1S2PA

The structure and refinement of apocrustacyanin c2 to 1.3a resolution and the search for differences between this protein and the homologous apoproteins a1 and c1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
b'KIPNFVVPGKCASVDRNKLWAEQTPNRNSYAGVWYQFALTNNPYQLIEKCVRNEYSFDGKQFVIKSTGIAYDGNLLKRNGKLYPNPFGEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSFIFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCPYDTQKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crustacyanin C2 subunit
publication title The structure and refinement of apocrustacyanin C2 to 1.3 A resolution and the search for differences between this protein and the homologous apoproteins A1 and C1.
pubmed doi rcsb
molecule tags Protein binding
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1s2pA00
2CM9A 1JZUA 4AZMA 3ELXA 3NPOA 1KOIA 5F58A 3FA7A 5HA0A 2DM5A 2F73A 1TOWA 2ACOA 1OEJA 2FRSA 3F9DA 2QO4A 4ZH6A 1BBPA 3UEXA 5EEDA 2AH7X 2R56A 1QY2A 1EIOA 5FFHA 4GETA 3PEDA 3MBTA 4YBUA 2RA6A 3PECA 3FA6A 3CQRA 3I0AA 5B27A 5K06A 1LKEA 4IMOA 5H8TA 4QYPA 3IFBA 1O1VA 3HWDA 4XMEA 2Q39A 1ZNDA 3TZSA 5LJCA 4IBAA 5HZ5A 4MVLA 3AKNA 3GAQA 4QYNA 1LIEA 1ICNA 2JN3A 1EPAA 4XMFA 1ZNHA 5HZQA 1O1UA 3BY0A 4OS3A 1IW2A 2A13A 3CWKA 1QFVA 4QGXA 1XKIA 3RZYA 1E02A 1PMPA 3BLGA 1OBUA 3IA8A 2WSJA 1OPBA 3B2HA 2FR2A 1A3YA 2FLJA 4AZRA 3FEKA 5D47A 2OFRX 3FLLA 1B56A 1HMTA 1UZ2X 4NYRA 4A1YA 1B0OA 3B2LA 3P6DA 1FEMA 5IO5A 1YWAA 5D45A 3BRNA 2MM3A 1CRBA 1OBPA 3C77X 3CMPA 3WJEA 4ZR2A 4ZCBA 1YIVA 2W2FA 4LZVA 5CE4A 3NADA 3D96A 3KFFA 1QWDA 1BRPA 1S7DA 3O19A 4BVMA 4TNNA 3HWGA 4TKHA 3FA8A 4YCEA 1KT6A 1OEEA 2QO5A 1KZWA 1SY2A 4M6SA 2R74A 4IAXA 3DTQA 1QABE 1R0UA 3C76X 1G85A 2G78A 2A3FX 1GX9A 4AZOA 3FA9A 2JU7A 2L5PA 4WBKA 4Y0QA 5LJDA 4D6BA 1JBHA 3DSZA 4ZGUA 3P6EA 5EPQA 1U18A 4NP1A 1DZJA 1TOUA 2K62A 1G5WA 3I17A 3P6GA 5LJHA 4TKBA 1GKAB 1GT5A 4GNWA 2OFMX 1FTPA 1IFCA 5H9LA 1CJ5A 2RD7C 1ZNEA 5LJKA 1E5PA 3KZAA 1ZNKA 1OEKA 2ALLX 2RQ0A 1IKJA 1BEBA 5C0NA 1LIFA 1U17A 1GM6A 4HPAA 3WJFA 2CZTA 4YGZA 2CM4A 1BJ7A 1DZKA 4YDBA 2W2BA 2XSTA 3VG6A 1HBQA 4I3DA 2Q4NA 4GE1A 4IMNA 4YH0A 1YWDA 1T68X 1YUPA 2AMMX 4OMXA 1KT7A 3FEPA 2AKQA 3PH5A 2O62A 4WFVA 2E4JA 1X8PA 4ALOA 5D48A 2WQ9A 5HBSA 3VG2A 3U03A 5F6ZA 3FR4A 5EDCA 4YFQA 1KXOA 3CQNA 5LKEA 3UEUA 1EALA 1GT4A 5LKFA 3WJGA 2EU7X 3QKGA 3FELA 2HYSA 5KICA 1JYDA 1BSYA 4NLIA 4R0BA 3HK1A 1BSOA 4ORUA 2WUTA 1GT3A 4QGWA 3AKMA 2FS7A 1FELA 3FW4A 1X8QA 3BS2A 4GRJA 4BOEA 3UEVA 2G7BA 5KHPA 1GGLA 4MVIA 2K23A 4YDAA 2AL0X 4ZHDA 4ORXA 2GTFX 5EEEA 1MUPA 1ERBA 1PBOA 3NX1A 1VYFA 4YKOA 3SAOA 5L8NA 1ALBA 2AT0X 1LIBA 1IKEA 4A8ZA 4NNTA 1HQPA 1KQWA 1OPAA 3WBGA 1CBQA 1JYJA 1A2DA 1OBQA 1QY0A 1NP4A 2N93A 2KT4B 3T1DA 3VG4A 4HPCA 1QQSA 1B4MA 5FENA 4N7CA 3KQ0A 3STKA 1A57A 5F1EA 1BLRA 1EXSA 2JU3A 3BX7A 2AT5X 3FENA 3BDRA 4A1HA 1CBIA 3KFIA 4I3CA 5F6BA 5BVTA 4Y0SA 3STNA 3U0DA 2AT8X 1KT3A 4HPBA 4LZUA 3APUA 3U9PC 4XMDA 5HZ8A 5H9NA 3VG3A 4YGHA 1ACDA 1I4UA 5HTEA 4ARHA 5B29A 1AELA 1E00A 4AZPA 1MVGA 3MVFA 5HCEC 4EXZA 1ERXA 1X71A 1GKAA 1VPRA 4ZFXA 2A2GA 1HMRA 1LFOA 2Q9SA 1PEEA 4RUNA 2MO5A 2FR3A 5L8IA 2PY1A 5AQ6A 2GC9A 1CBSA 3C78X 5HZ6A 2CBSA 2JU8A 1TXLA 5L8OA 5IO6A 3UEWA 4LKPA 1KT5A 1SY0A 4KIIA 4YKMA 4ALBA 1YWBA 2WQAE 2LFOA 5FAZA 3ELZA 2YG2A 2WEWA 4ZHGA 1TW4A 1PM1X 3TGAA 4EEJA 3EBKA 4WFUA 3EMMA 5HCDC 4YFPA 5H9KA 2HLVA 3WVMA 4MVKA 3APXA 3JS1A 2HZRA 4TKJA 1X8NA 1XCAA 4I9SA 2QM9A 4ORRA 4DQ3A 2LKKA 1LIDA 5HAEA 2FTBA 3B2JA 3TGBA 2A2UA 4YBPA 5IO7A 2HNXA 5HWZA 3FW5A 3CR6A 3PPTA 5DPQA 3APVA 3BU9A 4ZHCA 2AT3X 1E06A 1EIIA 3D97A 3KFHA 3NX2A 1GXAA 1KT4A 5LJBA 4EDEA 3FR2A 3F8AA 4IB7A 4IB6A 2RCTA 2JOZA 3WJDA 1L6MA 1SY3A 1GT1A 4D6AA 4AZNA 4QZTA 3P6HA 1ZRYA 5BVQA 2RCQA 3BSZE 4XMGA 1LPJA 2G79A 2WEXA 4I9RA 1IIUA 1DC9A 2HMBA 1QG5A 1I06A 4K19A 3RSWA 2CBRA 4AW8A 5EZ2A 3OJYC 3Q6LA 1NGLA 3FMZA 3NR3A 1H91A 3P6CA 2OVAA 1IFBA 1ICMA 5D4AA 1ADLA 2QO6A 1X8UA 4ZH9A 4BQUA 1DV9A 2OZQA 1DZPA 3S26A 1EPBA 1T0VA 1DF3A 1Z24A 2ASNX 2MJIA 5HZ9A 5LJEA 4ZHFA 1I04A 4ODDA 1VYGA 2LB6A 3L4RA 4GNYA 1D3SA 3PP6A 1UREA 3NQ3A 4ORYA 5DG4A 3ZQ3A 2OVEA 1SXWA 1SXXA 1GX8A 4UU2A 4N7DA 1KGLA 3G7XA 3BU1A 1MX7A 4GH7A 4O9SA 5HA1A 3VG5A 1KQXA 1RBPA 4EFGA 2XKLA 1D2UA 1BSQA 1DZMA 1HN2A 2NP1A 3EBWA 1LF7A 1HBPA 3BX8A 3PH6A 2L67A 1SA8A 5JR8A 1O8VA 1LICA 3NP1A 4TLJA 1AB0A 2HZQA 4OS8A 1B8EA 2NNEA 1CBRA 1U0XA 1FDQA 1FE3A 4Y0PA 1JJXA 4YMYA 2FT9A 1G7NA 2Q2PA 4OS0A 4UU3A 2L9CA 4QZUA 4ORSA 4A60A 2OVDA 2LBAA 4GKCA 2POAA 1QFTA 1P6PA 3JSQA 2NNQA 2WWPA 4IAWA 3O2YA 1S44A 5HTDA 3WXQA 1I05A 4OMWA 5BVSA 2Q2MA 3TF6A 5LJGA 3B2IA 1EQDA 5F7GA 1MDCA 4HPDA 4AYHA 3KFGA 1FENA 4TQ2A 1ML7A 1ZNGA 5D8JA 4Y0RA 3WJBA 1HMSA 2P8GA 1N0SA 3O22A 4XMHA 4IB8A 3EM0A 2L68A 4QAEA 3D95A 1X89A 2QOSC 4NYQA 3NQ9A 1EUOA 1RLBE 2X45A 1A18A 3HWEA 1ZNLA 2X46A 4YFRA 3HWFA 3VG7A 4DQ4A 1AVGI 1SXUA 1EW3A 1T8VA 3ZUIA 4HFOA 4LKTA 4AZQA 1BRQA 2FWVA 4ES7A 1LNMA 1SY1A 4IB9A 1S2PA 3APWA 3STMX 1BM5A 3FR5A 1NP1A 2NNDA 5KIDA 1JV4A 2ACPX 1MX8A 4TJZA 3P6FA 1QY1A 2A0AA 3CBSA 1SXYA 2W2AA 3B2KA 1G74A 2AT6X 4NNSA 3WJCA 1YP6A 3FIQA 1KZXA 4M7MA 1AQBA 4YGGA 4QGVA 2IFBA 1X8OA 4I3BA 2GJ5A 5H9AA 1BWYA 2LBVA 1YWCA 4YCHA 2ANSA 3K3LA 1DFVA 4CK4A 3EYCA 3ZUOA 1YP7A 4NLJA 2BLGA 2KTDA 4ZHHA 2FS6A 2WR6A 2R73A 1TVQA 4ORWA 1JJJA 3TGCA 4XMCA 3CBCA 4ZJ0A 4PSQA 5EDBA 4RUUA 2CZUA 5HCCC
chains in the Genus database with same CATH superfamily
2CM9A 1JZUA 4AZMA 3ELXA 3NPOA 2OF8A 2OY8A 1KOIA 4OEMA 2GTLO 3FA7A 5F58A 5HA0A 1VWCB 2DM5A 2F73A 1TOWA 1HXZA 2KTSA 3H3IA 5K68A 2ACOA 1Y52X 1OEJA 2FRSA 3FYFA 1HXLA 3F9DA 3RDUA 2QO4A 4ZH6A 1BBPA 4O4OA 3UEXA 4CDCA 5EEDA 2AH7X 2RTGB 1SWPA 2R56A 1QY2A 3MX7A 5FFHA 4GETA 4U8UO 1EIOA 3PEDA 3MBTA 4YBUA 2RA6A 3VGWA 4O4XA 3PECA 3FA6A 3CQRA 3I0AA 5B27A 2RTMA 5K06A 4O3ZA 4GJVA 1LKEA 2IZLB 4IMOA 4U3QA 5H8TA 1NC9A 4QYPA 3IFBA 1O1VA 3HWDA 3RDOA 4XMEA 2RTIB 2Q39A 2BT9A 1W5RA 1RXJA 2IZAA 2JMBA 1ZNDA 1HQQA 3TZSA 5LJCA 1VWFB 4IBAA 5FQ7E 4MVLA 1SWSA 5HZ5A 3AKNA 3GAQA 4QYNA 1LIEA 2C4IA 2IZCB 1ICNA 3Q34A 1KL4A 1VWOB 2G5LA 2JN3A 2RTAA 3SZHA 1SLFB 2RN4A 1EPAA 1RAVA 4XMFA 2RTNB 3WYPA 1ZNHA 5HZQA 2DJFA 1O1UA 2OL6O 3BY0A 4OS3A 1IW2A 2A13A 3CWKA 1QFVA 4QGXA 1XKIA 3RZYA 1E02A 1PMPA 3BLGA 1OBUA 3IA8A 2IZEB 2WSJA 1OPBA 3B2HA 2FR2A 1SWJA 1A3YA 1VWDB 2FLJA 5IRUA 5IXGA 4AZRA 3FEKA 5D47A 2OFRX 3FLLA 1B56A 1RSTB 1HMTA 1UZ2X 4NYRA 4A1YA 1B0OA 3B2LA 3PK2A 3P6DA 4GGZA 1FEMA 1VWAB 1YWAA 5D45A 5IO5A 1NQNA 1SWFA 3BRNA 2MM3A 1CRBA 1OBPA 2VFBA 3C77X 3CMPA 3WJEA 4ZR2A 4ZCBA 1YIVA 2W2FA 3MM0A 3RY2A 4C5PA 4O4UA 4LZVA 5CE4A 2X56A 3D96A 3NADA 3KFFA 1QWDA 2RTQB 1BRPA 1S7DA 3O19A 4BVMA 4TNNA 1UYOX 2VFCA 3HWGA 3FA8A 4TKHA 4YCEA 4GD9A 1SRJA 5K67A 1KT6A 1N9YA 1OEEA 2RTKA 2QO5A 1KZWA 4IRWA 2IZGB 1SY2A 4M6SA 2R74A 3PQUA 4IAXA 3DTQA 2OL7A 1QABE 1R0UA 2HKDA 1G85A 3C76X 3PQSA 1N4JA 2A3FX 2G78A 5JD2A 1GX9A 4KT5A 3SZIA 1W6FA 2G8CO 4AZOA 3OBLA 3FA9A 2JU7A 2L5PA 4WBKA 1FJ1E 5F2BA 4Y0QA 1JJUA 4CPEA 5LJDA 4D6BA 1JBHA 4JGLA 1VWPB 3DSZA 4ZGUA 1JMZA 3P6EA 5EPQA 3VE2A 1U18A 4NP1A 1DZJA 1VWHB 2X8SA 3OE3A 4Z6JA 1TOUA 2K62A 1G5WA 3I17A 3P6GA 2Y32A 5LJHA 2C1QA 4TKBA 1GKAB 1GT5A 4GNWA 1VWIB 2OFMX 1FTPA 4I60A 3S5VA 1IFCA 5H9LA 1CJ5A 4Z27A 2RD7C 1ZNEA 5LJKA 1E5PA 3KZAA 1K3BA 1OEKA 1W4TA 1ZNKA 2ALLX 2UZ2A 3SZJA 2RQ0A 4BX6B 1AVEA 1IKJA 1BEBA 2GH7A 3WZOA 1VWEB 1MM9A 5C0NA 1LIFA 1U17A 3F6ZB 1GM6A 4HPAA 1IJ8A 3WJFA 2IZDB 2F09A 2CZTA 2FGSA 4YGZA 2CM4A 1BJ7A 1DZKA 3OD9A 4YDBA 4CPFA 3WOVA 3ZW1B 2W2BA 2XSTA 3VG6A 1HBQA 1KL5A 2AVIA 1SWTA 4I3DA 2Q4NA 3RE6A 5L3YA 4GE1A 4IMNA 4YH0A 3RDQA 3SOTA 3VPJE 3GE2A 2OL8O 1YWDA 1T68X 1YUPA 2AMMX 4LQZA 4OMXA 1KT7A 3FEPA 2AKQA 3EW2A 2O62A 2FHLA 3PH5A 2E4JA 2QMIA 4GDAA 4WFVA 4COTA 3SLTA 1X8PA 4ALOA 5D48A 2WQ9A 4CPIA 3PDFA 4HWMA 4MVKA 4NW4A 3RDSA 2IZHB 5HBSA 3VG2A 3U03A 4WHIA 3FR4A 5F6ZA 5EDCA 4GGRA 1KXOA 3CQNA 4YFQA 3UEUA 5LKEA 1EALA 1GT4A 5LKFA 3WJGA 2EU7X 2X55A 3QKGA 3FELA 4KC8A 2HYSA 5KICA 4Z2PA 1JYDA 2ZSCA 1BSYA 4NLIA 3T2WA 4GZVA 4R0BA 3HK1A 1NBXA 1BSOA 4ORUA 2WUTA 1GT3A 4QGWA 4B55A 4L1NA 2FKJA 2M4LA 4PJ2A 2RTBB 3AKMA 2FS7A 1FELA 3FW4A 1X8QA 3BS2A 4GRJA 1STPA 1SWEA 4O3YA 3RWXA 3UEVA 4BOEA 2OFAA 1JJXA 2G7BA 5KHPA 1GGLA 3VHIA 4MVIA 2K23A 4YDAA 2AL0X 3WZNA 5IRAA 4ZHDA 2VDFA 4ORXA 3E3CA 2GTFX 5EEEA 4FBVA 1MUPA 1ERBA 1PBOA 2BHVA 1VYFA 3NX1A 4YKOA 3SAOA 2Z4IA 1SWKA 1ALBA 2AT0X 5L8NA 3AUMO 2OYBO 1LIBA 1IKEA 2LA7A 3JQOA 4A8ZA 4I6SA 4NNTA 1HQPA 1KQWA 4IABA 1OPAA 4INNA 2KW1A 2KD2A 4BJ8A 3WBGA 2JW1A 1CBQA 1JYJA 1A2DA 1OBQA 1LDQA 1QY0A 1NP4A 2N93A 2PI3O 4O3XB 2KT4B 2GTLM 3RE5A 3T1DA 3VG4A 2RTLA 3QQ2A 4HPCA 1SWGA 3ZI8A 1PBYA 4ID2A 1QQSA 5B5FA 1B4MA 1LCVA 5FENA 4N7CA 1JJJA 4QRLA 3KQ0A 1SWLA 3STKA 4U8UM 5F1EA 1VWRB 1A57A 1VWBB 1BLRA 1EXSA 3FDCA 2JU3A 1Y9TA 3BX7A 2AT5X 1VWQB 4MEEA 3FENA 3BDRA 4A1HA 1CBIA 3KFIA 4I3CA 1KL3A 4Z2OA 3UAQA 5F6BA 2BC3A 5FQ6E 5BVTA 4Y0SA 3STNA 3U0DA 2AT8X 1KT3A 3MG5A 4HPBA 4LZUA 3APUA 3S5XA 3U9PC 1SWAA 1NQMA 2FHNX 4XMDA 5HZ8A 5H9NA 4ML7B 1LCZA 3VG3A 4YGHA 1ACDA 1LCWA 1I4UA 5HTEA 4ARHA 4JHQA 5B29A 2C1SA 4CDFA 1E00A 4AZPA 1AELA 3TGCA 1MVGA 3MVFA 5HCEC 4EXZA 1ERXA 3V8UA 2GTLN 1X71A 4EQAC 1MOYA 4GDZA 1GKAA 1VPRA 4ZFXA 2A2GA 1HMRA 1LFOA 2Q9SA 5CSEA 3ZW2A 1PEEA 4RUNA 2MO5A 2FR3A 3ZZVA 5L8IA 4BX6A 1SLEB 2PY1A 5AQ6A 3WYQA 4U8UN 3VE1A 2GC9A 3HTYA 1CBSA 3C78X 4NV7A 5HZ6A 2CBSA 2JU8A 1TXLA 2IZBA 5L8OA 5IO6A 3UEWA 3WZQA 2Y3FA 1KT5A 4LKPA 4BX5A 4Z2VA 2Y3EA 1SY0A 4KIIA 3ZW1A 4YKMA 3SLJA 4ALBA 4MVEA 1YWBA 2WQAE 4QNIA 2LFOA 2ZAIA 2BS6A 5FAZA 1LUQA 2YG2A 3ELZA 2WEWA 4BGFA 4Z28A 1TW4A 1PM1X 3TGAA 4EEJA 4ZHGA 3EBKA 3LV4A 1NDJA 3EMMA 3EW1A 4WFUA 3VHMA 5HCDC 5IRWA 4YFPA 5H9KA 1JQPA 2HLVA 3WVMA 1JMXA 3T6LA 4ZGFA 1SWNA 3APXA 3JS1A 2HZRA 1VWNB 1X8NA 1XCAA 1Y55X 2QM9A 4I9SA 4ORRA 4TKJA 4DQ3A 2LKKA 1LIDA 5HAEA 2FTBA 3B2JA 3TGBA 3NBXX 2A2UA 5B10O 4YBPA 2HNXA 5IO7A 2BS5A 3HOEA 2QOMA 5HWZA 3FW5A 3CR6A 2MWHA 3PPTA 1SRFA 5DPQA 3APVA 3BU9A 4ZHCA 2AT3X 1E06A 4U46A 2A5BA 3LTWA 1EIIA 3D97A 3KFHA 3CKFA 1GXAA 1KT4A 3NX2A 5LJBA 1SRGA 2X8FA 4EDEA 3FR2A 3F8AA 2RTDB 4IB7A 2BSZA 1GX3A 4IB6A 1VYOA 2RCTA 2JOZA 3WJDA 1L6MA 4CPHA 1SY3A 1GT1A 4D6AA 4AZNA 4QZTA 1RSUB 1VWKB 3P6HA 1ZRYA 5BVQA 2RCQA 3BSZE 4XMGA 3VU1A 1LPJA 2G79A 4GUZA 2CAMA 2F01A 2WEXA 4I9RA 1IIUA 5CHKA 1DC9A 2HMBA 1QG5A 5AEOA 1I06A 4K19A 1OSPO 3RSWA 2CBRA 3ZW0A 4AW8A 5EZ2A 3OJYC 3Q6LA 1NGLA 3FMZA 3NR3A 1H91A 4U9CA 3P6CA 3KVNA 2OVAA 4CPHB 4O4SA 4FQBB 4QQ1A 2RTHB 1IFBA 1ICMA 5D4AA 1ADLA 2QO6A 1X8UA 4ZH9A 4BQUA 1DV9A 4GGTA 2OZQA 1DZPA 1DF8A 1RXHA 3S26A 3T6FA 1EPBA 4CV7A 2WPUA 1T0VA 2A8GA 1DF3A 1Z24A 2ASNX 2MJIA 3ZW0B 5HZ9A 5LJEA 4ZHFA 3RKGA 1I04A 4ODDA 1VYGA 2LB6A 3L4RA 4GNYA 4FBRA 4I95A 4BX7A 1D3SA 3PP6A 1UREA 3NQ3A 4ORYA 5DG4A 3ZQ3A 3VHHA 2OVEA 1SXWA 1SXXA 1GX8A 4UU2A 3N91A 4N7DA 1KGLA 3G7XA 3P24A 2JGSA 4L3RA 3BU1A 1SWBA 2DJGA 2Z4HA 1MX7A 4GH7A 4O9SA 5HA1A 4CDEA 3VG5A 1KQXA 1LDOA 1RBPA 4EFGA 2OY1O 2XKLA 1D2UA 1BSQA 1DZMA 4BX7B 1HN2A 2NP1A 3EBWA 1LF7A 1HBPA 1WUBA 3BX8A 2RTJA 3PH6A 2L67A 2RTPB 1SA8A 5JR8A 1STRB 1O8VA 1SLGB 2X34A 1LICA 2I5ZO 2X4MA 3NP1A 4OELA 4TLJA 1AB0A 2HZQA 4KC7A 1K24A 4OS8A 1B8EA 2NNEA 3LHNA 5B2AO 1RXKA 1CBRA 4KH8A 4DNEA 4Y5DA 1U0XA 1SLDB 1FDQA 1FE3A 2IZIA 2FKGA 4MIRA 1SRIA 1WBIA 1EI5A 2UYWA 4Y0PA 1E2TA 4O49A 4BBOA 1AVDA 2FT9A 4YMYA 1G7NA 2Q2PA 4OS0A 4UU3A 2L9CA 4QZUA 1SWCA 4ORSA 3RBYA 4A60A 2OVDA 2LBAA 4GKCA 4JO6A 2IZFB 2POAA 4MISA 1QFTA 2X32A 3S60A 1P6PA 1Y53X 3JSQA 2NNQA 2WWPA 1SREA 4IAWA 4O3WA 2QCBA 1PTSA 3O2YA 1S44A 2OY7A 5HTDA 3WXQA 5B3MO 2MHDA 5AJBA 3CKGA 1I05A 4OMWA 4ON1A 5FQ8E 5BVSA 2Q2MA 3TF6A 5LJGA 3B2IA 1EQDA 1SWQA 4FGIB 4KCAA 3NQKA 5F7GA 1MDCA 4HPDA 1SWOA 4AYHA 4FBOA 3KFGA 1FENA 4TQ2A 1ML7A 4OKAA 1ZNGA 5D8JA 4Y0RA 3WJBA 2YMSA 1VWGB 1HMSA 2P8GA 1N0SA 3O22A 4XMHA 4IB8A 3AEHA 1VWLB 2L68A 3EM0A 3D95A 4QAEA 3T2XA 4BX5B 1X89A 2I5VO 2QOSC 1SMPI 4CSBA 1I9HA 1UYNX 4NYQA 4EKVA 3NQ9A 3X00A 1EUOA 1RLBE 3HPEA 2X45A 4Y59A 4YVBA 2A5CA 2IZKA 1N43A 1SWDA 3P02A 1A18A 1N7YA 3HWEA 1ZNLA 2X46A 1Y0GA 4YFRA 5BYPA 1VWJB 3HWFA 1VWMB 4GK9A 3VG7A 4BCSA 4DQ4A 3FIDA 1AVGI 1SXUA 1KFFA 1EW3A 1T8VA 2OY5O 3ZUIA 4HFOA 4LKTA 4AZQA 5B11O 1BRQA 1N9MA 2FWVA 4ES7A 1MK5A 1LNMA 1SY1A 1LELA 1STSB 4IB9A 1HY2A 3WZPA 1S2PA 3APWA 3SLOA 3STMX 3FR5A 4CDDA 1BM5A 4DCBA 1NP1A 2NNDA 5KIDA 1JV4A 2ACPX 1MX8A 1SWUA 3HOLA 4NV8A 4TJZA 1SWHA 3EC5A 3P6FA 1QY1A 2A0AA 3CBSA 1Y9LA 1SXYA 2W2AA 3B2KA 1G74A 2AT6X 5CYBA 2OVSA 4NNSA 1YP6A 3FIQA 3WJCA 4M7MA 1KZXA 1AQBA 4YGGA 4QGVA 2IFBA 1MEPA 4GU8A 1X8OA 4I3BA 2X8TA 2GJ5A 1SWRA 3D4RA 5AJCA 5H9AA 1BWYA 2LBVA 4JNJA 1YWCA 4YCHA 2ANSA 3K3LA 3RDXA 1DFVA 2RTOB 2RTRB 4CK4A 3EYCA 1JIWI 3ZWEA 3ZUOA 1YP7A 3RY1A 4NLJA 2BLGA 2KTDA 5B5GA 2FS6A 4ZHHA 2WR6A 3RDMA 2R73A 4GJSA 2MF6A 1TVQA 2ZAGA 2OFBA 2AF5A 1I78A 2RTCB 2RTEB 3D9WA 4ORWA 4XMCA 3CBCA 4ZJ0A 4PSQA 2IZJA 2OF9A 2RTFB 1SRHA 5EDBA 4RUUA 2CZUA 5HCCC
chains in the Genus database with same CATH topology
2CM9A 1JZUA 4AZMA 3ELXA 3NPOA 1KOIA 2GTLO 3FA7A 5F58A 5HA0A 2KTSA 2DM5A 2F73A 1TOWA 3H3IA 2ACOA 1OEJA 2FRSA 3FYFA 3F9DA 2QO4A 4ZH6A 1BBPA 4O4OA 3UEXA 5EEDA 2AH7X 2R56A 3MX7A 1QY2A 1EIOA 5FFHA 4GETA 4U8UO 3PEDA 3MBTA 4YBUA 2RA6A 4O4XA 3PECA 3FA6A 3CQRA 3I0AA 5B27A 5K06A 4O3ZA 1LKEA 4IMOA 4U3QA 5H8TA 4QYPA 3IFBA 1O1VA 3HWDA 4XMEA 2Q39A 2BT9A 2JMBA 1ZNDA 3TZSA 5LJCA 4IBAA 5FQ7E 4MVLA 5HZ5A 3AKNA 3GAQA 4QYNA 1LIEA 1ICNA 2JN3A 2RN4A 1EPAA 4XMFA 1ZNHA 5HZQA 1O1UA 3BY0A 4OS3A 1IW2A 2A13A 3CWKA 1QFVA 4QGXA 1XKIA 3RZYA 1E02A 1PMPA 3BLGA 1OBUA 3IA8A 2WSJA 1OPBA 3B2HA 2FR2A 1A3YA 2FLJA 4AZRA 3FEKA 5D47A 2OFRX 3FLLA 1B56A 1HMTA 1UZ2X 4NYRA 4A1YA 1B0OA 3B2LA 3P6DA 1FEMA 5IO5A 1YWAA 5D45A 3BRNA 2MM3A 1CRBA 1OBPA 3C77X 3CMPA 3WJEA 4ZR2A 4ZCBA 1YIVA 2W2FA 4O4UA 4LZVA 5CE4A 3NADA 3D96A 3KFFA 1QWDA 1BRPA 1S7DA 3O19A 4BVMA 4TNNA 3HWGA 4TKHA 3FA8A 4YCEA 1KT6A 1OEEA 2QO5A 1KZWA 1SY2A 4M6SA 2R74A 3PQUA 4IAXA 3DTQA 1QABE 1R0UA 3C76X 1G85A 3PQSA 2G78A 2A3FX 1GX9A 4KT5A 4AZOA 3OBLA 3FA9A 2JU7A 2L5PA 4WBKA 4Y0QA 5LJDA 4D6BA 1JBHA 4JGLA 3DSZA 4ZGUA 3P6EA 5EPQA 3VE2A 1U18A 4NP1A 1DZJA 2X8SA 3OE3A 1TOUA 2K62A 1G5WA 3I17A 3P6GA 5LJHA 4TKBA 1GKAB 1GT5A 4GNWA 2OFMX 1FTPA 3S5VA 1IFCA 5H9LA 1CJ5A 2RD7C 1ZNEA 5LJKA 1E5PA 3KZAA 1ZNKA 1OEKA 2ALLX 2RQ0A 1IKJA 1BEBA 5C0NA 1LIFA 1U17A 3F6ZB 1GM6A 4HPAA 3WJFA 2F09A 2CZTA 4YGZA 2CM4A 1BJ7A 1DZKA 3OD9A 4YDBA 3WOVA 3ZW1B 2W2BA 2XSTA 3VG6A 1HBQA 4I3DA 2Q4NA 4GE1A 4IMNA 4YH0A 3SOTA 3VPJE 3GE2A 1YWDA 1T68X 1YUPA 2AMMX 4LQZA 4OMXA 1KT7A 3FEPA 2AKQA 3PH5A 2O62A 4WFVA 2E4JA 2QMIA 4COTA 1X8PA 4ALOA 5D48A 2WQ9A 4HWMA 4NW4A 5HBSA 3VG2A 3U03A 4WHIA 3FR4A 5F6ZA 5EDCA 4YFQA 1KXOA 3CQNA 5LKEA 3UEUA 1EALA 1GT4A 5LKFA 3WJGA 2EU7X 3QKGA 3FELA 4KC8A 2HYSA 5KICA 1JYDA 1BSYA 4NLIA 4GZVA 4R0BA 3HK1A 1BSOA 4ORUA 2WUTA 1GT3A 4QGWA 4L1NA 2M4LA 4PJ2A 3AKMA 2FS7A 1FELA 3FW4A 1X8QA 3BS2A 4GRJA 4O3YA 3RWXA 4BOEA 3UEVA 2G7BA 5KHPA 1GGLA 4MVIA 2K23A 4YDAA 2AL0X 4ZHDA 4ORXA 3E3CA 2GTFX 5EEEA 4FBVA 1MUPA 1ERBA 1PBOA 2BHVA 1VYFA 3NX1A 4YKOA 3SAOA 2Z4IA 5L8NA 1ALBA 2AT0X 1LIBA 1IKEA 2LA7A 3JQOA 4A8ZA 4I6SA 4NNTA 1HQPA 1KQWA 4IABA 1OPAA 4INNA 2KW1A 2KD2A 3WBGA 2JW1A 1CBQA 1JYJA 1A2DA 1OBQA 1QY0A 4O3XB 1NP4A 2N93A 2KT4B 2GTLM 3T1DA 3VG4A 4HPCA 3ZI8A 4ID2A 1QQSA 1B4MA 5FENA 4N7CA 4QRLA 3KQ0A 3STKA 4U8UM 5F1EA 1A57A 1BLRA 1EXSA 2JU3A 1Y9TA 3BX7A 2AT5X 3FENA 3BDRA 4A1HA 1CBIA 3KFIA 4I3CA 3UAQA 5F6BA 5FQ6E 5BVTA 4Y0SA 3STNA 3U0DA 2AT8X 1KT3A 4HPBA 4LZUA 3APUA 3S5XA 3U9PC 4XMDA 5HZ8A 5H9NA 4ML7B 3VG3A 4YGHA 1ACDA 1I4UA 5HTEA 4ARHA 5B29A 1AELA 1E00A 4AZPA 1MVGA 3MVFA 5HCEC 4EXZA 1ERXA 3V8UA 2GTLN 1X71A 4EQAC 4GDZA 1GKAA 1VPRA 4ZFXA 2A2GA 1HMRA 1LFOA 2Q9SA 3ZW2A 1PEEA 4RUNA 2MO5A 2FR3A 3ZZVA 5L8IA 2PY1A 5AQ6A 4U8UN 3VE1A 2GC9A 3HTYA 1CBSA 3C78X 5HZ6A 2CBSA 2JU8A 1TXLA 5L8OA 5IO6A 3UEWA 4LKPA 1KT5A 1SY0A 4KIIA 3ZW1A 4YKMA 4ALBA 4MVEA 1YWBA 2WQAE 4QNIA 2LFOA 2ZAIA 2BS6A 5FAZA 3ELZA 2YG2A 2WEWA 4ZHGA 1TW4A 1PM1X 3TGAA 4EEJA 3EBKA 3LV4A 3EMMA 4WFUA 5HCDC 4YFPA 5H9KA 2HLVA 3WVMA 4ZGFA 4MVKA 3APXA 3JS1A 2HZRA 4TKJA 1X8NA 1XCAA 4I9SA 2QM9A 4ORRA 4DQ3A 2LKKA 1LIDA 5HAEA 2FTBA 3B2JA 3TGBA 3NBXX 2A2UA 4YBPA 5IO7A 2HNXA 2BS5A 3HOEA 5HWZA 3FW5A 3CR6A 2MWHA 3PPTA 5DPQA 3APVA 3BU9A 4ZHCA 2AT3X 1E06A 1EIIA 3D97A 3KFHA 3NX2A 1GXAA 1KT4A 5LJBA 2X8FA 4EDEA 3FR2A 3F8AA 4IB7A 4IB6A 2RCTA 2JOZA 3WJDA 1L6MA 1SY3A 1GT1A 4D6AA 4AZNA 4QZTA 3P6HA 1ZRYA 5BVQA 2RCQA 3BSZE 4XMGA 3VU1A 1LPJA 2G79A 2WEXA 4I9RA 1IIUA 1DC9A 2HMBA 1QG5A 5AEOA 1I06A 4K19A 3RSWA 2CBRA 3ZW0A 4AW8A 5EZ2A 3OJYC 3Q6LA 1NGLA 3FMZA 3NR3A 1H91A 4U9CA 3P6CA 2OVAA 4O4SA 4FQBB 4QQ1A 1IFBA 1ICMA 5D4AA 1ADLA 2QO6A 1X8UA 4ZH9A 4BQUA 1DV9A 2OZQA 1DZPA 3S26A 1EPBA 4CV7A 1T0VA 1DF3A 1Z24A 2ASNX 2MJIA 3ZW0B 5HZ9A 5LJEA 4ZHFA 3RKGA 1I04A 4ODDA 1VYGA 2LB6A 3L4RA 4GNYA 4FBRA 4I95A 1D3SA 3PP6A 1UREA 3NQ3A 4ORYA 5DG4A 3ZQ3A 2OVEA 1SXWA 1SXXA 1GX8A 4UU2A 3N91A 4N7DA 1KGLA 3G7XA 3P24A 4L3RA 3BU1A 2Z4HA 1MX7A 4GH7A 4O9SA 5HA1A 3VG5A 1KQXA 1RBPA 4EFGA 2XKLA 1D2UA 1BSQA 1DZMA 1HN2A 2NP1A 3EBWA 1LF7A 1HBPA 3BX8A 3PH6A 2L67A 1SA8A 5JR8A 1O8VA 1LICA 3NP1A 4TLJA 1AB0A 2HZQA 4KC7A 4OS8A 1B8EA 2NNEA 3LHNA 1CBRA 4KH8A 1U0XA 1FDQA 1FE3A 4Y0PA 4MIRA 1JJXA 4YMYA 1EI5A 4O49A 2FT9A 1G7NA 2Q2PA 4OS0A 4UU3A 2L9CA 4QZUA 3RBYA 4ORSA 4A60A 2OVDA 2LBAA 4GKCA 2POAA 4MISA 1QFTA 3S60A 1P6PA 4O3WA 3JSQA 2NNQA 2WWPA 4IAWA 3O2YA 1S44A 5HTDA 3WXQA 2MHDA 5AJBA 1I05A 4OMWA 4ON1A 5FQ8E 5BVSA 2Q2MA 3TF6A 5LJGA 3B2IA 1EQDA 4FGIB 4KCAA 3NQKA 5F7GA 1MDCA 4HPDA 4AYHA 4FBOA 3KFGA 1FENA 4TQ2A 1ML7A 1ZNGA 5D8JA 4Y0RA 3WJBA 2YMSA 1HMSA 2P8GA 1N0SA 3O22A 4XMHA 4IB8A 3EM0A 2L68A 4QAEA 3D95A 1X89A 4CSBA 2QOSC 1SMPI 4NYQA 3NQ9A 1EUOA 1RLBE 2X45A 3P02A 1A18A 3HWEA 1ZNLA 2X46A 4YFRA 5BYPA 3HWFA 4GK9A 3VG7A 4DQ4A 1AVGI 1SXUA 1EW3A 1T8VA 3ZUIA 4HFOA 4LKTA 4AZQA 1BRQA 2FWVA 4ES7A 1LNMA 1SY1A 4IB9A 1S2PA 3APWA 3STMX 1BM5A 3FR5A 1NP1A 2NNDA 5KIDA 1JV4A 2ACPX 1MX8A 3HOLA 4TJZA 3P6FA 1QY1A 2A0AA 3CBSA 1Y9LA 1SXYA 2W2AA 3B2KA 1G74A 2AT6X 5CYBA 2OVSA 4NNSA 1YP6A 3FIQA 3WJCA 4M7MA 1KZXA 1AQBA 4YGGA 4QGVA 2IFBA 4GU8A 1X8OA 4I3BA 2X8TA 2GJ5A 3D4RA 5AJCA 5H9AA 1BWYA 2LBVA 1YWCA 4YCHA 2ANSA 3K3LA 1DFVA 4CK4A 3EYCA 1JIWI 3ZWEA 3ZUOA 1YP7A 4NLJA 2BLGA 2KTDA 4ZHHA 2FS6A 2WR6A 2R73A 1TVQA 2ZAGA 4ORWA 1JJJA 3TGCA 4XMCA 3CBCA 4ZJ0A 4PSQA 5EDBA 4RUUA 2CZUA 5HCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM9 A;  1JZU A;  4AZM A;  3ELX A;  3NPO A;  1KOI A;  5F58 A;  3FA7 A;  5HA0 A;  2DM5 A;  2F73 A;  1TOW A;  2ACO A;  1OEJ A;  2FRS A;  3F9D A;  2QO4 A;  4ZH6 A;  1BBP A;  3UEX A;  5EED A;  2AH7 X;  2R56 A;  1QY2 A;  1EIO A;  5FFH A;  4GET A;  3PED A;  3MBT A;  4YBU A;  2RA6 A;  3PEC A;  3FA6 A;  3CQR A;  3I0A A;  5B27 A;  5K06 A;  1LKE A;  4IMO A;  5H8T A;  4QYP A;  3IFB A;  1O1V A;  3HWD A;  4XME A;  2Q39 A;  1ZND A;  3TZS A;  5LJC A;  4IBA A;  5HZ5 A;  4MVL A;  3AKN A;  3GAQ A;  4QYN A;  1LIE A;  1ICN A;  2JN3 A;  1EPA A;  4XMF A;  1ZNH A;  5HZQ A;  1O1U A;  3BY0 A;  4OS3 A;  1IW2 A;  2A13 A;  3CWK A;  1QFV A;  4QGX A;  1XKI A;  3RZY A;  1E02 A;  1PMP A;  3BLG A;  1OBU A;  3IA8 A;  2WSJ A;  1OPB A;  3B2H A;  2FR2 A;  1A3Y A;  2FLJ A;  4AZR A;  3FEK A;  5D47 A;  2OFR X;  3FLL A;  1B56 A;  1HMT A;  1UZ2 X;  4NYR A;  4A1Y A;  1B0O A;  3B2L A;  3P6D A;  1FEM A;  5IO5 A;  1YWA A;  5D45 A;  3BRN A;  2MM3 A;  1CRB A;  1OBP A;  3C77 X;  3CMP A;  3WJE A;  4ZR2 A;  4ZCB A;  1YIV A;  2W2F A;  4LZV A;  5CE4 A;  3NAD A;  3D96 A;  3KFF A;  1QWD A;  1BRP A;  1S7D A;  3O19 A;  4BVM A;  4TNN A;  3HWG A;  4TKH A;  3FA8 A;  4YCE A;  1KT6 A;  1OEE A;  2QO5 A;  1KZW A;  1SY2 A;  4M6S A;  2R74 A;  4IAX A;  3DTQ A;  1QAB E;  1R0U A;  3C76 X;  1G85 A;  2G78 A;  2A3F X;  1GX9 A;  4AZO A;  3FA9 A;  2JU7 A;  2L5P A;  4WBK A;  4Y0Q A;  5LJD A;  4D6B A;  1JBH A;  3DSZ A;  4ZGU A;  3P6E A;  5EPQ A;  1U18 A;  4NP1 A;  1DZJ A;  1TOU A;  2K62 A;  1G5W A;  3I17 A;  3P6G A;  5LJH A;  4TKB A;  1GKA B;  1GT5 A;  4GNW A;  2OFM X;  1FTP A;  1IFC A;  5H9L A;  1CJ5 A;  2RD7 C;  1ZNE A;  5LJK A;  1E5P A;  3KZA A;  1ZNK A;  1OEK A;  2ALL X;  2RQ0 A;  1IKJ A;  1BEB A;  5C0N A;  1LIF A;  1U17 A;  1GM6 A;  4HPA A;  3WJF A;  2CZT A;  4YGZ A;  2CM4 A;  1BJ7 A;  1DZK A;  4YDB A;  2W2B A;  2XST A;  3VG6 A;  1HBQ A;  4I3D A;  2Q4N A;  4GE1 A;  4IMN A;  4YH0 A;  1YWD A;  1T68 X;  1YUP A;  2AMM X;  4OMX A;  1KT7 A;  3FEP A;  2AKQ A;  3PH5 A;  2O62 A;  4WFV A;  2E4J A;  1X8P A;  4ALO A;  5D48 A;  2WQ9 A;  5HBS A;  3VG2 A;  3U03 A;  5F6Z A;  3FR4 A;  5EDC A;  4YFQ A;  1KXO A;  3CQN A;  5LKE A;  3UEU A;  1EAL A;  1GT4 A;  5LKF A;  3WJG A;  2EU7 X;  3QKG A;  3FEL A;  2HYS A;  5KIC A;  1JYD A;  1BSY A;  4NLI A;  4R0B A;  3HK1 A;  1BSO A;  4ORU A;  2WUT A;  1GT3 A;  4QGW A;  3AKM A;  2FS7 A;  1FEL A;  3FW4 A;  1X8Q A;  3BS2 A;  4GRJ A;  4BOE A;  3UEV A;  2G7B A;  5KHP A;  1GGL A;  4MVI A;  2K23 A;  4YDA A;  2AL0 X;  4ZHD A;  4ORX A;  2GTF X;  5EEE A;  1MUP A;  1ERB A;  1PBO A;  3NX1 A;  1VYF A;  4YKO A;  3SAO A;  5L8N A;  1ALB A;  2AT0 X;  1LIB A;  1IKE A;  4A8Z A;  4NNT A;  1HQP A;  1KQW A;  1OPA A;  3WBG A;  1CBQ A;  1JYJ A;  1A2D A;  1OBQ A;  1QY0 A;  1NP4 A;  2N93 A;  2KT4 B;  3T1D A;  3VG4 A;  4HPC A;  1QQS A;  1B4M A;  5FEN A;  4N7C A;  3KQ0 A;  3STK A;  1A57 A;  5F1E A;  1BLR A;  1EXS A;  2JU3 A;  3BX7 A;  2AT5 X;  3FEN A;  3BDR A;  4A1H A;  1CBI A;  3KFI A;  4I3C A;  5F6B A;  5BVT A;  4Y0S A;  3STN A;  3U0D A;  2AT8 X;  1KT3 A;  4HPB A;  4LZU A;  3APU A;  3U9P C;  4XMD A;  5HZ8 A;  5H9N A;  3VG3 A;  4YGH A;  1ACD A;  1I4U A;  5HTE A;  4ARH A;  5B29 A;  1AEL A;  1E00 A;  4AZP A;  1MVG A;  3MVF A;  5HCE C;  4EXZ A;  1ERX A;  1X71 A;  1GKA A;  1VPR A;  4ZFX A;  2A2G A;  1HMR A;  1LFO A;  2Q9S A;  1PEE A;  4RUN A;  2MO5 A;  2FR3 A;  5L8I A;  2PY1 A;  5AQ6 A;  2GC9 A;  1CBS A;  3C78 X;  5HZ6 A;  2CBS A;  2JU8 A;  1TXL A;  5L8O A;  5IO6 A;  3UEW A;  4LKP A;  1KT5 A;  1SY0 A;  4KII A;  4YKM A;  4ALB A;  1YWB A;  2WQA E;  2LFO A;  5FAZ A;  3ELZ A;  2YG2 A;  2WEW A;  4ZHG A;  1TW4 A;  1PM1 X;  3TGA A;  4EEJ A;  3EBK A;  4WFU A;  3EMM A;  5HCD C;  4YFP A;  5H9K A;  2HLV A;  3WVM A;  4MVK A;  3APX A;  3JS1 A;  2HZR A;  4TKJ A;  1X8N A;  1XCA A;  4I9S A;  2QM9 A;  4ORR A;  4DQ3 A;  2LKK A;  1LID A;  5HAE A;  2FTB A;  3B2J A;  3TGB A;  2A2U A;  4YBP A;  5IO7 A;  2HNX A;  5HWZ A;  3FW5 A;  3CR6 A;  3PPT A;  5DPQ A;  3APV A;  3BU9 A;  4ZHC A;  2AT3 X;  1E06 A;  1EII A;  3D97 A;  3KFH A;  3NX2 A;  1GXA A;  1KT4 A;  5LJB A;  4EDE A;  3FR2 A;  3F8A A;  4IB7 A;  4IB6 A;  2RCT A;  2JOZ A;  3WJD A;  1L6M A;  1SY3 A;  1GT1 A;  4D6A A;  4AZN A;  4QZT A;  3P6H A;  1ZRY A;  5BVQ A;  2RCQ A;  3BSZ E;  4XMG A;  1LPJ A;  2G79 A;  2WEX A;  4I9R A;  1IIU A;  1DC9 A;  2HMB A;  1QG5 A;  1I06 A;  4K19 A;  3RSW A;  2CBR A;  4AW8 A;  5EZ2 A;  3OJY C;  3Q6L A;  1NGL A;  3FMZ A;  3NR3 A;  1H91 A;  3P6C A;  2OVA A;  1IFB A;  1ICM A;  5D4A A;  1ADL A;  2QO6 A;  1X8U A;  4ZH9 A;  4BQU A;  1DV9 A;  2OZQ A;  1DZP A;  3S26 A;  1EPB A;  1T0V A;  1DF3 A;  1Z24 A;  2ASN X;  2MJI A;  5HZ9 A;  5LJE A;  4ZHF A;  1I04 A;  4ODD A;  1VYG A;  2LB6 A;  3L4R A;  4GNY A;  1D3S A;  3PP6 A;  1URE A;  3NQ3 A;  4ORY A;  5DG4 A;  3ZQ3 A;  2OVE A;  1SXW A;  1SXX A;  1GX8 A;  4UU2 A;  4N7D A;  1KGL A;  3G7X A;  3BU1 A;  1MX7 A;  4GH7 A;  4O9S A;  5HA1 A;  3VG5 A;  1KQX A;  1RBP A;  4EFG A;  2XKL A;  1D2U A;  1BSQ A;  1DZM A;  1HN2 A;  2NP1 A;  3EBW A;  1LF7 A;  1HBP A;  3BX8 A;  3PH6 A;  2L67 A;  1SA8 A;  5JR8 A;  1O8V A;  1LIC A;  3NP1 A;  4TLJ A;  1AB0 A;  2HZQ A;  4OS8 A;  1B8E A;  2NNE A;  1CBR A;  1U0X A;  1FDQ A;  1FE3 A;  4Y0P A;  1JJX A;  4YMY A;  2FT9 A;  1G7N A;  2Q2P A;  4OS0 A;  4UU3 A;  2L9C A;  4QZU A;  4ORS A;  4A60 A;  2OVD A;  2LBA A;  4GKC A;  2POA A;  1QFT A;  1P6P A;  3JSQ A;  2NNQ A;  2WWP A;  4IAW A;  3O2Y A;  1S44 A;  5HTD A;  3WXQ A;  1I05 A;  4OMW A;  5BVS A;  2Q2M A;  3TF6 A;  5LJG A;  3B2I A;  1EQD A;  5F7G A;  1MDC A;  4HPD A;  4AYH A;  3KFG A;  1FEN A;  4TQ2 A;  1ML7 A;  1ZNG A;  5D8J A;  4Y0R A;  3WJB A;  1HMS A;  2P8G A;  1N0S A;  3O22 A;  4XMH A;  4IB8 A;  3EM0 A;  2L68 A;  4QAE A;  3D95 A;  1X89 A;  2QOS C;  4NYQ A;  3NQ9 A;  1EUO A;  1RLB E;  2X45 A;  1A18 A;  3HWE A;  1ZNL A;  2X46 A;  4YFR A;  3HWF A;  3VG7 A;  4DQ4 A;  1AVG I;  1SXU A;  1EW3 A;  1T8V A;  3ZUI A;  4HFO A;  4LKT A;  4AZQ A;  1BRQ A;  2FWV A;  4ES7 A;  1LNM A;  1SY1 A;  4IB9 A;  1S2P A;  3APW A;  3STM X;  1BM5 A;  3FR5 A;  1NP1 A;  2NND A;  5KID A;  1JV4 A;  2ACP X;  1MX8 A;  4TJZ A;  3P6F A;  1QY1 A;  2A0A A;  3CBS A;  1SXY A;  2W2A A;  3B2K A;  1G74 A;  2AT6 X;  4NNS A;  3WJC A;  1YP6 A;  3FIQ A;  1KZX A;  4M7M A;  1AQB A;  4YGG A;  4QGV A;  2IFB A;  1X8O A;  4I3B A;  2GJ5 A;  5H9A A;  1BWY A;  2LBV A;  1YWC A;  4YCH A;  2ANS A;  3K3L A;  1DFV A;  4CK4 A;  3EYC A;  3ZUO A;  1YP7 A;  4NLJ A;  2BLG A;  2KTD A;  4ZHH A;  2FS6 A;  2WR6 A;  2R73 A;  1TVQ A;  4ORW A;  1JJJ A;  3TGC A;  4XMC A;  3CBC A;  4ZJ0 A;  4PSQ A;  5EDB A;  4RUU A;  2CZU A;  5HCC C; 
#chains in the Genus database with same CATH topology
 2CM9 A;  1JZU A;  4AZM A;  3ELX A;  3NPO A;  2OF8 A;  2OY8 A;  1KOI A;  4OEM A;  2GTL O;  3FA7 A;  5F58 A;  5HA0 A;  1VWC B;  2DM5 A;  2F73 A;  1TOW A;  1HXZ A;  2KTS A;  3H3I A;  5K68 A;  2ACO A;  1Y52 X;  1OEJ A;  2FRS A;  3FYF A;  1HXL A;  3F9D A;  3RDU A;  2QO4 A;  4ZH6 A;  1BBP A;  4O4O A;  3UEX A;  4CDC A;  5EED A;  2AH7 X;  2RTG B;  1SWP A;  2R56 A;  1QY2 A;  3MX7 A;  5FFH A;  4GET A;  4U8U O;  1EIO A;  3PED A;  3MBT A;  4YBU A;  2RA6 A;  3VGW A;  4O4X A;  3PEC A;  3FA6 A;  3CQR A;  3I0A A;  5B27 A;  2RTM A;  5K06 A;  4O3Z A;  4GJV A;  1LKE A;  2IZL B;  4IMO A;  4U3Q A;  5H8T A;  1NC9 A;  4QYP A;  3IFB A;  1O1V A;  3HWD A;  3RDO A;  4XME A;  2RTI B;  2Q39 A;  2BT9 A;  1W5R A;  1RXJ A;  2IZA A;  2JMB A;  1ZND A;  1HQQ A;  3TZS A;  5LJC A;  1VWF B;  4IBA A;  5FQ7 E;  4MVL A;  1SWS A;  5HZ5 A;  3AKN A;  3GAQ A;  4QYN A;  1LIE A;  2C4I A;  2IZC B;  1ICN A;  3Q34 A;  1KL4 A;  1VWO B;  2G5L A;  2JN3 A;  2RTA A;  3SZH A;  1SLF B;  2RN4 A;  1EPA A;  1RAV A;  4XMF A;  2RTN B;  3WYP A;  1ZNH A;  5HZQ A;  2DJF A;  1O1U A;  2OL6 O;  3BY0 A;  4OS3 A;  1IW2 A;  2A13 A;  3CWK A;  1QFV A;  4QGX A;  1XKI A;  3RZY A;  1E02 A;  1PMP A;  3BLG A;  1OBU A;  3IA8 A;  2IZE B;  2WSJ A;  1OPB A;  3B2H A;  2FR2 A;  1SWJ A;  1A3Y A;  1VWD B;  2FLJ A;  5IRU A;  5IXG A;  4AZR A;  3FEK A;  5D47 A;  2OFR X;  3FLL A;  1B56 A;  1RST B;  1HMT A;  1UZ2 X;  4NYR A;  4A1Y A;  1B0O A;  3B2L A;  3PK2 A;  3P6D A;  4GGZ A;  1FEM A;  1VWA B;  1YWA A;  5D45 A;  5IO5 A;  1NQN A;  1SWF A;  3BRN A;  2MM3 A;  1CRB A;  1OBP A;  2VFB A;  3C77 X;  3CMP A;  3WJE A;  4ZR2 A;  4ZCB A;  1YIV A;  2W2F A;  3MM0 A;  3RY2 A;  4C5P A;  4O4U A;  4LZV A;  5CE4 A;  2X56 A;  3D96 A;  3NAD A;  3KFF A;  1QWD A;  2RTQ B;  1BRP A;  1S7D A;  3O19 A;  4BVM A;  4TNN A;  1UYO X;  2VFC A;  3HWG A;  3FA8 A;  4TKH A;  4YCE A;  4GD9 A;  1SRJ A;  5K67 A;  1KT6 A;  1N9Y A;  1OEE A;  2RTK A;  2QO5 A;  1KZW A;  4IRW A;  2IZG B;  1SY2 A;  4M6S A;  2R74 A;  3PQU A;  4IAX A;  3DTQ A;  2OL7 A;  1QAB E;  1R0U A;  2HKD A;  1G85 A;  3C76 X;  3PQS A;  1N4J A;  2A3F X;  2G78 A;  5JD2 A;  1GX9 A;  4KT5 A;  3SZI A;  1W6F A;  2G8C O;  4AZO A;  3OBL A;  3FA9 A;  2JU7 A;  2L5P A;  4WBK A;  1FJ1 E;  5F2B A;  4Y0Q A;  1JJU A;  4CPE A;  5LJD A;  4D6B A;  1JBH A;  4JGL A;  1VWP B;  3DSZ A;  4ZGU A;  1JMZ A;  3P6E A;  5EPQ A;  3VE2 A;  1U18 A;  4NP1 A;  1DZJ A;  1VWH B;  2X8S A;  3OE3 A;  4Z6J A;  1TOU A;  2K62 A;  1G5W A;  3I17 A;  3P6G A;  2Y32 A;  5LJH A;  2C1Q A;  4TKB A;  1GKA B;  1GT5 A;  4GNW A;  1VWI B;  2OFM X;  1FTP A;  4I60 A;  3S5V A;  1IFC A;  5H9L A;  1CJ5 A;  4Z27 A;  2RD7 C;  1ZNE A;  5LJK A;  1E5P A;  3KZA A;  1K3B A;  1OEK A;  1W4T A;  1ZNK A;  2ALL X;  2UZ2 A;  3SZJ A;  2RQ0 A;  4BX6 B;  1AVE A;  1IKJ A;  1BEB A;  2GH7 A;  3WZO A;  1VWE B;  1MM9 A;  5C0N A;  1LIF A;  1U17 A;  3F6Z B;  1GM6 A;  4HPA A;  1IJ8 A;  3WJF A;  2IZD B;  2F09 A;  2CZT A;  2FGS A;  4YGZ A;  2CM4 A;  1BJ7 A;  1DZK A;  3OD9 A;  4YDB A;  4CPF A;  3WOV A;  3ZW1 B;  2W2B A;  2XST A;  3VG6 A;  1HBQ A;  1KL5 A;  2AVI A;  1SWT A;  4I3D A;  2Q4N A;  3RE6 A;  5L3Y A;  4GE1 A;  4IMN A;  4YH0 A;  3RDQ A;  3SOT A;  3VPJ E;  3GE2 A;  2OL8 O;  1YWD A;  1T68 X;  1YUP A;  2AMM X;  4LQZ A;  4OMX A;  1KT7 A;  3FEP A;  2AKQ A;  3EW2 A;  2O62 A;  2FHL A;  3PH5 A;  2E4J A;  2QMI A;  4GDA A;  4WFV A;  4COT A;  3SLT A;  1X8P A;  4ALO A;  5D48 A;  2WQ9 A;  4CPI A;  3PDF A;  4HWM A;  4MVK A;  4NW4 A;  3RDS A;  2IZH B;  5HBS A;  3VG2 A;  3U03 A;  4WHI A;  3FR4 A;  5F6Z A;  5EDC A;  4GGR A;  1KXO A;  3CQN A;  4YFQ A;  3UEU A;  5LKE A;  1EAL A;  1GT4 A;  5LKF A;  3WJG A;  2EU7 X;  2X55 A;  3QKG A;  3FEL A;  4KC8 A;  2HYS A;  5KIC A;  4Z2P A;  1JYD A;  2ZSC A;  1BSY A;  4NLI A;  3T2W A;  4GZV A;  4R0B A;  3HK1 A;  1NBX A;  1BSO A;  4ORU A;  2WUT A;  1GT3 A;  4QGW A;  4B55 A;  4L1N A;  2FKJ A;  2M4L A;  4PJ2 A;  2RTB B;  3AKM A;  2FS7 A;  1FEL A;  3FW4 A;  1X8Q A;  3BS2 A;  4GRJ A;  1STP A;  1SWE A;  4O3Y A;  3RWX A;  3UEV A;  4BOE A;  2OFA A;  1JJX A;  2G7B A;  5KHP A;  1GGL A;  3VHI A;  4MVI A;  2K23 A;  4YDA A;  2AL0 X;  3WZN A;  5IRA A;  4ZHD A;  2VDF A;  4ORX A;  3E3C A;  2GTF X;  5EEE A;  4FBV A;  1MUP A;  1ERB A;  1PBO A;  2BHV A;  1VYF A;  3NX1 A;  4YKO A;  3SAO A;  2Z4I A;  1SWK A;  1ALB A;  2AT0 X;  5L8N A;  3AUM O;  2OYB O;  1LIB A;  1IKE A;  2LA7 A;  3JQO A;  4A8Z A;  4I6S A;  4NNT A;  1HQP A;  1KQW A;  4IAB A;  1OPA A;  4INN A;  2KW1 A;  2KD2 A;  4BJ8 A;  3WBG A;  2JW1 A;  1CBQ A;  1JYJ A;  1A2D A;  1OBQ A;  1LDQ A;  1QY0 A;  1NP4 A;  2N93 A;  2PI3 O;  4O3X B;  2KT4 B;  2GTL M;  3RE5 A;  3T1D A;  3VG4 A;  2RTL A;  3QQ2 A;  4HPC A;  1SWG A;  3ZI8 A;  1PBY A;  4ID2 A;  1QQS A;  5B5F A;  1B4M A;  1LCV A;  5FEN A;  4N7C A;  1JJJ A;  4QRL A;  3KQ0 A;  1SWL A;  3STK A;  4U8U M;  5F1E A;  1VWR B;  1A57 A;  1VWB B;  1BLR A;  1EXS A;  3FDC A;  2JU3 A;  1Y9T A;  3BX7 A;  2AT5 X;  1VWQ B;  4MEE A;  3FEN A;  3BDR A;  4A1H A;  1CBI A;  3KFI A;  4I3C A;  1KL3 A;  4Z2O A;  3UAQ A;  5F6B A;  2BC3 A;  5FQ6 E;  5BVT A;  4Y0S A;  3STN A;  3U0D A;  2AT8 X;  1KT3 A;  3MG5 A;  4HPB A;  4LZU A;  3APU A;  3S5X A;  3U9P C;  1SWA A;  1NQM A;  2FHN X;  4XMD A;  5HZ8 A;  5H9N A;  4ML7 B;  1LCZ A;  3VG3 A;  4YGH A;  1ACD A;  1LCW A;  1I4U A;  5HTE A;  4ARH A;  4JHQ A;  5B29 A;  2C1S A;  4CDF A;  1E00 A;  4AZP A;  1AEL A;  3TGC A;  1MVG A;  3MVF A;  5HCE C;  4EXZ A;  1ERX A;  3V8U A;  2GTL N;  1X71 A;  4EQA C;  1MOY A;  4GDZ A;  1GKA A;  1VPR A;  4ZFX A;  2A2G A;  1HMR A;  1LFO A;  2Q9S A;  5CSE A;  3ZW2 A;  1PEE A;  4RUN A;  2MO5 A;  2FR3 A;  3ZZV A;  5L8I A;  4BX6 A;  1SLE B;  2PY1 A;  5AQ6 A;  3WYQ A;  4U8U N;  3VE1 A;  2GC9 A;  3HTY A;  1CBS A;  3C78 X;  4NV7 A;  5HZ6 A;  2CBS A;  2JU8 A;  1TXL A;  2IZB A;  5L8O A;  5IO6 A;  3UEW A;  3WZQ A;  2Y3F A;  1KT5 A;  4LKP A;  4BX5 A;  4Z2V A;  2Y3E A;  1SY0 A;  4KII A;  3ZW1 A;  4YKM A;  3SLJ A;  4ALB A;  4MVE A;  1YWB A;  2WQA E;  4QNI A;  2LFO A;  2ZAI A;  2BS6 A;  5FAZ A;  1LUQ A;  2YG2 A;  3ELZ A;  2WEW A;  4BGF A;  4Z28 A;  1TW4 A;  1PM1 X;  3TGA A;  4EEJ A;  4ZHG A;  3EBK A;  3LV4 A;  1NDJ A;  3EMM A;  3EW1 A;  4WFU A;  3VHM A;  5HCD C;  5IRW A;  4YFP A;  5H9K A;  1JQP A;  2HLV A;  3WVM A;  1JMX A;  3T6L A;  4ZGF A;  1SWN A;  3APX A;  3JS1 A;  2HZR A;  1VWN B;  1X8N A;  1XCA A;  1Y55 X;  2QM9 A;  4I9S A;  4ORR A;  4TKJ A;  4DQ3 A;  2LKK A;  1LID A;  5HAE A;  2FTB A;  3B2J A;  3TGB A;  3NBX X;  2A2U A;  5B10 O;  4YBP A;  2HNX A;  5IO7 A;  2BS5 A;  3HOE A;  2QOM A;  5HWZ A;  3FW5 A;  3CR6 A;  2MWH A;  3PPT A;  1SRF A;  5DPQ A;  3APV A;  3BU9 A;  4ZHC A;  2AT3 X;  1E06 A;  4U46 A;  2A5B A;  3LTW A;  1EII A;  3D97 A;  3KFH A;  3CKF A;  1GXA A;  1KT4 A;  3NX2 A;  5LJB A;  1SRG A;  2X8F A;  4EDE A;  3FR2 A;  3F8A A;  2RTD B;  4IB7 A;  2BSZ A;  1GX3 A;  4IB6 A;  1VYO A;  2RCT A;  2JOZ A;  3WJD A;  1L6M A;  4CPH A;  1SY3 A;  1GT1 A;  4D6A A;  4AZN A;  4QZT A;  1RSU B;  1VWK B;  3P6H A;  1ZRY A;  5BVQ A;  2RCQ A;  3BSZ E;  4XMG A;  3VU1 A;  1LPJ A;  2G79 A;  4GUZ A;  2CAM A;  2F01 A;  2WEX A;  4I9R A;  1IIU A;  5CHK A;  1DC9 A;  2HMB A;  1QG5 A;  5AEO A;  1I06 A;  4K19 A;  1OSP O;  3RSW A;  2CBR A;  3ZW0 A;  4AW8 A;  5EZ2 A;  3OJY C;  3Q6L A;  1NGL A;  3FMZ A;  3NR3 A;  1H91 A;  4U9C A;  3P6C A;  3KVN A;  2OVA A;  4CPH B;  4O4S A;  4FQB B;  4QQ1 A;  2RTH B;  1IFB A;  1ICM A;  5D4A A;  1ADL A;  2QO6 A;  1X8U A;  4ZH9 A;  4BQU A;  1DV9 A;  4GGT A;  2OZQ A;  1DZP A;  1DF8 A;  1RXH A;  3S26 A;  3T6F A;  1EPB A;  4CV7 A;  2WPU A;  1T0V A;  2A8G A;  1DF3 A;  1Z24 A;  2ASN X;  2MJI A;  3ZW0 B;  5HZ9 A;  5LJE A;  4ZHF A;  3RKG A;  1I04 A;  4ODD A;  1VYG A;  2LB6 A;  3L4R A;  4GNY A;  4FBR A;  4I95 A;  4BX7 A;  1D3S A;  3PP6 A;  1URE A;  3NQ3 A;  4ORY A;  5DG4 A;  3ZQ3 A;  3VHH A;  2OVE A;  1SXW A;  1SXX A;  1GX8 A;  4UU2 A;  3N91 A;  4N7D A;  1KGL A;  3G7X A;  3P24 A;  2JGS A;  4L3R A;  3BU1 A;  1SWB A;  2DJG A;  2Z4H A;  1MX7 A;  4GH7 A;  4O9S A;  5HA1 A;  4CDE A;  3VG5 A;  1KQX A;  1LDO A;  1RBP A;  4EFG A;  2OY1 O;  2XKL A;  1D2U A;  1BSQ A;  1DZM A;  4BX7 B;  1HN2 A;  2NP1 A;  3EBW A;  1LF7 A;  1HBP A;  1WUB A;  3BX8 A;  2RTJ A;  3PH6 A;  2L67 A;  2RTP B;  1SA8 A;  5JR8 A;  1STR B;  1O8V A;  1SLG B;  2X34 A;  1LIC A;  2I5Z O;  2X4M A;  3NP1 A;  4OEL A;  4TLJ A;  1AB0 A;  2HZQ A;  4KC7 A;  1K24 A;  4OS8 A;  1B8E A;  2NNE A;  3LHN A;  5B2A O;  1RXK A;  1CBR A;  4KH8 A;  4DNE A;  4Y5D A;  1U0X A;  1SLD B;  1FDQ A;  1FE3 A;  2IZI A;  2FKG A;  4MIR A;  1SRI A;  1WBI A;  1EI5 A;  2UYW A;  4Y0P A;  1E2T A;  4O49 A;  4BBO A;  1AVD A;  2FT9 A;  4YMY A;  1G7N A;  2Q2P A;  4OS0 A;  4UU3 A;  2L9C A;  4QZU A;  1SWC A;  4ORS A;  3RBY A;  4A60 A;  2OVD A;  2LBA A;  4GKC A;  4JO6 A;  2IZF B;  2POA A;  4MIS A;  1QFT A;  2X32 A;  3S60 A;  1P6P A;  1Y53 X;  3JSQ A;  2NNQ A;  2WWP A;  1SRE A;  4IAW A;  4O3W A;  2QCB A;  1PTS A;  3O2Y A;  1S44 A;  2OY7 A;  5HTD A;  3WXQ A;  5B3M O;  2MHD A;  5AJB A;  3CKG A;  1I05 A;  4OMW A;  4ON1 A;  5FQ8 E;  5BVS A;  2Q2M A;  3TF6 A;  5LJG A;  3B2I A;  1EQD A;  1SWQ A;  4FGI B;  4KCA A;  3NQK A;  5F7G A;  1MDC A;  4HPD A;  1SWO A;  4AYH A;  4FBO A;  3KFG A;  1FEN A;  4TQ2 A;  1ML7 A;  4OKA A;  1ZNG A;  5D8J A;  4Y0R A;  3WJB A;  2YMS A;  1VWG B;  1HMS A;  2P8G A;  1N0S A;  3O22 A;  4XMH A;  4IB8 A;  3AEH A;  1VWL B;  2L68 A;  3EM0 A;  3D95 A;  4QAE A;  3T2X A;  4BX5 B;  1X89 A;  2I5V O;  2QOS C;  1SMP I;  4CSB A;  1I9H A;  1UYN X;  4NYQ A;  4EKV A;  3NQ9 A;  3X00 A;  1EUO A;  1RLB E;  3HPE A;  2X45 A;  4Y59 A;  4YVB A;  2A5C A;  2IZK A;  1N43 A;  1SWD A;  3P02 A;  1A18 A;  1N7Y A;  3HWE A;  1ZNL A;  2X46 A;  1Y0G A;  4YFR A;  5BYP A;  1VWJ B;  3HWF A;  1VWM B;  4GK9 A;  3VG7 A;  4BCS A;  4DQ4 A;  3FID A;  1AVG I;  1SXU A;  1KFF A;  1EW3 A;  1T8V A;  2OY5 O;  3ZUI A;  4HFO A;  4LKT A;  4AZQ A;  5B11 O;  1BRQ A;  1N9M A;  2FWV A;  4ES7 A;  1MK5 A;  1LNM A;  1SY1 A;  1LEL A;  1STS B;  4IB9 A;  1HY2 A;  3WZP A;  1S2P A;  3APW A;  3SLO A;  3STM X;  3FR5 A;  4CDD A;  1BM5 A;  4DCB A;  1NP1 A;  2NND A;  5KID A;  1JV4 A;  2ACP X;  1MX8 A;  1SWU A;  3HOL A;  4NV8 A;  4TJZ A;  1SWH A;  3EC5 A;  3P6F A;  1QY1 A;  2A0A A;  3CBS A;  1Y9L A;  1SXY A;  2W2A A;  3B2K A;  1G74 A;  2AT6 X;  5CYB A;  2OVS A;  4NNS A;  1YP6 A;  3FIQ A;  3WJC A;  4M7M A;  1KZX A;  1AQB A;  4YGG A;  4QGV A;  2IFB A;  1MEP A;  4GU8 A;  1X8O A;  4I3B A;  2X8T A;  2GJ5 A;  1SWR A;  3D4R A;  5AJC A;  5H9A A;  1BWY A;  2LBV A;  4JNJ A;  1YWC A;  4YCH A;  2ANS A;  3K3L A;  3RDX A;  1DFV A;  2RTO B;  2RTR B;  4CK4 A;  3EYC A;  1JIW I;  3ZWE A;  3ZUO A;  1YP7 A;  3RY1 A;  4NLJ A;  2BLG A;  2KTD A;  5B5G A;  2FS6 A;  4ZHH A;  2WR6 A;  3RDM A;  2R73 A;  4GJS A;  2MF6 A;  1TVQ A;  2ZAG A;  2OFB A;  2AF5 A;  1I78 A;  2RTC B;  2RTE B;  3D9W A;  4ORW A;  4XMC A;  3CBC A;  4ZJ0 A;  4PSQ A;  2IZJ A;  2OF9 A;  2RTF B;  1SRH A;  5EDB A;  4RUU A;  2CZU A;  5HCC C; 
#chains in the Genus database with same CATH homology
 2CM9 A;  1JZU A;  4AZM A;  3ELX A;  3NPO A;  1KOI A;  2GTL O;  3FA7 A;  5F58 A;  5HA0 A;  2KTS A;  2DM5 A;  2F73 A;  1TOW A;  3H3I A;  2ACO A;  1OEJ A;  2FRS A;  3FYF A;  3F9D A;  2QO4 A;  4ZH6 A;  1BBP A;  4O4O A;  3UEX A;  5EED A;  2AH7 X;  2R56 A;  3MX7 A;  1QY2 A;  1EIO A;  5FFH A;  4GET A;  4U8U O;  3PED A;  3MBT A;  4YBU A;  2RA6 A;  4O4X A;  3PEC A;  3FA6 A;  3CQR A;  3I0A A;  5B27 A;  5K06 A;  4O3Z A;  1LKE A;  4IMO A;  4U3Q A;  5H8T A;  4QYP A;  3IFB A;  1O1V A;  3HWD A;  4XME A;  2Q39 A;  2BT9 A;  2JMB A;  1ZND A;  3TZS A;  5LJC A;  4IBA A;  5FQ7 E;  4MVL A;  5HZ5 A;  3AKN A;  3GAQ A;  4QYN A;  1LIE A;  1ICN A;  2JN3 A;  2RN4 A;  1EPA A;  4XMF A;  1ZNH A;  5HZQ A;  1O1U A;  3BY0 A;  4OS3 A;  1IW2 A;  2A13 A;  3CWK A;  1QFV A;  4QGX A;  1XKI A;  3RZY A;  1E02 A;  1PMP A;  3BLG A;  1OBU A;  3IA8 A;  2WSJ A;  1OPB A;  3B2H A;  2FR2 A;  1A3Y A;  2FLJ A;  4AZR A;  3FEK A;  5D47 A;  2OFR X;  3FLL A;  1B56 A;  1HMT A;  1UZ2 X;  4NYR A;  4A1Y A;  1B0O A;  3B2L A;  3P6D A;  1FEM A;  5IO5 A;  1YWA A;  5D45 A;  3BRN A;  2MM3 A;  1CRB A;  1OBP A;  3C77 X;  3CMP A;  3WJE A;  4ZR2 A;  4ZCB A;  1YIV A;  2W2F A;  4O4U A;  4LZV A;  5CE4 A;  3NAD A;  3D96 A;  3KFF A;  1QWD A;  1BRP A;  1S7D A;  3O19 A;  4BVM A;  4TNN A;  3HWG A;  4TKH A;  3FA8 A;  4YCE A;  1KT6 A;  1OEE A;  2QO5 A;  1KZW A;  1SY2 A;  4M6S A;  2R74 A;  3PQU A;  4IAX A;  3DTQ A;  1QAB E;  1R0U A;  3C76 X;  1G85 A;  3PQS A;  2G78 A;  2A3F X;  1GX9 A;  4KT5 A;  4AZO A;  3OBL A;  3FA9 A;  2JU7 A;  2L5P A;  4WBK A;  4Y0Q A;  5LJD A;  4D6B A;  1JBH A;  4JGL A;  3DSZ A;  4ZGU A;  3P6E A;  5EPQ A;  3VE2 A;  1U18 A;  4NP1 A;  1DZJ A;  2X8S A;  3OE3 A;  1TOU A;  2K62 A;  1G5W A;  3I17 A;  3P6G A;  5LJH A;  4TKB A;  1GKA B;  1GT5 A;  4GNW A;  2OFM X;  1FTP A;  3S5V A;  1IFC A;  5H9L A;  1CJ5 A;  2RD7 C;  1ZNE A;  5LJK A;  1E5P A;  3KZA A;  1ZNK A;  1OEK A;  2ALL X;  2RQ0 A;  1IKJ A;  1BEB A;  5C0N A;  1LIF A;  1U17 A;  3F6Z B;  1GM6 A;  4HPA A;  3WJF A;  2F09 A;  2CZT A;  4YGZ A;  2CM4 A;  1BJ7 A;  1DZK A;  3OD9 A;  4YDB A;  3WOV A;  3ZW1 B;  2W2B A;  2XST A;  3VG6 A;  1HBQ A;  4I3D A;  2Q4N A;  4GE1 A;  4IMN A;  4YH0 A;  3SOT A;  3VPJ E;  3GE2 A;  1YWD A;  1T68 X;  1YUP A;  2AMM X;  4LQZ A;  4OMX A;  1KT7 A;  3FEP A;  2AKQ A;  3PH5 A;  2O62 A;  4WFV A;  2E4J A;  2QMI A;  4COT A;  1X8P A;  4ALO A;  5D48 A;  2WQ9 A;  4HWM A;  4NW4 A;  5HBS A;  3VG2 A;  3U03 A;  4WHI A;  3FR4 A;  5F6Z A;  5EDC A;  4YFQ A;  1KXO A;  3CQN A;  5LKE A;  3UEU A;  1EAL A;  1GT4 A;  5LKF A;  3WJG A;  2EU7 X;  3QKG A;  3FEL A;  4KC8 A;  2HYS A;  5KIC A;  1JYD A;  1BSY A;  4NLI A;  4GZV A;  4R0B A;  3HK1 A;  1BSO A;  4ORU A;  2WUT A;  1GT3 A;  4QGW A;  4L1N A;  2M4L A;  4PJ2 A;  3AKM A;  2FS7 A;  1FEL A;  3FW4 A;  1X8Q A;  3BS2 A;  4GRJ A;  4O3Y A;  3RWX A;  4BOE A;  3UEV A;  2G7B A;  5KHP A;  1GGL A;  4MVI A;  2K23 A;  4YDA A;  2AL0 X;  4ZHD A;  4ORX A;  3E3C A;  2GTF X;  5EEE A;  4FBV A;  1MUP A;  1ERB A;  1PBO A;  2BHV A;  1VYF A;  3NX1 A;  4YKO A;  3SAO A;  2Z4I A;  5L8N A;  1ALB A;  2AT0 X;  1LIB A;  1IKE A;  2LA7 A;  3JQO A;  4A8Z A;  4I6S A;  4NNT A;  1HQP A;  1KQW A;  4IAB A;  1OPA A;  4INN A;  2KW1 A;  2KD2 A;  3WBG A;  2JW1 A;  1CBQ A;  1JYJ A;  1A2D A;  1OBQ A;  1QY0 A;  4O3X B;  1NP4 A;  2N93 A;  2KT4 B;  2GTL M;  3T1D A;  3VG4 A;  4HPC A;  3ZI8 A;  4ID2 A;  1QQS A;  1B4M A;  5FEN A;  4N7C A;  4QRL A;  3KQ0 A;  3STK A;  4U8U M;  5F1E A;  1A57 A;  1BLR A;  1EXS A;  2JU3 A;  1Y9T A;  3BX7 A;  2AT5 X;  3FEN A;  3BDR A;  4A1H A;  1CBI A;  3KFI A;  4I3C A;  3UAQ A;  5F6B A;  5FQ6 E;  5BVT A;  4Y0S A;  3STN A;  3U0D A;  2AT8 X;  1KT3 A;  4HPB A;  4LZU A;  3APU A;  3S5X A;  3U9P C;  4XMD A;  5HZ8 A;  5H9N A;  4ML7 B;  3VG3 A;  4YGH A;  1ACD A;  1I4U A;  5HTE A;  4ARH A;  5B29 A;  1AEL A;  1E00 A;  4AZP A;  1MVG A;  3MVF A;  5HCE C;  4EXZ A;  1ERX A;  3V8U A;  2GTL N;  1X71 A;  4EQA C;  4GDZ A;  1GKA A;  1VPR A;  4ZFX A;  2A2G A;  1HMR A;  1LFO A;  2Q9S A;  3ZW2 A;  1PEE A;  4RUN A;  2MO5 A;  2FR3 A;  3ZZV A;  5L8I A;  2PY1 A;  5AQ6 A;  4U8U N;  3VE1 A;  2GC9 A;  3HTY A;  1CBS A;  3C78 X;  5HZ6 A;  2CBS A;  2JU8 A;  1TXL A;  5L8O A;  5IO6 A;  3UEW A;  4LKP A;  1KT5 A;  1SY0 A;  4KII A;  3ZW1 A;  4YKM A;  4ALB A;  4MVE A;  1YWB A;  2WQA E;  4QNI A;  2LFO A;  2ZAI A;  2BS6 A;  5FAZ A;  3ELZ A;  2YG2 A;  2WEW A;  4ZHG A;  1TW4 A;  1PM1 X;  3TGA A;  4EEJ A;  3EBK A;  3LV4 A;  3EMM A;  4WFU A;  5HCD C;  4YFP A;  5H9K A;  2HLV A;  3WVM A;  4ZGF A;  4MVK A;  3APX A;  3JS1 A;  2HZR A;  4TKJ A;  1X8N A;  1XCA A;  4I9S A;  2QM9 A;  4ORR A;  4DQ3 A;  2LKK A;  1LID A;  5HAE A;  2FTB A;  3B2J A;  3TGB A;  3NBX X;  2A2U A;  4YBP A;  5IO7 A;  2HNX A;  2BS5 A;  3HOE A;  5HWZ A;  3FW5 A;  3CR6 A;  2MWH A;  3PPT A;  5DPQ A;  3APV A;  3BU9 A;  4ZHC A;  2AT3 X;  1E06 A;  1EII A;  3D97 A;  3KFH A;  3NX2 A;  1GXA A;  1KT4 A;  5LJB A;  2X8F A;  4EDE A;  3FR2 A;  3F8A A;  4IB7 A;  4IB6 A;  2RCT A;  2JOZ A;  3WJD A;  1L6M A;  1SY3 A;  1GT1 A;  4D6A A;  4AZN A;  4QZT A;  3P6H A;  1ZRY A;  5BVQ A;  2RCQ A;  3BSZ E;  4XMG A;  3VU1 A;  1LPJ A;  2G79 A;  2WEX A;  4I9R A;  1IIU A;  1DC9 A;  2HMB A;  1QG5 A;  5AEO A;  1I06 A;  4K19 A;  3RSW A;  2CBR A;  3ZW0 A;  4AW8 A;  5EZ2 A;  3OJY C;  3Q6L A;  1NGL A;  3FMZ A;  3NR3 A;  1H91 A;  4U9C A;  3P6C A;  2OVA A;  4O4S A;  4FQB B;  4QQ1 A;  1IFB A;  1ICM A;  5D4A A;  1ADL A;  2QO6 A;  1X8U A;  4ZH9 A;  4BQU A;  1DV9 A;  2OZQ A;  1DZP A;  3S26 A;  1EPB A;  4CV7 A;  1T0V A;  1DF3 A;  1Z24 A;  2ASN X;  2MJI A;  3ZW0 B;  5HZ9 A;  5LJE A;  4ZHF A;  3RKG A;  1I04 A;  4ODD A;  1VYG A;  2LB6 A;  3L4R A;  4GNY A;  4FBR A;  4I95 A;  1D3S A;  3PP6 A;  1URE A;  3NQ3 A;  4ORY A;  5DG4 A;  3ZQ3 A;  2OVE A;  1SXW A;  1SXX A;  1GX8 A;  4UU2 A;  3N91 A;  4N7D A;  1KGL A;  3G7X A;  3P24 A;  4L3R A;  3BU1 A;  2Z4H A;  1MX7 A;  4GH7 A;  4O9S A;  5HA1 A;  3VG5 A;  1KQX A;  1RBP A;  4EFG A;  2XKL A;  1D2U A;  1BSQ A;  1DZM A;  1HN2 A;  2NP1 A;  3EBW A;  1LF7 A;  1HBP A;  3BX8 A;  3PH6 A;  2L67 A;  1SA8 A;  5JR8 A;  1O8V A;  1LIC A;  3NP1 A;  4TLJ A;  1AB0 A;  2HZQ A;  4KC7 A;  4OS8 A;  1B8E A;  2NNE A;  3LHN A;  1CBR A;  4KH8 A;  1U0X A;  1FDQ A;  1FE3 A;  4Y0P A;  4MIR A;  1JJX A;  4YMY A;  1EI5 A;  4O49 A;  2FT9 A;  1G7N A;  2Q2P A;  4OS0 A;  4UU3 A;  2L9C A;  4QZU A;  3RBY A;  4ORS A;  4A60 A;  2OVD A;  2LBA A;  4GKC A;  2POA A;  4MIS A;  1QFT A;  3S60 A;  1P6P A;  4O3W A;  3JSQ A;  2NNQ A;  2WWP A;  4IAW A;  3O2Y A;  1S44 A;  5HTD A;  3WXQ A;  2MHD A;  5AJB A;  1I05 A;  4OMW A;  4ON1 A;  5FQ8 E;  5BVS A;  2Q2M A;  3TF6 A;  5LJG A;  3B2I A;  1EQD A;  4FGI B;  4KCA A;  3NQK A;  5F7G A;  1MDC A;  4HPD A;  4AYH A;  4FBO A;  3KFG A;  1FEN A;  4TQ2 A;  1ML7 A;  1ZNG A;  5D8J A;  4Y0R A;  3WJB A;  2YMS A;  1HMS A;  2P8G A;  1N0S A;  3O22 A;  4XMH A;  4IB8 A;  3EM0 A;  2L68 A;  4QAE A;  3D95 A;  1X89 A;  4CSB A;  2QOS C;  1SMP I;  4NYQ A;  3NQ9 A;  1EUO A;  1RLB E;  2X45 A;  3P02 A;  1A18 A;  3HWE A;  1ZNL A;  2X46 A;  4YFR A;  5BYP A;  3HWF A;  4GK9 A;  3VG7 A;  4DQ4 A;  1AVG I;  1SXU A;  1EW3 A;  1T8V A;  3ZUI A;  4HFO A;  4LKT A;  4AZQ A;  1BRQ A;  2FWV A;  4ES7 A;  1LNM A;  1SY1 A;  4IB9 A;  1S2P A;  3APW A;  3STM X;  1BM5 A;  3FR5 A;  1NP1 A;  2NND A;  5KID A;  1JV4 A;  2ACP X;  1MX8 A;  3HOL A;  4TJZ A;  3P6F A;  1QY1 A;  2A0A A;  3CBS A;  1Y9L A;  1SXY A;  2W2A A;  3B2K A;  1G74 A;  2AT6 X;  5CYB A;  2OVS A;  4NNS A;  1YP6 A;  3FIQ A;  3WJC A;  4M7M A;  1KZX A;  1AQB A;  4YGG A;  4QGV A;  2IFB A;  4GU8 A;  1X8O A;  4I3B A;  2X8T A;  2GJ5 A;  3D4R A;  5AJC A;  5H9A A;  1BWY A;  2LBV A;  1YWC A;  4YCH A;  2ANS A;  3K3L A;  1DFV A;  4CK4 A;  3EYC A;  1JIW I;  3ZWE A;  3ZUO A;  1YP7 A;  4NLJ A;  2BLG A;  2KTD A;  4ZHH A;  2FS6 A;  2WR6 A;  2R73 A;  1TVQ A;  2ZAG A;  4ORW A;  1JJJ A;  3TGC A;  4XMC A;  3CBC A;  4ZJ0 A;  4PSQ A;  5EDB A;  4RUU A;  2CZU A;  5HCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...