1S32D

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 101
sequence length 101
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32D00
5GT0A 3AZLB 1P34A 4JJNC 5CPJC 1P3OC 4LD9C 2F8NA 3WKJA 5B33B 3A6ND 3B0CW 1P3KB 4Z66B 4G91B 5AV6B 1P3GC 3KXBD 2NQBB 5B2JC 3W97C 1P3PB 5CPKC 2IO5B 4Z5TA 3KUYC 1KX4A 4YM6A 3AZIA 5AV8B 3AFAD 3UTAD 3W99A 5B24D 3W98D 1AOIA 1TAFB 5BNXB 1BH9A 5BNVA 5B32A 3MNNA 4XZQA 5DNMA 3AZKA 1M19D 3AZNB 4KGCA 4WU9D 3AZJD 1S32A 5GSUA 5B1LC 4R8PB 3B0DB 5B0YD 4J8UB 2CWEA 4QLCB 4YS3C 2PYOD 2RVQD 3O62C 3AN2C 1ZLAA 3AYWC 2LY8A 3LJAA 4DRBA 3AZGA 3X1UD 3X1SD 3X1VC 5GXQA 4H9PA 1P34D 3WTPD 3LZ1D 5AV5C 1P3FC 3WKJD 4J8VB 3AV2A 5G49A 5FUGB 5DNND 4HGAC 2CV5A 2YFWB 3REIC 1H3OB 5GT3A 3AZHB 1M1AB 5CP6A 4H9NB 5JRGC 5B1MC 3LELA 4Z5TD 3WAAA 5GT0C 5AVBA 1KX4D 3AZID 3AV1C 1U35C 1EQZB 2HUEB 1WWSA 3W99D 3C1BA 4ZBJB 1AOID 3MNND 5B32D 5DNMD 4XZQD 3AZKD 3KWQA 4X23A 4KGCD 2FJ7A 5GSUD 1P3OA 5CPJA 5CPIC 4CSRA 3REHD 3WTPE 1KX5B 4YM6C 5E5AB 1P3GA 3UTBD 3KSYA 3B6GB 3B6FC 1ZLAD 3V9RA 3LJAD 5B2JA 3W97A 3AZGD 3KUYA 1P3LB 4Z2MH 5B31D 5AV9D 1HQ3A 3AV2D 2CV5D 5KDMB 5B1LA 5CP6D 3MGRB 1P3MC 5F99B 3MGQB 2HUEC 5AVCC 3WAAD 5GXQC 4YS3A 3C1CD 3O62A 4ZUXD 3AN2A 1M18B 5B2IB 2NZDB 5BO0B 3MVDC 3AZFB 1F66C 3KWQD 4X23D 5GT3C 3X1VA 1P3KA 3REJB 4JJND 5CPJD 3REKC 5B40B 5AV5A 3MGPB 1P3FA 1P3OD 4LD9D 2BYMB 3LELC 4Z2MG 1P3AB 5B0ZC 3REIA 3AZMC 1P3GD 1P3LC 1N1JA 5AY8B 4CAYA 4G92B 3TU4C 5B1MA 1Q9CA 1HTAA 5B2JD 4XUJB 3VH5T 5CPKD 3W97D 1WWIA 1P3BC 1TAFA 5BNXA 3KUYD 2FJ7C 3AZNA 3AV1A 1U35A 3X1TD 4KUDC 3A6NB 4R8PA 5JA4A 1TZYC 4NE5A 3MGQC 1JFIA 5B32G 2AROC 4QLCA 4J8UA 5B1LD 4J8WB 5CPIA 4H9RB 3UT9C 1ULYA 4J8XB 4YS3D 1ID3C 3MGSB 3O62D 3AFAB 3UTAB 3AZEC 3AN2D 3B6FA 1HQ3C 3W98B 3AYWD 1M19B 3X1VD 1KX3C 4H9QA 4WU9B 5FUGA 4WU8B 2YFWA 1H3OA 5B31G 5AV5D 1P3FD 4EO5B 5B0YB 4NFTA 4H9NA 4E45A 4AWLC 3WA9C 3REID 3AZLC 3W96D 1P3MA 5JRGD 5B1MD 3X1UB 5B33C 2F8NK 5AVCA 3X1SB 4Z66C 1P3KC 5GT0D 4G91C 1BH8B 5AV6C 3AV1D 1U35D 3WTPB 3LZ1B 2F8ND 3WKJB 2NQBC 4J8WC 5DNNB 3MVDA 1F66A 1P3PC 3NQUA 2BYKB 2IO5C 5CHLB 4J8XC 5AV8C 3REKA 3MGSC 5CPID 3RELB 4Z5TB 4YM6D 5B0ZA 1KX4B 3AZNC 3AZMA 1M19C 1P3LA 4KHAA 3B6FD 1BFMA 3TU4A 4E44A 3W99B 1AOIB 4WU8C 4R8PC 3B0DC 3MNNB 5BNVB 1BH9B 5B32B 4XZQB 5DNMB 3AZKB 1P3BA 4J8UC 1S32D 4QLCC 5GSUB 4KUDA 3REHB 1TZYA 3MGQA 2AROA 3NQJA 3UTBB 1ZLAB 1P3MD 3UT9A 3LJAB 4H9OA 3AZGB 4J8VC 5AVCD 2HIOB 5GXQD 5B31B 5BO0A 5AV9B 3AZFA 1ID3A 4WNNB 2YFVA 3AZHC 2F8NH 1M1AC 3AZEA 3AV2B 5B40A 3MGPA 3MVDD 2BYMA 1F66D 3RELC 5GT3D 2CV5B 1KX3A 4UUZB 5CP6B 3VH6W 5C3IB 1EQZC 3REKD 3LZ0B 1P3IB 4ZBJC 3LELD 5AVBD 3WAAB 5BT1C 3WA9A 5B0ZD 3C1CB 3AZMD 4ZUXB 1P3LD 3C1BD 3AZLA 3TU4D 5B33A 4Z66A 3KWQB 4X23B 1P3BD 1KX5C 2FJ7D 5AV6A 5E5AC 4JJNB 1P3OB 4KUDD 3VH5W 4LD9B 4CSRB 3B6GC 3UTBC 2NQBA 4M6BA 4J8WA 1TZYD 3MGQD 1P3PA 2F8NG 1P3GB 3R45B 2HIOC 2AROD 4J8XA 5AV9C 5AV8A 3MGSA 3UTAA 3V9RB 3UT9D 5B2JB 3W97B 3W98A 5CPKB 3KUYB 1M19A 1ID3D 3X1TB 4WU9A 3AZED 1HQ3D 3MGRC 4WU8A 5F99C 3LZ0C 1P3IC 1KX3D 3KXBB 1M18C 5B2IC 2NZDC 3AZFC 4YS3B 3WA9D 3O62B 3AN2B 1BH8A 5B24B 3AZLD 3AYWB 3REJC 3WTPA 3LZ1A 3MGPC 5B40C 4J8VA 5B33D 1P3AC 1KU5A 1P3KD 4Z66D 3X1VB 3AZJB 5DNNA 5AV6D 2BYKA 3AZHA 1M1AA 5AY8C 5AV5B 1P3FB 4G92C 2NQBD 4J8WD 4XUJC 1P3PD 2PYOB 4HGAB 3RELA 3REIB 3B0CT 3VH6A 1N1JB 4J8XD 4CAYB 1EQZA 5AV8D 3W96B 3MGSD 5JRGB 3X1TC 5B1MB 3A6NC 5GT0B 3AZND 1P34B 3AV1B 1U35B 3KXBC 2F8NB 4NE6A 4WU8D 4R8PD 5JA4B 3REHA 1KX5A 1JFIB 4J8UD 4QLCD 5E5AA 3VH5A 3AFAC 3UTAC 5CPIB 3B6GA 4NE3A 5B24C 3UTBA 3W98C 1B6WA 4YM6B 3AZIB 4WU9C 2HIOA 3AZJC 5B31A 3B6FB 5BS7A 5AV9A 4WNNA 4EO5C 4J8VD 5B0YC 4KGCB 4H9QB 1S32B 2PYOC 2RVQC 5KDMA 3AZHD 1M1AD 4H9SC 4UUZA 3MGRA 3W96C 5F99A 3LZ0A 1P3IA 3X1UC 3X1SC 3RELD 3C1CA 1R4VA 1P34C 1EQZD 3WTPC 4ZUXA 3LZ1C 1P3MB 1M18A 2L5AA 3WKJC 5B2IA 2NZDA 5AVCB 5GXQB 5BT1D 5DNNC 4H9PB 3REJA 5G49B 4JJNA 3B0BA 4LD9A 1P3AA 3MVDB 1F66B 3NQUB 5GT3B 4Z5TC 4DRAA 1KX5D 1KX4C 5E5AD 3AZIC 3REKB 3R45A 5AY8A 3B6GD 3W99C 3LELB 1AOIC 1B67A 5AVBB 5B32C 3MNNC 4XUJA 4XZQC 5DNMC 3AZKC 5B0ZB 5CPKA 3AZMB 4KGCC 2HIOD 4KHAB 1S32C 3C1BB 5GSUC 3TU4B 3X1TA 3REHC 3A6NA 1P3BB 2FJ7B 5CPJB 3KXBA 4KUDB 3MGRD 1ZLAC 4H9RA 4WZSB 1TZYB 5F99D 3LZ0D 3LJAC 3AZGC 1P3ID 5B31C 2AROB 5BS7C 3NQJB 1A7WA 3AFAA 3UT9B 1M18D 5B24A 4H9OB 5B2ID 3AYWA 3AV2C 2NZDD 3VH6T 3AZFD 2CV5C 1ID3B 2YFVB 3AZJA 3AZEB 2JSSA 1HQ3B 5CP6C 3REJD 5C3IC 5B40D 3MGPD 5B0YA 1P3AD 1F1EA 1KX3B 3WAAC 5AVBC 5B1LB 3C1CC 2PYOA 4H9SA 4ZUXC 5AY8D 4WV4B 3C1BC 3W96A 5JRGA 4XUJD 3X1UA 4AWLB 3WA9B 3X1SA 3KWQC 4X23C
chains in the Genus database with same CATH superfamily
5GT0A 3AZLB 1P34A 4JJNC 5CPJC 1P3OC 4LD9C 2F8NA 3WKJA 5B33B 3A6ND 3B0CW 1P3KB 4Z66B 4G91B 5AV6B 2XD5A 2Y2KA 1P3GC 2G5HC 3KXBD 2BG1A 2NQBB 5B2JC 3W97C 1P3PB 5CPKC 2IO5B 4Z5TA 3KUYC 1KX4A 4YM6A 3AZIA 5AV8B 3AFAD 3UTAD 3W99A 5B24D 3W98D 1AOIA 1TAFB 5BNXB 1BH9A 5BNVA 5B32A 3MNNA 4XZQA 5DNMA 3AZKA 1M19D 3AZNB 4KGCA 4WU9D 3AZJD 1S32A 2ZY2A 5GSUA 5B1LC 2ZM5A 4R8PB 3B0DB 2XD1A 5B0YD 4J8UB 2CWEA 4QLCB 4YS3C 2PYOD 2RVQD 3O62C 3AN2C 2ZY4A 1ZLAA 3AYWC 2LY8A 3LJAA 4DRBA 3AZGA 3X1UD 3X1SD 3X1VC 5GXQA 4H9PA 1P34D 3WTPD 3LZ1D 3KFUG 5AV5C 1P3FC 3WKJD 4J8VB 3AV2A 5G49A 5FUGB 5DNND 4HGAC 2CV5A 2YFWB 3REIC 1H3OB 5GT3A 3AZHB 1M1AB 5CP6A 2JCHA 4H9NB 5JRGC 5B1MC 3LELA 4Z5TD 3WAAA 5GT0C 5AVBA 1KX4D 3AZID 3AV1C 1U35C 1EQZB 2HUEB 1WWSA 3W99D 3C1BA 4ZBJB 1AOID 3MNND 5B32D 5DNMD 4XZQD 3AZKD 3KWQA 4X23A 4KGCD 2FJ7A 5GSUD 1P3OA 5CPJA 5CPIC 4CSRA 3REHD 2Y2HA 3WTPE 1KX5B 4DQYB 4YM6C 5E5AB 1P3GA 3UTBD 3KSYA 3B6GB 3B6FC 1ZLAD 3V9RA 3LJAD 5B2JA 3H0RC 3W97A 3AZGD 3KUYA 1P3LB 4Z2MH 5B31D 5AV9D 2FFFB 1HQ3A 3AV2D 2CV5D 5KDMB 5B1LA 5CP6D 3MGRB 1P3MC 5F99B 3MGQB 2HUEC 5AVCC 3WAAD 5GXQC 4YS3A 3C1CD 3O62A 4ZUXD 3AN2A 1M18B 5B2IB 2NZDB 5BO0B 1Z2CB 3MVDC 3AZFB 1F66C 3KWQD 4X23D 5GT3C 3X1VA 1P3KA 3REJB 4JJND 5CPJD 3REKC 5B40B 5AV5A 3MGPB 1P3FA 1P3OD 4LD9D 2BYMB 2DQNC 4Z2MG 3LELC 1P3AB 5B0ZC 3REIA 3AZMC 1P3GD 1P3LC 1N1JA 5AY8B 2Y2OA 3F6TA 4CAYA 4G92B 3TU4C 5B1MA 3EPLA 1Q9CA 1HTAA 5B2JD 4XUJB 3VH5T 5CPKD 3W97D 1WWIA 1P3BC 1TAFA 5BNXA 3KUYD 2FJ7C 3AZNA 3AV1A 1U35A 2Y2QA 3X1TD 4KUDC 3A6NB 4R8PA 5JA4A 1TZYC 4NE5A 3MGQC 1JFIA 2VQRA 5B32G 2AROC 4QLCA 4J8UA 5B1LD 4J8WB 5CPIA 4H9RB 3UT9C 1ULYA 4J8XB 4YS3D 1ID3C 3MGSB 3O62D 3AFAB 3UTAB 3AZEC 3AN2D 3B6FA 1HQ3C 3W98B 3AYWD 1M19B 3X1VD 1KX3C 4H9QA 4WU9B 5FUGA 3A1IA 4WJ3C 4WU8B 2YFWA 1H3OA 1W2EA 5B31G 5AV5D 1P3FD 4EO5B 5B0YB 4NFTA 4H9NA 4E45A 2ZY3A 4AWLC 3WA9C 3REID 3AZLC 3W96D 3EPHA 1P3MA 5JRGD 5B1MD 3X1UB 5B33C 2F8NK 5AVCA 3X1SB 4Z66C 1P3KC 5GT0D 4G91C 1BH8B 5AV6C 3AV1D 1U35D 3WTPB 2Y2JA 3LZ1B 2F8ND 3WKJB 2NQBC 4J8WC 5DNNB 3MVDA 1F66A 1P3PC 3NQUA 2BYKB 2IO5C 5CHLB 4J8XC 5AV8C 3REKA 3MGSC 5CPID 3RELB 4Z5TB 4YM6D 5B0ZA 1KX4B 3AZNC 3AZMA 1M19C 1P3LA 4KHAA 3B6FD 1BFMA 3TU4A 4E44A 3W99B 1AOIB 4WU8C 3P5JB 4R8PC 3B0DC 3MNNB 5BNVB 1BH9B 5B32B 4XZQB 5DNMB 3AZKB 1P3BA 4J8UC 1S32D 4QLCC 5GSUB 4KUDA 3REHB 1TZYA 3MGQA 2AROA 3NQJA 3UTBB 1ZLAB 1P3MD 3UT9A 3LJAB 2JE5A 4H9OA 3AZGB 4J8VC 5AVCD 2HIOB 5GXQD 5B31B 5BO0A 5AV9B 3AZFA 1ID3A 4WNNB 2YFVA 3AZHC 2F8NH 1M1AC 3AZEA 3AV2B 5B40A 3H0MC 2UWXA 3MGPA 3MVDD 2BYMA 1F66D 3RELC 5GT3D 2CV5B 1KX3A 4UUZB 5CP6B 3VH6W 5C3IB 1EQZC 3REKD 3LZ0B 1P3IB 4ZBJC 3LELD 5AVBD 3WAAB 5BT1C 3WA9A 5B0ZD 3C1CB 3AZMD 4ZUXB 1P3LD 3C1BD 3AZLA 3TU4D 3H0LC 5B33A 4Z66A 3KWQB 4X23B 1P3BD 1KX5C 2FJ7D 5AV6A 5E5AC 4JJNB 1P3OB 4KUDD 3VH5W 4LD9B 4CSRB 3B6GC 3UTBC 2NQBA 4M6BA 4J8WA 1TZYD 3MGQD 1P3PA 2F8NG 1P3GB 3R45B 2HIOC 2AROD 4J8XA 5AV9C 5AV8A 3MGSA 3UTAA 3V9RB 3UT9D 5B2JB 3W97B 3W98A 5CPKB 3KUYB 1M19A 2Y2NA 1ID3D 3X1TB 4WU9A 3AZED 1HQ3D 3MGRC 3IP4C 4WU8A 5F99C 3LZ0C 1P3IC 1KX3D 3KXBB 1M18C 5B2IC 2NZDC 3AZFC 4YS3B 3WA9D 3O62B 3AN2B 1BH8A 5B24B 3AZLD 3AYWB 3REJC 2ZY5A 3WTPA 3LZ1A 3MGPC 5B40C 4J8VA 5B33D 1P3AC 1KU5A 1P3KD 4Z66D 3X1VB 3AZJB 5DNNA 5AV6D 2BYKA 2Y2MA 3AZHA 1M1AA 5AY8C 5AV5B 1P3FB 4G92C 2NQBD 4J8WD 4XUJC 1P3PD 2PYOB 4HGAB 3RELA 3REIB 3B0CT 3VH6A 1N1JB 4J8XD 4CAYB 1EQZA 5AV8D 3W96B 3MGSD 5JRGB 3X1TC 5B1MB 3A6NC 5GT0B 3AZND 1P34B 2DF4C 3AV1B 1U35B 3KXBC 2F8NB 2Y2IA 4NE6A 4WU8D 4R8PD 5JA4B 3REHA 2RIQA 1KX5A 1JFIB 3EPJA 4J8UD 4QLCD 5E5AA 3VH5A 3AFAC 3UTAC 5CPIB 3B6GA 4NE3A 5B24C 3UTBA 3W98C 1B6WA 4YM6B 3AZIB 4WU9C 2HIOA 3AZJC 5B31A 3B6FB 5BS7A 5AV9A 4WNNA 2Y2PA 4EO5C 4J8VD 5B0YC 4KGCB 4H9QB 1S32B 2PYOC 2RVQC 5KDMA 3AZHD 1M1AD 4H9SC 4UUZA 3MGRA 2W8SA 3W96C 5F99A 3LZ0A 1P3IA 3X1UC 1T3UA 3X1SC 3RELD 3C1CA 1R4VA 1P34C 1EQZD 3WTPC 4ZUXA 3LZ1C 1P3MB 1M18A 2L5AA 3WKJC 5B2IA 2NZDA 5AVCB 5GXQB 5BT1D 5DNNC 2Y2GA 4UPKA 4H9PB 3REJA 5G49B 4JJNA 3B0BA 4LD9A 1P3AA 3MVDB 2Y2LA 1F66B 3NQUB 5GT3B 4Z5TC 4DRAA 1KX5D 1KX4C 5E5AD 3AZIC 3REKB 3R45A 5AY8A 3B6GD 3W99C 3LELB 1AOIC 1B67A 5AVBB 5B32C 3MNNC 4XUJA 4XZQC 5DNMC 3AZKC 5B0ZB 5CPKA 3AZMB 4KGCC 2HIOD 4KHAB 1S32C 3C1BB 5GSUC 3TU4B 3X1TA 3REHC 3A6NA 1PZRA 1P3BB 2FJ7B 5CPJB 3KXBA 2F2AC 4KUDB 3MGRD 1ZLAC 4H9RA 4WZSB 1TZYB 5F99D 3LZ0D 3LJAC 3AZGC 1P3ID 5B31C 2AROB 5BS7C 3NQJB 2G5IC 1A7WA 3AFAA 3UT9B 3EPKA 5B24A 1M18D 4H9OB 5B2ID 3AYWA 3AV2C 2NZDD 3VH6T 3AZFD 2CV5C 1ID3B 2YFVB 3FDDA 3AZJA 3A1KA 3AZEB 2JSSA 1HQ3B 5CP6C 3REJD 5C3IC 5B40D 3MGPD 5B0YA 1P3AD 1F1EA 1KX3B 3AL0C 3WAAC 3EG5B 2J8PA 5AVBC 5B1LB 3C1CC 2PYOA 4H9SA 4ZUXC 5AY8D 4WV4B 3C1BC 3W96A 5JRGA 4XUJD 3X1UA 4AWLB 3WA9B 3X1SA 3KWQC 4X23C
chains in the Genus database with same CATH topology
5GT0A 3AZLB 1P34A 4JJNC 5CPJC 1P3OC 4LD9C 2F8NA 3WKJA 5B33B 3A6ND 3B0CW 1P3KB 4Z66B 4G91B 5AV6B 2XD5A 2Y2KA 1P3GC 2G5HC 3KXBD 2BG1A 2NQBB 5B2JC 3W97C 1P3PB 5CPKC 2IO5B 4Z5TA 3KUYC 1KX4A 4YM6A 3AZIA 5AV8B 3AFAD 3UTAD 3W99A 5B24D 3W98D 1AOIA 1TAFB 5BNXB 1BH9A 5BNVA 5B32A 3MNNA 4XZQA 5DNMA 3AZKA 1M19D 3AZNB 4KGCA 4WU9D 3AZJD 1S32A 2ZY2A 5GSUA 5B1LC 2ZM5A 4R8PB 3B0DB 2XD1A 5B0YD 4J8UB 2CWEA 4QLCB 4YS3C 2PYOD 2RVQD 3O62C 3AN2C 2ZY4A 1ZLAA 3AYWC 2LY8A 3LJAA 4DRBA 3AZGA 3X1UD 3X1SD 3X1VC 5GXQA 4H9PA 1P34D 3WTPD 3LZ1D 3KFUG 5AV5C 1P3FC 3WKJD 4J8VB 3AV2A 5G49A 5FUGB 5DNND 4HGAC 2CV5A 2YFWB 3REIC 1H3OB 5GT3A 3AZHB 1M1AB 5CP6A 2JCHA 4H9NB 5JRGC 5B1MC 3LELA 4Z5TD 3WAAA 5GT0C 5AVBA 1KX4D 3AZID 3AV1C 1U35C 1EQZB 2HUEB 1WWSA 3W99D 3C1BA 4ZBJB 1AOID 3MNND 5B32D 5DNMD 4XZQD 3AZKD 3KWQA 4X23A 4KGCD 2FJ7A 5GSUD 1P3OA 5CPJA 5CPIC 4CSRA 3REHD 2Y2HA 3WTPE 1KX5B 4DQYB 4YM6C 5E5AB 1P3GA 3UTBD 3KSYA 3B6GB 3B6FC 1ZLAD 3V9RA 3LJAD 5B2JA 3H0RC 3W97A 3AZGD 3KUYA 1P3LB 4Z2MH 5B31D 5AV9D 2FFFB 1HQ3A 3AV2D 2CV5D 5KDMB 5B1LA 5CP6D 3MGRB 1P3MC 5F99B 3MGQB 2HUEC 5AVCC 3WAAD 5GXQC 4YS3A 3C1CD 3O62A 4ZUXD 3AN2A 1M18B 5B2IB 2NZDB 5BO0B 1Z2CB 3MVDC 3AZFB 1F66C 3KWQD 4X23D 5GT3C 3X1VA 1P3KA 3REJB 4JJND 5CPJD 3REKC 5B40B 5AV5A 3MGPB 1P3FA 1P3OD 4LD9D 2BYMB 2DQNC 4Z2MG 3LELC 1P3AB 5B0ZC 3REIA 3AZMC 1P3GD 1P3LC 1N1JA 5AY8B 2Y2OA 3F6TA 4CAYA 4G92B 3TU4C 5B1MA 3EPLA 1Q9CA 1HTAA 5B2JD 4XUJB 3VH5T 5CPKD 3W97D 1WWIA 1P3BC 1TAFA 5BNXA 3KUYD 2FJ7C 3AZNA 3AV1A 1U35A 2Y2QA 3X1TD 4KUDC 3A6NB 4R8PA 5JA4A 1TZYC 4NE5A 3MGQC 1JFIA 2VQRA 5B32G 2AROC 4QLCA 4J8UA 5B1LD 4J8WB 5CPIA 4H9RB 3UT9C 1ULYA 4J8XB 4YS3D 1ID3C 3MGSB 3O62D 3AFAB 3UTAB 3AZEC 3AN2D 3B6FA 1HQ3C 3W98B 3AYWD 1M19B 3X1VD 1KX3C 4H9QA 4WU9B 5FUGA 3A1IA 4WJ3C 4WU8B 2YFWA 1H3OA 1W2EA 5B31G 5AV5D 1P3FD 4EO5B 5B0YB 4NFTA 4H9NA 4E45A 2ZY3A 4AWLC 3WA9C 3REID 3AZLC 3W96D 3EPHA 1P3MA 5JRGD 5B1MD 3X1UB 5B33C 2F8NK 5AVCA 3X1SB 4Z66C 1P3KC 5GT0D 4G91C 1BH8B 5AV6C 3AV1D 1U35D 3WTPB 2Y2JA 3LZ1B 2F8ND 3WKJB 2NQBC 4J8WC 5DNNB 3MVDA 1F66A 1P3PC 3NQUA 2BYKB 2IO5C 5CHLB 4J8XC 5AV8C 3REKA 3MGSC 5CPID 3RELB 4Z5TB 4YM6D 5B0ZA 1KX4B 3AZNC 3AZMA 1M19C 1P3LA 4KHAA 3B6FD 1BFMA 3TU4A 4E44A 3W99B 1AOIB 4WU8C 3P5JB 4R8PC 3B0DC 3MNNB 5BNVB 1BH9B 5B32B 4XZQB 5DNMB 3AZKB 1P3BA 4J8UC 1S32D 4QLCC 5GSUB 4KUDA 3REHB 1TZYA 3MGQA 2AROA 3NQJA 3UTBB 1ZLAB 1P3MD 3UT9A 3LJAB 2JE5A 4H9OA 3AZGB 4J8VC 5AVCD 2HIOB 5GXQD 5B31B 5BO0A 5AV9B 3AZFA 1ID3A 4WNNB 2YFVA 3AZHC 2F8NH 1M1AC 3AZEA 3AV2B 5B40A 3H0MC 2UWXA 3MGPA 3MVDD 2BYMA 1F66D 3RELC 5GT3D 2CV5B 1KX3A 4UUZB 5CP6B 3VH6W 5C3IB 1EQZC 3REKD 3LZ0B 1P3IB 4ZBJC 3LELD 5AVBD 3WAAB 5BT1C 3WA9A 5B0ZD 3C1CB 3AZMD 4ZUXB 1P3LD 3C1BD 3AZLA 3TU4D 3H0LC 5B33A 4Z66A 3KWQB 4X23B 1P3BD 1KX5C 2FJ7D 5AV6A 5E5AC 4JJNB 1P3OB 4KUDD 3VH5W 4LD9B 4CSRB 3B6GC 3UTBC 2NQBA 4M6BA 4J8WA 1TZYD 3MGQD 1P3PA 2F8NG 1P3GB 3R45B 2HIOC 2AROD 4J8XA 5AV9C 5AV8A 3MGSA 3UTAA 3V9RB 3UT9D 5B2JB 3W97B 3W98A 5CPKB 3KUYB 1M19A 2Y2NA 1ID3D 3X1TB 4WU9A 3AZED 1HQ3D 3MGRC 3IP4C 4WU8A 5F99C 3LZ0C 1P3IC 1KX3D 3KXBB 1M18C 5B2IC 2NZDC 3AZFC 4YS3B 3WA9D 3O62B 3AN2B 1BH8A 5B24B 3AZLD 3AYWB 3REJC 2ZY5A 3WTPA 3LZ1A 3MGPC 5B40C 4J8VA 5B33D 1P3AC 1KU5A 1P3KD 4Z66D 3X1VB 3AZJB 5DNNA 5AV6D 2BYKA 2Y2MA 3AZHA 1M1AA 5AY8C 5AV5B 1P3FB 4G92C 2NQBD 4J8WD 4XUJC 1P3PD 2PYOB 4HGAB 3RELA 3REIB 3B0CT 3VH6A 1N1JB 4J8XD 4CAYB 1EQZA 5AV8D 3W96B 3MGSD 5JRGB 3X1TC 5B1MB 3A6NC 5GT0B 3AZND 1P34B 2DF4C 3AV1B 1U35B 3KXBC 2F8NB 2Y2IA 4NE6A 4WU8D 4R8PD 5JA4B 3REHA 2RIQA 1KX5A 1JFIB 3EPJA 4J8UD 4QLCD 5E5AA 3VH5A 3AFAC 3UTAC 5CPIB 3B6GA 4NE3A 5B24C 3UTBA 3W98C 1B6WA 4YM6B 3AZIB 4WU9C 2HIOA 3AZJC 5B31A 3B6FB 5BS7A 5AV9A 4WNNA 2Y2PA 4EO5C 4J8VD 5B0YC 4KGCB 4H9QB 1S32B 2PYOC 2RVQC 5KDMA 3AZHD 1M1AD 4H9SC 4UUZA 3MGRA 2W8SA 3W96C 5F99A 3LZ0A 1P3IA 3X1UC 1T3UA 3X1SC 3RELD 3C1CA 1R4VA 1P34C 1EQZD 3WTPC 4ZUXA 3LZ1C 1P3MB 1M18A 2L5AA 3WKJC 5B2IA 2NZDA 5AVCB 5GXQB 5BT1D 5DNNC 2Y2GA 4UPKA 4H9PB 3REJA 5G49B 4JJNA 3B0BA 4LD9A 1P3AA 3MVDB 2Y2LA 1F66B 3NQUB 5GT3B 4Z5TC 4DRAA 1KX5D 1KX4C 5E5AD 3AZIC 3REKB 3R45A 5AY8A 3B6GD 3W99C 3LELB 1AOIC 1B67A 5AVBB 5B32C 3MNNC 4XUJA 4XZQC 5DNMC 3AZKC 5B0ZB 5CPKA 3AZMB 4KGCC 2HIOD 4KHAB 1S32C 3C1BB 5GSUC 3TU4B 3X1TA 3REHC 3A6NA 1PZRA 1P3BB 2FJ7B 5CPJB 3KXBA 2F2AC 4KUDB 3MGRD 1ZLAC 4H9RA 4WZSB 1TZYB 5F99D 3LZ0D 3LJAC 3AZGC 1P3ID 5B31C 2AROB 5BS7C 3NQJB 2G5IC 1A7WA 3AFAA 3UT9B 3EPKA 5B24A 1M18D 4H9OB 5B2ID 3AYWA 3AV2C 2NZDD 3VH6T 3AZFD 2CV5C 1ID3B 2YFVB 3FDDA 3AZJA 3A1KA 3AZEB 2JSSA 1HQ3B 5CP6C 3REJD 5C3IC 5B40D 3MGPD 5B0YA 1P3AD 1F1EA 1KX3B 3AL0C 3WAAC 3EG5B 2J8PA 5AVBC 5B1LB 3C1CC 2PYOA 4H9SA 4ZUXC 5AY8D 4WV4B 3C1BC 3W96A 5JRGA 4XUJD 3X1UA 4AWLB 3WA9B 3X1SA 3KWQC 4X23C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 A;  3AZL B;  1P34 A;  4JJN C;  5CPJ C;  1P3O C;  4LD9 C;  2F8N A;  3WKJ A;  5B33 B;  3A6N D;  3B0C W;  1P3K B;  4Z66 B;  4G91 B;  5AV6 B;  1P3G C;  3KXB D;  2NQB B;  5B2J C;  3W97 C;  1P3P B;  5CPK C;  2IO5 B;  4Z5T A;  3KUY C;  1KX4 A;  4YM6 A;  3AZI A;  5AV8 B;  3AFA D;  3UTA D;  3W99 A;  5B24 D;  3W98 D;  1AOI A;  1TAF B;  5BNX B;  1BH9 A;  5BNV A;  5B32 A;  3MNN A;  4XZQ A;  5DNM A;  3AZK A;  1M19 D;  3AZN B;  4KGC A;  4WU9 D;  3AZJ D;  1S32 A;  5GSU A;  5B1L C;  4R8P B;  3B0D B;  5B0Y D;  4J8U B;  2CWE A;  4QLC B;  4YS3 C;  2PYO D;  2RVQ D;  3O62 C;  3AN2 C;  1ZLA A;  3AYW C;  2LY8 A;  3LJA A;  4DRB A;  3AZG A;  3X1U D;  3X1S D;  3X1V C;  5GXQ A;  4H9P A;  1P34 D;  3WTP D;  3LZ1 D;  5AV5 C;  1P3F C;  3WKJ D;  4J8V B;  3AV2 A;  5G49 A;  5FUG B;  5DNN D;  4HGA C;  2CV5 A;  2YFW B;  3REI C;  1H3O B;  5GT3 A;  3AZH B;  1M1A B;  5CP6 A;  4H9N B;  5JRG C;  5B1M C;  3LEL A;  4Z5T D;  3WAA A;  5GT0 C;  5AVB A;  1KX4 D;  3AZI D;  3AV1 C;  1U35 C;  1EQZ B;  2HUE B;  1WWS A;  3W99 D;  3C1B A;  4ZBJ B;  1AOI D;  3MNN D;  5B32 D;  5DNM D;  4XZQ D;  3AZK D;  3KWQ A;  4X23 A;  4KGC D;  2FJ7 A;  5GSU D;  1P3O A;  5CPJ A;  5CPI C;  4CSR A;  3REH D;  3WTP E;  1KX5 B;  4YM6 C;  5E5A B;  1P3G A;  3UTB D;  3KSY A;  3B6G B;  3B6F C;  1ZLA D;  3V9R A;  3LJA D;  5B2J A;  3W97 A;  3AZG D;  3KUY A;  1P3L B;  4Z2M H;  5B31 D;  5AV9 D;  1HQ3 A;  3AV2 D;  2CV5 D;  5KDM B;  5B1L A;  5CP6 D;  3MGR B;  1P3M C;  5F99 B;  3MGQ B;  2HUE C;  5AVC C;  3WAA D;  5GXQ C;  4YS3 A;  3C1C D;  3O62 A;  4ZUX D;  3AN2 A;  1M18 B;  5B2I B;  2NZD B;  5BO0 B;  3MVD C;  3AZF B;  1F66 C;  3KWQ D;  4X23 D;  5GT3 C;  3X1V A;  1P3K A;  3REJ B;  4JJN D;  5CPJ D;  3REK C;  5B40 B;  5AV5 A;  3MGP B;  1P3F A;  1P3O D;  4LD9 D;  2BYM B;  3LEL C;  4Z2M G;  1P3A B;  5B0Z C;  3REI A;  3AZM C;  1P3G D;  1P3L C;  1N1J A;  5AY8 B;  4CAY A;  4G92 B;  3TU4 C;  5B1M A;  1Q9C A;  1HTA A;  5B2J D;  4XUJ B;  3VH5 T;  5CPK D;  3W97 D;  1WWI A;  1P3B C;  1TAF A;  5BNX A;  3KUY D;  2FJ7 C;  3AZN A;  3AV1 A;  1U35 A;  3X1T D;  4KUD C;  3A6N B;  4R8P A;  5JA4 A;  1TZY C;  4NE5 A;  3MGQ C;  1JFI A;  5B32 G;  2ARO C;  4QLC A;  4J8U A;  5B1L D;  4J8W B;  5CPI A;  4H9R B;  3UT9 C;  1ULY A;  4J8X B;  4YS3 D;  1ID3 C;  3MGS B;  3O62 D;  3AFA B;  3UTA B;  3AZE C;  3AN2 D;  3B6F A;  1HQ3 C;  3W98 B;  3AYW D;  1M19 B;  3X1V D;  1KX3 C;  4H9Q A;  4WU9 B;  5FUG A;  4WU8 B;  2YFW A;  1H3O A;  5B31 G;  5AV5 D;  1P3F D;  4EO5 B;  5B0Y B;  4NFT A;  4H9N A;  4E45 A;  4AWL C;  3WA9 C;  3REI D;  3AZL C;  3W96 D;  1P3M A;  5JRG D;  5B1M D;  3X1U B;  5B33 C;  2F8N K;  5AVC A;  3X1S B;  4Z66 C;  1P3K C;  5GT0 D;  4G91 C;  1BH8 B;  5AV6 C;  3AV1 D;  1U35 D;  3WTP B;  3LZ1 B;  2F8N D;  3WKJ B;  2NQB C;  4J8W C;  5DNN B;  3MVD A;  1F66 A;  1P3P C;  3NQU A;  2BYK B;  2IO5 C;  5CHL B;  4J8X C;  5AV8 C;  3REK A;  3MGS C;  5CPI D;  3REL B;  4Z5T B;  4YM6 D;  5B0Z A;  1KX4 B;  3AZN C;  3AZM A;  1M19 C;  1P3L A;  4KHA A;  3B6F D;  1BFM A;  3TU4 A;  4E44 A;  3W99 B;  1AOI B;  4WU8 C;  4R8P C;  3B0D C;  3MNN B;  5BNV B;  1BH9 B;  5B32 B;  4XZQ B;  5DNM B;  3AZK B;  1P3B A;  4J8U C;  1S32 D;  4QLC C;  5GSU B;  4KUD A;  3REH B;  1TZY A;  3MGQ A;  2ARO A;  3NQJ A;  3UTB B;  1ZLA B;  1P3M D;  3UT9 A;  3LJA B;  4H9O A;  3AZG B;  4J8V C;  5AVC D;  2HIO B;  5GXQ D;  5B31 B;  5BO0 A;  5AV9 B;  3AZF A;  1ID3 A;  4WNN B;  2YFV A;  3AZH C;  2F8N H;  1M1A C;  3AZE A;  3AV2 B;  5B40 A;  3MGP A;  3MVD D;  2BYM A;  1F66 D;  3REL C;  5GT3 D;  2CV5 B;  1KX3 A;  4UUZ B;  5CP6 B;  3VH6 W;  5C3I B;  1EQZ C;  3REK D;  3LZ0 B;  1P3I B;  4ZBJ C;  3LEL D;  5AVB D;  3WAA B;  5BT1 C;  3WA9 A;  5B0Z D;  3C1C B;  3AZM D;  4ZUX B;  1P3L D;  3C1B D;  3AZL A;  3TU4 D;  5B33 A;  4Z66 A;  3KWQ B;  4X23 B;  1P3B D;  1KX5 C;  2FJ7 D;  5AV6 A;  5E5A C;  4JJN B;  1P3O B;  4KUD D;  3VH5 W;  4LD9 B;  4CSR B;  3B6G C;  3UTB C;  2NQB A;  4M6B A;  4J8W A;  1TZY D;  3MGQ D;  1P3P A;  2F8N G;  1P3G B;  3R45 B;  2HIO C;  2ARO D;  4J8X A;  5AV9 C;  5AV8 A;  3MGS A;  3UTA A;  3V9R B;  3UT9 D;  5B2J B;  3W97 B;  3W98 A;  5CPK B;  3KUY B;  1M19 A;  1ID3 D;  3X1T B;  4WU9 A;  3AZE D;  1HQ3 D;  3MGR C;  4WU8 A;  5F99 C;  3LZ0 C;  1P3I C;  1KX3 D;  3KXB B;  1M18 C;  5B2I C;  2NZD C;  3AZF C;  4YS3 B;  3WA9 D;  3O62 B;  3AN2 B;  1BH8 A;  5B24 B;  3AZL D;  3AYW B;  3REJ C;  3WTP A;  3LZ1 A;  3MGP C;  5B40 C;  4J8V A;  5B33 D;  1P3A C;  1KU5 A;  1P3K D;  4Z66 D;  3X1V B;  3AZJ B;  5DNN A;  5AV6 D;  2BYK A;  3AZH A;  1M1A A;  5AY8 C;  5AV5 B;  1P3F B;  4G92 C;  2NQB D;  4J8W D;  4XUJ C;  1P3P D;  2PYO B;  4HGA B;  3REL A;  3REI B;  3B0C T;  3VH6 A;  1N1J B;  4J8X D;  4CAY B;  1EQZ A;  5AV8 D;  3W96 B;  3MGS D;  5JRG B;  3X1T C;  5B1M B;  3A6N C;  5GT0 B;  3AZN D;  1P34 B;  3AV1 B;  1U35 B;  3KXB C;  2F8N B;  4NE6 A;  4WU8 D;  4R8P D;  5JA4 B;  3REH A;  1KX5 A;  1JFI B;  4J8U D;  4QLC D;  5E5A A;  3VH5 A;  3AFA C;  3UTA C;  5CPI B;  3B6G A;  4NE3 A;  5B24 C;  3UTB A;  3W98 C;  1B6W A;  4YM6 B;  3AZI B;  4WU9 C;  2HIO A;  3AZJ C;  5B31 A;  3B6F B;  5BS7 A;  5AV9 A;  4WNN A;  4EO5 C;  4J8V D;  5B0Y C;  4KGC B;  4H9Q B;  1S32 B;  2PYO C;  2RVQ C;  5KDM A;  3AZH D;  1M1A D;  4H9S C;  4UUZ A;  3MGR A;  3W96 C;  5F99 A;  3LZ0 A;  1P3I A;  3X1U C;  3X1S C;  3REL D;  3C1C A;  1R4V A;  1P34 C;  1EQZ D;  3WTP C;  4ZUX A;  3LZ1 C;  1P3M B;  1M18 A;  2L5A A;  3WKJ C;  5B2I A;  2NZD A;  5AVC B;  5GXQ B;  5BT1 D;  5DNN C;  4H9P B;  3REJ A;  5G49 B;  4JJN A;  3B0B A;  4LD9 A;  1P3A A;  3MVD B;  1F66 B;  3NQU B;  5GT3 B;  4Z5T C;  4DRA A;  1KX5 D;  1KX4 C;  5E5A D;  3AZI C;  3REK B;  3R45 A;  5AY8 A;  3B6G D;  3W99 C;  3LEL B;  1AOI C;  1B67 A;  5AVB B;  5B32 C;  3MNN C;  4XUJ A;  4XZQ C;  5DNM C;  3AZK C;  5B0Z B;  5CPK A;  3AZM B;  4KGC C;  2HIO D;  4KHA B;  1S32 C;  3C1B B;  5GSU C;  3TU4 B;  3X1T A;  3REH C;  3A6N A;  1P3B B;  2FJ7 B;  5CPJ B;  3KXB A;  4KUD B;  3MGR D;  1ZLA C;  4H9R A;  4WZS B;  1TZY B;  5F99 D;  3LZ0 D;  3LJA C;  3AZG C;  1P3I D;  5B31 C;  2ARO B;  5BS7 C;  3NQJ B;  1A7W A;  3AFA A;  3UT9 B;  1M18 D;  5B24 A;  4H9O B;  5B2I D;  3AYW A;  3AV2 C;  2NZD D;  3VH6 T;  3AZF D;  2CV5 C;  1ID3 B;  2YFV B;  3AZJ A;  3AZE B;  2JSS A;  1HQ3 B;  5CP6 C;  3REJ D;  5C3I C;  5B40 D;  3MGP D;  5B0Y A;  1P3A D;  1F1E A;  1KX3 B;  3WAA C;  5AVB C;  5B1L B;  3C1C C;  2PYO A;  4H9S A;  4ZUX C;  5AY8 D;  4WV4 B;  3C1B C;  3W96 A;  5JRG A;  4XUJ D;  3X1U A;  4AWL B;  3WA9 B;  3X1S A;  3KWQ C;  4X23 C; 
#chains in the Genus database with same CATH topology
 5GT0 A;  3AZL B;  1P34 A;  4JJN C;  5CPJ C;  1P3O C;  4LD9 C;  2F8N A;  3WKJ A;  5B33 B;  3A6N D;  3B0C W;  1P3K B;  4Z66 B;  4G91 B;  5AV6 B;  2XD5 A;  2Y2K A;  1P3G C;  2G5H C;  3KXB D;  2BG1 A;  2NQB B;  5B2J C;  3W97 C;  1P3P B;  5CPK C;  2IO5 B;  4Z5T A;  3KUY C;  1KX4 A;  4YM6 A;  3AZI A;  5AV8 B;  3AFA D;  3UTA D;  3W99 A;  5B24 D;  3W98 D;  1AOI A;  1TAF B;  5BNX B;  1BH9 A;  5BNV A;  5B32 A;  3MNN A;  4XZQ A;  5DNM A;  3AZK A;  1M19 D;  3AZN B;  4KGC A;  4WU9 D;  3AZJ D;  1S32 A;  2ZY2 A;  5GSU A;  5B1L C;  2ZM5 A;  4R8P B;  3B0D B;  2XD1 A;  5B0Y D;  4J8U B;  2CWE A;  4QLC B;  4YS3 C;  2PYO D;  2RVQ D;  3O62 C;  3AN2 C;  2ZY4 A;  1ZLA A;  3AYW C;  2LY8 A;  3LJA A;  4DRB A;  3AZG A;  3X1U D;  3X1S D;  3X1V C;  5GXQ A;  4H9P A;  1P34 D;  3WTP D;  3LZ1 D;  3KFU G;  5AV5 C;  1P3F C;  3WKJ D;  4J8V B;  3AV2 A;  5G49 A;  5FUG B;  5DNN D;  4HGA C;  2CV5 A;  2YFW B;  3REI C;  1H3O B;  5GT3 A;  3AZH B;  1M1A B;  5CP6 A;  2JCH A;  4H9N B;  5JRG C;  5B1M C;  3LEL A;  4Z5T D;  3WAA A;  5GT0 C;  5AVB A;  1KX4 D;  3AZI D;  3AV1 C;  1U35 C;  1EQZ B;  2HUE B;  1WWS A;  3W99 D;  3C1B A;  4ZBJ B;  1AOI D;  3MNN D;  5B32 D;  5DNM D;  4XZQ D;  3AZK D;  3KWQ A;  4X23 A;  4KGC D;  2FJ7 A;  5GSU D;  1P3O A;  5CPJ A;  5CPI C;  4CSR A;  3REH D;  2Y2H A;  3WTP E;  1KX5 B;  4DQY B;  4YM6 C;  5E5A B;  1P3G A;  3UTB D;  3KSY A;  3B6G B;  3B6F C;  1ZLA D;  3V9R A;  3LJA D;  5B2J A;  3H0R C;  3W97 A;  3AZG D;  3KUY A;  1P3L B;  4Z2M H;  5B31 D;  5AV9 D;  2FFF B;  1HQ3 A;  3AV2 D;  2CV5 D;  5KDM B;  5B1L A;  5CP6 D;  3MGR B;  1P3M C;  5F99 B;  3MGQ B;  2HUE C;  5AVC C;  3WAA D;  5GXQ C;  4YS3 A;  3C1C D;  3O62 A;  4ZUX D;  3AN2 A;  1M18 B;  5B2I B;  2NZD B;  5BO0 B;  1Z2C B;  3MVD C;  3AZF B;  1F66 C;  3KWQ D;  4X23 D;  5GT3 C;  3X1V A;  1P3K A;  3REJ B;  4JJN D;  5CPJ D;  3REK C;  5B40 B;  5AV5 A;  3MGP B;  1P3F A;  1P3O D;  4LD9 D;  2BYM B;  2DQN C;  4Z2M G;  3LEL C;  1P3A B;  5B0Z C;  3REI A;  3AZM C;  1P3G D;  1P3L C;  1N1J A;  5AY8 B;  2Y2O A;  3F6T A;  4CAY A;  4G92 B;  3TU4 C;  5B1M A;  3EPL A;  1Q9C A;  1HTA A;  5B2J D;  4XUJ B;  3VH5 T;  5CPK D;  3W97 D;  1WWI A;  1P3B C;  1TAF A;  5BNX A;  3KUY D;  2FJ7 C;  3AZN A;  3AV1 A;  1U35 A;  2Y2Q A;  3X1T D;  4KUD C;  3A6N B;  4R8P A;  5JA4 A;  1TZY C;  4NE5 A;  3MGQ C;  1JFI A;  2VQR A;  5B32 G;  2ARO C;  4QLC A;  4J8U A;  5B1L D;  4J8W B;  5CPI A;  4H9R B;  3UT9 C;  1ULY A;  4J8X B;  4YS3 D;  1ID3 C;  3MGS B;  3O62 D;  3AFA B;  3UTA B;  3AZE C;  3AN2 D;  3B6F A;  1HQ3 C;  3W98 B;  3AYW D;  1M19 B;  3X1V D;  1KX3 C;  4H9Q A;  4WU9 B;  5FUG A;  3A1I A;  4WJ3 C;  4WU8 B;  2YFW A;  1H3O A;  1W2E A;  5B31 G;  5AV5 D;  1P3F D;  4EO5 B;  5B0Y B;  4NFT A;  4H9N A;  4E45 A;  2ZY3 A;  4AWL C;  3WA9 C;  3REI D;  3AZL C;  3W96 D;  3EPH A;  1P3M A;  5JRG D;  5B1M D;  3X1U B;  5B33 C;  2F8N K;  5AVC A;  3X1S B;  4Z66 C;  1P3K C;  5GT0 D;  4G91 C;  1BH8 B;  5AV6 C;  3AV1 D;  1U35 D;  3WTP B;  2Y2J A;  3LZ1 B;  2F8N D;  3WKJ B;  2NQB C;  4J8W C;  5DNN B;  3MVD A;  1F66 A;  1P3P C;  3NQU A;  2BYK B;  2IO5 C;  5CHL B;  4J8X C;  5AV8 C;  3REK A;  3MGS C;  5CPI D;  3REL B;  4Z5T B;  4YM6 D;  5B0Z A;  1KX4 B;  3AZN C;  3AZM A;  1M19 C;  1P3L A;  4KHA A;  3B6F D;  1BFM A;  3TU4 A;  4E44 A;  3W99 B;  1AOI B;  4WU8 C;  3P5J B;  4R8P C;  3B0D C;  3MNN B;  5BNV B;  1BH9 B;  5B32 B;  4XZQ B;  5DNM B;  3AZK B;  1P3B A;  4J8U C;  1S32 D;  4QLC C;  5GSU B;  4KUD A;  3REH B;  1TZY A;  3MGQ A;  2ARO A;  3NQJ A;  3UTB B;  1ZLA B;  1P3M D;  3UT9 A;  3LJA B;  2JE5 A;  4H9O A;  3AZG B;  4J8V C;  5AVC D;  2HIO B;  5GXQ D;  5B31 B;  5BO0 A;  5AV9 B;  3AZF A;  1ID3 A;  4WNN B;  2YFV A;  3AZH C;  2F8N H;  1M1A C;  3AZE A;  3AV2 B;  5B40 A;  3H0M C;  2UWX A;  3MGP A;  3MVD D;  2BYM A;  1F66 D;  3REL C;  5GT3 D;  2CV5 B;  1KX3 A;  4UUZ B;  5CP6 B;  3VH6 W;  5C3I B;  1EQZ C;  3REK D;  3LZ0 B;  1P3I B;  4ZBJ C;  3LEL D;  5AVB D;  3WAA B;  5BT1 C;  3WA9 A;  5B0Z D;  3C1C B;  3AZM D;  4ZUX B;  1P3L D;  3C1B D;  3AZL A;  3TU4 D;  3H0L C;  5B33 A;  4Z66 A;  3KWQ B;  4X23 B;  1P3B D;  1KX5 C;  2FJ7 D;  5AV6 A;  5E5A C;  4JJN B;  1P3O B;  4KUD D;  3VH5 W;  4LD9 B;  4CSR B;  3B6G C;  3UTB C;  2NQB A;  4M6B A;  4J8W A;  1TZY D;  3MGQ D;  1P3P A;  2F8N G;  1P3G B;  3R45 B;  2HIO C;  2ARO D;  4J8X A;  5AV9 C;  5AV8 A;  3MGS A;  3UTA A;  3V9R B;  3UT9 D;  5B2J B;  3W97 B;  3W98 A;  5CPK B;  3KUY B;  1M19 A;  2Y2N A;  1ID3 D;  3X1T B;  4WU9 A;  3AZE D;  1HQ3 D;  3MGR C;  3IP4 C;  4WU8 A;  5F99 C;  3LZ0 C;  1P3I C;  1KX3 D;  3KXB B;  1M18 C;  5B2I C;  2NZD C;  3AZF C;  4YS3 B;  3WA9 D;  3O62 B;  3AN2 B;  1BH8 A;  5B24 B;  3AZL D;  3AYW B;  3REJ C;  2ZY5 A;  3WTP A;  3LZ1 A;  3MGP C;  5B40 C;  4J8V A;  5B33 D;  1P3A C;  1KU5 A;  1P3K D;  4Z66 D;  3X1V B;  3AZJ B;  5DNN A;  5AV6 D;  2BYK A;  2Y2M A;  3AZH A;  1M1A A;  5AY8 C;  5AV5 B;  1P3F B;  4G92 C;  2NQB D;  4J8W D;  4XUJ C;  1P3P D;  2PYO B;  4HGA B;  3REL A;  3REI B;  3B0C T;  3VH6 A;  1N1J B;  4J8X D;  4CAY B;  1EQZ A;  5AV8 D;  3W96 B;  3MGS D;  5JRG B;  3X1T C;  5B1M B;  3A6N C;  5GT0 B;  3AZN D;  1P34 B;  2DF4 C;  3AV1 B;  1U35 B;  3KXB C;  2F8N B;  2Y2I A;  4NE6 A;  4WU8 D;  4R8P D;  5JA4 B;  3REH A;  2RIQ A;  1KX5 A;  1JFI B;  3EPJ A;  4J8U D;  4QLC D;  5E5A A;  3VH5 A;  3AFA C;  3UTA C;  5CPI B;  3B6G A;  4NE3 A;  5B24 C;  3UTB A;  3W98 C;  1B6W A;  4YM6 B;  3AZI B;  4WU9 C;  2HIO A;  3AZJ C;  5B31 A;  3B6F B;  5BS7 A;  5AV9 A;  4WNN A;  2Y2P A;  4EO5 C;  4J8V D;  5B0Y C;  4KGC B;  4H9Q B;  1S32 B;  2PYO C;  2RVQ C;  5KDM A;  3AZH D;  1M1A D;  4H9S C;  4UUZ A;  3MGR A;  2W8S A;  3W96 C;  5F99 A;  3LZ0 A;  1P3I A;  3X1U C;  1T3U A;  3X1S C;  3REL D;  3C1C A;  1R4V A;  1P34 C;  1EQZ D;  3WTP C;  4ZUX A;  3LZ1 C;  1P3M B;  1M18 A;  2L5A A;  3WKJ C;  5B2I A;  2NZD A;  5AVC B;  5GXQ B;  5BT1 D;  5DNN C;  2Y2G A;  4UPK A;  4H9P B;  3REJ A;  5G49 B;  4JJN A;  3B0B A;  4LD9 A;  1P3A A;  3MVD B;  2Y2L A;  1F66 B;  3NQU B;  5GT3 B;  4Z5T C;  4DRA A;  1KX5 D;  1KX4 C;  5E5A D;  3AZI C;  3REK B;  3R45 A;  5AY8 A;  3B6G D;  3W99 C;  3LEL B;  1AOI C;  1B67 A;  5AVB B;  5B32 C;  3MNN C;  4XUJ A;  4XZQ C;  5DNM C;  3AZK C;  5B0Z B;  5CPK A;  3AZM B;  4KGC C;  2HIO D;  4KHA B;  1S32 C;  3C1B B;  5GSU C;  3TU4 B;  3X1T A;  3REH C;  3A6N A;  1PZR A;  1P3B B;  2FJ7 B;  5CPJ B;  3KXB A;  2F2A C;  4KUD B;  3MGR D;  1ZLA C;  4H9R A;  4WZS B;  1TZY B;  5F99 D;  3LZ0 D;  3LJA C;  3AZG C;  1P3I D;  5B31 C;  2ARO B;  5BS7 C;  3NQJ B;  2G5I C;  1A7W A;  3AFA A;  3UT9 B;  3EPK A;  5B24 A;  1M18 D;  4H9O B;  5B2I D;  3AYW A;  3AV2 C;  2NZD D;  3VH6 T;  3AZF D;  2CV5 C;  1ID3 B;  2YFV B;  3FDD A;  3AZJ A;  3A1K A;  3AZE B;  2JSS A;  1HQ3 B;  5CP6 C;  3REJ D;  5C3I C;  5B40 D;  3MGP D;  5B0Y A;  1P3A D;  1F1E A;  1KX3 B;  3AL0 C;  3WAA C;  3EG5 B;  2J8P A;  5AVB C;  5B1L B;  3C1C C;  2PYO A;  4H9S A;  4ZUX C;  5AY8 D;  4WV4 B;  3C1B C;  3W96 A;  5JRG A;  4XUJ D;  3X1U A;  4AWL B;  3WA9 B;  3X1S A;  3KWQ C;  4X23 C; 
#chains in the Genus database with same CATH homology
 5GT0 A;  3AZL B;  1P34 A;  4JJN C;  5CPJ C;  1P3O C;  4LD9 C;  2F8N A;  3WKJ A;  5B33 B;  3A6N D;  3B0C W;  1P3K B;  4Z66 B;  4G91 B;  5AV6 B;  2XD5 A;  2Y2K A;  1P3G C;  2G5H C;  3KXB D;  2BG1 A;  2NQB B;  5B2J C;  3W97 C;  1P3P B;  5CPK C;  2IO5 B;  4Z5T A;  3KUY C;  1KX4 A;  4YM6 A;  3AZI A;  5AV8 B;  3AFA D;  3UTA D;  3W99 A;  5B24 D;  3W98 D;  1AOI A;  1TAF B;  5BNX B;  1BH9 A;  5BNV A;  5B32 A;  3MNN A;  4XZQ A;  5DNM A;  3AZK A;  1M19 D;  3AZN B;  4KGC A;  4WU9 D;  3AZJ D;  1S32 A;  2ZY2 A;  5GSU A;  5B1L C;  2ZM5 A;  4R8P B;  3B0D B;  2XD1 A;  5B0Y D;  4J8U B;  2CWE A;  4QLC B;  4YS3 C;  2PYO D;  2RVQ D;  3O62 C;  3AN2 C;  2ZY4 A;  1ZLA A;  3AYW C;  2LY8 A;  3LJA A;  4DRB A;  3AZG A;  3X1U D;  3X1S D;  3X1V C;  5GXQ A;  4H9P A;  1P34 D;  3WTP D;  3LZ1 D;  3KFU G;  5AV5 C;  1P3F C;  3WKJ D;  4J8V B;  3AV2 A;  5G49 A;  5FUG B;  5DNN D;  4HGA C;  2CV5 A;  2YFW B;  3REI C;  1H3O B;  5GT3 A;  3AZH B;  1M1A B;  5CP6 A;  2JCH A;  4H9N B;  5JRG C;  5B1M C;  3LEL A;  4Z5T D;  3WAA A;  5GT0 C;  5AVB A;  1KX4 D;  3AZI D;  3AV1 C;  1U35 C;  1EQZ B;  2HUE B;  1WWS A;  3W99 D;  3C1B A;  4ZBJ B;  1AOI D;  3MNN D;  5B32 D;  5DNM D;  4XZQ D;  3AZK D;  3KWQ A;  4X23 A;  4KGC D;  2FJ7 A;  5GSU D;  1P3O A;  5CPJ A;  5CPI C;  4CSR A;  3REH D;  2Y2H A;  3WTP E;  1KX5 B;  4DQY B;  4YM6 C;  5E5A B;  1P3G A;  3UTB D;  3KSY A;  3B6G B;  3B6F C;  1ZLA D;  3V9R A;  3LJA D;  5B2J A;  3H0R C;  3W97 A;  3AZG D;  3KUY A;  1P3L B;  4Z2M H;  5B31 D;  5AV9 D;  2FFF B;  1HQ3 A;  3AV2 D;  2CV5 D;  5KDM B;  5B1L A;  5CP6 D;  3MGR B;  1P3M C;  5F99 B;  3MGQ B;  2HUE C;  5AVC C;  3WAA D;  5GXQ C;  4YS3 A;  3C1C D;  3O62 A;  4ZUX D;  3AN2 A;  1M18 B;  5B2I B;  2NZD B;  5BO0 B;  1Z2C B;  3MVD C;  3AZF B;  1F66 C;  3KWQ D;  4X23 D;  5GT3 C;  3X1V A;  1P3K A;  3REJ B;  4JJN D;  5CPJ D;  3REK C;  5B40 B;  5AV5 A;  3MGP B;  1P3F A;  1P3O D;  4LD9 D;  2BYM B;  2DQN C;  4Z2M G;  3LEL C;  1P3A B;  5B0Z C;  3REI A;  3AZM C;  1P3G D;  1P3L C;  1N1J A;  5AY8 B;  2Y2O A;  3F6T A;  4CAY A;  4G92 B;  3TU4 C;  5B1M A;  3EPL A;  1Q9C A;  1HTA A;  5B2J D;  4XUJ B;  3VH5 T;  5CPK D;  3W97 D;  1WWI A;  1P3B C;  1TAF A;  5BNX A;  3KUY D;  2FJ7 C;  3AZN A;  3AV1 A;  1U35 A;  2Y2Q A;  3X1T D;  4KUD C;  3A6N B;  4R8P A;  5JA4 A;  1TZY C;  4NE5 A;  3MGQ C;  1JFI A;  2VQR A;  5B32 G;  2ARO C;  4QLC A;  4J8U A;  5B1L D;  4J8W B;  5CPI A;  4H9R B;  3UT9 C;  1ULY A;  4J8X B;  4YS3 D;  1ID3 C;  3MGS B;  3O62 D;  3AFA B;  3UTA B;  3AZE C;  3AN2 D;  3B6F A;  1HQ3 C;  3W98 B;  3AYW D;  1M19 B;  3X1V D;  1KX3 C;  4H9Q A;  4WU9 B;  5FUG A;  3A1I A;  4WJ3 C;  4WU8 B;  2YFW A;  1H3O A;  1W2E A;  5B31 G;  5AV5 D;  1P3F D;  4EO5 B;  5B0Y B;  4NFT A;  4H9N A;  4E45 A;  2ZY3 A;  4AWL C;  3WA9 C;  3REI D;  3AZL C;  3W96 D;  3EPH A;  1P3M A;  5JRG D;  5B1M D;  3X1U B;  5B33 C;  2F8N K;  5AVC A;  3X1S B;  4Z66 C;  1P3K C;  5GT0 D;  4G91 C;  1BH8 B;  5AV6 C;  3AV1 D;  1U35 D;  3WTP B;  2Y2J A;  3LZ1 B;  2F8N D;  3WKJ B;  2NQB C;  4J8W C;  5DNN B;  3MVD A;  1F66 A;  1P3P C;  3NQU A;  2BYK B;  2IO5 C;  5CHL B;  4J8X C;  5AV8 C;  3REK A;  3MGS C;  5CPI D;  3REL B;  4Z5T B;  4YM6 D;  5B0Z A;  1KX4 B;  3AZN C;  3AZM A;  1M19 C;  1P3L A;  4KHA A;  3B6F D;  1BFM A;  3TU4 A;  4E44 A;  3W99 B;  1AOI B;  4WU8 C;  3P5J B;  4R8P C;  3B0D C;  3MNN B;  5BNV B;  1BH9 B;  5B32 B;  4XZQ B;  5DNM B;  3AZK B;  1P3B A;  4J8U C;  1S32 D;  4QLC C;  5GSU B;  4KUD A;  3REH B;  1TZY A;  3MGQ A;  2ARO A;  3NQJ A;  3UTB B;  1ZLA B;  1P3M D;  3UT9 A;  3LJA B;  2JE5 A;  4H9O A;  3AZG B;  4J8V C;  5AVC D;  2HIO B;  5GXQ D;  5B31 B;  5BO0 A;  5AV9 B;  3AZF A;  1ID3 A;  4WNN B;  2YFV A;  3AZH C;  2F8N H;  1M1A C;  3AZE A;  3AV2 B;  5B40 A;  3H0M C;  2UWX A;  3MGP A;  3MVD D;  2BYM A;  1F66 D;  3REL C;  5GT3 D;  2CV5 B;  1KX3 A;  4UUZ B;  5CP6 B;  3VH6 W;  5C3I B;  1EQZ C;  3REK D;  3LZ0 B;  1P3I B;  4ZBJ C;  3LEL D;  5AVB D;  3WAA B;  5BT1 C;  3WA9 A;  5B0Z D;  3C1C B;  3AZM D;  4ZUX B;  1P3L D;  3C1B D;  3AZL A;  3TU4 D;  3H0L C;  5B33 A;  4Z66 A;  3KWQ B;  4X23 B;  1P3B D;  1KX5 C;  2FJ7 D;  5AV6 A;  5E5A C;  4JJN B;  1P3O B;  4KUD D;  3VH5 W;  4LD9 B;  4CSR B;  3B6G C;  3UTB C;  2NQB A;  4M6B A;  4J8W A;  1TZY D;  3MGQ D;  1P3P A;  2F8N G;  1P3G B;  3R45 B;  2HIO C;  2ARO D;  4J8X A;  5AV9 C;  5AV8 A;  3MGS A;  3UTA A;  3V9R B;  3UT9 D;  5B2J B;  3W97 B;  3W98 A;  5CPK B;  3KUY B;  1M19 A;  2Y2N A;  1ID3 D;  3X1T B;  4WU9 A;  3AZE D;  1HQ3 D;  3MGR C;  3IP4 C;  4WU8 A;  5F99 C;  3LZ0 C;  1P3I C;  1KX3 D;  3KXB B;  1M18 C;  5B2I C;  2NZD C;  3AZF C;  4YS3 B;  3WA9 D;  3O62 B;  3AN2 B;  1BH8 A;  5B24 B;  3AZL D;  3AYW B;  3REJ C;  2ZY5 A;  3WTP A;  3LZ1 A;  3MGP C;  5B40 C;  4J8V A;  5B33 D;  1P3A C;  1KU5 A;  1P3K D;  4Z66 D;  3X1V B;  3AZJ B;  5DNN A;  5AV6 D;  2BYK A;  2Y2M A;  3AZH A;  1M1A A;  5AY8 C;  5AV5 B;  1P3F B;  4G92 C;  2NQB D;  4J8W D;  4XUJ C;  1P3P D;  2PYO B;  4HGA B;  3REL A;  3REI B;  3B0C T;  3VH6 A;  1N1J B;  4J8X D;  4CAY B;  1EQZ A;  5AV8 D;  3W96 B;  3MGS D;  5JRG B;  3X1T C;  5B1M B;  3A6N C;  5GT0 B;  3AZN D;  1P34 B;  2DF4 C;  3AV1 B;  1U35 B;  3KXB C;  2F8N B;  2Y2I A;  4NE6 A;  4WU8 D;  4R8P D;  5JA4 B;  3REH A;  2RIQ A;  1KX5 A;  1JFI B;  3EPJ A;  4J8U D;  4QLC D;  5E5A A;  3VH5 A;  3AFA C;  3UTA C;  5CPI B;  3B6G A;  4NE3 A;  5B24 C;  3UTB A;  3W98 C;  1B6W A;  4YM6 B;  3AZI B;  4WU9 C;  2HIO A;  3AZJ C;  5B31 A;  3B6F B;  5BS7 A;  5AV9 A;  4WNN A;  2Y2P A;  4EO5 C;  4J8V D;  5B0Y C;  4KGC B;  4H9Q B;  1S32 B;  2PYO C;  2RVQ C;  5KDM A;  3AZH D;  1M1A D;  4H9S C;  4UUZ A;  3MGR A;  2W8S A;  3W96 C;  5F99 A;  3LZ0 A;  1P3I A;  3X1U C;  1T3U A;  3X1S C;  3REL D;  3C1C A;  1R4V A;  1P34 C;  1EQZ D;  3WTP C;  4ZUX A;  3LZ1 C;  1P3M B;  1M18 A;  2L5A A;  3WKJ C;  5B2I A;  2NZD A;  5AVC B;  5GXQ B;  5BT1 D;  5DNN C;  2Y2G A;  4UPK A;  4H9P B;  3REJ A;  5G49 B;  4JJN A;  3B0B A;  4LD9 A;  1P3A A;  3MVD B;  2Y2L A;  1F66 B;  3NQU B;  5GT3 B;  4Z5T C;  4DRA A;  1KX5 D;  1KX4 C;  5E5A D;  3AZI C;  3REK B;  3R45 A;  5AY8 A;  3B6G D;  3W99 C;  3LEL B;  1AOI C;  1B67 A;  5AVB B;  5B32 C;  3MNN C;  4XUJ A;  4XZQ C;  5DNM C;  3AZK C;  5B0Z B;  5CPK A;  3AZM B;  4KGC C;  2HIO D;  4KHA B;  1S32 C;  3C1B B;  5GSU C;  3TU4 B;  3X1T A;  3REH C;  3A6N A;  1PZR A;  1P3B B;  2FJ7 B;  5CPJ B;  3KXB A;  2F2A C;  4KUD B;  3MGR D;  1ZLA C;  4H9R A;  4WZS B;  1TZY B;  5F99 D;  3LZ0 D;  3LJA C;  3AZG C;  1P3I D;  5B31 C;  2ARO B;  5BS7 C;  3NQJ B;  2G5I C;  1A7W A;  3AFA A;  3UT9 B;  3EPK A;  5B24 A;  1M18 D;  4H9O B;  5B2I D;  3AYW A;  3AV2 C;  2NZD D;  3VH6 T;  3AZF D;  2CV5 C;  1ID3 B;  2YFV B;  3FDD A;  3AZJ A;  3A1K A;  3AZE B;  2JSS A;  1HQ3 B;  5CP6 C;  3REJ D;  5C3I C;  5B40 D;  3MGP D;  5B0Y A;  1P3A D;  1F1E A;  1KX3 B;  3AL0 C;  3WAA C;  3EG5 B;  2J8P A;  5AVB C;  5B1L B;  3C1C C;  2PYO A;  4H9S A;  4ZUX C;  5AY8 D;  4WV4 B;  3C1B C;  3W96 A;  5JRG A;  4XUJ D;  3X1U A;  4AWL B;  3WA9 B;  3X1S A;  3KWQ C;  4X23 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...