1S35A

Crystal structure of repeats 8 and 9 of human erythroid spectrin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
211
structure length
211
Chain Sequence
EQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWDALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spectrin beta chain, erythrocyte
publication title Structural insights into the stability and flexibility of unusual erythroid spectrin repeats
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 97
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s35A02
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s35A01
3UUMA 1WLXA 3UULA 3PE0A 1OWAA 1S35A 3FB2A 1U5PA 3EDVA 3LBXB 3UUNA 2ODUA 1QUUA 1HCIA 3LBXA 2SPCA 1CUNA 1U4QA 2ODVA 3F31A 1AJ3A
chains in the Genus database with same CATH superfamily
1VRBA 2VASA 5J1GA 3MZKB 4B3ST 3ZT5A 4V1Av 3LDQB 3ZYMA 2XM2A 1SA0E 5HCMA 2IW5B 4KHZF 1J1JA 3Q2MA 2W00A 2V5DA 2FJEA 1X9BA 3QK6A 4YHHT 5FXWA 3CPZA 4I0UA 5L3GB 1MMAA 1WLXA 3A8YC 2VL0A 1GQEA 4YSZA 3O1HA 2XSAA 2G0UA 1KNZA 3AEGA 4YY3T 2CBIA 4JEHB 4MLKA 2VURA 3C4ZA 3P7IA 5J0ZA 2LSJA 4ZOLE 2X9HA 4JI4T 3ZKRA 2Q9QD 3P8CD 4YFSA 3T1YT 5IWAT 2XM1A 1T72A 4KI0F 5ADXL 3J7Yq 3C98B 2WS3A 2LSIA 2IMLA 2FUPA 2MOZA 4YT0A 1EZ3A 3V5SA 1ZOYA 4LMJA 4IE5A 3ZCJA 4IDZA 3IHRA 4IE6A 4OHFA 2J47A 3FHNA 3LJCA 3P4RA 2Y48B 4EXTA 5CFBA 2LT3A 3FZFB 4TNWA 2VQFT 2UU9T 4HWFA 2I59A 5AQLB 5C2TA 1IJ5A 5M4YA 5JDFA 3GN5B 4ISTA 3FB2A 2AXDS 4DR3T 3MK7C 5CA0E 1BR2A 4ANJA 2Q9QB 2UUAT 4IDNA 3H3MA 4F6RC 1MIVA 2XSBA 3TLTA 4B3TT 4BA9A 1N36T 3ZYKA 3U3IA 3RKGA 4U2ZA 3RIAA 4TZ4C 3Q5EA 1LVFA 3NZQA 4JUYA 5DABA 2VQET 1LVKA 3SRZA 4KP3C 3KVAA 5EK4A 5ABEA 5CA1E 3I9YA 1HS7A 2YN6A 2MYSA 4A5XA 3ZEFB 3ZPOA 3C4WA 2HPJA 4GKKT 4JV5T 1N33T 1V9DA 2W66A 3FZHB 3NZPA 5JDLA 5AQFB 3AE4A 2KZ7B 3QB5A 4HWIB 3LG7A 3ZMTB 2PFVA 2W0GA 4H9QC 1YQ3A 3LBXA 4PK4A 4QX8B 4UV8B 4PJLA 2SPCA 1KNRA 5FL0A 4ZI3C 3HA4A 2I0MA 4P1NA 3PJAA 2YU2A 3H37A 2WZIA 2J4GA 1MIYA 3ZT7A 2LM9A 4TWFA 3CQXC 1QLBA 4EIWA 2HN1A 3MA9A 2LM2A 3M65A 2L8KA 2WB5A 2XHEB 3AECA 2NR4A 1ZV4X 4UIGA 4EGWA 2CM0A 2WDVA 2D0TA 3D0TA 2XASB 3O4XE 2XJ7A 3HKCE 5HXHA 2LSYA 4LMLA 3AEDA 2BKOA 4KHPT 3AE6A 2XY8B 3TKLB 3N9QA 4AIUA 2HN2A 2E9XC 3IBPA 5HEGA 2N2NA 3V5UA 2QYWA 4YLHA 3EDUA 4NXMT 4ADZA 5JTGA 3IEEA 2F4VT 3CVRA 3F31A 3PJAJ 2BKPA 2KWIB 3JC6C 1KNPA 2MBGA 2I6HA 4UVCB 3O9XA 2KNDA 3E0ZA 5LMUT 4AXPA 3PUYF 3N2KE 2IDOB 1FEWA 2BBHA 3RIUA 2OLTA 3N9NA 1S35A 1UX4A 3DJBA 3OPCA 5AQJB 1HR0T 5LP6E 4QWNB 2E9XD 1YD8G 2V6XA 4H9OC 4WZXA 2JMKA 2WWVA 2NTXA 2RA1A 5LOVE 2YU1A 4ILUA 2HPLA 3CX6B 3I0QA 3CK6A 2CXFA 2WDRA 1MIWA 5FXVA 3JC6D 4AQFC 2WP9A 1E7PA 2J62A 3TLWA 1XNQT 4JI5T 3UQ7A 2WCAA 2XQ5A 5HWXA 5JH7E 4F8HA 2CEAA 4L5GA 3W15B 3VKHA 4DMWA 3AAEB 4FI5A 3UUXB 4IE7A 2X9XA 2NW9A 5LG3A 2WAUA 4ZS2A 2CHNA 3AA1B 3FZLB 5GONE 3ABVA 1S94A 4DV2T 4X5TA 1D0XA 5F8PA 2MAWA 2XPKA 2A72A 2V1DB 4NUUA 5FY1A 3FXEB 3RQWA 1US7B 2CCQA 4OYJA 4I4TE 1Z8UA 1HNWT 2MTQA 1BR0A 3JAEA 3KVBA 4LFCT 5L3DB 3PURA 2LOPA 1I94T 2CMRA 2LE8A 4AKGA 1KFYA 2LLYA 5HXEA 5FL1A 3I1AA 5JRCA 4ZZBA 5BR8T 2V6YA 5EZYE 2LOSA 4LF6T 4LFBT 4CI3B 3K3NA 2C5IT 2X68A 1R8IA 3DP7A 3RHWA 1FJGT 4U33A 4AKIA 3RKOA 3HKEE 3U78A 2DNXA 2W62A 2ACZA 4LF5T 5L3EB 3JAFA 3M3ZB 2C0SA 3CQGB 5L47A 3HI2A 5AQNB 4JI8T 5AQVB 3ONXA 5EK3A 3RC8A 3OTOT 1IJ6A 2BG9E 2X67A 2JJ9A 3Q9DA 5ABHA 4AKLA 2UXNB 4CQIA 2J1DG 4DBQA 4HFEA 1W9RA 4YXDA 1ZEEA 4QX7B 3P4PA 2KT9A 1MMGA 3P4WA 3OBVE 3FZKB 4ZZCA 1JNRA 5AQPB 2Q9QC 5HXRA 4IT4A 1OEDA 3RQUA 4P0BA 2WWUA 5LJNA 4ISSA 2LEHA 1VCTA 3AEAA 2WU5A 5LMNT 1UK5A 4BJMA 4G2AA 5J2UE 4ZEYA 1YKHB 3KINB 1HNXT 1M7KA 3AVSA 4TN7B 3RYCE 2D9DA 4BAYB 2V6YB 2VVNA 1KK7A 4TWHA 4G63A 3AE9A 3VR8A 1J5WA 3A5XA 2JQ9A 1N34T 2QA7A 3ESLA 3J9X1 4XZCA 3RLFF 4IDPA 2K24A 3A7MA 4X62T 2XQ4A 5F5WA 3VR9A 2HH7A 5JQGE 2YDRA 4WW0A 3KV6A 3F57A 3K8PC 3UU5A 2LHRA 2XQ9A 3EUHA 4OYKA 1D0YA 4QKNA 3KV4A 5AQRB 4DR2T 4HGAA 1E1HB 4CXWA 4EV6A 5JDMA 3PDYA 4O4IE 2N1GA 2DLRA 3B13A 4EEDA 2V7IA 5AQOB 3Q5XA 3BQKA 3C50A 2ZM6T 4HWCA 4CN1A 3EABA 3AA6B 1IZNB 4EYUA 2CRBA 4LFAT 1XDOA 4DV4T 1D1CA 3N2GE 4TV8E 2E5VA 5HEJA 5H6QB 3SFDA 2LSGA 3ZC1A 3X1DA 2B76A 3RX6A 5KMGP 4JYAT 1OEDB 5LBMA 4UF0A 4TWDA 2BG9C 1OXZA 2HHHT 4DNDA 2K3WA 3ZMZB 3RRCA 2CXDA 3KBUA 5JREA 2JIWA 1SHZC 4H9RC 2X0LB 3NRYA 3CWZB 2CLYB 5FVLA 4LMKA 2XAQB 2Y6XA 4PK5A 3HL6A 1XDPA 4FJOA 2CE7A 1YKEB 4AKRB 5L2LA 5HWYA 4WBNE 2WU2A 2DHRA 2H88A 3GWHA 4P09A 3NWIA 3WI3A 1N32T 3OJAA 4YSXA 4P0AA 5HXCA 3CIRA 3K3OA 1XMOT 4UELA 3HKDE 2YK0A 3C64A 2UXXB 3NVOA 3PV0F 2XQYA 3PUWF 3RPUA 3IA3A 3AEBA 2JQHA 3E22E 4HFHA 2PTFA 4QH4A 5LCYA 2JMHA 4IREA 2BS4A 1UUSA 4DR1T 3OKQA 4A56A 4WBOA 4TV9E 3ZCIA 2NP9A 3I0OA 4IGUA 1SUMB 4UVAB 4DMVA 1HF8A 3PE0A 3RI5A 2A9UA 4PFOA 3ZJ2A 2ACXA 3BQIA 4QXCB 2JPFA 5DJQC 5IUXA 2X9WA 4PJJA 4HFBA 3K1SA 3VRBA 4DUZT 4HEAA 3N9LA 1VOMA 4KMCA 1IAPA 3PTRB 5FYMA 3IF8B 4YTMA 5JR9C 2UUCT 4PJNA 4NIQA 4ZHQE 2NTYA 4U31A 2PJQA 2BS3A 3H3AA 2XAJB 3AXJA 1IBLT 3RYFE 4JI1T 3ZSTA 1HX1B 4B3RT 1JNZA 3SWHA 1HCIA 2Z6EA 4X64T 5FMNA 2B1EA 3RIUC 3ZN0B 4E7ZA 2CXLA 2EHOA 2LRLA 2W4XA 5ABFA 5IHYA 3N9OA 3QUJA 4U74A 5KXJA 3LBXB 4H63V 3LK42 1L0VA 3UU6A 5LBQB 3SFEA 4CZZB 3SOLA 1CUNA 2IUBA 3RYHE 4IE0A 4UVBB 3PUZF 2DL1A 2ZM8A 4HN9A 4O4JE 3AAAB 2BBJA 4O4LE 4QHOA 3ONJA 5C3JA 2D0UA 2JQQA 2D2SA 2CWOA 3LSVA 1M62A 4ILCA 3MKDA 4DR5T 2WZHA 4ILAA 2QGSA 3ANWA 4HE8A 4YSYA 3FZMB 4JEUB 5AQHB 2ZLYA 2CA5A 5FXZA 4H9NC 2FBWA 4LF9T 5JDGA 1VCSA 5C8YE 3JCFA 2KINB 2PBIA 3PUVF 4AQFA 4EOZB 2WSSV 3CMLA 2WDQA 1I6ZA 4U2YA 4JI2T 4DR7T 5AFUL 4IDOA 1ZHCA 3AE8A 4EAHA 2W2UA 3PU3A 4IL4A 3ZSSA 4IDQA 2VKDA 4J2CA 3VU7H 4GYSA 3LK2B 4GK5E 3K3QC 1NAFA 4UV9B 5L4EA 2XZEA 2EHOB 4HTEA 2YDQA 4YJ3E 4IIJE 4PJMA 1MMNA 3B57A 5ABFB 2E8IA 4MALA 3UULA 2XQAA 3ZT6A 5AQGB 4DR4T 2UXBT 3T1HT 2E2AA 1MNEA 3EI0A 4CXXA 4JI7T 3PUGA 3GMIA 4CN6A 5AQQB 4ILBA 4HWDA 1MNDA 4HKAA 4C91A 2Y8DA 1XZYA 2ZM0A 2M6BA 5JDHA 4B6XA 4E7SA 4QXHB 1U4QA 3NRXA 3RF1A 4O2AE 1G8XA 2KWHA 4HFVA 3AB3B 1HG2A 3UFGA 4JBWF 4OK0A 2QRXA 4ASKA 3RIFA 5LGNB 4UR9A 2V7LA 5LB7B 4LF7T 2L3LA 3EHZA 1T7SA 5AQUB 3TLUA 2IIUA 4H9PC 3ZMSB 4JI6T 5FXXA 4I43B 2QVAA 3E08A 3N9PA 2OV9A 2VK9A 1WRDA 2K48A 3ONLC 1KF6A 4IHJE 2WMOA 3ZMUB 4AI6A 2XQ7A 5AQKB 3L09A 2UXDT 4X65T 3L3PA 5AQIB 1MMDA 3TLSA 1YW0A 4EB6E 3SS1A 2BS2A 4GIWA 4X66T 2E5LT 4K0UA 5LJMA 2DCFA 5JRCB 2C5KT 2Q9QA 3BK9A 4MBQA 3QOFA 2AE9A 2H89A 2K9AA 5JVDE 4GKJT 4NPPA 4TX5A 4B3MT 2IC9A 4PNIA 4PK6A 3DTOA 2IC6A 4U7YA 2IAKA 4ZI2D 3AE1A 1OWAA 4JI0T 4I50E 1U5PA 2YKSA 3EAMA 2K5BB 5DQWA 2YEVC 3PU8A 5FNVE 4TNVA 2DWGA 2VKOA 2V26A 5CJ5A 2P9BA 1XMQT 2H3RA 2PG8A 1E2AA 4UEMA 2BDEA 4ZXLA 3ETVA 3P50A 4DIDB 3AEFA 1KEYA 1LKXA 4COFA 1W09A 5E0OA 1Z0PA 1D0ZA 5LG4A 5LYJE 3KBTA 5A1LA 2XTLA 1X79A 3KDSE 3EDVA 1NWMX 2VKHA 1SE7A 2W61A 2X9YA 3ZN1B 4O2BE 3GA8A 2XAGB 1WYBA 1BR4A 3AEEA 4PFPA 4UXNB 4Z91A 4JI3T 3EVYA 3RYIE 4U72A 3CQCB 2VKJA 2KLQA 1B7TA 4H63H 2BVMA 2A3DA 3CKDA 1BR1A 3JADA 2R6GF 2M67A 5FVKA 2BG9A 4CI2B 4WNKA 4DV6T 1T8BA 4PAGA 4EYYR 2KSRA 1WR6A 4DVDA 5FKYA 3PUXF 3ETUA 4M1PA 1NENA 1QSDA 1HNZT 5BMVE 2IHR1 2LKHA 5L3CB 1G73A 3AE5A 1O3XA 4O8SA 3O1IA 2VWAA 1H7CA 2ODVA 5DQVA 2YINA 2V8SV 4OX9T 5LHGB 2DI4A 2UXCT 3RC3A 3MXZA 4ERRA 2XAHB 1ZKEA 3B5MA 3QB5K 3F2EA 3G06A 2X51A 4CXYA 4DR6T 3FBZA 1FMVA 2ES0A 4ZI7E 3ZJ1A 3UU4A 3UT5E 2M6IA 4KUMB 3AE2A 4KX6A 3R84B 2LHNA 3CX8B 5EK2A 3R6NA 4U3CA 1CHUA 1LRZA 4UF0B 5LA6E 2OA5A 3OYXA 2WMNA 2WY2A 4QH1A 1YXRA 1IBMT 2FJAA 4N78D 2FJBA 3HR0A 4EZ4A 4U7IA 3C51A 1HTJF 4GYRA 2V7KA 3T8OA 5JDQA 4EZHA 4YJ2E 2YOEA 2JRKA 3UU8A 1W0AA 3AE3A 5HEUA 2X0HA 4TUYE 1NEKA 2BG9B 2VVSA 4NUVA 1UCUA 4ZI3D 2X66A 3C4XA 2LRKA 3PUQA 2ZM2A 2EHOC 4OFZA 4JLEA 2BKNA 2E9XA 5JDNA 4XBFB 2VL8A 4AQYT 3RGLA 4WYVA 4I55E 1UGOA 5LHHB 3UFEA 3UQ4A 3N5LA 2H7OA 4DUYT 3RH3A 3TLVA 5L3FB 5JR9A 3UU3A 2RP4A 5LNKA 1XWMA 5HAXA 2NW7A 5HCJA 3AAIA 5TAOA 1QUUA 5AQTB 5FY7A 1HFAA 4BJNA 4A97A 5HEHA 2XUEA 3UUMA 4NXNT 4DO0A 2RPAA 5FP3A 1HX8A 5HEOA 2V5CA 4X1YE 3KV5A 3WAJA 3WAKA 5CGMA 3ZC0A 4YTNA 4XAXB 1WR0A 4HFIA 2EHOD 5J2TE 5H6RB 1AJ3A 4DBRA 1OEDE 3RRWA 4MHCA 2CWYA 3P4SA 5IYZE 4MFRA 4YTPA 1WFDA 4DV3T 4QH5A 3NBXX 4YHJA 3AVRA 4DV0T 5AQSB 4HFCA 5LHIB 3VKGA 2GK9A 2D5UA 2WM9A 2CBJA 4IE4A 1XNRT 1W0BA 5CB4E 1Y01A 3I9WA 3AE7A 3Q5WA 3PUAA 1DU2A 2LSKA 2XAFB 3VRAA 3N2OA 3P4QA 2YDSA 3VHLA 3LFMA 4IL9A 3AA0B 4H9SE 3KFWX 3L39A 3Q5DA 3FXDB 3AXJB 2E9XB 2N9DA 5AQMB 4LF8T 3ZMVB 2FJDA 4Q25A 1UX5A 2NOXA 2BZBA 3AA7B 1D1AA 5LGUB 5JR9B 4AQGA 2NW8A 4HWHA 4O4HE 4Z90A 2KMFA 4GK0E 2XQ3A 2X0YA 4L9IA 3UUNA 3KV9A 2LJLA 1IBKT 5HXSA 4L0RA 1ZP0A 5L3BB 2V7MA 3OVUA 2NWBA 3S4UA 4CI1B 2L9QA 3O1JA 2CPTA 5ETWA 4Z8XA 4X20E 1UURA 4AISA 3UUBA 2ODUA 5KX5E 2WBLA 5KDMC 4DV5T 2MPKA 4HFDA 3ANWB 1YQ4A 2H7VC 3BQLA 3L8RA 5HYAA 3ZYLA 3CX7B 2CHOA 3OYZA 1WCRA 3MACA 1HG5A 1FMWA 2BVLA 5LGTB 2W63A 5L4HA 3LK3B 4A98A 1WYCA 3N9MA 1FIOA 3QC9A 4AKHA 4X1KE 5F3JA 3UTKA 5ABGA 4DV7T 2XQ8A 4GOUA 1D1BA 2UUBT 3ZLIA 1OEDC 1Y64B 2JQKA 2V7JA 5FY0A 4QXBB 2XQ6A 3HKBE 4ZI2C 4DV1T 4PW8A 1T98A 1J5ET 3GN5A 2C5JA 4CN4A 2LKGA 3FBLA 2VB6A 4C90A 3MJXA 3NKZA 4ZS3A 2WQYA 4LF4T 4X1IE 2CLYC 3PUSA 4EEBA 4KBMB 2KXPB 2W67A 2A2FX 4K0KT 2DWKA 5LXTE 2ZMAA 3QNUA
chains in the Genus database with same CATH topology
1BR1A 1VRBA 2NTYA 2PJQA 4I4TE 4ZHQE 2VASA 2M67A 5J1GA 2MTQA 3H3AA 1BR0A 3MZKB 4V1Av 2XAJB 4CI2B 3KVBA 4WNKA 4PAGA 3ZYMA 4EYYR 5L3DB 3PURA 3RYFE 1SA0E 2LOPA 2IW5B 3Q2MA 1WR6A 4DVDA 2CMRA 2LE8A 2W00A 1HCIA 2Z6EA 3SWHA 4AKGA 5FMNA 3QK6A 2B1EA 5HXEA 3ZN0B 5FXWA 2CXLA 3I1AA 4E7ZA 2EHOA 3CPZA 3ETUA 5JRCA 4M1PA 5L3GB 1QSDA 1MMAA 1WLXA 5EZYE 5BMVE 5IHYA 3N9OA 2LOSA 5L3CB 3QUJA 3O1HA 1G73A 2G0UA 4U74A 1KNZA 3LBXB 4H63V 3LK42 4JEHB 4MLKA 1O3XA 4CI3B 4O8SA 3K3NA 5LBQB 3C4ZA 3P7IA 2C5IT 3O1IA 4CZZB 2VWAA 1H7CA 2LSJA 3SOLA 4ZOLE 1CUNA 2X68A 2ODVA 3RYHE 2X9HA 4IE0A 4UVBB 5DQVA 2YINA 2Q9QD 2ZM8A 4HN9A 3P8CD 4O4JE 2DI4A 3DP7A 4YFSA 3AAAB 5LHGB 3RC3A 3MXZA 4AKIA 4O4LE 4QHOA 4ERRA 3RKOA 2D0UA 2XAHB 1ZKEA 5ADXL 3HKEE 2JQQA 3U78A 2D2SA 3C98B 3J7Yq 3F2EA 2X51A 2CWOA 2LSIA 2DNXA 2W62A 4CXYA 3FBZA 2MOZA 1EZ3A 3V5SA 5L3EB 3MKDA 1FMVA 2ES0A 4IE5A 4ZI7E 3ZCJA 2C0SA 3IHRA 3CQGB 4IE6A 4IDZA 4OHFA 3FHNA 3LJCA 3ZJ1A 2Y48B 3UT5E 4EXTA 2LT3A 2QGSA 3ANWA 4KUMB 3R84B 2LHNA 3HI2A 4HE8A 3CX8B 5EK2A 4JEUB 3R6NA 2ZLYA 3ONXA 5EK3A 1LRZA 2I59A 3RC8A 4UF0B 1IJ6A 2CA5A 1IJ5A 5FXZA 5LA6E 5M4YA 2X67A 2OA5A 4H9NC 3OYXA 5JDFA 2WMNA 3GN5B 2JJ9A 3Q9DA 5JDGA 5C8YE 2KINB 2PBIA 4AKLA 4AQFA 4EOZB 2WSSV 2UXNB 3CMLA 4CQIA 2J1DG 4DBQA 1ZEEA 4QX7B 4N78D 3HR0A 4EZ4A 3C51A 2KT9A 4ISTA 1MMGA 3FB2A 1HTJF 4GYRA 2V7KA 5AFUL 3OBVE 3T8OA 5JDQA 3MK7C 5CA0E 1ZHCA 2Q9QC 5HXRA 4EZHA 1BR2A 4EAHA 4YJ2E 3PU3A 4ANJA 2JRKA 4P0BA 2WWUA 2Q9QB 5LJNA 4ISSA 2LEHA 4TUYE 2VKDA 4J2CA 4NUVA 3VU7H 4F6RC 1MIVA 4BJMA 4G2AA 5J2UE 1UCUA 4GYSA 3LK2B 4GK5E 1YKHB 2X66A 4ZI3D 3K3QC 3KINB 3C4XA 3PUQA 4BA9A 2ZM2A 2EHOC 4OFZA 3ZYKA 3U3IA 1NAFA 4JLEA 4TZ4C 4UV9B 2E9XA 5JDNA 4XBFB 2EHOB 4HTEA 2VL8A 3AVSA 4TN7B 1LVFA 4YJ3E 3RYCE 4I55E 4IIJE 4BAYB 4PJMA 5LHHB 3NZQA 1MMNA 3UFEA 3B57A 4JUYA 5DABA 1KK7A 2E8IA 4MALA 3N5LA 2H7OA 1LVKA 4G63A 3RH3A 5L3FB 3UULA 5JR9A 3SRZA 2RP4A 4KP3C 5LNKA 3A5XA 3KVAA 5EK4A 5HAXA 1MNEA 2NW7A 5CA1E 4CXXA 3I9YA 3PUGA 1HS7A 3AAIA 3GMIA 5TAOA 2MYSA 1QUUA 5FY7A 2QA7A 3ZEFB 3ESLA 1HFAA 3J9X1 3ZPOA 3C4WA 1MNDA 4BJNA 4XZCA 2HPJA 2XUEA 2K24A 3UUMA 4DO0A 4HKAA 4C91A 2Y8DA 2BVMA 2HH7A 2ZM0A 5JQGE 1V9DA 5FP3A 4WW0A 3KV6A 1HX8A 3NZPA 3F57A 5JDLA 4X1YE 5JDHA 3K8PC 2KZ7B 2LHRA 3KV5A 3EUHA 3LG7A 4OYKA 3ZMTB 4B6XA 2W0GA 2PFVA 4E7SA 4H9QC 1D0YA 4QKNA 3WAKA 3KV4A 4QXHB 3WAJA 3LBXA 4PK4A 4QX8B 4UV8B 3ZC0A 4PJLA 2SPCA 4XAXB 4HGAA 1E1HB 4ZI3C 1U4QA 3HA4A 4CXWA 3NRXA 2EHOD 5JDMA 2YU2A 5J2TE 3H37A 4O2AE 5H6RB 1AJ3A 3PDYA 4O4IE 4DBRA 2N1GA 3RRWA 4MHCA 2CWYA 5IYZE 1G8XA 4MFRA 2KWHA 2DLRA 3B13A 4HFVA 3AB3B 1HG2A 1MIYA 2V7IA 3NBXX 4YHJA 2LM9A 3AVRA 3Q5XA 3BQKA 3C50A 4OK0A 3CQXC 4ASKA 5LHIB 3VKGA 4EIWA 5LGNB 2GK9A 2D5UA 2WM9A 2V7LA 3MA9A 3AA6B 2L3LA 1IZNB 4IE4A 3M65A 4EYUA 2L8KA 2XHEB 5CB4E 3I9WA 4H9PC 1D1CA 3N2GE 4TV8E 1ZV4X 4UIGA 3ZMSB 5FXXA 4I43B 5H6QB 3Q5WA 2LSGA 3ZC1A 2CM0A 3RX6A 5KMGP 3E08A 2D0TA 3D0TA 3PUAA 3N9PA 5HYAA 2VK9A 2XASB 3O4XE 2LSKA 5LBMA 2XAFB 3HKCE 5HXHA 1WRDA 4UF0A 2K48A 3N2OA 2LSYA 1OXZA 4DNDA 3VHLA 3LFMA 4IHJE 3ZMZB 3RRCA 2WMOA 3ZMUB 3AA0B 3TKLB 4H9SE 4AI6A 3KFWX 3N9QA 2CXDA 3L09A 2E9XC 3KBUA 3IBPA 5JREA 2N2NA 3FXDB 3V5UA 1SHZC 4YLHA 3L3PA 4H9RC 2X0LB 3EDUA 1MMDA 3NRYA 2E9XB 3CWZB 1YW0A 4ADZA 4EB6E 2CLYB 2N9DA 3SS1A 3ZMVB 4GIWA 3IEEA 4K0UA 5LJMA 1UX5A 2NOXA 2XAQB 2DCFA 5JRCB 2C5KT 3CVRA 3F31A 2Y6XA 2BZBA 4PK5A 2Q9QA 3BK9A 3AA7B 3JC6C 2KWIB 1D1AA 3HL6A 4MBQA 5LGUB 5JR9B 4AQGA 2NW8A 4FJOA 2CE7A 4O4HE 2KMFA 1YKEB 2K9AA 4GK0E 4AKRB 5JVDE 2MBGA 5L2LA 4L9IA 5HWYA 4WBNE 4TX5A 3UUNA 2DHRA 2IC9A 4UVCB 3O9XA 2KNDA 3GWHA 3KV9A 2LJLA 4PNIA 4PK6A 5HXSA 3DTOA 3E0ZA 4L0RA 4P09A 3WI3A 2IC6A 5L3BB 2IAKA 2V7MA 4AXPA 3OJAA 2NWBA 3N2KE 4ZI2D 4P0AA 5HXCA 3S4UA 1FEWA 4CI1B 2L9QA 3K3OA 3O1JA 4UELA 1OWAA 5ETWA 3N9NA 1S35A 4I50E 1U5PA 3HKDE 1UX4A 4Z8XA 4X20E 2YK0A 2K5BB 3C64A 3DJBA 2ODUA 5DQWA 2YEVC 3PU8A 5FNVE 5LP6E 2UXXB 5KX5E 4QWNB 2E9XD 1YD8G 2WBLA 2DWGA 5KDMC 2VKOA 2XQYA 2V26A 4H9OC 3ANWB 2JMKA 2P9BA 2H3RA 3RPUA 2H7VC 2NTXA 2PG8A 2RA1A 2YU1A 3BQLA 4ILUA 2HPLA 3CX6B 4UEMA 5LOVE 3ZYLA 3CX7B 3I0QA 2CXFA 3E22E 2BDEA 3OYZA 1MIWA 5FXVA 3ETVA 3MACA 3JC6D 1HG5A 1FMWA 2BVLA 4AQFC 5LGTB 2W63A 5LCYA 3LK3B 2JMHA 1WYCA 3N9MA 1FIOA 1LKXA 3OKQA 4A56A 3QC9A 4WBOA 4AKHA 4X1KE 4TV9E 3ZCIA 2NP9A 5E0OA 1Z0PA 5F3JA 3I0OA 3UTKA 1D0ZA 4IGUA 5LG4A 4UVAB 4DMVA 5LYJE 3KBTA 1HF8A 5A1LA 4GOUA 3PE0A 1D1BA 2XTLA 3ZLIA 5HWXA 1X79A 3KDSE 1Y64B 3EDVA 1NWMX 2VKHA 5JH7E 2V7JA 4PFOA 5FY0A 3ZJ2A 2W61A 4QXBB 2CEAA 4L5GA 3W15B 2X9YA 2ACXA 3HKBE 3ZN1B 4ZI2C 3VKHA 4DMWA 3AAEB 3BQIA 4FI5A 4PW8A 3UUXB 4O2BE 3GA8A 1T98A 4IE7A 4QXCB 2JPFA 2X9XA 2XAGB 5DJQC 2NW9A 1WYBA 3GN5A 2C5JA 1BR4A 2WAUA 4ZS2A 2X9WA 4PFPA 3FBLA 4PJJA 2VB6A 3AA1B 5GONE 4UXNB 3MJXA 4C90A 4ZS3A 1S94A 4X1IE 3EVYA 2CLYC 3RYIE 4U72A 1D0XA 3CQCB 3PUSA 4HEAA 3N9LA 4KBMB 5F8PA 2VKJA 1VOMA 2KLQA 2KXPB 4KMCA 1B7TA 2A72A 2V1DB 4H63H 4NUUA 3FXEB 1IAPA 2A2FX 3PTRB 5FY1A 5FYMA 1US7B 3IF8B 2DWKA 5LXTE 2CCQA 4OYJA 5JR9C 2ZMAA 4PJNA 2A3DA 3CKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUM A;  1WLX A;  3UUL A;  3PE0 A;  1OWA A;  1S35 A;  3FB2 A;  1U5P A;  3EDV A;  3LBX B;  3UUN A;  2ODU A;  1QUU A;  1HCI A;  3LBX A;  2SPC A;  1CUN A;  1U4Q A;  2ODV A;  3F31 A;  1AJ3 A; 
#chains in the Genus database with same CATH topology
 1VRB A;  2VAS A;  5J1G A;  3MZK B;  4B3S T;  3ZT5 A;  4V1A v;  3LDQ B;  3ZYM A;  2XM2 A;  1SA0 E;  5HCM A;  2IW5 B;  4KHZ F;  1J1J A;  3Q2M A;  2W00 A;  2V5D A;  2FJE A;  1X9B A;  3QK6 A;  4YHH T;  5FXW A;  3CPZ A;  4I0U A;  5L3G B;  1MMA A;  1WLX A;  3A8Y C;  2VL0 A;  1GQE A;  4YSZ A;  3O1H A;  2XSA A;  2G0U A;  1KNZ A;  3AEG A;  4YY3 T;  2CBI A;  4JEH B;  4MLK A;  2VUR A;  3C4Z A;  3P7I A;  5J0Z A;  2LSJ A;  4ZOL E;  2X9H A;  4JI4 T;  3ZKR A;  2Q9Q D;  3P8C D;  4YFS A;  3T1Y T;  5IWA T;  2XM1 A;  1T72 A;  4KI0 F;  5ADX L;  3J7Y q;  3C98 B;  2WS3 A;  2LSI A;  2IML A;  2FUP A;  2MOZ A;  4YT0 A;  1EZ3 A;  3V5S A;  1ZOY A;  4LMJ A;  4IE5 A;  3ZCJ A;  4IDZ A;  3IHR A;  4IE6 A;  4OHF A;  2J47 A;  3FHN A;  3LJC A;  3P4R A;  2Y48 B;  4EXT A;  5CFB A;  2LT3 A;  3FZF B;  4TNW A;  2VQF T;  2UU9 T;  4HWF A;  2I59 A;  5AQL B;  5C2T A;  1IJ5 A;  5M4Y A;  5JDF A;  3GN5 B;  4IST A;  3FB2 A;  2AXD S;  4DR3 T;  3MK7 C;  5CA0 E;  1BR2 A;  4ANJ A;  2Q9Q B;  2UUA T;  4IDN A;  3H3M A;  4F6R C;  1MIV A;  2XSB A;  3TLT A;  4B3T T;  4BA9 A;  1N36 T;  3ZYK A;  3U3I A;  3RKG A;  4U2Z A;  3RIA A;  4TZ4 C;  3Q5E A;  1LVF A;  3NZQ A;  4JUY A;  5DAB A;  2VQE T;  1LVK A;  3SRZ A;  4KP3 C;  3KVA A;  5EK4 A;  5ABE A;  5CA1 E;  3I9Y A;  1HS7 A;  2YN6 A;  2MYS A;  4A5X A;  3ZEF B;  3ZPO A;  3C4W A;  2HPJ A;  4GKK T;  4JV5 T;  1N33 T;  1V9D A;  2W66 A;  3FZH B;  3NZP A;  5JDL A;  5AQF B;  3AE4 A;  2KZ7 B;  3QB5 A;  4HWI B;  3LG7 A;  3ZMT B;  2PFV A;  2W0G A;  4H9Q C;  1YQ3 A;  3LBX A;  4PK4 A;  4QX8 B;  4UV8 B;  4PJL A;  2SPC A;  1KNR A;  5FL0 A;  4ZI3 C;  3HA4 A;  2I0M A;  4P1N A;  3PJA A;  2YU2 A;  3H37 A;  2WZI A;  2J4G A;  1MIY A;  3ZT7 A;  2LM9 A;  4TWF A;  3CQX C;  1QLB A;  4EIW A;  2HN1 A;  3MA9 A;  2LM2 A;  3M65 A;  2L8K A;  2WB5 A;  2XHE B;  3AEC A;  2NR4 A;  1ZV4 X;  4UIG A;  4EGW A;  2CM0 A;  2WDV A;  2D0T A;  3D0T A;  2XAS B;  3O4X E;  2XJ7 A;  3HKC E;  5HXH A;  2LSY A;  4LML A;  3AED A;  2BKO A;  4KHP T;  3AE6 A;  2XY8 B;  3TKL B;  3N9Q A;  4AIU A;  2HN2 A;  2E9X C;  3IBP A;  5HEG A;  2N2N A;  3V5U A;  2QYW A;  4YLH A;  3EDU A;  4NXM T;  4ADZ A;  5JTG A;  3IEE A;  2F4V T;  3CVR A;  3F31 A;  3PJA J;  2BKP A;  2KWI B;  3JC6 C;  1KNP A;  2MBG A;  2I6H A;  4UVC B;  3O9X A;  2KND A;  3E0Z A;  5LMU T;  4AXP A;  3PUY F;  3N2K E;  2IDO B;  1FEW A;  2BBH A;  3RIU A;  2OLT A;  3N9N A;  1S35 A;  1UX4 A;  3DJB A;  3OPC A;  5AQJ B;  1HR0 T;  5LP6 E;  4QWN B;  2E9X D;  1YD8 G;  2V6X A;  4H9O C;  4WZX A;  2JMK A;  2WWV A;  2NTX A;  2RA1 A;  5LOV E;  2YU1 A;  4ILU A;  2HPL A;  3CX6 B;  3I0Q A;  3CK6 A;  2CXF A;  2WDR A;  1MIW A;  5FXV A;  3JC6 D;  4AQF C;  2WP9 A;  1E7P A;  2J62 A;  3TLW A;  1XNQ T;  4JI5 T;  3UQ7 A;  2WCA A;  2XQ5 A;  5HWX A;  5JH7 E;  4F8H A;  2CEA A;  4L5G A;  3W15 B;  3VKH A;  4DMW A;  3AAE B;  4FI5 A;  3UUX B;  4IE7 A;  2X9X A;  2NW9 A;  5LG3 A;  2WAU A;  4ZS2 A;  2CHN A;  3AA1 B;  3FZL B;  5GON E;  3ABV A;  1S94 A;  4DV2 T;  4X5T A;  1D0X A;  5F8P A;  2MAW A;  2XPK A;  2A72 A;  2V1D B;  4NUU A;  5FY1 A;  3FXE B;  3RQW A;  1US7 B;  2CCQ A;  4OYJ A;  4I4T E;  1Z8U A;  1HNW T;  2MTQ A;  1BR0 A;  3JAE A;  3KVB A;  4LFC T;  5L3D B;  3PUR A;  2LOP A;  1I94 T;  2CMR A;  2LE8 A;  4AKG A;  1KFY A;  2LLY A;  5HXE A;  5FL1 A;  3I1A A;  5JRC A;  4ZZB A;  5BR8 T;  2V6Y A;  5EZY E;  2LOS A;  4LF6 T;  4LFB T;  4CI3 B;  3K3N A;  2C5I T;  2X68 A;  1R8I A;  3DP7 A;  3RHW A;  1FJG T;  4U33 A;  4AKI A;  3RKO A;  3HKE E;  3U78 A;  2DNX A;  2W62 A;  2ACZ A;  4LF5 T;  5L3E B;  3JAF A;  3M3Z B;  2C0S A;  3CQG B;  5L47 A;  3HI2 A;  5AQN B;  4JI8 T;  5AQV B;  3ONX A;  5EK3 A;  3RC8 A;  3OTO T;  1IJ6 A;  2BG9 E;  2X67 A;  2JJ9 A;  3Q9D A;  5ABH A;  4AKL A;  2UXN B;  4CQI A;  2J1D G;  4DBQ A;  4HFE A;  1W9R A;  4YXD A;  1ZEE A;  4QX7 B;  3P4P A;  2KT9 A;  1MMG A;  3P4W A;  3OBV E;  3FZK B;  4ZZC A;  1JNR A;  5AQP B;  2Q9Q C;  5HXR A;  4IT4 A;  1OED A;  3RQU A;  4P0B A;  2WWU A;  5LJN A;  4ISS A;  2LEH A;  1VCT A;  3AEA A;  2WU5 A;  5LMN T;  1UK5 A;  4BJM A;  4G2A A;  5J2U E;  4ZEY A;  1YKH B;  3KIN B;  1HNX T;  1M7K A;  3AVS A;  4TN7 B;  3RYC E;  2D9D A;  4BAY B;  2V6Y B;  2VVN A;  1KK7 A;  4TWH A;  4G63 A;  3AE9 A;  3VR8 A;  1J5W A;  3A5X A;  2JQ9 A;  1N34 T;  2QA7 A;  3ESL A;  3J9X 1;  4XZC A;  3RLF F;  4IDP A;  2K24 A;  3A7M A;  4X62 T;  2XQ4 A;  5F5W A;  3VR9 A;  2HH7 A;  5JQG E;  2YDR A;  4WW0 A;  3KV6 A;  3F57 A;  3K8P C;  3UU5 A;  2LHR A;  2XQ9 A;  3EUH A;  4OYK A;  1D0Y A;  4QKN A;  3KV4 A;  5AQR B;  4DR2 T;  4HGA A;  1E1H B;  4CXW A;  4EV6 A;  5JDM A;  3PDY A;  4O4I E;  2N1G A;  2DLR A;  3B13 A;  4EED A;  2V7I A;  5AQO B;  3Q5X A;  3BQK A;  3C50 A;  2ZM6 T;  4HWC A;  4CN1 A;  3EAB A;  3AA6 B;  1IZN B;  4EYU A;  2CRB A;  4LFA T;  1XDO A;  4DV4 T;  1D1C A;  3N2G E;  4TV8 E;  2E5V A;  5HEJ A;  5H6Q B;  3SFD A;  2LSG A;  3ZC1 A;  3X1D A;  2B76 A;  3RX6 A;  5KMG P;  4JYA T;  1OED B;  5LBM A;  4UF0 A;  4TWD A;  2BG9 C;  1OXZ A;  2HHH T;  4DND A;  2K3W A;  3ZMZ B;  3RRC A;  2CXD A;  3KBU A;  5JRE A;  2JIW A;  1SHZ C;  4H9R C;  2X0L B;  3NRY A;  3CWZ B;  2CLY B;  5FVL A;  4LMK A;  2XAQ B;  2Y6X A;  4PK5 A;  3HL6 A;  1XDP A;  4FJO A;  2CE7 A;  1YKE B;  4AKR B;  5L2L A;  5HWY A;  4WBN E;  2WU2 A;  2DHR A;  2H88 A;  3GWH A;  4P09 A;  3NWI A;  3WI3 A;  1N32 T;  3OJA A;  4YSX A;  4P0A A;  5HXC A;  3CIR A;  3K3O A;  1XMO T;  4UEL A;  3HKD E;  2YK0 A;  3C64 A;  2UXX B;  3NVO A;  3PV0 F;  2XQY A;  3PUW F;  3RPU A;  3IA3 A;  3AEB A;  2JQH A;  3E22 E;  4HFH A;  2PTF A;  4QH4 A;  5LCY A;  2JMH A;  4IRE A;  2BS4 A;  1UUS A;  4DR1 T;  3OKQ A;  4A56 A;  4WBO A;  4TV9 E;  3ZCI A;  2NP9 A;  3I0O A;  4IGU A;  1SUM B;  4UVA B;  4DMV A;  1HF8 A;  3PE0 A;  3RI5 A;  2A9U A;  4PFO A;  3ZJ2 A;  2ACX A;  3BQI A;  4QXC B;  2JPF A;  5DJQ C;  5IUX A;  2X9W A;  4PJJ A;  4HFB A;  3K1S A;  3VRB A;  4DUZ T;  4HEA A;  3N9L A;  1VOM A;  4KMC A;  1IAP A;  3PTR B;  5FYM A;  3IF8 B;  4YTM A;  5JR9 C;  2UUC T;  4PJN A;  4NIQ A;  4ZHQ E;  2NTY A;  4U31 A;  2PJQ A;  2BS3 A;  3H3A A;  2XAJ B;  3AXJ A;  1IBL T;  3RYF E;  4JI1 T;  3ZST A;  1HX1 B;  4B3R T;  1JNZ A;  3SWH A;  1HCI A;  2Z6E A;  4X64 T;  5FMN A;  2B1E A;  3RIU C;  3ZN0 B;  4E7Z A;  2CXL A;  2EHO A;  2LRL A;  2W4X A;  5ABF A;  5IHY A;  3N9O A;  3QUJ A;  4U74 A;  5KXJ A;  3LBX B;  4H63 V;  3LK4 2;  1L0V A;  3UU6 A;  5LBQ B;  3SFE A;  4CZZ B;  3SOL A;  1CUN A;  2IUB A;  3RYH E;  4IE0 A;  4UVB B;  3PUZ F;  2DL1 A;  2ZM8 A;  4HN9 A;  4O4J E;  3AAA B;  2BBJ A;  4O4L E;  4QHO A;  3ONJ A;  5C3J A;  2D0U A;  2JQQ A;  2D2S A;  2CWO A;  3LSV A;  1M62 A;  4ILC A;  3MKD A;  4DR5 T;  2WZH A;  4ILA A;  2QGS A;  3ANW A;  4HE8 A;  4YSY A;  3FZM B;  4JEU B;  5AQH B;  2ZLY A;  2CA5 A;  5FXZ A;  4H9N C;  2FBW A;  4LF9 T;  5JDG A;  1VCS A;  5C8Y E;  3JCF A;  2KIN B;  2PBI A;  3PUV F;  4AQF A;  4EOZ B;  2WSS V;  3CML A;  2WDQ A;  1I6Z A;  4U2Y A;  4JI2 T;  4DR7 T;  5AFU L;  4IDO A;  1ZHC A;  3AE8 A;  4EAH A;  2W2U A;  3PU3 A;  4IL4 A;  3ZSS A;  4IDQ A;  2VKD A;  4J2C A;  3VU7 H;  4GYS A;  3LK2 B;  4GK5 E;  3K3Q C;  1NAF A;  4UV9 B;  5L4E A;  2XZE A;  2EHO B;  4HTE A;  2YDQ A;  4YJ3 E;  4IIJ E;  4PJM A;  1MMN A;  3B57 A;  5ABF B;  2E8I A;  4MAL A;  3UUL A;  2XQA A;  3ZT6 A;  5AQG B;  4DR4 T;  2UXB T;  3T1H T;  2E2A A;  1MNE A;  3EI0 A;  4CXX A;  4JI7 T;  3PUG A;  3GMI A;  4CN6 A;  5AQQ B;  4ILB A;  4HWD A;  1MND A;  4HKA A;  4C91 A;  2Y8D A;  1XZY A;  2ZM0 A;  2M6B A;  5JDH A;  4B6X A;  4E7S A;  4QXH B;  1U4Q A;  3NRX A;  3RF1 A;  4O2A E;  1G8X A;  2KWH A;  4HFV A;  3AB3 B;  1HG2 A;  3UFG A;  4JBW F;  4OK0 A;  2QRX A;  4ASK A;  3RIF A;  5LGN B;  4UR9 A;  2V7L A;  5LB7 B;  4LF7 T;  2L3L A;  3EHZ A;  1T7S A;  5AQU B;  3TLU A;  2IIU A;  4H9P C;  3ZMS B;  4JI6 T;  5FXX A;  4I43 B;  2QVA A;  3E08 A;  3N9P A;  2OV9 A;  2VK9 A;  1WRD A;  2K48 A;  3ONL C;  1KF6 A;  4IHJ E;  2WMO A;  3ZMU B;  4AI6 A;  2XQ7 A;  5AQK B;  3L09 A;  2UXD T;  4X65 T;  3L3P A;  5AQI B;  1MMD A;  3TLS A;  1YW0 A;  4EB6 E;  3SS1 A;  2BS2 A;  4GIW A;  4X66 T;  2E5L T;  4K0U A;  5LJM A;  2DCF A;  5JRC B;  2C5K T;  2Q9Q A;  3BK9 A;  4MBQ A;  3QOF A;  2AE9 A;  2H89 A;  2K9A A;  5JVD E;  4GKJ T;  4NPP A;  4TX5 A;  4B3M T;  2IC9 A;  4PNI A;  4PK6 A;  3DTO A;  2IC6 A;  4U7Y A;  2IAK A;  4ZI2 D;  3AE1 A;  1OWA A;  4JI0 T;  4I50 E;  1U5P A;  2YKS A;  3EAM A;  2K5B B;  5DQW A;  2YEV C;  3PU8 A;  5FNV E;  4TNV A;  2DWG A;  2VKO A;  2V26 A;  5CJ5 A;  2P9B A;  1XMQ T;  2H3R A;  2PG8 A;  1E2A A;  4UEM A;  2BDE A;  4ZXL A;  3ETV A;  3P50 A;  4DID B;  3AEF A;  1KEY A;  1LKX A;  4COF A;  1W09 A;  5E0O A;  1Z0P A;  1D0Z A;  5LG4 A;  5LYJ E;  3KBT A;  5A1L A;  2XTL A;  1X79 A;  3KDS E;  3EDV A;  1NWM X;  2VKH A;  1SE7 A;  2W61 A;  2X9Y A;  3ZN1 B;  4O2B E;  3GA8 A;  2XAG B;  1WYB A;  1BR4 A;  3AEE A;  4PFP A;  4UXN B;  4Z91 A;  4JI3 T;  3EVY A;  3RYI E;  4U72 A;  3CQC B;  2VKJ A;  2KLQ A;  1B7T A;  4H63 H;  2BVM A;  2A3D A;  3CKD A;  1BR1 A;  3JAD A;  2R6G F;  2M67 A;  5FVK A;  2BG9 A;  4CI2 B;  4WNK A;  4DV6 T;  1T8B A;  4PAG A;  4EYY R;  2KSR A;  1WR6 A;  4DVD A;  5FKY A;  3PUX F;  3ETU A;  4M1P A;  1NEN A;  1QSD A;  1HNZ T;  5BMV E;  2IHR 1;  2LKH A;  5L3C B;  1G73 A;  3AE5 A;  1O3X A;  4O8S A;  3O1I A;  2VWA A;  1H7C A;  2ODV A;  5DQV A;  2YIN A;  2V8S V;  4OX9 T;  5LHG B;  2DI4 A;  2UXC T;  3RC3 A;  3MXZ A;  4ERR A;  2XAH B;  1ZKE A;  3B5M A;  3QB5 K;  3F2E A;  3G06 A;  2X51 A;  4CXY A;  4DR6 T;  3FBZ A;  1FMV A;  2ES0 A;  4ZI7 E;  3ZJ1 A;  3UU4 A;  3UT5 E;  2M6I A;  4KUM B;  3AE2 A;  4KX6 A;  3R84 B;  2LHN A;  3CX8 B;  5EK2 A;  3R6N A;  4U3C A;  1CHU A;  1LRZ A;  4UF0 B;  5LA6 E;  2OA5 A;  3OYX A;  2WMN A;  2WY2 A;  4QH1 A;  1YXR A;  1IBM T;  2FJA A;  4N78 D;  2FJB A;  3HR0 A;  4EZ4 A;  4U7I A;  3C51 A;  1HTJ F;  4GYR A;  2V7K A;  3T8O A;  5JDQ A;  4EZH A;  4YJ2 E;  2YOE A;  2JRK A;  3UU8 A;  1W0A A;  3AE3 A;  5HEU A;  2X0H A;  4TUY E;  1NEK A;  2BG9 B;  2VVS A;  4NUV A;  1UCU A;  4ZI3 D;  2X66 A;  3C4X A;  2LRK A;  3PUQ A;  2ZM2 A;  2EHO C;  4OFZ A;  4JLE A;  2BKN A;  2E9X A;  5JDN A;  4XBF B;  2VL8 A;  4AQY T;  3RGL A;  4WYV A;  4I55 E;  1UGO A;  5LHH B;  3UFE A;  3UQ4 A;  3N5L A;  2H7O A;  4DUY T;  3RH3 A;  3TLV A;  5L3F B;  5JR9 A;  3UU3 A;  2RP4 A;  5LNK A;  1XWM A;  5HAX A;  2NW7 A;  5HCJ A;  3AAI A;  5TAO A;  1QUU A;  5AQT B;  5FY7 A;  1HFA A;  4BJN A;  4A97 A;  5HEH A;  2XUE A;  3UUM A;  4NXN T;  4DO0 A;  2RPA A;  5FP3 A;  1HX8 A;  5HEO A;  2V5C A;  4X1Y E;  3KV5 A;  3WAJ A;  3WAK A;  5CGM A;  3ZC0 A;  4YTN A;  4XAX B;  1WR0 A;  4HFI A;  2EHO D;  5J2T E;  5H6R B;  1AJ3 A;  4DBR A;  1OED E;  3RRW A;  4MHC A;  2CWY A;  3P4S A;  5IYZ E;  4MFR A;  4YTP A;  1WFD A;  4DV3 T;  4QH5 A;  3NBX X;  4YHJ A;  3AVR A;  4DV0 T;  5AQS B;  4HFC A;  5LHI B;  3VKG A;  2GK9 A;  2D5U A;  2WM9 A;  2CBJ A;  4IE4 A;  1XNR T;  1W0B A;  5CB4 E;  1Y01 A;  3I9W A;  3AE7 A;  3Q5W A;  3PUA A;  1DU2 A;  2LSK A;  2XAF B;  3VRA A;  3N2O A;  3P4Q A;  2YDS A;  3VHL A;  3LFM A;  4IL9 A;  3AA0 B;  4H9S E;  3KFW X;  3L39 A;  3Q5D A;  3FXD B;  3AXJ B;  2E9X B;  2N9D A;  5AQM B;  4LF8 T;  3ZMV B;  2FJD A;  4Q25 A;  1UX5 A;  2NOX A;  2BZB A;  3AA7 B;  1D1A A;  5LGU B;  5JR9 B;  4AQG A;  2NW8 A;  4HWH A;  4O4H E;  4Z90 A;  2KMF A;  4GK0 E;  2XQ3 A;  2X0Y A;  4L9I A;  3UUN A;  3KV9 A;  2LJL A;  1IBK T;  5HXS A;  4L0R A;  1ZP0 A;  5L3B B;  2V7M A;  3OVU A;  2NWB A;  3S4U A;  4CI1 B;  2L9Q A;  3O1J A;  2CPT A;  5ETW A;  4Z8X A;  4X20 E;  1UUR A;  4AIS A;  3UUB A;  2ODU A;  5KX5 E;  2WBL A;  5KDM C;  4DV5 T;  2MPK A;  4HFD A;  3ANW B;  1YQ4 A;  2H7V C;  3BQL A;  3L8R A;  5HYA A;  3ZYL A;  3CX7 B;  2CHO A;  3OYZ A;  1WCR A;  3MAC A;  1HG5 A;  1FMW A;  2BVL A;  5LGT B;  2W63 A;  5L4H A;  3LK3 B;  4A98 A;  1WYC A;  3N9M A;  1FIO A;  3QC9 A;  4AKH A;  4X1K E;  5F3J A;  3UTK A;  5ABG A;  4DV7 T;  2XQ8 A;  4GOU A;  1D1B A;  2UUB T;  3ZLI A;  1OED C;  1Y64 B;  2JQK A;  2V7J A;  5FY0 A;  4QXB B;  2XQ6 A;  3HKB E;  4ZI2 C;  4DV1 T;  4PW8 A;  1T98 A;  1J5E T;  3GN5 A;  2C5J A;  4CN4 A;  2LKG A;  3FBL A;  2VB6 A;  4C90 A;  3MJX A;  3NKZ A;  4ZS3 A;  2WQY A;  4LF4 T;  4X1I E;  2CLY C;  3PUS A;  4EEB A;  4KBM B;  2KXP B;  2W67 A;  2A2F X;  4K0K T;  2DWK A;  5LXT E;  2ZMA A;  3QNU A; 
#chains in the Genus database with same CATH homology
 1BR1 A;  1VRB A;  2NTY A;  2PJQ A;  4I4T E;  4ZHQ E;  2VAS A;  2M67 A;  5J1G A;  2MTQ A;  3H3A A;  1BR0 A;  3MZK B;  4V1A v;  2XAJ B;  4CI2 B;  3KVB A;  4WNK A;  4PAG A;  3ZYM A;  4EYY R;  5L3D B;  3PUR A;  3RYF E;  1SA0 E;  2LOP A;  2IW5 B;  3Q2M A;  1WR6 A;  4DVD A;  2CMR A;  2LE8 A;  2W00 A;  1HCI A;  2Z6E A;  3SWH A;  4AKG A;  5FMN A;  3QK6 A;  2B1E A;  5HXE A;  3ZN0 B;  5FXW A;  2CXL A;  3I1A A;  4E7Z A;  2EHO A;  3CPZ A;  3ETU A;  5JRC A;  4M1P A;  5L3G B;  1QSD A;  1MMA A;  1WLX A;  5EZY E;  5BMV E;  5IHY A;  3N9O A;  2LOS A;  5L3C B;  3QUJ A;  3O1H A;  1G73 A;  2G0U A;  4U74 A;  1KNZ A;  3LBX B;  4H63 V;  3LK4 2;  4JEH B;  4MLK A;  1O3X A;  4CI3 B;  4O8S A;  3K3N A;  5LBQ B;  3C4Z A;  3P7I A;  2C5I T;  3O1I A;  4CZZ B;  2VWA A;  1H7C A;  2LSJ A;  3SOL A;  4ZOL E;  1CUN A;  2X68 A;  2ODV A;  3RYH E;  2X9H A;  4IE0 A;  4UVB B;  5DQV A;  2YIN A;  2Q9Q D;  2ZM8 A;  4HN9 A;  3P8C D;  4O4J E;  2DI4 A;  3DP7 A;  4YFS A;  3AAA B;  5LHG B;  3RC3 A;  3MXZ A;  4AKI A;  4O4L E;  4QHO A;  4ERR A;  3RKO A;  2D0U A;  2XAH B;  1ZKE A;  5ADX L;  3HKE E;  2JQQ A;  3U78 A;  2D2S A;  3C98 B;  3J7Y q;  3F2E A;  2X51 A;  2CWO A;  2LSI A;  2DNX A;  2W62 A;  4CXY A;  3FBZ A;  2MOZ A;  1EZ3 A;  3V5S A;  5L3E B;  3MKD A;  1FMV A;  2ES0 A;  4IE5 A;  4ZI7 E;  3ZCJ A;  2C0S A;  3IHR A;  3CQG B;  4IE6 A;  4IDZ A;  4OHF A;  3FHN A;  3LJC A;  3ZJ1 A;  2Y48 B;  3UT5 E;  4EXT A;  2LT3 A;  2QGS A;  3ANW A;  4KUM B;  3R84 B;  2LHN A;  3HI2 A;  4HE8 A;  3CX8 B;  5EK2 A;  4JEU B;  3R6N A;  2ZLY A;  3ONX A;  5EK3 A;  1LRZ A;  2I59 A;  3RC8 A;  4UF0 B;  1IJ6 A;  2CA5 A;  1IJ5 A;  5FXZ A;  5LA6 E;  5M4Y A;  2X67 A;  2OA5 A;  4H9N C;  3OYX A;  5JDF A;  2WMN A;  3GN5 B;  2JJ9 A;  3Q9D A;  5JDG A;  5C8Y E;  2KIN B;  2PBI A;  4AKL A;  4AQF A;  4EOZ B;  2WSS V;  2UXN B;  3CML A;  4CQI A;  2J1D G;  4DBQ A;  1ZEE A;  4QX7 B;  4N78 D;  3HR0 A;  4EZ4 A;  3C51 A;  2KT9 A;  4IST A;  1MMG A;  3FB2 A;  1HTJ F;  4GYR A;  2V7K A;  5AFU L;  3OBV E;  3T8O A;  5JDQ A;  3MK7 C;  5CA0 E;  1ZHC A;  2Q9Q C;  5HXR A;  4EZH A;  1BR2 A;  4EAH A;  4YJ2 E;  3PU3 A;  4ANJ A;  2JRK A;  4P0B A;  2WWU A;  2Q9Q B;  5LJN A;  4ISS A;  2LEH A;  4TUY E;  2VKD A;  4J2C A;  4NUV A;  3VU7 H;  4F6R C;  1MIV A;  4BJM A;  4G2A A;  5J2U E;  1UCU A;  4GYS A;  3LK2 B;  4GK5 E;  1YKH B;  2X66 A;  4ZI3 D;  3K3Q C;  3KIN B;  3C4X A;  3PUQ A;  4BA9 A;  2ZM2 A;  2EHO C;  4OFZ A;  3ZYK A;  3U3I A;  1NAF A;  4JLE A;  4TZ4 C;  4UV9 B;  2E9X A;  5JDN A;  4XBF B;  2EHO B;  4HTE A;  2VL8 A;  3AVS A;  4TN7 B;  1LVF A;  4YJ3 E;  3RYC E;  4I55 E;  4IIJ E;  4BAY B;  4PJM A;  5LHH B;  3NZQ A;  1MMN A;  3UFE A;  3B57 A;  4JUY A;  5DAB A;  1KK7 A;  2E8I A;  4MAL A;  3N5L A;  2H7O A;  1LVK A;  4G63 A;  3RH3 A;  5L3F B;  3UUL A;  5JR9 A;  3SRZ A;  2RP4 A;  4KP3 C;  5LNK A;  3A5X A;  3KVA A;  5EK4 A;  5HAX A;  1MNE A;  2NW7 A;  5CA1 E;  4CXX A;  3I9Y A;  3PUG A;  1HS7 A;  3AAI A;  3GMI A;  5TAO A;  2MYS A;  1QUU A;  5FY7 A;  2QA7 A;  3ZEF B;  3ESL A;  1HFA A;  3J9X 1;  3ZPO A;  3C4W A;  1MND A;  4BJN A;  4XZC A;  2HPJ A;  2XUE A;  2K24 A;  3UUM A;  4DO0 A;  4HKA A;  4C91 A;  2Y8D A;  2BVM A;  2HH7 A;  2ZM0 A;  5JQG E;  1V9D A;  5FP3 A;  4WW0 A;  3KV6 A;  1HX8 A;  3NZP A;  3F57 A;  5JDL A;  4X1Y E;  5JDH A;  3K8P C;  2KZ7 B;  2LHR A;  3KV5 A;  3EUH A;  3LG7 A;  4OYK A;  3ZMT B;  4B6X A;  2W0G A;  2PFV A;  4E7S A;  4H9Q C;  1D0Y A;  4QKN A;  3WAK A;  3KV4 A;  4QXH B;  3WAJ A;  3LBX A;  4PK4 A;  4QX8 B;  4UV8 B;  3ZC0 A;  4PJL A;  2SPC A;  4XAX B;  4HGA A;  1E1H B;  4ZI3 C;  1U4Q A;  3HA4 A;  4CXW A;  3NRX A;  2EHO D;  5JDM A;  2YU2 A;  5J2T E;  3H37 A;  4O2A E;  5H6R B;  1AJ3 A;  3PDY A;  4O4I E;  4DBR A;  2N1G A;  3RRW A;  4MHC A;  2CWY A;  5IYZ E;  1G8X A;  4MFR A;  2KWH A;  2DLR A;  3B13 A;  4HFV A;  3AB3 B;  1HG2 A;  1MIY A;  2V7I A;  3NBX X;  4YHJ A;  2LM9 A;  3AVR A;  3Q5X A;  3BQK A;  3C50 A;  4OK0 A;  3CQX C;  4ASK A;  5LHI B;  3VKG A;  4EIW A;  5LGN B;  2GK9 A;  2D5U A;  2WM9 A;  2V7L A;  3MA9 A;  3AA6 B;  2L3L A;  1IZN B;  4IE4 A;  3M65 A;  4EYU A;  2L8K A;  2XHE B;  5CB4 E;  3I9W A;  4H9P C;  1D1C A;  3N2G E;  4TV8 E;  1ZV4 X;  4UIG A;  3ZMS B;  5FXX A;  4I43 B;  5H6Q B;  3Q5W A;  2LSG A;  3ZC1 A;  2CM0 A;  3RX6 A;  5KMG P;  3E08 A;  2D0T A;  3D0T A;  3PUA A;  3N9P A;  5HYA A;  2VK9 A;  2XAS B;  3O4X E;  2LSK A;  5LBM A;  2XAF B;  3HKC E;  5HXH A;  1WRD A;  4UF0 A;  2K48 A;  3N2O A;  2LSY A;  1OXZ A;  4DND A;  3VHL A;  3LFM A;  4IHJ E;  3ZMZ B;  3RRC A;  2WMO A;  3ZMU B;  3AA0 B;  3TKL B;  4H9S E;  4AI6 A;  3KFW X;  3N9Q A;  2CXD A;  3L09 A;  2E9X C;  3KBU A;  3IBP A;  5JRE A;  2N2N A;  3FXD B;  3V5U A;  1SHZ C;  4YLH A;  3L3P A;  4H9R C;  2X0L B;  3EDU A;  1MMD A;  3NRY A;  2E9X B;  3CWZ B;  1YW0 A;  4ADZ A;  4EB6 E;  2CLY B;  2N9D A;  3SS1 A;  3ZMV B;  4GIW A;  3IEE A;  4K0U A;  5LJM A;  1UX5 A;  2NOX A;  2XAQ B;  2DCF A;  5JRC B;  2C5K T;  3CVR A;  3F31 A;  2Y6X A;  2BZB A;  4PK5 A;  2Q9Q A;  3BK9 A;  3AA7 B;  3JC6 C;  2KWI B;  1D1A A;  3HL6 A;  4MBQ A;  5LGU B;  5JR9 B;  4AQG A;  2NW8 A;  4FJO A;  2CE7 A;  4O4H E;  2KMF A;  1YKE B;  2K9A A;  4GK0 E;  4AKR B;  5JVD E;  2MBG A;  5L2L A;  4L9I A;  5HWY A;  4WBN E;  4TX5 A;  3UUN A;  2DHR A;  2IC9 A;  4UVC B;  3O9X A;  2KND A;  3GWH A;  3KV9 A;  2LJL A;  4PNI A;  4PK6 A;  5HXS A;  3DTO A;  3E0Z A;  4L0R A;  4P09 A;  3WI3 A;  2IC6 A;  5L3B B;  2IAK A;  2V7M A;  4AXP A;  3OJA A;  2NWB A;  3N2K E;  4ZI2 D;  4P0A A;  5HXC A;  3S4U A;  1FEW A;  4CI1 B;  2L9Q A;  3K3O A;  3O1J A;  4UEL A;  1OWA A;  5ETW A;  3N9N A;  1S35 A;  4I50 E;  1U5P A;  3HKD E;  1UX4 A;  4Z8X A;  4X20 E;  2YK0 A;  2K5B B;  3C64 A;  3DJB A;  2ODU A;  5DQW A;  2YEV C;  3PU8 A;  5FNV E;  5LP6 E;  2UXX B;  5KX5 E;  4QWN B;  2E9X D;  1YD8 G;  2WBL A;  2DWG A;  5KDM C;  2VKO A;  2XQY A;  2V26 A;  4H9O C;  3ANW B;  2JMK A;  2P9B A;  2H3R A;  3RPU A;  2H7V C;  2NTX A;  2PG8 A;  2RA1 A;  2YU1 A;  3BQL A;  4ILU A;  2HPL A;  3CX6 B;  4UEM A;  5LOV E;  3ZYL A;  3CX7 B;  3I0Q A;  2CXF A;  3E22 E;  2BDE A;  3OYZ A;  1MIW A;  5FXV A;  3ETV A;  3MAC A;  3JC6 D;  1HG5 A;  1FMW A;  2BVL A;  4AQF C;  5LGT B;  2W63 A;  5LCY A;  3LK3 B;  2JMH A;  1WYC A;  3N9M A;  1FIO A;  1LKX A;  3OKQ A;  4A56 A;  3QC9 A;  4WBO A;  4AKH A;  4X1K E;  4TV9 E;  3ZCI A;  2NP9 A;  5E0O A;  1Z0P A;  5F3J A;  3I0O A;  3UTK A;  1D0Z A;  4IGU A;  5LG4 A;  4UVA B;  4DMV A;  5LYJ E;  3KBT A;  1HF8 A;  5A1L A;  4GOU A;  3PE0 A;  1D1B A;  2XTL A;  3ZLI A;  5HWX A;  1X79 A;  3KDS E;  1Y64 B;  3EDV A;  1NWM X;  2VKH A;  5JH7 E;  2V7J A;  4PFO A;  5FY0 A;  3ZJ2 A;  2W61 A;  4QXB B;  2CEA A;  4L5G A;  3W15 B;  2X9Y A;  2ACX A;  3HKB E;  3ZN1 B;  4ZI2 C;  3VKH A;  4DMW A;  3AAE B;  3BQI A;  4FI5 A;  4PW8 A;  3UUX B;  4O2B E;  3GA8 A;  1T98 A;  4IE7 A;  4QXC B;  2JPF A;  2X9X A;  2XAG B;  5DJQ C;  2NW9 A;  1WYB A;  3GN5 A;  2C5J A;  1BR4 A;  2WAU A;  4ZS2 A;  2X9W A;  4PFP A;  3FBL A;  4PJJ A;  2VB6 A;  3AA1 B;  5GON E;  4UXN B;  3MJX A;  4C90 A;  4ZS3 A;  1S94 A;  4X1I E;  3EVY A;  2CLY C;  3RYI E;  4U72 A;  1D0X A;  3CQC B;  3PUS A;  4HEA A;  3N9L A;  4KBM B;  5F8P A;  2VKJ A;  1VOM A;  2KLQ A;  2KXP B;  4KMC A;  1B7T A;  2A72 A;  2V1D B;  4H63 H;  4NUU A;  3FXE B;  1IAP A;  2A2F X;  3PTR B;  5FY1 A;  5FYM A;  1US7 B;  3IF8 B;  2DWK A;  5LXT E;  2CCQ A;  4OYJ A;  5JR9 C;  2ZMA A;  4PJN A;  2A3D A;  3CKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...