1S2GA

Purine 2'deoxyribosyltransferase + 2'-deoxyadenosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
167
structure length
165
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDGFTDPDEKPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of purine 2'-deoxyribosyltransferase, substrate complexes, and the ribosylated enzyme intermediate at 2.0 A resolution.
pubmed doi rcsb
source organism Lactobacillus helveticus
molecule tags Transferase
molecule keywords purine trans deoxyribosylase
total genus 50
structure length 165
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s2gA00
2NX2A 3O8OB 2PMBA 2F62A 4KXNA 4OHRA 1S2LA 6PFKA 3K2QA 2IZ5A 4JELA 3OPYA 1S2DA 4OHBA 1WEKA 4LJLA 1YDHA 5AJTA 3EHDA 2PFKA 2A33A 2F67A 5AJUA 2HIGA 2Q4OA 3BQ9A 3UQZA 4WL0A 2KHZA 4LJKA 1MTOA 3SBXA 1S2IA 4LJRA 1S3FA 1RCUA 4KXMA 4RH3A 3O8OA 1ZXXA 1WEHA 4P5EA 2A0KA 2Q4DA 3O8LA 2F48A 4FYKA 4P5DA 1PFKA 3HNOA 4I7EA 3OPYB 1F8YA 4I36A 4JENA 4FYHA 4PFKA 3MAJA 2IZ7A 4NPAA 4I4IA 5ITSA 3PFKA 4HX9A 2IZ6A 4MEJA 1F8XA 3IMKA 4A3SA 1KZHA 4U1RA 3GH1A 2F2TA 3F5MA 4KXLA 4FYIA 3U39A 4MCJA 3O8NA 1T35A 2F64A 3QUAA 2KLHA 1S2GA 4JEMA
chains in the Genus database with same CATH superfamily
4WNAA 1O9HA 5AMXA 1HC7A 1DJPA 5LFAA 3ZWKA 5M3BA 4F1JA 3MILA 2ZRAA 3H5IA 3S8MA 3DV9A 1PR3A 4PBTA 1YB5A 1R6DA 2CNWD 5IABA 6REQB 2NO4A 3IQWA 1XNJA 3EXG2 4M0PA 5KYNA 4MDEA 3X0DA 1GDHA 2ZB4A 4F2HA 2FPSA 4KN8A 5F2KA 3QG5A 4LS3A 4DDMA 4LHYA 4LOLA 4NCAA 2Y1DA 2JGFA 4DC9A 4QYWA 1R7RA 3A58B 2DQKA 3PJDA 2ZR7A 4XE5A 3NT4A 5EKUA 4BP1A 1U1GA 1E4YA 1NBHA 1XE3A 4ZT4A 2FN3A 4WASA 4BLPA 2R97A 1XV5A 4X00A 2F3RA 4AKHA 3LUCA 1Z29A 1TLTA 2X2EA 1PJ3A 3LLMA 1A69A 3EEIA 3AC0A 3UM9A 3QRWA 4YNBA 4ZOEA 1YFKA 1Q2XA 1AKVA 2XUJA 5ADVA 1ENPA 1Z5PA 2A3RA 4WN9A 1UIRA 3GJXC 1FXUA 4KIFA 3TTTA 2CK3A 3QBEA 3HTXA 3IH5A 4X8OA 1ZQ1A 2QRNA 2LR0A 3IQFA 2NSLA 2R2GA 3QLUC 3K2EA 2C97A 4IOJA 3DMHA 3DM5A 5ALKA 1JI3A 3B1WA 4MIEA 2FPUA 3KZOA 3UXEA 4IMPA 2JAWA 4LJ9A 3QU5A 2Z2ZA 1NIJA 6Q21A 4CL2A 5LP6B 4P0PB 3RC8A 5ALPA 4G0UA 3DTYA 1VGVA 4TUYB 4EZBA 2O5EA 2IOHA 1DIHA 3A25A 1RJ9A 3FUUA 2YZKA 3I72A 2Y1WA 4ME6A 1FQKA 2MSDB 2DETA 1O8CA 3NJ4A 5ALYA 2OESA 2XTMA 2GAJA 4I08A 2IUUA 1FS5A 5BUZA 4K5QA 5DM2A 1ZX1A 2QJOA 3M5WA 3INNA 4RYLA 3HI4A 4ZVLA 1VYHA 1ISHA 1DC7A 3ASZA 4RKRA 5FBRB 3NCTA 1ZJWA 4ZCRA 3SHWA 3I9MA 2O3QA 2OVFA 1YA8A 3WJAA 4NG4A 5C8YF 3T3NA 2ZRIA 2R62A 4MQEB 1MLDA 2HN9A 2HUPA 1SXJA 1LXCA 1TAGA 2W2QA 1NHGA 4UBOA 4XJTA 2FP4B 5EIWA 5ICCA 1XMQB 2QA5A 3ZY5A 3KEFA 3O2JA 1ZGHA 3OLXA 4YRPA 4DWVA 3PKIA 3I6BA 3W1EA 4AJPA 2GH1A 3VKGA 3LKDA 3UN1A 5IKXA 1QF7A 1MX5A 5KNCD 2IS6A 1Q15A 1SXGA 4EG8A 5JCZA 4LBVA 3K32A 3WWYA 3NTRA 1X74A 1OYOA 2XCTB 3WYCA 4K6MA 3CH4B 4KN9S 5HP4A 4DLSA 3IMCA 4B6JA 5DGXA 2G08A 4MW4A 4ARVA 2BKVA 3RI3A 4A8JC 3VJMA 1TK3A 4HBZA 4YAEA 1AA6A 3ZY3A 2QX9A 2W4QA 1BEZA 4JI5B 2QSJA 3IDOA 1JILA 2RK4A 2CMDA 3G2OA 4JB3A 2I8LA 1EDOA 2X14A 3C39A 1UT6A 3NFRA 1UDBA 3OCCA 3RIXA 3RSZA 4JJFA 3GZNA 2IBMA 5LLSA 1DRVA 4LI3X 3JQAB 3RC1A 4G3XA 1B8VA 1UAYA 2DYKA 2DWQA 3NQ41 1CY2A 2JD0A 2M6RA 3M3HA 1T3SA 3HHPA 1N2BA 3FWNA 2H0RA 3M6FA 2I7CA 3QX8A 4RKFA 4CTMA 4F96A 1E1RD 1ZQ9A 1VJGA 1YJ5A 2Q3JA 3BVPA 3PNVA 5J40A 1GVHA 3UYKA 4UQLA 4HDRB 1JHOA 4ZXFA 1NDHA 1PFGA 2HJWA 2RONA 3CC8A 4AO6A 3IESA 1NVUQ 2BZGA 3TQTA 1YL7A 4G9BA 4TSFA 1PBTA 3RS8A 4CGZA 2O8DB 4DLLA 5F5NA 1U8FO 4A8HA 3KSBC 3L7JA 3E9EA 4HVCA 2X1LA 4W82A 3TINA 1XMXA 3EFBA 1C8LA 4UM7A 1GU0A 3KTAA 5FUYA 5JCOA 5K3DA 3T5DA 2DLNA 3Q9NA 4NCNA 2F67A 1ZFNA 2UZ1B 4QBTA 3CZAA 5JEDA 1UBNA 5K0LA 3OKFA 3DR5A 4HI0E 4PZUA 1E0SA 2NMVA 3GRKA 1JQEA 5ALVA 1PL0A 1DC6A 1TM2A 5AK4A 3ZK9A 1JAHA 4II7A 1E8DA 1C3EA 1TEXA 1FFCA 3CW9A 4C3ZA 5IJWA 5F21A 2CMFA 1PEAA 2JD2A 2MINA 2NVOA 1PYOA 3QVJA 4TRRA 4HRYA 5IASA 3LPCA 4BNHA 1WZCA 1J9EA 2NYVA 4JODA 4JR1A 3COSA 1SQ5A 5IC5A 4IRUB 3C6ZA 4MKGA 1DGQA 3AIKA 2Y1OA 3KPJA 2HJRA 1T3LA 1Y7PA 4XLLA 5H81A 1N75A 2JLZA 5EWMB 4PO8A 1F06A 5DYTA 1F9EA 3BUSA 3HYRA 3LC7O 6NULA 2Y1KA 4MKZA 5HOEA 1WMAA 4Z4FA 3U44A 1J0AA 2P90A 1EMDA 1P31A 2GFHA 2Q6OA 2YNMD 2NADA 4MB0A 4ND6A 3UAOA 1QE3A 3VNUA 4GWLA 4A0SA 1W5FA 1M5UA 3IT1A 1YAJA 1CEYA 1LV7A 2NGRA 3TZLA 2DFKB 3EIFA 3HDGA 2HA5A 5K9ZA 4KO2S 2IZZA 4FGUA 2IUYA 2PX3A 2Q28A 2VNHA 3S1LA 4R2LA 2B7CA 1JDBB 3BWBA 1VSUA 3ENVA 2PKCA 2C9YA 2IPNA 2Q8NA 2PWZA 2UZ0A 4RZIA 5E6UB 2WMDA 5JI2E 4EGFA 4BLTA 1OA0A 4C20A 4CU5A 2BOVA 5LPNA 1XZPA 3TSYA 4MR7B 1RHJA 5ANRB 4XUEA 2XUPA 2JVKA 3Q11A 1KDYA 1N2XA 4E1BA 1OBHA 3D2AA 1CQJB 3GH1A 4I5FA 4WLFA 1SMKA 4YJGA 3NIWA 2OPBA 4ZVTA 3AKYA 3NNSA 5GV7A 1YJXA 3OEHD 2GF9A 1C1DA 1I5RA 4MJ3A 5L4NA 1ORWA 3SS7X 3P0JA 3WV5A 1EYZA 1OH7A 4IUCS 5KYXA 1LVGA 3VGJA 2VVTA 3W5JA 1W49A 4N4AA 3K1ZA 1IUNA 3HFGA 4MLCA 3ZY2A 3CKYA 1JI0A 1V3QE 4KMOA 5BMOA 3QJ5A 1E6EA 3T9FA 3VSAA 2HMUA 1H5NA 2VK8A 1I2BA 3H16A 3ZCRA 5KVVA 4D7AA 1CVLA 2MSNA 3G1TA 1DBQA 5FDFA 7ADHA 5L3SA 2Y2VA 3FZEA 4Q37A 2HU8A 2G80A 2XPCA 4E46A 221PA 4JCCA 4TWZA 2FWAA 2PT7A 5EQTA 1U7ZA 4RETA 2BHTA 3FOAA 1T2AA 3LWZA 5JXGA 1UT8A 1MD9A 2ZJ2A 2OYSA 3PRHA 4HJRA 3HM2A 3PKJA 4P32A 4Y98A 2LW7A 2VYFA 5FB3A 3UUFA 4A0RA 2IU3A 2A5JA 3WK5A 1W29A 2E4XA 5AO9A 4R8LA 5KKCA 3LYUA 4TLBA 4NPCA 6GPBA 1H93A 4LAFA 3F1LA 1QRTA 1ENOA 2QQ5A 4DEXA 3KAKA 4PQGA 5CK4A 5HQTA 4JC5A 2UYHA 3KT0A 1C4KA 1QAMA 4FC7A 3DOOA 5WRFA 3NALA 3OTHA 2YJZA 1CJSA 4I0WB 4LK3A 4JR0A 1BJTA 1H1DA 4B17A 1DBVO 3CISA 3GBSA 4I9GA 5K7SA 4S1NA 4ER6A 2O2DA 3E81A 3O75A 4YDRA 1ZNWA 4Y2TA 3WGUA 4BOYA 2PFKA 4AAYA 2NUAA 1EP9A 4C07A 3VR5H 4IOMA 4GMGA 4EWLA 1QDEA 2JCYA 2MYTA 2P9BA 4Q9JA 5DDIP 2GCOB 2FRVA 4EHIA 4URVR 3CVYA 2F8SA 4YCNA 3NS7A 2JG3A 4WLVA 1W19A 2A2ZA 1D2NA 2OBBA 1DAIA 2QZ4A 3SQXA 2HPVA 3TRHA 3UC5A 2YC2C 1UWKA 1BU8A 5I7AA 3KR9A 4KO8A 2FDXA 5DM4A 4DRXB 4EA7A 4EYSA 4OHYA 1ONPA 2XMQA 3QLTA 3RTCA 3SYTA 1JUDA 3AIOA 2FPRA 2M9MA 5DP2A 1TOAA 1NY5A 2ZANA 2XCRB 1BQ3A 1Q95A 1JKJB 3JVEA 4C06A 3TQRA 1E2NA 1YQ9A 4BX2A 2A5LA 4D99A 4N5LA 2IHKA 3E4DA 4ENQA 3THXB 1PV2A 2P9GA 4YMGA 2ETVA 2FQ1A 1SVOA 1DTSA 2QZJA 4XTCS 5ISMA 2C99A 3ZVNA 1NFFA 1PW5A 2VT6A 1YFLA 2PGOA 1G5QA 1ATIA 1KJZA 1XQYA 2J0UB 4YO8A 2OGSA 5TQJA 2QTHA 3BJMA 2HSGA 2IHTA 3LA6A 4JLWA 4R68A 2QXTA 2JAHA 2A9JA 1HDXA 2GERA 2R79A 4CEJA 3SJCA 5BPFA 1GZ4A 1KOJA 2W2LD 1L5WA 4G0PA 4I36A 3R9WA 2N75A 1MJFA 1HZZC 1QGED 3LX4A 4DA7A 2RIRA 2O8BA 1ZBDA 3LIPA 1T25A 1FFSA 1XA4A 3BOSA 3OE7A 1G8JA 1ZKDA 3N5KA 5AM0A 1SVMA 3W4IA 4ZVVA 1X1EA 4ZTZB 1ZJ5A 3F5SA 1DC5A 3RYHA 5EMNA 3TN7A 4XKJA 3K9CA 1UT5A 2FJPA 2A4MA 2EKBA 1YZHA 2IZ0A 4X20A 4D43A 1E6UA 3K2BA 2PNFA 5JLJA 3OLWA 3SX4A 2AMFA 3PUJA 2F3QA 2XRFA 4GSLA 1TW3A 4R9NA 1W4CA 4UBLA 3T54A 4CLXA 2XY4A 3QEMB 3A1SA 3AVUA 3OZUA 2NG1A 2AYZA 1TCBA 3IJ5A 3R6TA 4GQAA 2PV7A 4DR1B 1XJ5A 4BBJA 4FMPA 2DWUA 3JASA 3Q1LA 3OWHA 4ABYA 2PKXA 2FR8A 4MWZA 2YYSA 3GLRA 2BGLA 4R1QA 3NBFA 2VJAA 2P75A 3FBWA 3ROEA 3SAJA 3CX4A 1MAVA 3OZ7A 2OT3B 4MRRA 3MTGA 4ZVUA 4QGFA 1OLXA 2BR4A 3VH4A 3PPWA 1SOMA 3FMVA 1E5QA 3BAZA 1TCVA 4UUNA 4GI5A 2CUZA 4UOZA 1RU3A 2Y1XA 1EFRD 1VLLA 2JFPA 2WJWA 1ZK1A 3ZU6A 3ZTYA 4JLKA 2QNRA 3TQFA 2QUZA 2AK2A 4RFLA 4YT5A 1NUHA 3DCYA 5EA2A 1Y5RA 4KRYA 3C3XA 1G8PA 1MC4A 3JAKB 3OE5A 1E1KA 3PJGA 2ZATA 1LNSA 4JOBA 4WCFC 3W5VA 2I54A 2WQ6A 1B8PA 2Y93A 4ICIA 5C52B 1KIFA 2FSHA 4BN4A 2IPLA 2XVZA 4LYYA 2NVUB 3ENKA 5EWLB 1EA7A 2OLEA 5DHUA 5T3YA 2BKEA 1KPGA 4LTDA 2O57A 2AFIB 3TTXA 5HZHA 4YHHB 3EPPA 3IBYA 4LYDA 4X91A 3BFJA 3AF6A 1VL6A 4LWZA 2QYOA 3SNHA 1CD5A 2V8BA 1K68A 4UW9A 1WUYA 2JIQA 1N77A 1VB3A 2L69A 1E4OA 2YHIB 4M9XA 3TLGB 2PZBA 3R0XA 3GG9A 3ORYA 1IUKA 5CJJA 4OXXA 3R5XA 2YW9A 3RRXA 1IXKA 3ESYA 2EGUA 5INTA 1YVEI 4R7ZA 2PUBA 5EPEA 2HSEA 4D46A 2OKCA 3VVMA 2FR8C 4Q4LA 2PG3A 2VYNA 1VCHA 1HLFA 1MC8A 1R0XA 2ILTA 2RB5A 2ZI3A 3IMGA 3MC1A 3PGXA 3THXA 4BDSA 2YYAA 1AUOA 4PR0A 4X6UA 5A4IS 2BE7A 3K7EA 3SIRA 4A26A 2DT5A 2HMYB 7ABPA 4UJ3A 2P2SA 5A2GA 1G6KA 4OBXA 2WFMA 4I50B 2DBZA 4DAOA 3G8AA 2IYQA 2EERA 2R85A 4GYJA 1KXJA 4IMRA 4K26A 3MJRA 1KRWA 4Q9LA 4HEQA 3CVUA 1NR5A 4HAWA 1A5AB 3EUWA 1BMQA 1E61A 2BGTA 4JU8A 4R3UC 4UOQA 2JHCA 4C3VA 4AQYB 1HNNA 4QBKA 4AROA 1E0JA 5CDYA 1OLUB 1YV9A 2NTNA 2P7IA 2QP4A 3F78A 4RHUA 3GCXA 3BIOA 3G8BA 3TMYA 1Z4KA 4RJIA 3MG9A 2V0NA 3D0OA 1RYNA 4M9CA 1N6HA 4LQLA 4RESA 4BRZA 3ERCA 2XIJA 3T35A 5JHHB 1JR3E 3K94A 5E2AA 4YXWA 1QHYA 5AJVB 3KR0A 1H05A 4GKAA 2Z5GA 4GUDA 3UHJA 3KQUA 3DZHA 1TPYA 1ICIA 4MYUA 1F51E 2RBKA 3DPUA 1KYXA 4Z7OB 3ZE9A 2QG6A 5AM4A 5B6JA 4A16A 3C41J 3FHLA 1U2DC 4NCJA 3MTDA 4MV7A 2HMAA 2OHIA 3IDZA 3VDMA 4UNRA 1U5BB 3ZJVA 2YWJA 1GG5A 5G4KB 3WMGA 5EJ6A 4YBZA 1NWCA 4MULA 1BOFA 1UJCA 3F0TA 3KZCA 3RU3A 2JCSA 4KLCA 4FI3F 4LGCA 1DOZA 4PGHA 4QXAA 4XSVA 3ETJA 5C4IA 4R2HA 1E5LA 3REQA 3K1TA 1GYRA 3WIVA 2PTHA 2EDCA 3HSSA 2C9ZA 4MXDA 4P3YA 4PN7A 4HJXA 3P52A 2QHXA 1C30A 1N6IA 4D4KA 3A36A 1V7ZA 4DA8A 2YRWA 3A06A 1SOAA 2P5YA 2PS9A 2WABA 2YFKA 3V8RA 2IZOA 2R87A 2JJ2A 4QDKA 3PQ7A 3R5TA 4ZDKA 3RJ5A 2WJGA 1UMBB 2J4FA 2HTFA 3EZNA 1EG7A 1LLDA 4Q9DA 2HJHA 2C5AA 5EJEA 3RD5A 1Z39A 1MT0A 2I4OA 3BXGA 5AI9A 4QDTA 4Z2YA 3VOSA 2Y1EA 4DLZA 3O2SB 1JT2A 2BJWA 1NNI1 4JKIA 1CUWA 1L4KA 4KHPB 2F8TA 5AJXA 2X8WA 5JMPA 3KXPA 4EMTA 2LUOA 4AJIA 2JFHA 3Q7TA 3SSOA 3DPIA 1Z4MA 3LY5A 1L7EA 3FTPA 4PZLA 5DI3A 3BFKA 3V33A 4AJ2A 4EO4A 4B7CA 1UODA 4CM4A 3QXCA 5AICA 3MMSA 5FA8A 3OJFA 2O4CA 4JUDX 3ZN2A 1UBOS 2AHRA 4M3NA 3ZBUA 721PA 5J4VA 4QD3A 5AVZA 2V6BA 3TXYA 3N8KA 4Q3OA 2Q1SA 2PKRA 4B4WA 5KNCA 1HWYA 4HSEA 2YVKA 4QNMA 2ABWA 1QKJA 5DW3A 1I3MA 1B8NA 1WDTA 2Y27A 4MGEA 2VSXA 1U1IA 4I5GA 4R5HA 5ALGA 5LQUA 3B6JA 5FQOA 1LPNA 1W5EA 4RPJA 4YRQA 2JI6A 2PMCA 2I6TA 2Z2XA 3FPAA 5HMMA 3RQSA 1AHNA 2C83A 3MCAA 1CZNA 1X2BA 4EKEA 3OD5A 1QHEA 1CPYA 5HF8A 2F9MA 2YXNA 4RA9A 5LWQA 2ZBQA 2V6GA 4V03A 3EZYA 3JR7A 1CQJA 3FBTA 5EWJA 2ZWAA 1XD2B 2XTAA 1KTIA 1ZXBA 5IXSA 1FNNA 4OGWA 3S68A 2JHAA 2JFWA 3RUDA 4AJLA 2XUHA 3THSA 5KYUB 1AZTA 1FP2A 4M22A 3V8BA 1LA2A 1EUZA 2OPHA 1KJJA 1NLZA 1WB4A 3FF4A 1G9SA 2H1FA 2FPGB 3FPSA 3HRHA 2E82A 4B45A 5ELMA 5K0TA 1DKUA 3FDJA 1RAGA 2AWNA 4TM8A 2PSJA 4MRMA 4CMIA 3EXHC 4F38A 3A6LA 4G5FA 4F9GA 4MK4A 3BORA 4P33A 3O2QB 1P75A 4IXMA 5LBUA 5CW1A 1QV6A 4FKZA 1D6MA 4MS4B 4GRIA 1SVNA 2QG4A 4LOJA 4EEKA 2VLBA 1OLSB 5IYZA 1RZUA 4HFMA 1MVLA 1J39A 4NYJR 4WZZA 2GBLA 3DXFA 3BCRA 4XDZA 1ISFA 2ZUFA 4UXJA 5J59A 3TLMA 3IMKA 5IPFA 3C87A 1ZVMA 2C95A 1HL7A 2COKA 3TMAA 1Q1BA 3V9AA 1J0BA 2O0KA 1XQ1A 4EIWA 2F2TA 4RW0A 3C3PA 4PNEA 1MR3F 5A4MS 3EVNA 3NDBB 3LX6A 4UMFA 4WFJA 5I51A 3ICVA 5AXCA 2J5BA 1AGYA 2WJPA 4D4IA 1O5OA 2O8CA 4TTSA 4YAKA 2Y0EA 1T0JB 1II9A 1R74A 4GO1A 1KI7A 2YZ2A 2RSLA 3JYHA 3FCUB 4K28A 5AK6A 1FIUA 4RJKA 1DBSA 1XZMA 4TWIA 3WA6A 4REOA 1ZIXA 2PCLA 1I2AA 3IAM1 4AZVA 3QEMA 1YFZA 2BCJQ 4QAQA 3EWAA 3G89A 4PC1A 3U7EB 3BMNB 2D7CA 4BTVA 3TE6A 2F8LA 4ED9A 4CKBA 2L82A 1U2PA 5EJ5A 1TE2A 4KUHA 5EOVA 4L6AA 1Q0SA 5DTJA 1E2QA 3AHFA 1HQDA 1Z62A 3B70A 3TI9A 2JCGA 2OV8A 1BWQA 1WP4A 1RRGA 1LDEA 5FCDA 4C22A 3Q1KA 2M1XA 4DQVA 3NYWA 1XRRA 1N2GA 2YH2A 1D2EA 1BHO1 1SC4A 1Q12A 5FPPA 4ZYWA 1ZXLA 2Z30A 3HB1A 4WX2B 3FDXA 4RIEA 5K2MA 1C7JA 2BZ1A 1Q6YA 1QFYA 1W34A 3AQ4A 3URMA 3QYPA 3WK6A 4M76B 2CFOA 3L7CA 4F92B 2P3SA 4DUGD 1D8AA 1MPXA 4R41A 1X1AA 1AGNA 4D4GA 1K7YA 1Q0LA 5BRNA 4JIMA 1XCMA 5K3CA 2YHAA 4PSKA 4JNKA 4KPEC 4M1OA 4YFVA 1SXJB 5F5LA 4XUDA 1M8PA 3O47A 4J0DA 5A7FA 4A8JA 1LSJA 4LC0A 3ECSA 1OXVA 3CR3C 1K7FB 1NNLA 3O3OB 3N7UA 1L4LA 1KKMA 2XQJA 4HZGA 1UZNA 1J2UA 4HOYA 3RVMA 2AOTB 4KLNA 4EUNA 2CLFB 1V9CA 4BNIA 2D3WA 4U7JA 4IFBA 1T5SA 3NIFB 4LJRA 4N76A 3GRVA 1LBHA 4J0EA 4ITVA 3VBEA 4A1FA 1A95A 4PG6A 2JJ8A 4EJSA 4TGLA 1PZFA 2CEAA 3VO1A 3AVVA 5H9VA 1F38A 3M2TA 4X8MA 1C8BA 4BKPA 3L1HA 3QVTA 2CZGA 2FPGA 2H6EA 4BLSA 2WFLB 5J1SB 4TS9A 1NOIA 3HCWA 4GUAA 4V38A 4WIAA 4YUVA 4GC9A 3RC2A 4W5OA 2N1BA 2HNAA 4TTVA 1LTKA 3HUTA 4BNWA 4PTYA 2JGDA 1I3OA 2XCSB 1L7XA 4BO6A 5AOCA 5BN3B 1GRNA 1K3UB 2EJVA 2Q21A 4NBTA 4RL6A 3FUVA 5YASA 1ZVQA 2EXXA 1XJQA 3ND8A 3O6VA 4FYHA 4WKBA 5HS6A 2EGHA 4JN6B 3MMXA 3F3KA 4RXUA 3G88A 2ZSAA 3O2NA 3F5QA 5FQNA 5JCJA 4A27A 5KVQA 3S81A 1DKRA 2AMJA 4QWMA 5JVDB 3WGTA 4D2IA 4A1OA 2GZDA 4HYYA 4RJ2A 2XRMA 4FYYA 3TTSA 4BQSA 2Z08A 3LTEA 1AQ6A 1WU8A 4UE2A 5TS2A 1KFBB 5D8DA 3CLUC 1P2GA 3VBCA 2QR3A 3KHTA 3VM6A 1G9TA 2JLQA 2XUGA 4HGQA 5FV4A 3QPBA 4TUYA 3HDQA 4GZ6A 5HJ5A 4B3JA 1FTWA 3FWKA 3OM0A 4WE3A 2JGEA 3SP1A 4EVSA 4ZODA 2F9LA 1F8UA 1KARA 1KVSA 2APJA 5GZ6A 1XBTA 4EDHA 4L95C 1U4SA 4MS4A 4EGQA 1PG5A 2G76A 2GPYA 5EE9A 4ASUD 4IDBA 1AKEA 4N0PA 4AMVA 2JA1A 2JW5A 4G63A 3I2KA 3GLIE 3LUFA 5THXA 5F23A 1V45E 1DOAA 3N2KB 1M1ZA 1FYEA 1EQUA 1F2UB 1V6AA 1XCJA 1FXWA 2OECA 5KNBD 3SE7A 2HO4A 2HRBA 4DQKA 3NYIA 3ZWCA 4H6PA 3KQQA 4JT9A 4ITUA 1PT7A 1IBKB 1AK2A 3AG5A 3DF7A 3ROMA 1WOMA 4MQFA 1C7IA 5ITVA 3I42A 1FK8A 2XUKA 1D03A 3JQDA 4MR7A 3S5UA 2QU7A 2HF8A 4KQKA 3STUA 1VG1A 1OT3A 4ZYYA 2OSBA 5F1KA 3DZJA 2LP4Y 2GVDC 4BY9E 1Z06A 2R11A 2IY7A 1DAGA 2OZPA 1U0NA 1RAFA 3PGA1 4DIFA 5D7NA 3A6EA 3EVEA 3AHDA 3BB4A 1Z8HA 3TW8B 2QX4A 4ZZ2A 1J5XA 1IC6A 5DWVA 2HXGA 3G82C 1Q91A 3LQQA 4XYBA 2EQBA 4YK7A 3W7AA 2NVBA 3M2PA 5M5BA 1EHCA 4C1BA 5T4HA 1SU8A 4NFLA 5AUPB 8ADHA 1PWEA 1U7TA 1RI3A 3NHRA 3TSCA 4Y9SA 4Q3BA 3TUIC 4LK2A 3IPAA 3CW2A 2V4MA 3H8WA 3CJTA 4M89A 4NAVA 5COBA 5IKOA 2OCKA 1EE2A 4ARUA 1NF8A 1DAMA 1U98A 5HJEA 5K45A 3L0BA 1FFGA 5CX1B 3E9DA 4JJAA 3O0DA 4GL2A 3HDYA 1PJLA 1IZ8A 1SHUX 3KR1A 1XRLA 2GMWA 4OL9A 4K6HA 2HLDD 4U6SA 4Q24A 4LJKA 4E22A 5FNVA 4EHNA 5L3QA 3DKPA 1OKKD 1XZLA 4IILA 3SZMA 4XQ0A 1UKEA 1KAQA 4YRLA 1YFJA 3KD2A 4KE7A 1RVV1 4Q12A 2RHJA 2FSVC 3FSGA 1T6NA 2OFFA 4CDNA 3HXPA 1KMHB 2B36A 1QK3A 5A9TA 3DAFA 1FTSA 4UMDA 4FE4A 4GE0A 4IG4A 3ZNNA 3DVQX 4YCCA 3CH7A 5CFLA 3AFOA 5JXHA 1G3IA 3MJEA 4L6IA 4OK5A 1QHXA 3N53A 5U1PA 4BKUA 1TPZA 3U4DA 3BGDA 5B57C 1IDN1 3TL3A 4EX7A 3PQ2A 4PHGA 4ERNA 1M6VB 3N8NA 4YJ2A 5D86A 1X87A 4P4GA 1GPJA 4ARSA 2FYTA 5GM2A 3O3NB 4FMDB 1XTPA 5DN6D 1L7AA 2PYZA 2BONA 1WXEA 4J3NA 2J9GA 1TQDA 2JF0A 2PMFA 4ZMSA 2HDHA 1OWMA 4PC2A 2X23A 1P1RA 2PUHA 2CV1A 2QQ0A 4JSYA 2EAUA 1JSZA 1UP6A 2OFWA 1Q3TA 1XP8A 2C3YA 4YV1A 1KMIY 1JXMA 1MXHA 2CY0A 3NLLA 2ZUTA 2QUIA 1NMZA 1FUIA 2IIBA 1TLFA 2DWOA 3FYHA 5EWMA 1U8EA 2WYOA 3Q12A 3VSCA 2D8MA 3HB4X 3RSHA 1XZIA 3M33A 1F0KA 4LJ4A 4NULA 1N6LA 2OR3A 3K9WA 5KTMA 1H3EA 3FZGA 4A36A 1X8LA 1T2NA 3ICPA 2I4IA 1Q50A 1HOXA 1C3OA 2C7BA 2W58A 1R50A 4N5NA 4Q4JB 5T67A 5CEEA 5EIEA 3NVDA 1RPNA 1Z7EA 1TZCA 2PT6A 2B8TA 4LFAB 4ZHQA 1P7PA 3EZ9A 1OAAA 2ERXA 1E3LA 1KMQA 2O50A 1E20A 1H23A 1CZHA 2BP7B 3M1YA 3PLAE 1NZFA 4C7OB 4JA0A 5J5CA 1QB8A 2CLLB 5EN4A 3VZPA 4AMYA 5JC1A 2YY7A 5E9QA 5ILOA 3VTAA 2XEDA 4JA2A 1A2BA 3KOZA 3LDHA 3MRSA 5FFNA 3ZYZA 1NX6A 1ZDMA 3PD1A 2JFZA 5BN4B 3IFSA 4O2LA 2OZLA 4GL4A 2DBVO 3JAKA 2NUBA 4AF8A 1TZ2A 5AVTA 2XXAA 4RGQA 3QWAA 2CBZA 4UUOA 4R1SA 4EA8A 4KAAA 2OD7A 1Q74A 4ZYTA 1A9ZA 1EXVA 4FMDF 5H3LA 3F73A 4JYCA 5EIXA 2YMQA 1YTLA 3DHVA 5C81A 2H16A 1JEYB 3N59A 3NRJA 4GS5A 3V8NA 1WPQA 3D4NA 2AD1A 3EEFA 3EXFB 3PE4A 4GMXA 4LPKA 5BWMA 5BWLA 5EXDA 5FNVF 4Q16A 4PC3A 1KZ4A 1LSOA 3KSRA 3OJWA 4R54A 4FOSA 2OQVA 1U81A 1VZ3A 1GG9A 3PQFA 4EB0A 1JR3D 3PNLA 3MOGA 1CQZA 5CU7A 2PBRA 4H7HA 3R3HA 1HX7A 4Y2PA 1JIJA 1LWOA 1WSBA 2BFFA 1AIPA 4ZOBA 1COWA 1RKVA 1LRKA 3BQ9A 2SKCA 1Y3DE 5JIBA 2ZIFA 4MQBA 3BGVA 4G5QA 1PEDA 1Y9EA 1GKYA 3GEBA 3HG7A 3ZHVA 1M6YA 2IEYA 2IYOA 5HZGA 5K0NA 1YCFA 4ZO9A 3RARA 4QBHA 2QBYB 3R6WA 5ALHA 2YASA 2ZR8A 3VR6A 3BICA 3EQ7A 3KKPA 2NP7A 4RZXA 3W1VA 4Q7MB 4JL5A 2JFQA 4N12A 4TSKA 1E1CA 3F3MA 4OXKA 4JJKA 2Z3WA 4F4JA 4JLBA 2JI9A 5HFAA 2HHCA 4ZQEA 2JIOA 1TCCA 1NXQA 1W9HA 5ABPA 3F7MA 1NQVA 5A6SA 3WXBA 4BGDA 4MQ4A 3T0IA 4DA9A 5LLDA 3GROA 3GPDG 1UADA 3EFEA 4N9WA 3COZA 4Z9FA 4WY2A 3HI6A 2IP1A 2PVPA 4I7EA 2XQIA 3HFJA 4CEIB 5I4CA 1L2TA 1OYVA 1YOBA 1KZYC 4MPJA 3B9BA 4LSZA 4KNVA 1XZGA 2DH6A 3W9SA 4EUKA 5I7VA 1B15A 3R23A 1CQPA 1Q20A 1NBOA 2H57A 121PA 3SNKA 4ZO6A 4EFMA 3H42B 4NJEA 1QQBA 2QSUA 4ZT7A 4CMJA 1G20B 1LPOA 2PBZA 2G8NA 4J9VA 2AF4C 4A5OA 3RM3A 1XX6A 2OHFA 2YV3A 2Y1LA 2R25B 3C16C 3O4GA 3SU8A 4A0HA 4CIDA 3O95A 1J5EB 3W3AA 5TQVA 4IHKA 1VB5A 3RVQA 2IXTA 3KQSA 1T0UA 1DQYA 2C4HA 2OSVA 3SIXA 2CLEB 2GM4A 2Q2QA 4B33A 2YZ7A 4GH5A 4HH4A 1LSUA 4E5PA 2OXRA 3LK7A 1ZJJA 1TK2A 5KJEA 2ZCUA 5HRUA 2G82A 4DLKA 4DEYA 1XKXA 2PZ8A 3M9WA 4FIDA 2CLKB 3IUQA 5CVDA 4JV5B 2VK4A 1JLMA 5K4GA 2I2DA 1ELOA 3WAGA 3SR0A 3P9ZA 2GPJA 2Z8ZA 2FPWA 3GT4A 3FVTA 4TTQA 4W6ZA 4HP8A 5JZSA 5ELXA 3CLHA 5FV7A 3ZWNA 1K86A 1WCIA 2FCRA 2FLVA 3HC7A 3NEJA 2DEUA 1UK9A 4BEBA 3I73A 4RQAA 3QFRA 5E8RA 5CD1A 3DFKA 2AG1A 3C3YA 3ITNA 4Q15A 4RHCA 3A1WA 4M88A 1A76A 4XGKA 1P1KA 4TKLA 3T1TA 1CTQA 4TOIA 2Q3HA 2OC9A 3O4IA 3AR2A 5DEOA 5TXGA 1CEXA 1DRKA 2N47A 4DC1A 2QRPA 4HY3A 3UANA 3EGOA 3VTFA 3GLIB 1XMOB 4YONB 5EQFA 4ZAGA 4YWHA 4MZXA 2DFNA 1N8TA 3RU7A 2EW2A 3NB0A 1ML4A 5GVSA 4RTMA 1W581 5E3JA 5C0OE 2P2YA 5DU2A 1MB9A 1P4HA 3MUOA 2QMZA 3KQNA 5I5EA 3H4MA 1QCYA 3K1AA 3RF6A 1K6IA 3LHFA 3W05A 1JJVA 3D7RA 3PB3A 3HLTA 4L72A 4RD2A 2VAVA 1TKRA 2ZREA 1S8AA 4QASA 4P2GA 2VSNA 1RXCA 1V48A 2ZAYA 4UCFA 2X3FA 4M6WB 1WETA 3I3OA 1KI6A 5C3MA 1A04A 2I1LA 3NBZC 4L76A 1A8QA 2A1TS 4PYMA 3P71T 3EGXB 5EJGA 4HGOA 4P5PA 5FPQA 3LECA 2GKSA 2F17A 4XLTA 5CA1B 1XAHA 1YMUA 5I7EA 3DT9A 3BSYA 1SCBA 2QTZA 1X1CA 1WB5A 3L0IB 5BR1A 1U7HA 1YB6A 1LBQA 2EQ5A 1D04A 2HCJB 5CH5A 3PUHA 3PQDA 1H69A 1WXGA 4BBAA 2BFWA 4QU5A 3KLMX 3UUGA 2DM6A 1Y7TA 4PBRA 4PC6A 1LC0A 3U3DA 1HMPA 2AE2A 1XKTA 1FNCA 3OY7A 2IODA 4Q1EA 1Y1TA 2ODBA 2JAOA 3G9TA 4IKPA 3SC2A 1G21B 3MTEA 5LDGA 1O96B 1VKZA 2BFDA 2WB2A 4YECA 3NHWA 4YRMA 1U9CA 5K8LA 3K0KA 2OLKA 5EUCA 3LBFA 4HUQA 2QSYA 1P4JA 4MW1A 4Q9NA 3SX2A 2XT6A 1DKPA 3SQWA 4XAQA 3L4BC 2AEEA 5E1BA 1FUKA 2R68A 5TPZA 2AJDA 1JDVA 1HTBA 1S0UA 4BNNA 4COOA 1MT3A 1GXSB 1I1QB 5KYXB 5CFNA 3OOWA 1BDIA 3P9YA 3FDZB 3PQ4A 2NV6A 4ER3A 1G18A 2Q1WA 3W8RA 4ECAA 4FWBA 3EIOA 3LXXA 3KVRA 1B93A 2Y9PB 3OQHA 1I0ZA 1YDMA 4CJXA 1BRTA 5MN6A 5B2ZA 3EXAA 1L7QA 4J0GA 1AQNA 4G2TA 1ZRMA 3ZLTA 5AM3A 2QRVA 4FDLA 4WCFA 1NKVA 3PT9A 4XIFA 3WSVA 2LV8A 4IS2A 3SKVA 5EWLA 1RYFA 1E5VA 3CUEF 4HAIA 4K88A 5CK5A 2VPZA 4H7EA 3R75A 4AWBA 1CE8A 4UTPA 3DAPA 1L9XA 1KEUA 2MJLA 3F6EX 4JVOA 2AOXA 2ZBDA 4U6QA 1YRQA 5IVIA 4JI2B 2UZIR 1XGKA 2DC1A 3IVCA 1QZZA 3MBOA 5EMMA 2RHMA 5LP6F 2AMVA 2GGSA 2XCUA 5K2OA 3DXZA 2GZHA 4YJ3F 2CXQA 3FLAA 2WE7A 4MS1B 1TT5B 1G6OA 1Q7RA 1Y6JA 4XI9A 5K0FA 2Q9UA 3VNAA 5LDDC 4OHUA 4OQXA 4M0UA 1CUFA 2UVPA 2VQDA 5ARBA 5KOYA 1RAAA 1PSZA 5DXJA 2C7RA 3IBSA 1S5PA 4YAWA 1GNTA 4HPXB 3O4RA 4DDKA 4I5IA 1L5GB 3KJXA 1JFTA 3GMIA 4Y9TA 1OU4A 1XP5A 2WPDA 2FX5A 2PU5A 4OJKA 3B38A 1NL3A 2OQIA 1CNEA 1EVLA 3K0CC 1WEKA 4PLYA 4Y6OA 5AI4A 5FULA 3V32A 1OAKA 5IZCA 3BYZA 2P40A 3EEBA 4PNZA 5I7HA 1MEEA 3L0PA 5CX4A 3IAFA 3H2IA 3F49S 1GYQA 2ZFUA 2KSQA 2H85A 4N8DA 2FZLA 3SSMA 3GJRA 3W5IA 1U0EA 4WK0B 3WO1A 3FCXA 1WPXA 1WZEA 2DG2A 3J81A 5JYBA 1GAWA 2GNPA 3FDZA 4JXXA 1E6KA 3CX8A 5KMGB 1JHZA 2X86A 3AONB 4OREX 1XPRA 2ST1A 2IU0A 3R1IA 2W22A 3SKXA 4KQHA 4LFBB 5FUMA 2XLBA 5HF6A 4RSRA 2HMSA 3G2KA 2HA0A 5DX8A 1IEQA 1XDZA 2PV0A 3PR3A 1O77A 1JQDA 1Y3HA 2C61A 4I46A 4N0DA 1BWSA 1FJ2A 2FMUA 2VPYA 1SUFA 1YHNA 2Z98A 5CPFA 3VOBA 4LA4A 1QHHA 2FN7A 4OK6A 4DXHA 6ADHA 3S27A 3HR7A 5LOVF 3QFSA 3ZWMA 2HWYA 3HZOA 1ABFA 3T4PA 1NX9A 3JYPA 4PYLA 4Z7QB 1I3KA 2J08A 3I2YX 3GRYA 1VBKA 3RUCA 1OW3B 2FK7A 3HLYA 4QOHA 4RHTA 3QPWA 1VYUA 4IEEA 4EPRA 2O3TA 2NLOA 2P67A 4NPHA 5FPTA 3B48A 4EZEA 4WJKB 4WA7A 5ITWA 1E1YA 3MK31 2JS7A 2YQZA 1CK4A 1L5ZA 2R00A 4IJUA 4GP9A 4F86A 2AMYA 3AV0B 1BDMA 1V8FA 2QPAA 2BPOA 5E9AA 5JHGB 5EKTA 3RYCB 1PT5A 2PS3A 3BE8A 3OT5A 3K0CA 3WBBA 2PL9A 1E18A 3BDIA 2BGRA 4HMPA 4AZTA 3IPXA 1SHKA 2AXNA 4RCYA 4D0NA 3IP1A 4WESA 4JKYA 1EE9A 3SMVA 1B00A 1EM6A 4K6FA 2AJBA 4ND8A 1EHIA 4GLFA 3UG7A 1IZYA 4PXYA 2DR3A 3PQ6A 5G4LA 1LZKA 1EZZA 3UUEA 3P9RA 3WNVA 3D9QX 4WZAE 4M8IA 3O91A 5FHRA 3WISA 3WO0A 1ILEA 2ZPAA 1YHYA 3GQBB 4IJ6A 3OX2A 4LYEA 4BYGA 4ZVNA 1Y1KE 3GFVA 1BS2A 5J2UA 4RLSA 4CQLA 2YVQA 4AY6A 3U3ZA 4F21A 1MUUA 4DR5B 4ON9A 2ZJYA 1UC8A 4U7HA 3VVBA 2CBGA 2QT9A 3IB6A 3RTEA 3VAAA 4B8ZA 1Z25A 1H3NA 5KB3A 2XMGA 2WLSA 4OUKX 4UHKA 3LKVA 1Z4PX 5KSOA 1JF8A 1SRQA 3BD9A 3I4FA 1NFQA 3ZHZA 1MB4A 3LSTA 1VCOA 2IF2A 4MVYA 3E27A 2XB9A 1E77A 1U9JA 2JPDA 3IAXA 4WBNF 3DZGA 5DWQA 1BXKA 1K88A 3S1AB 1U8XX 1WCXA 1OV4A 2D5IA 2R66A 1S96A 4J7CA 2F43A 3FFBA 1RLUA 1SU6A 2OK7A 1RACA 2XMCA 1CHNA 5GM1A 2EP7A 4OQYA 4CPDA 4DMCA 1EFDN 1YAHA 1XCOA 3HCEA 4BZXA 1JA9A 2H9YA 2ZYDA 3PUZA 5C8XA 1JDSA 5D51S 3N0VA 4X1YB 1GSHA 1UK6A 4ZFNA 4QBGB 4HFJA 1EGQA 3HXOA 3AM3A 1GLVA 1UMDB 1PL8A 3FNFA 4KYTA 2ZZMA 1R8XA 3R7WA 1CIPA 1HYHA 2E49A 3ELYA 3I5YA 2EWWA 4LOKA 3EK2A 1I0IA 4C29A 4LJ7A 3AVYA 2F6RA 3AKCA 1I1HA 5MDHA 1WCIB 2P1RA 5JNSA 4V0RA 3OX4A 4CLOA 5D00A 3EGDB 1M6VA 2YZNA 3P4UA 4FEGA 4M8NE 4LF9B 4ZYUA 2C5SA 5KC8A 1M2GA 2IPMA 2PA3A 3GN1A 3NVMB 3DDNA 3JWJA 5E6UA 1KDVA 1CCWA 2QDKA 2RKWA 2ZIGA 4DLXA 4JC4A 3DL4A 4EYQA 5FOWA 1KAGA 4KK4A 1QM5A 1ZD5A 1L8AA 2GT1A 2DQSA 2KJQA 3NWEA 1RE1A 2DPYA 3OSUA 4U02A 5P21A 5JZVA 1GQRA 4FC6A 1KMHA 4OYRA 1PV1A 2ZWIA 2SNIE 3ITEA 2HU5A 3ESZA 3RKSA 1QGYA 3EIXA 3FG9A 1U3TA 3KB8A 5IEBA 3QVSA 1UOEA 4PZDA 2UYGA 4JDUA 3E3NA 2CNOA 1RYMA 4L74A 4YDHB 5C5DA 1BS9A 2O2YA 5F76A 3OQOA 3F67A 4L78A 2IDKA 1BZYA 3O8LA 4AK9A 2CUKA 3AVOA 3E9ZA 1KFEB 2HQRA 2ATIA 2W43A 1SCDA 3VPGA 4Y7CA 4QGBA 1ZOLA 2CB9A 1QF9A 3PC8C 4Q6BA 3R3YA 5B4UA 3BMQB 4U5XA 3GT0A 3ZWAA 3R9XB 4CLEA 1O95C 4Q05A 5ALEA 3S29A 2YVUA 3D8UA 4MICA 2XBUA 5GQSA 3GDOA 1E1RA 2C04A 1XMVA 4OYLA 5HPYB 4KZPA 4YJFB 2XWSA 2JGIA 4F3CA 1G21E 4RAQA 3UV7A 3L43A 1DO2A 3NKVA 3PFFA 5DN9A 3W5SA 3WYDA 4B7UA 4HH3C 4IV8A 1JJFA 3OTQA 3HEMA 1GY8A 1ZWKA 4DQUA 4HX2A 2YWRA 3A9CA 3DJFA 4S1WA 1SQ0A 1BMFA 1SULA 2PE5A 1W0JD 4QTTB 5EUMA 1D2HA 1VJ5A 1BA3A 2BE9A 2DX7A 2H51A 2V6MA 2ZB2A 5FX2A 5JISA 3T7DA 2AXQA 2QM3A 2H5EA 5IANA 3MB8A 4FGSA 4N0QA 4MVJF 1V37A 2XUDA 5DOZA 3NFYA 2YCBA 3LPLA 1LQTA 1VG0B 5BSWA 5HGXA 3IEMA 4FM9A 3R0ZA 4Q4AA 1CQIB 2WB4A 4URWR 5CB4F 2W2VA 2QL9A 3TCNA 4LY6A 3VJKA 1SM4A 4OAOA 3E5HA 2FPXA 1Y7IA 4OJNA 1ZUD1 1M8JA 3H87A 4DNQA 3CGWA 5HK9A 3NBAA 1YRAA 5AP9A 3A2LA 4C0LA 1GPAA 2AN5A 4BQEA 2QJTA 2AV6A 4IDEA 1K8RA 3FOCA 5K3OA 1GN8A 2ZM6B 3EVCA 4BQOA 2X5KO 4MAFA 3DOUA 1P1BA 4WY8A 5FUVA 3TW4A 2Z09A 1S6YA 2OVBA 1BXGB 4DR6B 3OQPA 3DUWA 2Q4RA 2FSUA 3H05A 5EXSA 3P4YA 3O84A 4INJA 3M81A 3JWEA 4P4SA 3UJDA 4BKQA 2FPPA 3N8DA 3HY3A 4LJSA 5AK0A 4BJ5A 1JVNA 4RVNA 4B43A 5ER9A 3BHNA 1DLIA 2JJ1D 3ZWOA 5EEHA 3TJZA 4E31A 5BWBA 3LDAA 2AXEA 3GJSA 3FGOA 4TTAA 1W0KD 1WR8A 3A31A 3V3TA 4AB1A 3GZTB 1MNAA 4DYDA 3RWMB 3GYBA 2FG7C 2UVPB 5AVJA 5FTJA 1RJGA 3KV3O 4M98A 1NMYA 3I9LA 3PGMA 3I53A 2HAEA 2R8ZA 2ZI6A 5B3JA 1B43A 1WKVA 4A91A 4CMCA 5TY0A 1RQGA 1P9OA 4EJSC 3DZIA 1VPWA 4MV9A 4OKSA 1ZH2A 2NZVG 2AOUA 2IDZA 3BREA 1QHNA 3HKBA 3KAQA 4RMNA 2ZZNA 2YZGA 4EFKA 3V00A 3MNFA 4FMCF 1K8XB 1YR8A 4MCHA 4GDMA 4LX8A 5AESA 3AEQB 3WI7A 1I4WA 3DLIA 2ZSHA 4PGMA 2IKSA 4EH1A 5BURA 4JI0B 5L8VA 1OIWA 2WR8A 3MWLA 5JLAA 4CTNA 4DDUA 4YRFA 3WB0A 1P9LA 2E89A 4QLBA 1WABA 2EFCB 3FDFA 3D5QA 2JH9A 1QJ4A 3EIWA 2W6PA 3I6ZA 3QM1A 4LBWA 5D5HA 3V1TC 5U9CA 1X3SA 4XOUA 4EW1A 3GPCA 3HV0A 1B23P 4BQFA 5K5EA 3AL0C 4DCOA 4Q1VA 2Q5CA 1PJRA 3BH7A 5JFGA 5LZ2A 1WXDA 4TLCA 2E1PA 2JANA 2P35A 2XYVA 1LK7A 2H5IA 4UHHA 1DO0A 2YDYA 2Z58A 3JWPA 4GLJA 4LRUA 3GRZA 1W4ZA 4WUVA 2H2FA 5AVSA 3ADKA 3W6NA 5JD5A 2UU9B 4NMXB 5JDIC 3MMPA 4BS9A 1P73A 1DWOA 2ZIXA 1MX1A 1OXBB 3LQKA 4G24A 2VNSA 1G5RA 4OB8A 2E4WA 2IITA 2NN3C 4E12A 4JP5A 1ONOA 1E3IA 2KYRA 4QQKA 4CLRB 4JLOA 2V7VA 5TX7A 5ECDA 2DSNA 2Y6VA 3GMTA 1RLTA 4YMWA 1SA0A 2D2EA 4BBPA 2ZBFA 3RSCA 1I7PA 4IZ6A 1SD1A 2YVAA 3LQFA 3WFJA 4KAXA 1TRKA 3D8RA 1PWYE 4R3WA 1ZN8A 4TTTS 4UU0A 2QKYA 4YRDA 5J2TA 4HADA 2IWRA 1OX6A 3UK6A 3C5HA 5E8JA 3AF5A 4L7QA 3TKYA 1EGHA 3LYHA 3UMVA 1TL7C 2GVNA 2OO5C 3LZ6A 2VJOA 1MF7A 2V7QD 4IDOA 1RWOA 3V4SA 4E4RA 4UOEA 1WW2A 2VK2A 3HXMA 5JD6A 5GJVC 3HMQA 3CONA 2OFPA 3M49A 4FYXA 4LDNA 3L7DA 4NE7A 4AX8A 3K70C 1L3IA 2H65A 2NXWA 2OD2A 3S2GA 3AU8A 2H8KA 2NQ2C 3AM5A 3SZOA 1YZ3A 4GX0A 1WUJS 1O6ZA 4F56A 2C1ZA 2W4IA 3ND9A 4MW9A 1EWTA 3A04A 1G7RA 4KO3S 5CVEA 4K2AA 2A0XA 2WU3A 2VIIA 3W8EA 3EQ6A 4JUAA 1RPJA 3KM0A 4FPXA 4KVAA 2OXTA 1UP7A 4ZI7F 4ZC8A 3VSBA 3TLAA 4Q4AB 3LOUA 2IYWA 1TIBA 3KUKA 1UQRA 3DMTC 5EKXA 1P77A 3A9TA 1FOEB 3L6RA 2F1IA 4JP1A 1J6UA 3R7NA 2JHPA 1MDFA 4XVUA 3ADDA 4LDRA 1OWNA 2AJLI 2OWEA 1ETUA 3C1UA 4TL9A 3LO5A 3BN3A 3IEVA 3WS7A 4E6EA 4P92A 5C1IA 3Q72A 3ZQUA 4GKKB 4O2AB 4QAJA 1JDZA 2FEWB 4HDNB 2Q8QA 2NXCA 1F8FA 1JW9B 3V42A 3EXIA 1J33A 1DBPA 5EY5B 5LMCA 4TMTA 1YQUA 1RCFA 4FW9A 1PEYA 2VQ6A 4X5OA 1GZSA 2ZW9A 4C30A 3AGQA 1P1HA 5H3HA 3VNQA 1G7CA 2W2PA 1CEEA 3C48A 3L0OA 4IVPA 3V97A 2HC9A 2OUIA 2Q41A 4UMVA 3FTQA 3GFOA 2HLDA 3Q6MA 4EFNA 3BGOS 1G3QA 1ADGA 2I2BA 4WL0A 1NNEA 4MUMA 1FYWA 1PUJA 4M8SA 1RLMA 3MLAA 5COAA 3SXJA 1D0SA 3BB3A 1NC1A 1J56A 1N9ZA 5DFAA 1HT1E 2GHQA 2M6KA 5JSUA 4Z4EA 3SBXA 1D5WA 1H0HA 2XJ4A 1JIVA 3C5CA 5LZ7A 3TOSA 1T6XA 1OIVA 4YDQA 5JNLA 5H8WA 1AJEA 4HDAA 1PS0A 2AZTA 3MCTA 3K92A 5A5GA 4MV3A 1TUIA 2WG0A 4LHEA 1V7QA 1XDWA 1YZVA 3KPUA 5BUQA 1TXGA 5AHOA 1QGZA 2QB5A 2XAAA 5BSKA 4QC2A 2GBCA 2ZWPA 1M0TA 2XVAA 3JV7A 3FR8A 4H1UA 1A8HA 1MORA 3PENA 2ZROA 1K6XA 1ZW6A 1QFXA 1XCPA 2EIHA 1EXNA 3ICQB 1JYFA 2RK6A 4CEIA 4NS4A 5D3MB 4GEGA 4IIDA 3WK7A 5DEIA 3GLGE 3OFJA 2IVFA 3BX1A 3M5DA 4G0NA 4S12A 3S28A 3ZWDA 4X71A 1JZSA 1C3VA 2H08A 3CCCA 1ZL2A 1HDZA 4FB5A 1TF5A 2VTEA 1WUKS 3PTZA 4CETA 1R0KA 2HSZA 4PLVA 5CLGA 1FDIA 1CR6A 3EPRA 1U3GA 1XXHB 3AETB 3JRWA 2JFUA 3GHYA 4NFYA 3TGWA 4XFJA 1R6VA 3I92A 2WTBA 3O31A 3K4QA 4Y6GB 2VTKA 3LD9A 3AEXA 4PHTA 3WDLA 3M6XA 1OX4B 3QF4B 1Y5IA 2WKWA 5K20A 1Z22A 2YWXA 3QMMA 4YAGA 1QV9A 4KR3A 1Z5WA 2VTBB 4ND8B 4CR8A 2CFCA 1RIFA 4C4AA 2GN1A 2NIPA 2VBIA 3JAWA 2XB8A 2QUAA 4DV5B 1TUGA 3NWJA 5KOHB 5DNYB 3A4MA 1TQ4A 1IOWA 3BXZA 3D02A 2QM7A 1FCJA 2CNNA 3QXJA 1U28C 3GX1A 5G02A 4ETIA 2IEGA 2X6RA 2V7PA 1RKXA 2CKMA 4G1MB 4ECEA 1L3BA 1HEYA 2X19A 1SUCA 5I9IA 3VU3A 3RYIA 4WXYB 2QY6A 4FR5A 2FQWA 4QVKA 2IV2X 4JZYA 2GEBA 1SJ9A 3PEEA 3E18A 2QV0A 2RHGB 4NAHA 1N2HA 4PZYA 2B4KA 2ZRCA 2KPOA 3HO1A 4DDVA 3MBKA 4ZO4A 4I55A 3QV1A 3HWSA 5K3SA 4I3GA 3A6FA 4FNOA 3N70A 5LQRA 2QD3A 1IY0A 2GUWA 2WW8A 4U7WA 5H4HA 4ETMA 4PC7A 4GPIB 1KRHA 4HZUA 3TIGA 3ONVA 4HDMA 2Q9AA 1SXJC 3TLKA 4OFXA 3HKCA 2VHTA 2HSDA 3NO4A 1F6BA 5CT5A 2I7XA 1ZH0A 4I9FA 3BH0A 4BTEA 3UW1A 3GIDA 1NIPA 4RADA 1SHLA 4HVAA 3DD1A 5IN4A 1QYVA 3FGZA 2REBA 3ISJA 4LDAA 3L01A 3R3UA 3OU7A 2BF4A 5M2QA 1V71A 5AI6A 3IO5A 4WADA 3D8NA 5UKDA 1QIFA 3CE9A 2RHOA 4L16A 3BMXA 1NUSA 4P4SB 1ML3A 2WAMA 3IKJA 5EQDA 4XSGA 5BW6B 4A8TA 3ORQA 3EISA 4IV0A 3K8OE 1JE1A 1PX2A 4GECA 4LJ6A 3PUYA 2H4FA 4DF3A 1KETA 2W6MA 2IGBA 4BNYA 2FMTA 3F8SA 2FVYA 3I83A 2GPBA 1XL1A 1B1AA 4PVCA 1E9DA 4ZOLA 1E79A 3CE6A 2FZ5A 3T1OA 3V55A 4DJFC 1XTVA 1X1RA 1CUYA 3CKKA 2D1RA 3FPBA 3OA2A 5EVCA 5B3KA 2G9NA 3K4PA 1RYZA 1VJ1A 3EAFA 4JJGA 5A62A 1PVOA 1ND5A 5CA1F 1VPTA 3LC0A 4WOJA 2J6CA 2C4VA 2GF0A 4B2PA 1RZRD 1H5UA 4ZI3A 1ZD8A 1XFDA 1I4EB 3UAWA 1KK2A 4ZWNA 1Q7EA 3FPGA 4LZLA 1OBOA 3INGA 4W5TA 2QRUA 1I2ZA 4KTVE 1M2NA 2HMTA 3BK7A 4LHZA 4NCHA 1RLIA 5K3BA 2JLBA 3I2HA 2WC1A 1KEEA 2YMLA 1FUYB 1F8YA 2PLRA 4JMLA 4CFYA 5ILQA 2X8LA 4BE9A 4KGXA 2II6A 4F45A 3FUCA 1DELA 1GFWA 4MS3A 8ATCA 3WSWA 2QMHA 2UYOA 3U7QB 2DJIA 4FUTA 1BYIA 3S5JA 4AQ7A 4MVJD 3IDAA 1QG4A 3D3KA 5HUQA 3EWSA 4OJYA 1Z6YA 3LV8A 1HFKA 1ODKA 2CCGA 3W90A 3HVJA 4LZPA 3ZHYA 1N5OX 3HPRA 1E3TA 3IUMA 2BI4A 3TJMA 1ISRA 3ZZMA 5ITZA 2QOEA 4S2UA 5L45A 1KYVA 2WFAA 1AQIA 1XD2A 1H1LA 4I19A 4DMLA 1FQOA 5CA0A 3S2YA 5JI3E 1OUMA 1L8QA 3RHSA 4C14A 2FXIA 4XPZA 1ZM9A 4NCKA 3DWIA 4Z8YA 4FT4A 1UBRS 1EH5A 1R16A 2CYAA 2EOAA 2R751 1X7YA 1E4VA 1R9MA 4QYIB 2O0MA 3M4XA 1FMJA 2AJTA 3UV3A 1TQ2A 4RY8A 4QXOA 3K9BA 2XZOA 3D5TA 1UANA 1W35A 2VQSA 2ZVJA 1QO0D 1P91A 4MEAA 5G3ZA 3ZWBA 3QEAZ 3L7MA 1M54A 4MNTA 4U0JA 1NOJA 5HKKA 4GX1A 2E87A 2J9RA 4NU8X 4KEAA 4TKVB 2ZULA 3MT9A 2XOKA 2C8LA 4BB5A 3CBQA 3WMXA 4I1IA 1YZGA 4F4UA 4IWXA 1GEEA 1PHPA 4CM8A 3PR2B 1D1SA 1P5ZB 4KLRA 4Q9HA 3BXHA 3QVKA 5EZ5A 2C9CA 3NRBA 3TFWA 1NXSA 3D54D 1U0SY 1H2BA 2ZI9A 1QR6A 3NIDB 3L3BA 4XUCA 5HMLA 4NFSA 2GEDA 2QD1A 1P5HA 1G2OA 3OSZA 5ENDA 4MARA 3ZUGA 1IZZA 3OIDA 4EY4A 2I6UA 2L19A 4X1YA 2NO5A 3RYIB 1QLJA 1XQVA 4XDYA 5TMDA 3KTOA 4E1AA 4KQMA 5TQ0B 2D1SA 3ZOKA 4PR3A 1HQCA 3VNRA 3OIFA 3GLSA 4Y7DA 1Z6AA 5A3RA 3A4TA 3KYJB 1W8IA 1ZUIA 4DLNA 4DDTA 1HY3A 2GEFA 5AI5A 1DJQA 1T5IA 1IY9A 4P22A 2ZRKA 4HQOA 4PFJA 1TAQA 3VPCA 5CVUA 3L8YA 1YE3A 3FMGA 4D3ZA 5BO5A 2NPOA 3UJBA 4BVKA 4UTOA 5ALMA 3ABQB 5J1TB 1E60A 3VHRA 1EFUA 2HWWA 1XTZA 4TVKA 2VDMB 4QUBA 1YKSA 1H42A 1KFJB 2WOJA 1B6RA 4HCJA 1YRLA 3P96A 5DLEA 4ZCSA 3T1NA 1PQUA 3TSOA 5KQSA 3VU0A 1UC5B 4QJ3A 1MJGA 2QM8A 3MWJA 4JNCA 2E9SA 5HE8A 3T7JA 1MFZA 1UXKA 2VP2A 4OHWA 5CNJA 2Y66A 4DA6A 2G4LA 1E2KA 4LXTA 4BGEA 1V9SA 4U9IS 2I4RA 3RFVA 5HFJA 1QP4A 2F1HA 2O8FA 1A2KC 1YO6A 5HEKA 2A9FA 3QLVC 2ZJ0A 3JARB 4TS4A 4JYZA 1ADCA 5G4KA 1EG2A 2BWJA 2HQOA 3U7RA 3IILA 4RDCA 3SPXA 5HQ3B 4UHEA 2CF5A 2ZIXB 1SVLA 4LISA 4K9SA 1ZKMA 3R7SA 1PEKE 2IYAA 2VJMA 5JJCA 2CZQA 2ECQA 2ZT7A 1S2MA 4HFNA 3GELA 2VZ9A 4I4IA 4D79A 1NJ6A 2GHTA 4TRNA 3NU1A 4ZANA 4Z4HA 3OG9A 1IIBA 2BEUA 2VRCD 2YWFA 2QEQA 1VJRA 1VPEA 1N57A 3T9CA 3WG9A 3KXKA 1EAMA 1GGEA 3QOYA 4RVFA 3WGLA 3A1DA 2HRRA 5BOSA 2C84A 3CRNA 4MV0A 3WLMA 5JQGB 5CG1A 4AS2A 2JDIA 1XD9A 3QTTA 3FMPB 2JLSA 5HCUA 2WUEA 2GJ9A 3ILVA 3O3CA 1BH2A 2N0SA 4IXTA 3ROGA 4BFYA 4DT1A 4B3TB 4X1KA 4BN0A 4K87A 1ZMBA 2ZOSA 5J2UB 2OYCA 3PUKA 2LCFA 4ZRDA 1N0HA 3K73O 1Z6GA 3TSWA 2ATCA 4R8RA 1LQUA 3B9PA 4S05A 2EJCA 3ZJUA 1DC4A 3T99A 1UDAA 1XL0A 4HL6A 5LU9A 2DKFA 1U6IA 1GIAA 4G6ZA 2GF2A 1OFHA 3WKBA 4LRWA 1T3HA 2XEXA 3MJFA 2CLDX 2HX1A 1FNDA 4ZAZA 1ZESA 1XHFA 3HCRA 1G4HA 1XMPA 1CFZA 1XTUA 1JA0A 3NAQA 3O8OB 4F85A 1JIXA 4MVWA 3U4QA 1YR7A 3B5JA 3GWZA 5AVKA 4M9ZA 1WB9A 4LYAA 3BTOA 2I80A 4O59O 2FEOA 1JEAA 2CHVA 5E4FA 3L7AA 4M86A 3HO6A 1E1CB 3X1XA 6PFKA 1ACMA 2H4ZA 2GBLC 4ILEA 4OEHA 5BWNA 3WKEA 1KSGA 1SD5A 2VEOA 2E3JA 3UPDA 1RI1A 2HCTA 3Q40A 1OBFO 4N7MA 2AWOA 4TLAA 2GZSA 5T5QA 3RROA 1SN7A 1OFUX 2PH7A 4MLDA 2WHXA 5FOTA 1W0JA 3I12A 4MUJA 3W5HA 4X64B 3UT6A 4MLZA 4DLVA 3IQIX 1NQUA 5CDFA 1YBHA 3K31A 1G5FA 2I2CA 2BDEA 4UULA 2XE7A 1IB0A 2AH5A 1T34A 3PLRA 4LDQA 4NHOA 2AQIA 4LYFA 2AR0A 1RM0A 4R6XA 5ICMA 3IBGA 2B92A 2OHGA 4QZVA 4K9QA 2QNBA 3H2SA 1K0FA 2ZR0A 1FL9A 4ZPJA 4Q4CA 3ILYA 4XX0B 3WGQA 5KNDD 4TWJA 2QAIA 4UFPA 1S2IA 2EG9A 4ZGBA 2JFFA 1BE6A 1CZRA 4W5HA 3T4XA 3NANA 3T7SA 4XR9A 4Y1GA 4URZR 1WZNA 3PGKA 2XNKA 4TYYA 1E1QA 1R9JA 2AC2A 4IP0A 5KNBA 1CJKC 1F60A 2WHRA 1V9LA 5ADWA 3GB9A 5KINB 1B42A 1QO0A 1BIFA 1RNLA 1XD8A 1OBCA 4KGZA 4P53A 1Z5NA 3PDIA 4BRWA 2EKDA 4ZT2A 3MOSA 2YV5A 3QYAA 1XVUA 2ZRPA 4OU4A 1GNQA 3MMNA 4CQMA 2CXHA 1GJRA 1N5RA 1W85B 1DAFA 1GNLA 2P30A 3MGKA 1BXZA 4FYWA 4RLFA 4BHTA 3AUYA 2EZ9A 2JJQA 2QRVB 3B6MA 1ZGGA 2CWWA 3I9V6 1LBIA 1VDZA 4WCFB 3H5AA 3L0DA 2CXNA 1RWPA 3KDAA 4I6JA 2VT2A 3DKVA 3TW0A 4DNOA 4X97A 4D56A 4QRIA 5HZKA 2GD0A 4RLHA 1GZVA 4Z9XA 3IDQA 4U3JA 1HYGA 2C4KA 3JSXA 3LQRA 4HUQB 4LCBA 3W5CA 3CPEA 3O9MA 4L6CA 5BV0A 3W6OA 5HXAA 2Q2OA 2VA9A 3GUYA 5JCJD 5JZMA 1BO6A 4DIUA 2C3UA 2ZUUA 1JLKA 2QN8A 4QO7A 2CJPA 1NYQA 3K71B 3AKDA 2R2AA 4B47A 5DBFA 4CG1A 1AUVA 4F91B 2WQ7A 2C9MA 3NHUA 1NRXA 2I67A 2QAGC 3S3TA 1XTJA 4B48A 4KFUA 3RUPA 1IBLB 2J07A 4RBNA 2Z2IA 4YVFA 4BMSA 3U4CA 4DNXA 1AA9A 1L4HA 3ROKA 4FW8A 4ZCQA 4R71A 4PFQA 2C82A 4MGHA 1U3FA 5IP5A 3I62A 1UF9A 1EBUA 1ECGA 3OOYA 3ADCA 1LSSA 4QTUB 1V39A 1NI4B 3PP8A 4GOOD 3SHVA 4DJTA 3P2EA 2ZDQA 1CHDA 2WIGA 3GAMA 3JZAA 4DRXA 2TMGA 4D9JA 4KSBA 1WZUA 3VI4B 5KTSA 1LZLA 4X7PA 3I9FA 2J1LA 3BJEA 4X8LA 3CNQS 5DJ5A 4XLZA 2GCOA 4NU6A 1MJ5A 4PE5B 5G1PA 1FFYA 3ENZA 2Z3VA 2NUAB 3PVCA 4PNHA 1RXEA 2R8OA 1NSYA 1AKQA 3DP9A 3OMLA 4UEWA 4YC7A 3OZRA 4PLTA 4PWYA 5LQKA 1ITZA 1UPCA 1EWRA 3WKDA 2VDLB 3GC6A 4MKIA 2P9ZA 4FNAA 4QPPA 5SZJA 4I6GA 4BMNA 5IX8A 4KNYA 4G1CA 5GZ3A 4GVLA 4KR0A 2RJOA 4COKA 3PJEA 4OLBA 1U2DA 5DNAA 1JBEA 1G21A 1SKYE 3M6WA 1E3WA 1S4QA 3NYRA 3EW7A 2IYPA 2XQGA 1JV2B 3OOEA 2Q07A 2MOKA 3BPSA 4YPVA 4KR2A 1Q7TA 2GN6A 2WHYA 4UDYX 1GU7A 1XAGA 1ZK3A 4EHBA 1YI8A 3KKLA 4JB0A 4GQIA 3NWPA 4WKGA 1DE0A 1NYLA 2QMEA 2JLRA 2BLLA 3JPWA 3DE2X 1HE8B 4L4UA 2FZKA 4OK3A 3IA7A 1PR0A 3SK0A 4DCJA 2CJYA 4HWGA 4X0EA 3O21A 1NATA 1T8WA 1HH4A 4KGDA 3OLQA 4BV9A 4RD4A 1DDIA 2YZMA 3L49A 4BQNA 4FBLA 1BOOA 3HABA 3ROZA 5EESA 3UWPA 2EARA 2Q45A 4HNUA 2NZJA 1GA1A 1Q22A 5I7SA 5CCXA 3PFWO 2BGWA 4U7FA 1E6WA 1W5TA 3A3OA 1QIHA 4ZCPA 2HY7A 4Q7LA 1LJLA 3AZOA 3AR7A 1S9DA 1SNYA 3MRTA 3W79A 2CXPA 3DHEA 2R47A 3G0DA 4FYKA 1LJ8A 4DWWA 3COWA 2R5WA 3ETHA 4MIOA 5TT0A 1Z7GA 2Y67A 2ZT5A 1JKMA 2C57A 1NXPA 3M1IA 3WWPA 1OAOC 4O08A 1EK2A 4RTQA 3RS2A 3CYFA 2ZJ1A 1EDDA 1RBMA 3B12A 2GK6A 4JLVA 4WQMA 2QZPA 2K7FA 5F35A 4KOEC 3I04M 3LP5A 1UFRA 3V1YA 4JJEA 4C0BA 2RGGA 2NO6A 2X4GA 5ES4B 2W2NA 1UBGA 3CUYA 4BVAA 1PNRA 2IZ7A 3WV4A 4MITA 2R0QC 3C6BA 3CRRA 2XE4A 1RI5A 2BTEA 3I2GA 4B71A 1ZC3A 2D2IA 1W59A 3EFHA 4HX9A 5DRTA 3ZXXA 4DUGA 1LI4A 4C0JA 1AURA 3M7IA 3N8GA 2GCEA 1ESCA 3WRXA 3B1JA 1FLDA 3T3MB 3CH6A 1KO1A 1TYZA 2EBHX 4JVLA 2JI8A 3DQQA 2D59A 5T4EA 4CHTA 1SCAA 2A1UA 5C3UA 5B5SA 1B14A 3U37A 1GL7A 2MYPA 3UGTA 4AS1A 5GONB 4B3SB 2B37A 1OTHA 2R48A 4JU9A 5CM8B 4HLQB 5IAEA 3VZBA 3UJPA 2OO5A 4AUKA 4CMBA 3T5CA 2VJBA 7MHTA 1V43A 1NWHA 3IUPA 4QYSA 1LDGA 1K8ZB 5J4YA 3P0EA 2KWIA 4WKNA 5BSFA 5J4KA 1U9IA 4A0FA 4E4YA 1ECFA 2B94A 4GIBA 2L0XA 4DSUA 1P8JA 3D8TA 3B2EA 3KCNA 4CKCB 1CUEA 2ZRBA 1EWVA 1XA0A 2F1RA 2GETA 1QH9A 2P9QA 4OHRA 3SFVA 5FOXA 1XKLA 4C0HA 1W0KA 2DWCA 4PQRA 3LWNA 4RH1A 2WKSA 3SBOA 3UIEA 1GZ6A 1JQLB 2HB6A 1ONBA 3K9LA 3NT2A 3VR4A 4BTLA 4E11A 5F7OA 1N78A 1V4NA 1MAHA 1JH8A 4BB0A 3DMRA 1N25A 4OPMA 4EJFA 5HHTA 4X1IB 3WXMA 5BVHB 3LNCA 3MF4A 4TROA 5JH7F 4RM3A 3NBKA 2VPIA 3GDFA 2O0JA 3RC9A 1YZUA 3GQBA 3EEYA 3C6KA 5AW2A 5KCMA 4IEFB 4IDQA 1K0UA 3R5FA 2AR9A 3K70D 1RKUA 1TA4A 2DRIA 3WRXC 4ENVA 1Y3BE 2SBTA 1EGVB 2Z5VA 1CBUA 4AFNA 3E15A 2HQSA 3AVQA 3ZJ5A 3IQGX 4C0SA 4PPNA 1ZINA 3AF1A 3VU8A 5GJBA 5G0SA 4BNKA 4QJ4A 1UK8A 5JDIA 5JADA 2RG7A 4MPTA 1YONA 4JROA 5IFLA 2Z56A 3PI7A 5D1HA 3NW9A 1VKRA 4WH0A 1JG3A 1BU5A 2FWRA 3U4AA 2OOKA 4YGYA 5JAQA 1HZJA 1SBTA 3B13B 1AM4D 2EW1A 2EZUA 5IWAB 3EG9B 2FSPA 4DSNA 4NI5A 5GGYA 3G0HA 3EF3A 1AS0A 2YNMA 1R4MA 1PR2A 5CHYA 5DM1A 3SS9X 4TM7A 3TIXB 4JCOA 3H17A 4EHJA 4AJNA 5EZYF 4EEZA 1ZAYA 4ZHQF 4BB9A 3OZXA 3U40A 4O4LA 2PYDA 4EKGA 1QGUA 1PGNA 4J4BA 4NZPA 1UDWA 3NKLA 1IH8A 3QEJA 4NDNE 3UUWA 3AESB 4TS3A 2RKBA 1EFVA 2NSYA 4XW2A 2VBCA 1CU1A 2QW0X 2X9NA 4QL3A 1AF4A 1HGXA 2P2GA 2WFZA 2WDPA 4ZJZA 5M7EA 5JS2A 4RABA 3C7TA 4J4HA 5AUQA 4EY6A 5JYEA 1HZZA 3V4VB 4YCSA 3L8GA 4IZHA 2GASA 4HQLA 4WEQA 3SSNA 1N2CE 2WNIA 2FF5A 5B1HA 3RKRA 3IQEA 3P9CA 4D9MA 5BQFA 1KORA 3U56A 1JPNA 3YASA 1ZM2A 4QNNA 2XWBF 3QVOA 1MOQA 5KJFA 3CY6A 3CLRD 3SD7A 1VHDA 1IVNA 2SCUB 3KZKA 5D5PA 2YICA 2SICE 1TFUA 4WJLA 5HBRA 3TX2A 1TZMA 1VSTA 2DUWA 1JKJA 1UZMA 1YIAA 2GKGA 2PLWA 1N3IA 5CLJA 1GGMA 3QMWA 1BA2A 4PLFA 3FOBA 1UZUA 2NPIA 2YJTD 3GZ4A 3HBFA 3KBBA 3KVYA 4G1FA 5LKAA 4BCBA 2VNIA 1WY7A 2Z5LA 4WLOA 3TJRA 3G6WA 5G0TA 1PWXA 3DDSA 4LF6B 1GUYA 1GVNB 4F9TA 2G5TA 4HD8A 4OMDA 1YBFA 2C2OA 3H8JA 4P93A 3QTBA 5AKXA 1Z8DA 2EX0A 1CJCA 1K27A 3I9JA 2A1IA 3TTYA 1X7ZA 1X0XA 3QUAA 4CKCA 3WYEA 1ADYA 1TEHA 2C92A 2J46A 3M34A 3EOAI 2PL5A 3ZVRA 5JARA 3LT1A 2FAXA 3F6SA 3I52A 4XX1A 2A5YB 3PHBE 4EHLA 4I2NA 2WT9A 1KY2A 5LBTA 4EB8A 3G6KA 1BE8A 3TG2A 1PF7E 2C58A 3QIAA 4UASA 1XWIA 1XZBA 4HEA1 1KS2A 5FNVB 2I4NA 5B1YA 3GCDA 3I28A 1DAPA 3QVXA 4WERA 4PO1A 4DCPA 1W4BA 1RBYA 1DXYA 2D8AA 3OPNA 1U02A 4UATA 1YS1X 2GWRA 3LPDA 1M0SA 4KH0A 4RGYA 1YOVA 4TQUS 1UDXA 4JI1B 4UXHA 3PKZA 5DLYA 4UUPA 1C0LA 2O2JA 2ZQ5A 1E1MA 2EKLA 2QYSA 3JU3A 4ZA2A 5EMLA 1SK8A 5CXQA 3ZGYA 5AW0A 3OKAA 4GYWA 4OB7A 3D6VA 4J0HA 3UMJA 3O90A 5DKFA 1RWNA 2O59A 3TIVA 4D9NA 4HNRA 5DGHA 4WLNA 3AUTA 1ZUNA 2X2FA 2Q27A 1R66A 1Y82A 3C6XA 2PIAA 3M4YA 3NIGB 3R6LA 4WHMA 4NATA 2Q6TA 3D64A 4V39A 4RTJA 5B1SA 2VZ0A 1VIAA 1ZYUA 2PR7A 1PZMA 2YRFA 4M21A 4EQZA 5K8TA 5A03A 4ZVMA 3E1KA 3H9EO 4KYIB 4DMMA 2QRLA 3EVDA 3MLBA 1JFFA 4X41A 3S0JA 3GLVA 1ZSYA 3IP9A 4MUFA 3HM9A 4TV8B 1WU7A 1GV1A 3ZWQA 3RYFB 1SQFA 3R0JA 2ZQZA 1ORDA 1W87A 5LYJF 4KLZA 4Z0TA 4HATA 1G59A 4E70A 1G20A 5EIHA 1XRMA 2BFNA 3OZDA 4B46A 5CDUA 4PQYA 4L9RA 1SZJG 4RYDA 1I1OA 3R7LA 2P5TB 1C7FA 1JHQA 2VWGA 3HVKA 2MMCA 3SQDA 4E5UA 4M0CA 5DF1A 5JY6A 2ZS9A 2WJJA 3FZNA 1YA4A 3L77A 3OTWA 3G9UA 4D9BA 1IMOA 4G89A 1SVIA 3HRIA 5IVDA 3TTVA 1UBUS 2Q1XA 3EIHA 4WUTA 3T3OA 2XD9A 2OD9A 3D1LA 2HK6A 4Q01A 4WPGA 2JEZA 1ZMRA 3MAJA 4PFKA 621PA 1O94A 3IP3A 2PANA 3VR4D 3W2IA 4MGYR 3RADC 4U9HS 3WDKA 1U1CA 2WJZB 1KAEA 2Z9DA 1NSTA 2PN1A 1ZNQO 1Y5MA 4AJHA 2PWBA 5LC1A 4F7WA 4JB8A 3BDVA 4IH9A 4L27A 1X7WB 3MJTA 4QDJA 2AYYA 4K40A 5IDQA 3GA5A 3QU7A 4JBLA 2BI7A 2M1ZA 3E2PA 4MLPA 4NIMA 2VN8A 2CDAA 3MBIA 2FQXA 4KXVA 2AQ8A 4K86A 2C1EA 2IHUA 4ITRC 3ZHQA 2G28A 1QPGA 1N9KA 1KU0A 1CUJA 1WAMA 1WHTB 2ANCA 3E7PA 4DBLC 3AHHA 1PDOA 1O08A 4O4HB 4WZAA 4QVIA 2JGRA 3KX2A 3R6DA 1KE1A 1D4FA 2IP4A 4N7BA 2J5XA 2Y9MB 1VJTA 1JXAA 5KNDA 3WGIA 3V8PA 3VPXA 1H65A 2ZXFA 5HDQA 3S1AA 2WVJA 1RFGE 1PG0A 5F2OA 3ZDCA 1GNPA 3M3DA 1JDJA 4BX8A 2QE7A 4HRVA 5G53C 2D3TA 1D1TA 3EUEA 1TYCA 1U99A 1DHTA 2QGZA 3FIUA 2WMYA 2JJ1A 2PZKA 4MUAA 3BJZA 5SZHB 3WP1B 3BIXA 3L4KA 5DN6A 5JT1A 2P3OA 2K87A 2BSQA 3P9PA 4OUDB 5KVCA 1T3ZA 3H5OA 1I5OA 3OU6A 3PWSA 4RK7A 4A03A 4C21A 4B6FA 5L4LA 1KQFA 4Y6PA 4X65B 4QOIA 1MH9A 4LZZA 2P68A 3DE0X 3NHMA 4P7JA 3LVFO 4R2MA 2PT9A 5U4XA 5BT9A 3UHOA 3S2UA 5FWXA 2FY8A 4ZGGA 2G07A 4BUCA 3WAJA 3SDBA 3F7OA 4HEHA 1O94C 2OAEA 5B3AA 2BDTA 2VL7A 4K6GA 1KMMA 1A5BB 4ZOQI 5BYBA 4DXDA 1P1CA 2GBPA 3HL4A 2ZJ5A 3KQOA 4CODB 3UEOA 1WHSA 5SY9A 4BFWA 4KRFA 5IHPA 2O9JA 3NI2A 1Z4QA 3KZ1E 3O7MA 4GGPA 2DU8A 1S8OA 1QYCA 3CSUA 4YRRA 5JRJA 2BCEA 3FTNA 3SIPA 4B5LA 3PTLA 4PHHA 4BU1A 2VHZA 1VA5A 9LDTA 2X58A 4F8YA 2HWXA 3TB4A 4R1OA 4L22A 1HURA 5DASA 3ZIAA 2J9FA 3DBOB 3W2FA 1OASA 1T5TA 1OT5A 2R5FA 3QY0A 1ZH6A 2HBZA 3ANLA 3O38A 3KP1A 4ROTA 1YF3A 2JFYA 3LUHA 4YLGA 4B3IA 4W63A 1S01A 2G06A 1L7NA 4EB6B 1G38A 1NYTA 1XO1A 2QTMA 4F3TA 4RMIA 5JG7A 1D0VA 3U7QA 1YU9A 1VZ2A 4ESHA 1I6MA 2G70A 1KJ8A 1CUCA 3PYXA 2W4MA 3F5FA 5KKNB 5ESXA 4LXUA 1LLQA 4OLAA 2DP4E 5BV1A 1VMAA 1YQGA 2WA1A 3NR2A 3WP0A 3I6QA 1Z7WA 2JAPA 1Z4IA 1A4RA 3ML1A 4EY5A 1MIOA 3FOZA 1E2MA 1ODIA 1SWWA 3ASUA 1CJTC 3EDOA 3LLCA 4GICA 5AKLA 3OJCA 4G8BA 3FHOA 4II2A 5IAGA 3UICA 2YOGA 3FYCA 2VXOA 1KYTA 1M76A 2C2WA 4MW7A 3HBJA 3EVGA 2BFMA 2XQVA 2IYNA 3AI2A 4ZZ3A 4DJDC 3GQVA 4U6NA 1DUVG 4F4DA 1LC3A 4D3SA 2CW5A 5HGJA 1CUXA 4RE5A 5ALJA 4EG5A 5LIPA 2FW6A 2O2XA 3ZK7A 1U9YA 3LZCA 1LVHA 1RQ2A 2ECFA 1TA0A 2NV0A 1QC5B 1Y8CA 2FWNA 4HDQB 4A92A 5JECA 1RQNA 3N74A 3SKYA 5FJIA 5DI9A 4MZDA 4NX2A 4RD0A 1Z0FA 4U1RA 4ZO7A 1RZVA 1NVTA 2P0YA 5AKGA 4C01A 4N18A 2Z1DA 1EWKA 3RB8A 4OFBA 1TJYA 2OCAA 1WMFA 1THGA 2JFXA 1NW9B 4BEWA 3A6ZA 2QR2A 1GPLA 3FOFC 5HKLA 1NKTA 3KB2A 4J76A 4MINA 4QEKA 4AF7A 1SC6A 4YMLA 3X1JA 3DHYA 2X7JA 1PYGA 1UBSB 3LT5A 1XDBA 2JIPA 3G49A 4D9IA 3ETDA 2CK3D 3VR3A 4F46A 3ZLVA 5JQWA 1ST3A 3HXQA 1PT9A 3D2LA 2O19A 3L2OB 3I4LA 4A82A 3OM1A 4G25A 1V6CA 3HN6A 1C4OA 3W8FA 5JVDF 4KR6A 1R5BA 3KFXA 5A4KA 1YDWA 4WKOA 3D2CA 2XGSA 2NQTA 3NHBA 2YWCA 4MP6A 5ADUS 4C43A 2X8AA 3H9UA 4S04A 3Q5EA 2C5HA 3L8FA 4XH9B 2A78A 2PJDA 1K92A 4FCTA 1N3LA 4KI7A 4P58A 2JJ2D 3KKNA 2P6MA 5EP3A 2I6SA 2WF6A 4J2OA 2Q9CA 3TL6A 5K3FA 1K97A 1KAMA 3RFUA 5LQAA 4LNUB 2VJLA 1EBFA 4BVFA 3MQFA 2QIOA 2VJMB 1JJIA 2YHBA 2G63A 3OPMA 1JG2A 2CYCA 1QIIA 2WBLC 3O26A 1ST2A 3DEZA 2PRKA 3L05A 5EUQB 3MJSA 2BLNA 4PX5A 2F3SA 4RA6B 1SH7A 4ISBA 3GN2A 3F4LA 4PF1A 3RV4A 4BFXA 1CR4A 4Y2XA 2XA9A 4F06A 4Q0MA 1F6WA 2EFJA 4WV3A 5CH8A 1EFHA 1NMQA 2FLWA 4UZFA 2AVDA 3JD0A 4M1EA 1GL9B 4TVBA 2Q0HA 3BE4A 3L7LA 3T7CA 1X7DA 1I01A 4HKTA 4R0NA 2ZS7A 3CLTC 4XQGA 1IN1A 1OH5A 5FFFA 3O8DA 1D2GA 3ELUA 1Z0AA 4FSHA 4FYVA 1I4TD 1W4RA 3MTQA 3UCEA 3SVTA 3OCWA 1QOPB 2CZCA 3PFCA 3BRSA 4EG1A 2GXSA 2X7XA 3H2ZA 2C4UA 4KDCA 4X1KB 3RVRA 3A3NA 2C00A 3H9QA 2PX0A 1GGHA 2Q62A 4BNLA 1EUQA 2WJ3A 4R8SA 4IX9A 2A9QA 3TS1A 1DAOA 2DY0A 5LVAA 1Q0UA 1Z13A 2BVNA 2YTZA 1NE7A 3EMVA 3HZZA 1NJGA 1Z6PA 2O8NA 3TZ6A 3ZXUB 1MG5A 3KZMA 1A50B 1NF3A 5EI5A 2XW6A 3UQYS 4D41A 3OOHA 4MA5A 3KDSE 1DWUA 1FNBA 1G8FA 4ZIRB 4UNIA 1K8QA 2PRIA 5CDGA 3EG5A 2R8YA 4PAWA 4Z3OA 2FGKA 4L75A 3AUFA 1DARA 4TLLB 1KP3A 1WX1A 1EVIA 3RS0A 1VCNA 3K9NA 1JWLA 3OBIA 4MAAA 2I03A 1B74A 4XGNA 1GPYA 1ZR2A 4IINA 5ERXA 3J81k 2CD7A 3G5AA 4OLHA 4NS1A 2ORED 5FJJA 3ZDQA 5AKZA 1CDEA 4AJJA 2VKQA 2IXEA 3DOJA 2OY0A 1XDUA 3W3ZB 3VPAA 4BGIA 1F8XA 1V1RB 4RD1A 1YGPA 3G0GA 5I9SA 3HN2A 4O8CA 1ADFA 2XTZA 4X92A 3CXRA 3RIEA 4DGQA 1YIDA 4GT1A 3CH5A 1CZKA 2NYAA 1M1NB 1GHTA 1YGYA 2YC4C 1CY8A 2HMWA 4H16A 3HJAA 3MTAA 3K8YA 1KL7A 4B3FX 1OLUA 1JEEA 1QYWA 3UJ8A 4JUBA 3PD7A 1O95D 4MR8A 2G9UA 4R3NA 4DY4A 4RTRA 4X93A 2VZEA 1Q0QA 3MOIA 1PK7A 3PBKA 4HVTA 4YB8A 3PUIA 5A4JA 1DMRA 5LP1A 1JTVA 2AOVA 5J23A 3FMIA 3HYTA 2P91A 5IF3A 5CFOA 3AVTA 2G36A 4CGYA 2O3RA 2W8ZA 2ZSBA 4WBNB