1ECLA 2A5YB 1F0PA 3MBKA 3L0OA 4M99A 1RACA 2E48A 4YR9A 2R6ZA 3OPNA 4JJFA 5K99A 2OOSA 3D6MA 3H2IA 5C31A 4GZMA 3F7TA 4FIZA 5T6MA 5JAQA 2QVCA 1QVWA 3P4XA 1N2CB 3P4YA 1LDMA 4M7OA 3WG9A 5DSTA 5BSKA 1WMBA 5DGDA 4M22A 4GOND 3OLWA 4XLLA 5JD3A 3WGMA 3O1LA 3KSAC 4KVAA 5BNZA 4P31A 4NP6A 5CD9A 2RGXA 5J4HA 4CGZA 4RD2A 1ECGA 1TZBA 3IJ5A 2X8JB 1XEWY 1H6CA 3NWOA 3PTLA 2HZ7A 2CF6A 4IX1A 4XUDA 3RVJA 5B5SA 3TM5A 2CXQA 4JL5A 1CJBA 2PKYX 4HPJB 4V3CA 4D6PA 4MV3A 1ZGJA 2VJBA 3NPAA 1FFGA 4OQEA 3RVKA 3UGQA 4W5JA 1TQ8A 4FJ0A 1Z15A 5IBQA 3PXGA 1DAPA 4Q66C 2FSVC 2B4QA 4QYMA 5AW6A 4KR6A 2VLIA 3R0JA 3A28A 2HHAA 2Q5QA 2AYZA 4ZZIA 4TQGA 1EE9A 4CR8A 5EGSA 1W4LA 2BONA 1XU9A 2B92A 1RHQA 3DG9A 4ZVVA 5KNDH 4Z4FA 3IR7A 3PDIA 4YH1A 4KPYA 1X80B 2NWQA 4R8SA 4KUGA 1DFGA 1ZMTA 2ZTMA 4CCYB 2CV0A 4ARAA 2A0FA 4QTYA 2WF5A 3DEIA 5KTOA 1XZGA 3IKVA 3K4PA 4KXVA 1RWNA 3A27A 4U7FA 4BPRA 5K3AA 4E5SA 1R0SA 4C7OA 1LTKA 3AGPA 4UCFA 2A5GA 4MI6A 3M89A 3HZOA 3TTSA 4CETA 3WGVA 1BD3A 3K9FC 1MQ8B 3JVDA 1ZINA 4QEZA 3W4IA 4B4DA 2AN3A 2HRDA 4CXMA 4I3FA 5DASA 3HVRA 4C0HA 3THOA 4C07A 5JUWA 4P5DA 4HDRB 3F90A 3F97A 4RQUA 1IN5A 2JHPA 1CHNA 4M55A 1BE8A 2GUWA 3C98A 3OIYA 4KBGA 4LE0A 3O26A 4MVJF 4B76A 5LQKA 1KDRA 1PSDA 4G9EA 2FA9A 2Y1GA 3NRJA 1YMUA 4GEKA 4RLQA 2HT6A 3BKWA 3PQCA 3SHTA 2C07A 3GJ6A 3A26A 1ZBQA 3JYPA 2QTVB 1ZNWA 3OPYA 3CWCA 3KHSA 3EQ7A 4IDBA 2WKWA 3G88A 1DMRA 1IB6A 4BMZA 3X1ZA 5DEOA 1YDMA 3QNMA 4W7IA 1GR0A 1DBRA 2VNIA 3P9PA 3PYLA 5COBA 5HEKA 1QC5B 3B36A 2W48A 1P7VA 2PFSA 3X1MA 4AAYA 4C21A 2JIQA 4JI2B 1QYXA 3VSEA 2AEFA 1LZLA 1NFQA 4QPNA 2AFHE 1MIOA 3DEHA 3I4CA 3GMTA 2CNNA 3C6YA 1Z6TA 4M0FA 2EX1A 3A1CA 1IIRA 1IY2A 1SUDA 1V47A 3L0BA 3RF6A 5E3IA 3RUDA 4F6RB 3K53A 3GLKA 4IMJB 4UCXA 1M1NB 2D3WA 2IXEA 3PE3A 2IYZA 1UXJA 1Y37A 2PQ2A 3A36A 1EUDA 3DDNA 1HE5A 1AV6A 2GPWA 2OP0A 3KDPA 4IF4A 5B30A 4L6AA 1J8DA 1OC4A 2JJ2D 1AGXA 3IB3A 3R2JA 4MVWA 4IQ0A 2FLKA 4ZXPA 3WWYA 2NPOA 1FZQA 4J03A 3IQFA 4CODB 4LV6A 1TW3A 2C9OA 3TTYA 2O7VA 1E63A 1JDNA 1XP8A 2EBFX 2G9UA 2XWJI 4NDAA 1JNYA 3QMPA 5DNVA 5FBHA 3L40A 4U2EA 5TS3A 3D0OA 5LM3A 3AF4A 4JB3A 4Y6SA 4JFRA 2XQKA 3S40A 4BFVA 1NV9A 3RS8A 3HM2A 2IQIA 4K7JA 2QRUA 2D4AA 1SG0A 2JL1A 3W5CA 4IEEA 5IXSA 1MT3A 3EC2A 3DEJA 4G81A 2CMHA 4AG6A 4D4GA 4NG4A 3X0DA 3D0QA 4KAFA 1XA4A 3IXLA 1DQSA 3P1JA 2W8BB 3A05A 1L4UA 3DUFB 1ZU5A 1G7CA 1RDFA 2XNDD 5AK5A 3RHSA 4KPGA 2I6GA 4ANFA 4DDHA 3CTPA 4MVXA 1Y3CE 2AOUB 3HCBA 5HVNA 4AKSA 2WRZA 3LKDA 1RQXA 1N34B 1V8DA 2EP7A 2ZYAA 1D4OA 5CGQB 4ALNA 3CZQA 3FNFA 4IDOA 1CY8A 2B21A 2NZYA 4DXDA 5JAZA 3M4JA 2VHJA 5AK4A 5CVEA 1ZBDA 2OA0A 2ENUA 5JQGB 4IKPA 2ZE7A 1CLUA 5HPYB 1DWQA 1K1EA 4MDYA 1F8UA 2GXUA 1JF8A 3CSUA 3G89A 2AD1A 3OFVA 1ADCA 1FDVA 3CUSA 4W1QA 3WX0A 3ZCQA 5AOVA 1ONOA 2CL6X 1RT9A 3OQ6A 4AY3A 1EP3B 2Q46A 4NCKA 4EY6A 2OVBA 1WULS 4L9SA 4WN9B 4F3RA 4NSNA 1BXGB 2O0JA 1P73A 2QD1A 1Z36A 2HMSA 4WNAA 3CQ9A 1YAJA 2A3RA 3HEBA 4HBZA 3G2LA 3ZCPA 4M0KA 4ILKA 4P83A 3VYVA 2AG8A 5BUZA 2RC6A 3CZPA 3UAVA 1SVSA 4DR2B 2F17A 1GRNA 2UZAA 1OAAA 2ZTSA 1NM5C 1W36C 1T2NA 1TIBA 2FFAA 3G2KA 1T2EA 4YCNA 1SMKA 1SD1A 5AJZA 4BJ1A 1BD4A 3DOHA 3IMEA 3V8RA 1DO8A 1J0CA 4U7TB 4YACA 3ETHA 1CVRA 1D4AA 4D0NA 5FX2A 2WVJA 3PG5A 3S44A 1SKYB 1NN3A 2XCLA 1ZPDA 2B1IA 2HWUA 3IP1A 4HDRA 4NYJQ 4EUSA 3PJGA 1TKCA 1QHGA 1ZKDA 2VCYA 1AKVA 1MU0A 1KVTA 4LC1A 2IW3A 5I7HA 1VLZA 2O52A 2XOXA 4F2PA 2XW6A 2HHLA 1E6WA 1X7ZA 4AJHA 2GPJA 4ND3A 3R8FA 3OKAA 1WR8A 4GNKA 2ODBA 1PBTA 4HGPA 2NUTA 3GUUA 3PCRB 1A9ZA 4D6XA 3P2JA 2ZYTX 3PUWA 1L4MA 1AKMA 4JIGA 4Q18A 2O8EA 5ALXA 2MTBA 2BI8A 5T7BA 4XCQA 4Q5IA 2XCOA 3C5HA 4A8JB 1G4AE 2M6SA 2VZ8A 4H1WA 2B83A 4EM6A 3F78A 3Q87B 4I0WB 1JFFB 3DZHA 5B7QA 1S3IA 1ZRMA 4I5FA 5FIUA 2VDRB 5L6MB 3WDLA 3OZWA 5ER6A 2W83A 3RBXA 4EPYA 3JWHA 3PR3A 1YB7A 2IPMA 3QVXA 1HYEA 5DBHX 4JJ4A 3L2OB 4LJ5A 1ONSA 4ARVA 4DYDA 2X5NA 3PFKA 5BV7A 4H3SA 3HZZA 4N0DA 4ARUA 4Q9HA 1R9MA 3REQB 1S1CA 3KQSA 3EHEA 4D3SA 5ELLA 1AB6A 1MDFA 2X40A 3JRNA 3QVSA 4DLWA 3DCNA 3GFSA 1HC7A 3M3DA 1I0IA 1SUSA 1ZEJA 3H2SA 4MAMA 3THSA 3N7AA 2Q8PA 1Z26A 2QAGC 4GDMA 1WCYA 5EJ4A 3UWPA 1NW3A 2JCYA 1XFDA 2M1XA 5JU6A 2VF2A 4CLEA 2Z2XA 3H9QA 3QHPA 4IDQA 2O3JA 4BFUA 4FHDA 5HIAA 3RARA 1VIAA 4C87A 4OQLA 1VL2A 1RC8A 1BDJA 2ZQ5A 5LCXA 2WHPA 1S7GA 5BR8B 4L0MA 3V4ZA 1IZ0A 2QUKA 2ZAYA 5K4GA 3NOOA 4JGBA 5L3SA 3C6MA 1II8A 4R7ZA 2HQRA 3UXHA 3M0EA 1QBGA 2V03A 3QEJA 3NNSA 5E4FA 4RW0A 4ZEXA 2G17A 4IQ4A 3UUFA 3O8QB 2WG0A 2C99A 2FYTA 3KR2A 4DJFC 1ABFA 3A9UA 5AKHA 3R24A 1NRJB 1RWOA 1G6OA 3E84A 5J4YA 4FQ7A 1OLXA 3LS2A 4HEQA 1EHIA 1ODTC 2LCIA 2WJAA 4RJ2A 2J85A 2WAAA 4OI2A 4DCPA 1AY0A 3CIOA 3MRSA 4M8IA 4H60A 1R5NA 1D0VA 4AROA 1GKYA 3L41A 4GQIA 1DJLA 1XQ9A 2Z5LA 1Z13A 2BGIA 1U0JA 2A8YA 5MHTA 5C80A 3ESQA 2CNBA 4K1LA 3W8RA 4Z9XA 2OCYC 4WGFA 3QRWA 5ARBA 4PZDA 4I99A 4D1YA 1SQ6A 2G0NA 1TLLA 2ZI5A 3AVVA 2P1DA 3M6IA 3ZOZA 2WHRA 1T9GS 5PNTA 1S2LA 3EEYA 4WUVA 3T7TA 4DUGD 5BYJA 4ZMRA 2WJYA 5KNDD 4ZV4A 1E8DA 2DFNA 2XUHA 1JI0A 1N7HA 1S2DA 1KI6B 2AZ4A 1I2AA 1H2AS 3OTQA 1NNSA 1HKHA 3AEKA 4ACAA 5I9TA 3DDUA 1L9KA 1H93A 4MVJI 4U9UA 4YXWD 4A5OA 4FGUA 5I45A 3BIFA 4GSYA 1PZFA 3AK4A 3E18A 3FPLA 4NEGA 1DG1G 5CLLA 3TQFA 4EKNB 3GUVA 3RCBA 4LCJA 4HMQA 1DOZA 4QYIA 5F4ZA 4ZCSA 1NP3A 4K87A 3TFWA 2VNAA 1OH8A 1WPXA 5JATA 4JB2A 5BWLA 1QP0A 2ZE8A 1EP1B 3DDWA 1NMZA 4X7RA 5FLKA 2HH9A 3OT5A 4LXTA 4QBFA 5JRDS 1H6BA 1N9ZA 1VMDA 4U00A 4OJQA 3P2IA 3BN3A 2J0EA 3X43A 3ZY4A 1OTXA 4G4IA 4OB8A 4ILEA 2PH5A 1GV0A 3NETA 4GE0A 5LQCA 5LU8A 1BGWA 4F2HA 1MOSA 3ESCA 1DKMA 3WK7A 4F86A 3E3MA 4PHHA 1AC5A 3DWGA 2I03A 1ZL2A 4CR7A 1RKXA 1ORIA 3T1YB 2MCFA 4KIUA 4OIMA 2V58A 2W6ZA 3I9KA 5LXTA 4FYXA 4TVOA 5AW1A 2X19A 2OILA 3C1UA 2VDJA 5FWDA 1E77A 2QW8A 4U6SA 2CHGA 3ZXUB 5FBVB 2BF7A 3PWTA 5KX5A 3GNQA 2AEJA 1OXXK 4PNPA 1HEYA 2IYRA 5DYYA 3ODGA 4RQBA 1IC6A 4MUNA 1P8AA 4NFLA 4MV7A 2C4UA 1JHAA 5FKJA 2IZ1A 2QVGA 3CN7A 3PPVA 4QU0A 1PJAA 3JZMA 2PG3A 4YRRA 5WRFA 2JD0A 1GNSA 3UJ7A 3L0IB 2UUAB 1ISRA 2OD7A 1EAYA 2FFJA 3PUJA 2P3QA 4FSHA 2NZJA 4X90A 1XZDA 3ADCA 4KR2A 2ZB4A 2B3TA 1IZ8A 3ODPA 3RJTA 4BY9E 4WY2A 4YRLA 3KZ1E 1MX5A 4UEWA 3FTPA 1EWTA 2FRDA 4U0JA 4ZDIA 5JWOA 1TZCA 3HXOA 3A6EA 5JWRA 2Y76A 3VYTB 1R0LA 3JVUA 1QO7A 1PVDA 1ZD2P 4ON9A 5AI4A 3BBPA 1ML3A 3DEFA 3D7KA 4DDUA 1UKCA 1I7LA 2F9LA 3DWFA 3LZ6A 4GPTA 2W6PA 2WYVA 1KE2A 4IHJA 4KVZA 4O4HB 4P7KA 4A8TA 1LLFA 2XD9A 1ISIA 1BHQ1 1XZMA 2YXPX 2ZUUA 1EBFA 3UW1A 5BR1A 3ACCA 3S2UA 1M1YE 3PKIA 2ZI3A 4MZXA 1AHIA 1F8GA 1P4AA 3EXFA 2OTCA 2ZJ7A 4YB8A 4LE1A 4JLJA 1M5TA 1CJKC 1P60A 3V00A 1V5EA 1M5RA 2XZTA 4Z1OA 4NLLA 1DAMA 1JH9A 2OC4A 1NSFA 2O5RA 2YY6A 3QF4B 1U8UA 3E82A 1T36A 2P41A 2C4KA 3LQKA 4HXYA 4F06A 3PDIB 1BZYA 4K6GA 1ESDA 4PCVA 2A0XA 2ZWPA 5TNXA 4L51A 4DIOA 1XJ0A 1G3UA 3GA7A 4L95C 4ZODA 1LUAA 3CW8X 4DUYB 3FNHA 1R0XA 1X8LA 5I4BA 2I22A 4LRUA 4NU8X 4ACBA 1NR5A 2PQ6A 1EYZA 4ZT6A 1EK0A 2QRJA 3HCDA 2QSJA 4YP7A 3PZRA 3BA6A 4ARSA 2P5SA 4A1FA 1VI5A 2QSYA 4JASB 1J2UA 4CKCB 1WNFA 4FCCA 3G13A 2YW2A 1KP9A 4HNGA 4QBHA 2DFLA 3KQHA 2C2KA 5EE9A 5ECDA 4ER7A 4HX2A 2YMQA 4KGZA 1T36B 3C39A 1SUCA 4JOSA 1BCRB 5ALLA 4DG8A 4F92B 4PSKA 2TMKA 2WEKA 3SJCA 2ZBGA 4KQ1A 4P92A 2WSSA 3UHAA 3CKMA 2GCEA 5IVIA 3VO1A 1R0ZA 2YDYA 3NXSA 5DLQC 4IDAA 3RSSA 1RHUA 3QBDA 3GVXA 4JDUA 3HNPA 2W43A 3HFGA 1WSWA 4M4SA 3G3EA 4CL8A 2K7FA 4CU2A 5B4VA 1KFEB 3NBKA 3PUKA 3WYFA 1KJWA 2XMPA 4PU0A 5AM1A 1GSIA 1AQUA 2RONA 5HA5A 3STHA 3ZCRA 5A0VA 5KJCA 5AHWA 3F73A 1EU1A 4M9QA 1N6IA 1J39A 1SC9A 3ADBA 2W2KA 2B1JA 2XKAA 3OJEA 4RWEA 1UMBB 2NPIA 2WTMA 4NYMR 4RSMA 1S2GA 1E0JA 2FQQA 1JALA 1YBFA 2Q3BA 3FWKA 3ME5A 2AXQA 2IYNA 4IP0A 4KTTE 4LXHA 4P5PA 4YMSA 1PIWA 1T1IA 3K6JA 3RC1A 2NUPA 2GK7A 1GPUA 1A7AA 4FD2A 4G5RA 4PTYA 4UJ5A 3DXYA 5G1NA 5IC6A 1ZUHA 4N1AA 2BGNA 1P7CA 1G2OA 1P61B 1XAGA 3BCRA 3NANA 2JFOA 3GH1A 4WADA 5IJ9A 1XZKA 2RARA 3R75A 2J3LA 4C0XA 3Q72A 1XWFA 4OU5A 2ZSIA 2Z9CA 4L22A 4Q4JA 4QDJA 1N2EA 3EGIA 4LS3A 1WB5A 1X1RA 1T6BY 3EDMA 3MILA 3KK0A 2Q1XA 3MS4A 1T5BA 3KUKA 1CY1A 4ZRNA 2XTJA 4LOHA 3EIFA 3GVIA 1VDZA 1W4ZA 4X24A 3H6KA 3UFXA 1HDEA 3FZQA 2VQ6A 4YPFA 1KQ3A 4Q1CA 1GTSA 2E6KA 3JQ6A 3UUWA 3RD5A 3LUAA 4UHJA 1JPJA 4RSHA 5F23A 1MAVA 4JNKA 7REQA 5JJLA 3FFTA 2WM8A 1E3WA 4G1UC 1UBFA 2PQ0A 4PHCA 5JSKA 1E3JA 1UM9A 3BWVA 1XRMA 3STTA 3AJAA 2VYQA 1YR7A 3WRVA 1DIRA 1VJRA 3HUFA 4A6XA 2VK8A 4CKWA 2OXFA 2XITA 4QQ8A 2BP7A 4GLOA 1X87A 2WYWA 1G98A 5H4GA 5DM1A 3WK6A 1XVAA 2ZJ0A 3G79A 4YAUA 1DTWA 4NZ9A 5HF6A 5BP7A 4TRNA 5JTTA 2NO4A 3RC3A 4L16A 5BURA 4N0QA 4W99A 3NASA 4TV8A 3ZJ4A 1T9ZA 2ACVA 4XFKA 1OX4B 2H11A 4AY5A 3THXA 2Y0BA 1FS4A 1ZOOA 2CLHB 3KKNA 4U3JA 2ZCVA 2QF7A 1E2BA 2VZLA 5B4TA 2AF3C 1WCIB 2D1TA 4HQNA 5A5EA 4FJ2A 2O8CA 2P77A 1MAHA 2WSSD 4WOJA 5GWXA 2QDKA 2PZAA 3NI2A 3QXHA 4Y6QA 2NT4A 4RTOA 5K05A 2IF2A 3PBKA 1M5UA 5JVDA 3PUYA 1DIOB 1Q3KA 3WBBA 2ZIUB 4OX9B 2JIRA 3PNVA 5DH9A 3OFNA 3VTZA 3X1YA 2ZITA 2WLSA 2ABWA 1TUBB 2ZYUX 3KHTA 4KXUA 4FB5A 3GLGB 1RXWA 3HDYA 4D9GA 5T4EA 2HR1A 3LDHA 1TMOA 2YV3A 3Q7RA 4V0MA 1J4AA 1ZJJA 1ZX1A 5FPKA 3AB7A 3ICOA 1WOMA 1SBQA 5H1YA 4QDOA 2NIPA 1ZWLA 5ECGC 2ZLBA 4P84A 1BVHA 2HF9A 4DQDA 3A3YA 3STYA 5TDHA 3ZD7A 4TKUA 1N0VC 3TPCA 3EPPA 3TB4A 2UXCB 2V5VA 4RIHA 4II2A 2I8LA 3C3MA 3QPBA 4F96A 1EJ0A 3U56A 1KSHA 4JLVA 3AESB 3MMNA 3QYPA 4MW9A 3GJ3A 4GE3A 3WIVA 1P4RA 4D3ZA 2H65A 4OQZA 1IJFA 2OBXA 1AB5A 3K0KA 2G6TA 1Q15A 2ZSEA 2PUCA 2WE7A 3E9ZA 1MABA 3H5OA 4LWZA 4LSZA 2X0EA 3UOAB 4QUIA 1Y6FA 3PVSA 4IJUA 3G0DA 4FD3A 4U7DA 4QUGA 1W0KD 4YDHB 2OFFA 4ZI7A 3OOWA 3QV2A 3LYAA 4CQNA 1I7QB 3OH8A 3ZHYA 3G59A 2ZIEA 3I3SR 2GD6A 4NBUA 2AWNA 1I2BA 2P9YA 3UV3A 4E46A 5CDFE 5MFZA 3UICA 3B3AA 1ILWA 5G0VA 2IJGX 3R7BA 1DX4A 4DSOA 3PDCA 4WKNA 1CUZA 1W1WA 1FLDA 3LY9A 3PNPA 5E0OA 3G2MA 1ODJA 4UTPA 4MYRA 1ACMA 1PRYA 1W59A 1YVRA 4G0QA 4JJAA 4N5IX 1FNDA 4S12A 2PKRA 5C8YF 1F6BA 2HUNA 2HWXA 2YV4A 1FDIA 3NKFA 3JYQA 2B30A 4YRZA 1HKUA 2BEUA 1NVDA 1PHRA 1SBHA 1BRTA 3G2PA 3H4TA 4R8LA 1UBRS 1ZA2A 3TIFA 1AKUA 4H3VA 2B8EA 2ZTVA 3Q11A 3DMGA 2VQEB 2K87A 4ZICA 8LDHA 3RUFA 4AP9A 1LLQA 1DBPA 1I80A 2E2WA 5ILGA 2I2AA 4HPWA 3BK1A 1QIMA 5EP3A 5JBIA 3GLFE 1PG0A 3ZY5A 1XQWA 4MS3A 4QPJC 3K5HA 4RHUA 1DDOA 3LVBA 1EFPB 3TD6A 4XOUA 2VQSA 4E0BA 3KB2A 1XCMA 4XB1A 1IBMB 1E6EA 4KU4A 3TNDA 4FYMA 4Y2VA 5FWXB 5JSQA 1OFIA 1Y1TA 2WD7B 3SYNA 4S1PA 4JBXA 3ZI7A 3HA5A 3C8MA 4I55A 4R8RA 5CCBA 1QRSA 1WV1A 2XGMA 3QVVA 3FWNA 3QKSB 4HNAB 5FTJA 5KNCA 3N58A 1E2GA 1GGKA 3KZVA 5IS2A 1WDLA 3K15A 3U6BA 2CFOA 4L27A 1HL7A 1OZ0A 2V6BA 1P2VA 3OHSX 4HUTA 4NXMB 1KK2A 1LBIA 2R25B 4JLKA 1PU2A 2WJGA 3RYTC 2UZ4A 5AIBA 3AIKA 3OPMA 4BDSA 3VM6A 1PNVA 1RRKA 4BVEA 1DG9A 3QU9A 3QXSA 4M1TA 2DB3A 2V7BA 4NJMA 1EZZA 3C3YA 1E5LA 2ZJ8A 4ZQIA 3MRVA 1UKZA 4V0KA 1LVGA 5BOSB 3R74A 1W5SA 2WU1A 4CLOA 1L5VA 1XTVA 1U3CA 2H7YA 3O4JA 5IN5A 2PM8A 4JCOA 1N2SA 2CLKB 4BGEA 4JJGA 3TCXB 4ZVQA 1UC8A 3V8BA 3ULKA 5JQGF 4B75A 3BCUA 1HOXA 2Y0DA 2VWHA 4CV2A 1SUPA 4F4HA 1HE1C 3COPA 3DLTA 2O14A 5EUBA 1JP7A 2X1LA 3C74A 1PJZA 3QLUC 4Q1AA 4LN1A 4TQUS 3FZYA 3WGTA 1OI7A 5IK2D 3IKMB 2HDOA 4DMGA 1AF4A 1V71A 4NBWA 3MGKA 4YRNA 1N78A 5B7PA 5KOJA 3HRKA 2O5EA 2AZTA 3RIHA 1ZN2A 3SEAA 4MWTA 4LXUA 3DMPA 3SR4A 1II9A 1KAQA 3AGQA 2PLWA 4XIIA 2LCQA 2Z0MA 3BGDA 4J7UA 4L3OA 1JEQA 1NMYA 2AV6A 3BFJA 3VO9A 5K2MA 3VNRA 2B34A 4LJKA 3SVTA 1C3OA 1ZAKA 4ND1A 4BB5A 4FMPA 4ZAYA 3GW8A 4PG6A 2FPRA 3HVIA 4KRGA 1VPTA 2VF7A 3VDMA 4RTRA 1VG1A 3OU2A 1PEDA 5DTEA 1HZZA 3L6DA 1W36D 1AMUA 2V4UA 3TKLA 3AHCA 2G09A 2IYYA 3TK1A 3W8NA 4U4AA 3GFGA 3Q2OA 2BE9A 2XUDA 3QI7A 4LOKA 3S8EA 1ZKMA 1TK3A 4L28A 1I4TD 2XVAA 4PPGA 3SC6A 9GPBA 1GQSA 2PGLA 3MJRA 3NWEA 4DIFA 3VRHA 2CHUA 3P9IA 2EATA 5F5LA 1AA6A 4YRBA 3FRHA 3NWPA 4LBWA 4CUZA 5K3BA 4AD8A 3RVQA 3Q7TA 3AUYA 4II7A 4CTKA 3F67A 2J31A 4YHHB 4EI9A 2VPYA 2YKGA 2XEDA 4W5NA 3DZGA 1YR3A 2RIRA 3IMFA 4PQRA 3VZBA 1VYUA 1N8SA 2B4KA 2R6CA 4P82A 1RRMA 4KQMA 3BORA 2XUKA 2VP5A 5DHQA 3V80A 4UVEA 5HP4A 1T5OA 4OQNA 5H82A 4J90A 2X4IA 5B3JA 5B6JA 1WW2A 2ORYA 2JFQA 4MS1B 4TT8A 4Y1RB 4DV5B 1CUVA 2PL5A 4K46A 1WBBA 1C7EA 5K03A 5IVHA 5HK9A 1G2PA 3HYNA 3U4DA 4G5YA 2ZAGA 1KEZA 2D2EA 4NOJA 4MVYA 1ES9A 4KTVE 4YCCA 1P9LA 3V1UA 5LQNA 3QX3A 1V7PC 4Q4AB 1OAKA 4D3YA 4F71A 3U2QA 3ZK9A 1U0GA 1GPYA 3SLGA 1R1DA 3WSVA 4KRFA 1DQPA 2WKSA 4RZQA 5LA6F 4UOQA 4BNMA 4YXFA 1A72A 1Q0LA 1QX3A 2X76A 5GGYA 1MOZA 3AHGA 3N3AC 2XE6A 3JQ7B 2BSAA 4XTCS 4ATNA 1BW9B 2XMDA 4YRMA 2PH1A 3DXXA 2YV5A 1K86A 3OICA 2GNOA 1EUCB 1M1NA 3KCNA 2E4VA 3L01A 5GVSA 1KY2A 5DM70 3RO7A 1TAQA 1KBOA 3GBSA 5C7OO 1KEVA 5SY6A 4LK3A 4EYSA 1S8NA 1GA1A 3G8BA 3NHYA 4NE2A 4JODA 4TS3A 1JA9A 5EMNA 3CYFA 1G2IA 2CWDA 4OH7A 2ZIWB 1BDHA 1VHWA 2RGNC 5BV1A 4DEVA 1BXRA 2CMDA 5TVGA 1VJTA 3QE4A 4YS6A 2I6XA 3R20A 3DZIA 3VR4D 3AM5A 4FU0A 3RIXA 2AJTA 4LXGA 5F7ZA 4I55B 3KYCB 4S1VA 4TM7A 5DISB 3FAKA 1M2VA 1Z2OX 1GA6A 2NAFA 1V16A 1SGWA 1PEAA 1BKDR 4J4BA 2JATA 4XASA 2O7NA 4JITA 1I01A 3TINA 1LBSA 4RZIA 1LKZA 3KHUA 1H2RS 3FIJA 2WMYA 5EHGA 1WDMA 1U6IA 3N0WA 3ONNA 2GCOA 2I1LA 3UEOA 4EH1A 4EB0A 1LD3A 2HRCA 2EKLA 2XODA 3TYXA 4RQTA 3BGWA 1KDPA 3DFMA 5L45A 1SIBE 2JZCA 2O5VA 1AUOA 2Y9PB 4RETA 5FORA 4ZFNA 5JD5A 1K3FA 3TSWA 2GUGA 3I73A 1TD1A 1GRCA 2NOAA 2P4SA 5EQJB 4U02A 2BFBB 3KTAB 4RD1A 1ZCJA 3O4IA 3IELA 5AVKA 1QOZA 5A0TA 5KC9A 2GCPA 2WJZB 1X42A 3VNSA 2ORVA 4LBYA 1DDIA 4KFTA 3WNVA 3NUQA 4UEKA 4W7SA 4I7EA 4PZPA 3TZQA 4XFJA 5KPJA 2NP7A 1H0KA 5DWVA 5IXYA 1RYEA 1LPOA 3MB5A 5ETJA 4BQQA 1E9VA 1LGYA 3E6AA 2GBLA 2OV2A 3LGSA 2EAUA 3PF9A 3L0SA 2P4EA 2OAP1 2JIPA 3GRZA 3GPBA 4OQ4A 2XVZA 3H3XA 1V0JA 2R5FA 3D1VA 1WL8A 4BO0A 1XZIA 4L7VA 4DBZA 2PKQO 3CFYA 3B7PA 1U3FA 3BTVA 1WQ3A 1Y1RA 4FQ8A 2IS6A 4HSEA 2PSJA 3LV8A 3A3KA 1Q1NA 1PK9A 2I2FA 1T4CB 1XYGA 2CF5A 2J4DA 3GYBA 5DDIP 2I9KA 3EUEA 4C5BA 2O8NA 5GQSA 1K8YB 1NY5A 4INJA 4RPCA 1HV8A 4L50A 4REMA 5KQLA 4HAWA 4H9GA 3WRYC 4PYNA 4DSZA 1PL8A 2GZMA 1Z6YA 2FEMA 3T3DA 3U80A 5ITSA 4RTPA 3AESA 2LTAA 4HADA 2RI6A 4X45A 4ETMA 3B1KA 3UO8B 3WK4A 1RBZA 1S4QA 4NV3A 2Y0EA 1K0UA 3GX1A 2H57A 5B3KA 1C50A 1OFUX 4RK5A 4KLAA 1Y9DA 1RCUA 4LTNA 2QD5A 1V6SA 3TDKA 2X0KA 4ECAA 2JVKA 3U37A 3LLUA 1IG0A 4I08A 2R8OA 2P8SA 3TMAA 3WFZA 3ZDBA 1HMPA 3E1KA 2CLEB 4ND4A 3RUHA 1TFRA 2QRNA 2FOLA 1YZFA 3PRKE 4QOSA 1O08A 4I4TB 1YRAA 3LFUA 5EZ5A 2ZZNA 2H29A 3LK6A 1XCBA 1P1HA 5FOSA 1Q84A 2X4LA 3VHXB 2QAGA 3L5KA 5ESWA 4RTNA 2MMCA 2BJHA 2HM7A 3T0GA 3T8YA 3IJRA 3JQGB 4K8OA 4WASA 3B53X 1CFJA 1U1FA 1RHMA 1XCOA 2FLWA 3ET5A 4LZWA 1L4HA 3ZHBA 5DXJA 1JLMA 5EFZA 3CF0A 3WMWA 1XTJA 3F3YA 3NNDA 4WA8A 1HLDA 1E2FA 1G21E 4XX0A 1C3LA 2WU3A 3ZEAA 5JZOA 2GBFA 4E2YA 3ECCA 2D7JA 3LVFO 4N0EA 4WLOA 2WF6A 3HP1A 4R7TA 2OWEA 3FYDA 1P4HA 1C0PA 1E2DA 1F5SA 1GU0A 1U3UA 5JWHA 3AOEC 1J1ZA 3IE1A 2HMUA 1NPTO 1LQ2A 2Y66A 3L1KA 4FFBB 1JYSA 2QUZA