1S3DA

Arsenate reductase r60a mutant from e. coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
b'NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title Arginine 60 in the ArsC arsenate reductase of E. coli plasmid R773 determines the chemical nature of the bound As(III) product.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 37
structure length 138
sequence length 138
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1s3dA00
4L0UA 4RI6A 1VF1A 1QMVA 2DJ2A 5DCGA 4POMA 1G6WA 5G1KA 3ZMKA 4EDZA 3ZL5A 3WGDA 3LJRA 2DJKA 3GIXA 3UVTA 2C1YA 4GSSA 1PQNA 1TRWA 1WRYA 3I9V2 5J4UA 2IL3A 4V2LA 2C0EA 4PQ1A 3I43A 1M2DA 2HFDA 4DVCA 1FW1A 3ME7A 2R5GA 3GKNA 1M0UA 2VL9A 4PUAA 3UOMA 2B1LA 2LRTA 1URMA 3FZ9A 4RQRA 4HDEA 3UEMA 2KHPA 1TK5B 3I6AA 2DIZA 2CA8A 2GQMA 5H5RA 3QPMA 4YQUA 4G2EA 3F0IA 3HVXA 2H76A 2WDUA 4NHZA 1XW9A 3VWUA 2M72A 3RHBA 2DMMA 2MBTA 2DBCA 4LL4B 4P3YB 1JFUA 2QGVA 2O8VB 3ZLPA 5DBQA 4MJBA 2L59A 4PGTA 2RIIA 1V9WA 3IXRA 3PINA 1B8XA 2P31A 1HYUA 3F8UA 4MJAA 5F8BA 2IJYA 4G9HA 4IBPA 1M2BA 3J7Yk 3GSSA 4MH3A 1PN9A 3RAZA 1AQXA 2IMEA 2D2ZA 3UL3A 4NXIA 1VF2A 4AJ6A 4AJ7A 1AQVA 2R4VA 2J23A 4L0WA 3ZZXA 2FNOA 4O92A 3HJPA 3GV1A 5ENUA 1KBNA 2YJHA 2DJ0A 5D9TA 1M2AA 2HYXA 3IRAA 3CSHA 4ZL9A 4ZXGA 5CNWA 2LRCA 3K8NA 2VIMA 2VD1A 1O8WA 3WD6A 1TDIA 3C71A 3IK7A 4Q5NA 1ABAA 2AV4A 2FD3A 1FOVA 3QFAC 4ZB9A 3TOUA 3TKSC 3EE2A 3APOA 4EDYA 4GSNA 4JR6A 4TR1B 4BWSA 1TK8B 1JZOA 2H1BA 2HT9A 2V6KA 3H4KA 2HRFA 1K3LA 3WT2A 4K0NA 2FGXA 3C73A 1OC9A 4IKHA 1SKWB 3IDVA 1TJDA 3LFLA 1CQHA 4KX4A 3GX8A 2GGTA 2LKUA 2YCDA 1QUWA 1SENA 4NWYA 5B6MA 4K9ZA 1K0CA 3GMFA 1DUGA 2FCHA 1A0FA 3ZFLA 2LRNA 11GSA 4BVYA 2RM6A 2V2GA 2DJ3A 3O76A 5IMZA 4IW9A 3TKRA 6GSSA 4N10A 4ID0A 1B9YC 5ELGA 2VLUA 2MMOA 3E9JB 2XC2A 2I9HA 1H75A 1PSQA 5JCWA 3QMXA 2O85A 4EC0A 2R6KA 4V2MA 2O89A 1TOFA 2P5QA 1WP0A 2NPBA 2DJ1A 3M9KA 2YZUA 1XBSA 2F3MA 4OO4A 4Q5QA 1GSEA 3APSA 1Z9HA 2OE1A 2H0IA 1WMJA 2LNSA 2VLVA 2WCIA 1TP9A 2WGRA 1Z5YE 1Z7PA 3TUEA 4LA1A 1RK4A 3DKSA 3LYPA 4LL1B 4EF0A 4F9ZA 4IELA 4E8EA 1XVWA 4YAVA 1U6TA 4KH7A 3IPZA 2X99A 2DMLA 1S3CA 1F3BA 3CMIA 5JWQB 3KXOA 1O81A 5J9CA 1W89A 1QQ2A 1PD21 5JCGA 4F0BA 4PQHA 3A2WA 3VPTA 1HQOA 1HNBA 5DCHA 6GSVA 3A2VA 3PR8A 2O7KA 3VURA 4KSOA 5DALA 2GQKA 3BD2A 1B9XC 1GNEA 4K2DA 1B4PA 2G2QA 2GZYA 1XW5A 2HZEA 2YANA 2JL4A 10GSA 2NBSA 2YWOA 4WF5A 2KOKA 2CZ3A 3GHAA 2B5YA 4HS1A 1SK1A 3FR9A 3KEBA 1OC9B 1XOAA 2B7KA 3DXBA 3CRTA 1DE1A 2B6MA 3G7YA 1XWKA 5HFGA 1RQMA 4XS6A 1NHOA 2CVBA 3CRUA 4YQMA 1U3AA 1AAZA 5IO0A 5ECOB 4ZBAA 5DAKA 5IMCA 3RHCA 3F3QA 2JSZA 1Q4JA 5EVOA 1ZGNA 3VFIA 1AW9A 3D22A 2VD0A 3QD9A 4EKZA 2FWGA 2X8GA 4JRRA 2V1MA 2HSYA 2WJUA 1V40A 2GZZA 1F2EA 5CYYA 1SYRA 3MNGA 3Q6OA 3VWVA 1GUMA 4O5RA 4MH2A 2C8UA 3VWWA 1T00A 2GT5A 3R2QA 4EXJA 3VPQA 1JZRA 2QKEA 3EYTA 5IM9A 3H8QA 4DSSA 3E0UA 5D73A 3M9JA 2FWHA 5KN1A 1U88A 4MF6A 5IPGA 5ECQB 3IV4A 4MPFA 3KP9A 1J9BA 1XWAA 1OKDA 4I2UA 1J08A 3FEUA 1M9AA 2EIRA 1E6BA 1ZL9A 4IS0A 4KA0A 4NHWA 1AQWA 4WR4A 1UA5A 5D9VA 1DBYA 2XBQA 4N30A 2EIQA 4GQFA 5D8IA 14GSA 1PKWA 3HVSA 1X9SB 5ELAA 2M46A 3MWHA 2YWIA 5AIVA 2A4VA 3IR4A 1PL2A 2PN8A 5G5FA 1B48A 1ACVA 1O8XA 3F9UA 1ERTA 3LG6A 4V1Ap 1PRXA 5A4UA 5ECHB 2C4JA 2DLXA 3U5RE 2ON7A 3KM6A 2G0FA 1KTEA 1ZYQB 4ZBBA 3ZMLA 20GSA 6GSUA 5G30A 5DJLA 1GSQA 4HQZA 1NHYA 1YKAA 3IBHA 2VM1A 4OFMA 5J3RA 3KGKA 2RUEA 1A0RP 4NV5A 5G5EA 4KDXA 5G1LA 3ZRDA 4IJIA 5DALB 2IFQA 1ZZYA 5HFKA 4IGJA 1EP8A 3Q18A 2C3QA 1XIYA 2JZTA 3CTFA 5JCUA 4POLA 1UN2A 4FH8A 5HR3A 2HZEB 1B4QA 2F8AA 3SBCA 3TB2A 1PL1A 2VLTA 2YWMA 4HJ2A 2HSHA 5ECMB 4Q5FA 3UBLA 1G7EA 6GSYA 2V41A 1YEPA 1GTAA 5CO3A 5IOWA 3GL3A 4OO5A 3IA1A 18GSA 1V57A 3BCKA 4ECCA 3HD5A 4KCAA 5ECSA 2JADA 4L5LA 1GLQA 5EL8A 2L4CA 2JZSA 2FA4A 3KCMA 1O73A 2O87A 4XCSA 2GVPA 1DE2A 5IMVA 1F37A 4RQXA 2PVQA 3G7JA 3HXSA 2NDOA 3CYNA 1ST9A 4DSRA 1X9MB 2H6ZA 4V2NA 1A8LA 4EL1A 2JZRA 3D6IA 4JR4A 3HJOA 2OE0A 3D21A 2PU9C 3GA4A 4ECIA 3DEXA 2HI7A 1I5GA 4KE3A 19GSA 4F2IA 3DRNA 1PA3A 2DSAA 3KH7A 1FO5A 1GRXA 4KGIA 4OFTA 1BEDA 4IP1A 3F4SA 1M9BA 2C3TA 1PKZA 4TR3A 2CQ9A 2WFCA 1R5AA 2TIRA 1GNWA 4CHSA 1GH2A 3N9JA 2GDRA 1SJIA 2OADA 4WF4A 4YH2A 4WBRD 1GSDA 2K9FA 3MSZA 1XW6A 3DYRA 4OCFA 3ZIVA 4HEA2 4TXOA 2AB6A 1TRUA 3L78A 3QR6A 2YP6A 1EV4A 2YPMA 3UMAA 3FZ5A 2H66A 9GSSA 2VL2A 3VLNA 4QQ7A 2DIYA 2ZUPA 2E2MA 4GSTA 1X0RA 3TJGA 6GSXA 3LQ7A 1GTIA 2GQLA 2YN1A 2DJJA 3U6VA 3TJKA 3C1SA 1FG4A 1Z3EA 2GT6A 4NMUA 4MZCA 3US3A 1T8EB 3TKSE 4NV2A 2WS2A 2K8SA 3LGCA 2CX3A 1OVNA 1K0AA 1AC1A 1O7UA 4QL9A 5F06A 5ID2A 3QFBC 2LNTA 5LCZA 2ZCTA 5CRGA 1TI1A 1SL2B 3TOTA 2CAQA 3UJ1A 4WXTA 1JLVA 8GSSA 5H5SA 22GSA 4KDYA 2CZ2A 1R26A 4RI7A 5DDLA 1XOBA 1K0MA 1Y6EA 5INYA 4TXVA 2IPAA 2WULA 4MPGA 5ABRA 2LUSA 4ULXA 2H19A 4EUYA 1JLWA 4XS4B 1Q98A 5IMDA 1SKSB 1BX9A 4WBJA 5G31A 3BOAA 2AJQB 2B3SA 2H71A 4FYCA 5ECPB 5COHA 2HZFA 1T4YA 2VOCA 1YQ1A 3F4RA 1SKRB 2Z9SA 1T1VA 2H30A 3M1GA 1N2AA 2OKAA 1T4ZA 3KTBA 4BWQA 4MZWA 1LBKA 2V6OA 1EOGA 5GSSA 2PBJA 2OE3A 1TU8A 5F05A 4G10A 3SWLA 3TGZA 4ML1A 1ON4A 2MYGA 3DIEA 1YJ6A 2H1DA 1XWBA 1Z6NA 5D9WA 1VRSD 2L6CA 1HNCA 2B5XA 1XZOA 4MCUA 4TKYA 4FYBA 3CSIA 5KN0A 1XPVA 3LXZA 4AJ8A 3UVHA 2CX4A 1EP7A 2B7JA 2GSTA 2PWJA 2H70A 2QSIA 2R37A 4IQ1A 3H1NA 4PUFC 2FA8A 4WETA 1SK0A 1OE8A 2BMXA 3FZ4A 2C0FA 5DQYA 2FY6A 2V32A 1GUHA 2CT6A 3TJFA 4HJMA 2GTUA 4TXOB 5KEJA 4N0VA 1F9MA 3F3RA 4MJCA 3NIVA 1O6JA 2YOIA 5AIXA 2YWNA 4ZL8A 5FWGA 3TRXA 2YJ7A 4XHMA 3IC4A 3HHVA 1F3AA 1NM3A 2A2SA 4JE1A 2I1UA 4ZBDA 5GZZB 3WGXA 4EE0A 5E59A 2HXKA 2P0GA 4JEDA 7GSSA 4IN0A 5D96A 1VF4A 3P2AA 4I8BA 1GP1A 1PGTA 3GN3A 4MA9A 1GSUA 4HZ4A 5CRWA 2I3YA 3N5OA 1YKCA 2LTKA 1G6YA 3I69A 2L5LA 4XRDA 2IMFA 2J9HA 3L0HA 2XPDA 5ECKB 4WKWA 1XFLA 4IHUA 3HZ4A 5DQSA 1WE0A 3HKRA 4HU7A 2MMZA 1TW9A 2TRXA 3FYGA 4YQVA 4ZL7A 5FT3A 1JZWA 2E7PA 6GSWA 1WOUA 4TVEA 1SU9A 1EWXA 4EVMA 4F0CA 1T3BA 5GAPD 1QGVA 3GKXA 4QL7A 1PX7A 5DJMA 4Q5RA 1XCCA 2AAWA 4PX1A 3ZTLA 4BPYA 1GTUA 3W6GA 5KN2A 5L71A 3VI5A 3D4TA 4Z7XA 3BBYA 3TCOA 3NOFA 5HFIA 5HQPA 5J9BA 1LU4A 1U87A 3EWLA 3CTGA 3RPPA 4V1Ag 2N5AA 3F4TA 3QAVA 4GCIA 3LEFA 3KD0A 1MDJA 1ILOA 3S9FA 2X64A 5IO2A 1TRSA 2REMA 4XS1A 1WJKA 3RDWA 2VL3A 4JBBA 4PNFA 3VK9A 1WIKA 2H1GA 1ZOFA 2ALBA 4X1UA 3ERWA 5A5KA 2WB9A 1K0DA 2OBIA 3EMPA 3MDKA 1GUKA 5AN1A 5HR1A 4BVXA 1G7OA 2CAIA 3TJJA 4L5OA 1FHEA 3IAS2 2QC7A 2IMIA 3ERGA 1GWCA 3FZAA 3GNJA 2C0DA 5CP1A 2IIYA 3W8SA 2AHEA 4MF5A 2GSRA 1ZYEA 3F6FA 2YV9A 4WEYA 2WRTA 5J5NA 5B8BA 3HZ8A 2HE3A 4ILFA 2VCVA 2LEGA 1M7TA 1MTCA 3KH9A 4OD7A 3LYKA 4GWRA 4AGSA 2LSTA 3TKQA 2B1KA 4IQAA 1YY7A 3KP8A 1AIUA 4GTUA 2H74A 3ZITA 1GULA 3VWXA 1V58A 4ZB8A 3L9VA 4MF7A 2FHEA 4I2TA 2EC4A 3ZVJD 2ON5A 4MABA 3FKFA 1XXUA 3ZREA 3IHQA 2L6DA 1W4VA 3EMXA 3EINA 3VI7A 5ECIB 1K0OA 2JSYA 3HYPA 4OCEA 1EEMA 2TRCP 1VGLA 2H73A 4I5QA 4HQSA 2OJLA 3F63A 4TR1A 1ZCPA 4F82A 4J57E 2MMAA 2MBSA 4LMWA 2GZPA 1GSYA 1X5EA 3QAWA 4O32A 1XWCA 1K3YA 3GL5A 4J2FA 3HJMA 5JWRB 4O7HA 1SL0B 4X0XA 2HNLA 2VL2C 2YZHA 4FO5A 1BAYA 2LJRA 2LJAA 1U3IA 5LD0A 1GSFA 3F6DA 1QK8A 4N11A 4RUVA 4XRAA 5DAKB 1OAZA 1FB6A 4XTSA 4L8EA 5B8AA 1O85A 3Q19A 2H8LA 3ZYWA 1RW1A 3KIJA 5G2ZA 1THOA 3GH9A 3HY2A 1GTBA 3M8NA 5CAXA 5J41A 4PXOA 3L9UA 5H5QA 1EZKA 3ERFA 1QXHA 4HI7A 1X5CA 4I97A 4TN8A 4K7NA 5GAND 2FUG2 2IMKA 4IP6A 2YNXA 6GSTA 5E4WA 4DSSB 3KMOA 5D9XA 2AYTA 3GKMA 1TXXA 2P5RA 3LWAA 2LV3A 16GSA 3CXGA 5CRHA 4POBA 3FW2A 3GYKA 1KEBA 1X5DA 2M80A 2XHFA 3TDGA 1SK2A 4PQIA 1OC8A 3KMNA 3CBUA 4TOPA 3APQA 2KP2A 1CQGA 3GFKA 3P90A 2LJKA 5A4WA 1S3DA 2OACA 1E2YA 1MDIA 3OR5A 1BJXA 2JACA 1NSWA 1A2MA 2CV4A 2X8HA 4K0GA 1ML6A 4WR5A 1XVQA 4LLRA 1PMTA 3D0ZA 1YF1A 2VCXA 3FHKA 3WT1A 5IPHA 1A23A 1AUCA 1AXDA 4NPBA 4ECBA 1WPIA 3C8EA 1K0NA 4JZQA 4OFNA 3EURA 1EOHA 12GSA 4ZB6A 3RPNA 1YZXA 3DWVA 2FWFA 2VCZA 1Z7RA 3P8WA 5CRDA 4F03A 2JU5A 4BL7A 2IFQB 2RUFA 5ECLB 4TW5A 3IE3A 4K7IA 1K0BA 2NVLA 1YEXA 4KDUA 3DGQA 1JZDA 3QDNA 3FR3A 2F8FA 2H6YA 4GLTA 1KNGA 4GXZA 1PX6A 1ERUA 2C0GA 4DEJA 1R4WA 5EPFA 3O6TA 3HDCA 3BJ5A 3GKKA 2BTOT 3QAGA 1DSBA 2CVDA 3GUSA 3EU4A 1WWJA 4MJEA 1A2LA 1SJ6A 2H0GA 2OBKA 2XPEA 1OE7A 3M0FA 3G9BA 2L5OA 4E8HA 3J7Yb 4K6XA 1UVZA 3LXTA 1V2AA 3L4NA 2E0QA 3UARA 4BA7A 5JWOB 3FY7A 3O3TA 5C04A 5IMAA 1EEJA 2HLSA 4OWYA 1A24A 2AUVA 3DD3A 2VO4A 1GLPA 3IOSA 3JCML 4OMVA 3FK8A 2ES7A 1Z6MA 1TK0B 1MDKA 3WYWA 4MMMA 4PNGA 1NW2A 4ACSA 3TKSA 2NTOA 4GF0A 1EGRA 3TJBA 5ECNB 17GSA 4KW6A 1THXA 1MD3A 5ECRB 4ML6A 5F0GA 1T7PB 1TU7A 3GRXA 3PGTA 1GL8A 13GSA 3QOUA 2K6VA 4KB3A 1BG5A 1G0TA 2PMTA 3EC3A 3ED3A 2MMNA 5IIZA 3L9SA 2KLXA 5EY6A 4GQCA 2MZCA 4TR4A 3RBTA 4YAPA 2PVOC 2VAFA 1MEKA 2RM5A 5B7CA 2C80A 3KZQA 4ZILA 2GSQA 2PGTA 3HCZA 5FHIA 5F07A 3A3TA 3LSZA 2A2RA 2F51A 1HNAA 2C3NA 3GH6A 5D93A 2ZNMA 4MP4A 2N5FA 4EO3A 2N5BA 2L57A 1FVJA 2GS3A 2L4QA 3UBKA 1LJRA 2VUPA 2XBIA 5ID2B 1VF3A 3GURA 4G19A 1FB0A 2H01A 1YF0A 1A2JA 1S3AA 3LORA 3QCPA 2VCTA 3GX0A 1GSSA 3IK9A 4KUNA 1X9WB 4MK3A 1YDKA 3GTUA 1M99A 4TR0A 2B5EA 1BYEA 3E3EA 2BJXA 4CDOA 2RLIA 1K3OA 2FLSA 3EU3A 1R7HA 2VCWA 1F6MC 4KNDA 4K1FA 4D73A 1ERWA 2R2JA 1IYHA 2H1AA 3FRCA 3DMLA 3KTLA 4MZBA 3WGEA 2H0HA 2CVKA 3ME8A 2YV7A 3G7IA 4FYUA 2IMDA 3TKPA 3D4MA 5CREA 1TI3A 4K7OA 4CW9A 4ECJA 1JHBA 2GLRA 3H79A 3TRPA 4HZ2A 1TTZA 3FR6A 2LQQA 3HVVA 1MD4A 1TKDB 4DSQA 1OC3A 2OA7A 1R5PA 4GRFA 5AISA 3GSTA 1V98A 1ERVA 3M3MA 4PURA 1SD8A 1EGOA 3TRQA 2I4AA 5AGYA 4ISDA 3PH9A 5IMFA 3IAM2 1Y25A 3DVWA 2PUKC 3A2XA 2HRNA 1HD2A 3UAPA 4KSMA 3AY8A 4J56E 4NAXA 5HR0A 2PPTA 2E2GA 2H72A 2DC5A 1C72A 2FWEA 4N0ZA 1UC7A 1A8YA 1IYIA 3P7XA 3CSJA 3ZIJA 4H86A 2PERA 1FVKA 3BCIA 3UIWA 1OYJA 1ZMAA 2X8CA 3D5JA 3W8JA 5IOXA 1FAAA 4HU9A 1USBA 1XWGA 3EVIA 4MLYA 2EIOA 4HOJA 4KAEA 4XIHA 1SD9A 1TRVA 2IN3A 4TRXA 2WZ9A 4MDCA 3NZNA 1SJZA 3H93A 1SL1B 4HUAA 2KUCA 3KJYA 5A4VA 2H6XA 1H4OA 3ZFBA 2LS5A 2H75A 3V1WA 4FIWA 2I81A 2VM2A 3C7MA 2IWTA 4I6XA 1QFNA 4K8MA 5GSTA 5KN3A 4AF2A 3Q74A 5HR2A 5DVBA 1SYXA 2F9SA 2LQOA 3C1RA 2R3XA 4KCEA 4LMVA 3DVXA 2KP1A 2K8VA 4ZIJA 3GTUB 2GSSA 2VCQA 5C00A 4POKA 2K18A 5IQYA 3HA9A 4X43A 1N8JA 3ISOA 1BQ7A 4IVFA 4XS4A 1OKTA 5LNKe 3ZVJA 3A5WA 1EV9A 1I9DA 1J0FA 4IJ3A 5B6NA 3MAKA 4JU5A 4D73B
chains in the Genus database with same CATH superfamily
4L0UA 4RI6A 1VF1A 1QMVA 2DJ2A 5DCGA 4POMA 1G6WA 5G1KA 3ZMKA 4EDZA 3ZL5A 3WGDA 3LJRA 2DJKA 3GIXA 3UVTA 2C1YA 4GSSA 1PQNA 1TRWA 1WRYA 3I9V2 5J4UA 2IL3A 4V2LA 2C0EA 4PQ1A 3I43A 1M2DA 2HFDA 4DVCA 1FW1A 3ME7A 2R5GA 4CY8A 1ZYPA 3GKNA 4CY6A 1M0UA 2VL9A 4PUAA 3UOMA 2B1LA 2LRTA 1URMA 3FZ9A 4RQRA 4HDEA 3UEMA 2KHPA 1TK5B 3I6AA 2DIZA 2CA8A 2GQMA 5H5RA 3QPMA 4YQUA 4G2EA 3F0IA 3HVXA 2H76A 2WDUA 4NHZA 1XW9A 3VWUA 2M72A 3RHBA 2DMMA 2MBTA 4BVXB 2DBCA 4LL4B 4P3YB 1JFUA 2QGVA 2O8VB 3ZLPA 5DBQA 4MJBA 2L59A 4PGTA 2RIIA 1V9WA 3IXRA 3PINA 1B8XA 2P31A 1HYUA 3F8UA 4MJAA 5F8BA 2IJYA 4G9HA 4IBPA 1M2BA 3J7Yk 1M3IA 3GSSA 4MH3A 1PN9A 3RAZA 1AQXA 2IMEA 2D2ZA 3UL3A 4NXIA 1VF2A 4AJ6A 4AJ7A 1ZYNA 4USSA 1AQVA 2R4VA 2J23A 4L0WA 3ZZXA 2FNOA 4O92A 3HJPA 3GV1A 5ENUA 1KBNA 3EPTA 2YJHA 2DJ0A 5D9TA 1M2AA 2HYXA 3IRAA 3CSHA 3HVNA 4ZL9A 4ZXGA 5CNWA 2LRCA 3K8NA 2VIMA 2VD1A 1O8WA 3WD6A 1TDIA 3C71A 3IK7A 4Q5NA 1ABAA 1PN0A 2AV4A 2FD3A 1FOVA 3QFAC 4ZB9A 3TOUA 3TKSC 3EE2A 3APOA 4EDYA 4GSNA 4JR6A 4TR1B 4BWSA 1TK8B 1JZOA 2H1BA 2HT9A 2V6KA 3H4KA 2HRFA 1K3LA 3WT2A 4K0NA 2FGXA 3C73A 1OC9A 4IKHA 1SKWB 3IDVA 1TJDA 3LFLA 1CQHA 4KX4A 3GX8A 2GGTA 2LKUA 2YCDA 1QUWA 1SENA 4NWYA 5B6MA 4K9ZA 1K0CA 3GMFA 1DUGA 2FCHA 1A0FA 3ZFLA 2LRNA 11GSA 4BVYA 2RM6A 2V2GA 2DJ3A 3O76A 5IMZA 4IW9A 3TKRA 6GSSA 4N10A 4ID0A 1B9YC 5ELGA 2VLUA 2MMOA 3E9JB 2XC2A 2I9HA 1H75A 1PSQA 5JCWA 3QMXA 2O85A 4EC0A 2R6KA 4V2MA 2O89A 1TOFA 2P5QA 1WP0A 2NPBA 2DJ1A 3M9KA 2YZUA 1XBSA 2F3MA 4OO4A 4Q5QA 1GSEA 3APSA 1Z9HA 2OE1A 2H0IA 1WMJA 2LNSA 2VLVA 2WCIA 1TP9A 2WGRA 1Z5YE 1Z7PA 3TUEA 4LA1A 1RK4A 3DKSA 3LYPA 4LL1B 4EF0A 4F9ZA 4YKGA 4IELA 4E8EA 1XVWA 4YAVA 1U6TA 4KH7A 3IPZA 2X99A 2DMLA 1S3CA 1F3BA 3CMIA 5JWQB 3KXOA 4FQUA 1O81A 5J9CA 1W89A 1QQ2A 1PD21 5JCGA 4F0BA 2UZ8A 4PQHA 3A2WA 3VPTA 1HQOA 4BL7B 1HNBA 5DCHA 6GSVA 3A2VA 3PR8A 2O7KA 3VURA 4KSOA 5DALA 2GQKA 3BD2A 1B9XC 1GNEA 4K2DA 1B4PA 2G2QA 2GZYA 1XW5A 2HZEA 2YANA 2JL4A 10GSA 2NBSA 3FMWA 2YWOA 4WF5A 2KOKA 2CZ3A 3GHAA 2B5YA 4HS1A 1SK1A 3IHGA 3FR9A 3KEBA 1OC9B 1XOAA 2B7KA 3DXBA 3CRTA 1DE1A 2B6MA 3G7YA 1XWKA 5HFGA 1RQMA 4XS6A 1NHOA 2CVBA 3CRUA 1U3AA 4YQMA 1AAZA 5IO0A 5ECOB 4ZBAA 5DAKA 5IMCA 3RHCA 3F3QA 2JSZA 4BVYB 1Q4JA 1ZGNA 5EVOA 3VFIA 1AW9A 3D22A 2VD0A 3QD9A 4G0KA 4EKZA 2FWGA 2X8GA 4JRRA 2V1MA 2HSYA 1XG8A 2WJUA 1V40A 2GZZA 1F2EA 5CYYA 1SYRA 3MNGA 3Q6OA 3VWVA 1GUMA 4O5RA 4MH2A 2C8UA 3VWWA 1T00A 2GT5A 3R2QA 4EXJA 3VPQA 1JZRA 2QKEA 3EYTA 5IM9A 3H8QA 4DSSA 3E0UA 5D73A 3M9JA 2FWHA 5KN1A 1U88A 4MF6A 5IPGA 5ECQB 3IV4A 4MPFA 3KP9A 1J9BA 1XWAA 1OKDA 4I2UA 1J08A 3FEUA 1M9AA 2EIRA 1E6BA 1ZL9A 4IS0A 4KA0A 4NHWA 1AQWA 4WR4A 1UA5A 5D9VA 1DBYA 2XBQA 4N30A 2EIQA 4GQFA 5D8IA 14GSA 1PKWA 3HVSA 1X9SB 5ELAA 2M46A 3MWHA 2YWIA 5AIVA 2A4VA 3IR4A 1PL2A 2PN8A 5G5FA 1B48A 1ACVA 1O8XA 3F9UA 1ERTA 3LG6A 4V1Ap 1PRXA 5A4UA 5ECHB 5KOWA 2C4JA 2DLXA 3U5RE 2ON7A 3KM6A 2G0FA 1KTEA 1ZYQB 4ZBBA 3ZMLA 20GSA 6GSUA 5G30A 5DJLA 1GSQA 4HQZA 1NHYA 1YKAA 3IBHA 2VM1A 4OFMA 5J3RA 3KGKA 2RUEA 1A0RP 4NV5A 5G5EA 4KDXA 3R3EA 5G1LA 3ZRDA 4IJIA 5DALB 2IFQA 1ZZYA 5HFKA 4IGJA 1EP8A 3Q18A 2C3QA 1XIYA 2JZTA 3CTFA 5JCUA 4POLA 1UN2A 4FH8A 5HR3A 2HZEB 1B4QA 2F8AA 3SBCA 3TB2A 1PL1A 2VLTA 2YWMA 4HJ2A 2HSHA 4KF9A 2R0GA 5ECMB 4Q5FA 3UBLA 1G7EA 6GSYA 2V41A 1YEPA 1GTAA 5CO3A 5IOWA 3GL3A 4OO5A 3IA1A 18GSA 1V57A 3BCKA 4ECCA 3HD5A 4KCAA 5ECSA 2JADA 4L5LA 1GLQA 2HSMA 2QA2A 5EL8A 2L4CA 2JZSA 4ICYA 2FA4A 3KCMA 1O73A 2O87A 4XCSA 2GVPA 1DE2A 5IMVA 1F37A 4RQXA 2PVQA 3G7JA 3HXSA 2NDOA 3CYNA 1ST9A 4DSRA 1X9MB 2H6ZA 4V2NA 1A8LA 4EL1A 2JZRA 3D6IA 4JR4A 2HRAA 3HJOA 2OE0A 3D21A 2PU9C 3GA4A 4ECIA 3DEXA 2HI7A 1I5GA 4KE3A 19GSA 4F2IA 3DRNA 1PA3A 2DSAA 3KH7A 1FO5A 1GRXA 4KGIA 4OFTA 1BEDA 4IP1A 3F4SA 1M9BA 2C3TA 1PKZA 4TR3A 2CQ9A 2WFCA 1R5AA 2TIRA 1GNWA 4CHSA 1GH2A 3N9JA 2GDRA 1SJIA 2OADA 4WF4A 4YH2A 4WBRD 1GSDA 2K9FA 3MSZA 1XW6A 3DYRA 4OCFA 3ZIVA 4HEA2 4TXOA 2AB6A 1TRUA 3L78A 3QR6A 2YP6A 1EV4A 2YPMA 3UMAA 3FZ5A 2H66A 9GSSA 2VL2A 3VLNA 4QQ7A 2DIYA 2ZUPA 2E2MA 4GSTA 1X0RA 3TJGA 6GSXA 3LQ7A 1GTIA 2GQLA 2YN1A 2DJJA 3U6VA 3TJKA 3C1SA 1FG4A 1Z3EA 2GT6A 4NMUA 4MZCA 3US3A 1T8EB 3TKSE 4NV2A 5BRTA 2WS2A 2K8SA 3LGCA 2CX3A 1OVNA 1K0AA 1AC1A 1O7UA 4QL9A 5F06A 5ID2A 3QFBC 2LNTA 5LCZA 2ZCTA 5CRGA 1TI1A 1SL2B 3TOTA 2CAQA 3UJ1A 4G0IA 4WXTA 1JLVA 8GSSA 5H5SA 22GSA 4KDYA 3MYDA 2CZ2A 4EIQA 1R26A 4RI7A 5DDLA 1XOBA 1K0MA 1Y6EA 5INYA 4TXVA 2IPAA 2WULA 4MPGA 5ABRA 2LUSA 4ULXA 2H19A 4O5UA 1JLWA 4XS4B 4EUYA 1Q98A 5IMDA 1SKSB 1BX9A 4WBJA 5G31A 3BOAA 2AJQB 2B3SA 2H71A 4FYCA 5ECPB 5COHA 2HZFA 1T4YA 2VOCA 1YQ1A 3F4RA 1SKRB 2Z9SA 1T1VA 2H30A 3M1GA 1N2AA 2OKAA 1T4ZA 3KTBA 4BWQA 4MZWA 1LBKA 2V6OA 1EOGA 5GSSA 2PBJA 2OE3A 1TU8A 5F05A 4G10A 3SWLA 3TGZA 4ML1A 1ON4A 2MYGA 3DIEA 1PFOA 1YJ6A 2H1DA 1XWBA 1Z6NA 4A5PA 5D9WA 1VRSD 2L6CA 1HNCA 3MIXA 2B5XA 1XZOA 4MCUA 4TKYA 4FYBA 3CSIA 5KN0A 1XPVA 3LXZA 4AJ8A 3UVHA 2CX4A 1EP7A 2B7JA 2GSTA 2PWJA 2H70A 2QSIA 2R37A 4IQ1A 3H1NA 4PUFC 2FA8A 4WETA 1SK0A 1OE8A 2BMXA 3FZ4A 2C0FA 5DQYA 2FY6A 2V32A 1GUHA 2CT6A 3TJFA 4HJMA 2GTUA 4TXOB 5KEJA 4N0VA 1F9MA 3F3RA 4MJCA 3NIVA 1O6JA 2YOIA 5AIXA 2YWNA 4ZL8A 5FWGA 3TRXA 2YJ7A 4XHMA 3IC4A 3HHVA 1F3AA 1NM3A 2A2SA 4JE1A 2I1UA 4ZBDA 5GZZB 3WGXA 4EE0A 3PPUA 5E59A 2HXKA 2P0GA 4JEDA 7GSSA 4IN0A 5D96A 1VF4A 3P2AA 4I8BA 1GP1A 1PGTA 3GN3A 4MA9A 1GSUA 4HZ4A 5CRWA 2I3YA 3N5OA 1YKCA 2LTKA 1G6YA 2R0PA 3I69A 2L5LA 4XRDA 2IMFA 2J9HA 3L0HA 2XPDA 5ECKB 4WKWA 1XFLA 4IHUA 3HZ4A 5DQSA 1WE0A 3HKRA 4HU7A 2MMZA 1TW9A 2TRXA 3FYGA 4YQVA 4ZL7A 5FT3A 1JZWA 2E7PA 6GSWA 1WOUA 4TVEA 1SU9A 1EWXA 4EVMA 4F0CA 1T3BA 5GAPD 1QGVA 3GKXA 4QL7A 1PX7A 5DJMA 4Q5RA 1XCCA 2AAWA 4PX1A 3ZTLA 4BPYA 1GTUA 3W6GA 5KN2A 5L71A 3VI5A 3D4TA 4Z7XA 3BBYA 3TCOA 3NOFA 5HFIA 5HQPA 5J9BA 1LU4A 1U87A 4K5RA 3EWLA 3CTGA 3RPPA 4V1Ag 2N5AA 3F4TA 3QAVA 4GCIA 3LEFA 3KD0A 1MDJA 1ILOA 3S9FA 2X64A 5IO2A 1TRSA 2REMA 4XS1A 1WJKA 3RDWA 3IC8A 2VL3A 4JBBA 4PNFA 3VK9A 1WIKA 2H1GA 1ZOFA 2ALBA 4X1UA 3ERWA 5A5KA 2WB9A 1K0DA 2OBIA 3EMPA 3MDKA 1GUKA 5AN1A 5HR1A 4BVXA 1G7OA 2CAIA 3TJJA 4L5OA 2R0CA 1FHEA 3IAS2 2QC7A 2IMIA 3ERGA 1GWCA 3FZAA 3GNJA 2C0DA 5CP1A 2IIYA 3W8SA 2AHEA 4MF5A 2GSRA 1ZYEA 3F6FA 2YV9A 4WEYA 2WRTA 2A4HA 5J5NA 4PTSA 5B8BA 3HZ8A 2HE3A 4ILFA 2VCVA 2LEGA 1M7TA 1MTCA 3KH9A 4OD7A 3LYKA 4GWRA 4AGSA 2LSTA 3TKQA 2B1KA 4IQAA 1YY7A 3KP8A 1AIUA 4Z2RA 4GTUA 2H74A 3ZITA 1GULA 3VWXA 1V58A 4ZB8A 3L9VA 4MF7A 2FHEA 4I2TA 2EC4A 3ZVJD 2ON5A 4MABA 3FKFA 1XXUA 3ZREA 3IHQA 2L6DA 1W4VA 3EMXA 3EINA 3VI7A 5ECIB 1K0OA 2JSYA 3HYPA 4OCEA 1EEMA 2TRCP 1VGLA 2H73A 4I5QA 4HQSA 2OJLA 3F63A 4TR1A 1ZCPA 4F82A 4J57E 2MMAA 2MBSA 4LMWA 2GZPA 2X4AA 1GSYA 1X5EA 3QAWA 4O32A 1XWCA 1K3YA 3GL5A 4J2FA 3HJMA 5JWRB 4O7HA 1SL0B 4X0XA 2HNLA 2VL2C 2YZHA 4FO5A 1BAYA 2LJRA 2LJAA 1U3IA 5LD0A 1GSFA 3F6DA 1QK8A 4N11A 4RUVA 4MNNA 4XRAA 5DAKB 1OAZA 1FB6A 4XTSA 4L8EA 5B8AA 1O85A 3Q19A 2H8LA 3ZYWA 1RW1A 3KIJA 5G2ZA 1THOA 3GH9A 3HY2A 1GTBA 3LW9A 3M8NA 5CAXA 5J41A 4PXOA 3L9UA 5H5QA 1EZKA 3ERFA 1QXHA 4HI7A 1X5CA 4I97A 4TN8A 4K7NA 5GAND 2FUG2 2IMKA 4IP6A 2YNXA 6GSTA 5KOXA 5E4WA 4DSSB 3KMOA 5D9XA 2AYTA 3GKMA 1TXXA 2P5RA 3LWAA 2LV3A 4Z2TA 16GSA 3CXGA 5CRHA 4POBA 3FW2A 3GYKA 1KEBA 1X5DA 2M80A 2XHFA 3TDGA 1SK2A 4PQIA 1OC8A 3KMNA 3CBUA 4TOPA 4EIPA 3APQA 2KP2A 1CQGA 3GFKA 3P90A 2LJKA 5A4WA 1S3DA 2OACA 1E2YA 1MDIA 3OR5A 1BJXA 2JACA 1NSWA 1A2MA 2CV4A 2X8HA 4K0GA 1ML6A 4WR5A 1XVQA 4LLRA 1PMTA 3D0ZA 1YF1A 2VCXA 3FHKA 3WT1A 5IPHA 1A23A 1AUCA 1AXDA 4NPBA 4ECBA 1WPIA 3C8EA 1K0NA 4JZQA 4OFNA 3EURA 1S3RA 1EOHA 12GSA 4ZB6A 3RPNA 1YZXA 3DWVA 2FWFA 2VCZA 1Z7RA 3P8WA 5CRDA 4F03A 2JU5A 4BL7A 2IFQB 2RUFA 5ECLB 4TW5A 3IE3A 1M3JA 4K7IA 1K0BA 2NVLA 1YEXA 4KDUA 3DGQA 1JZDA 3QDNA 3FR3A 2F8FA 2H6YA 4GLTA 2DKHA 1KNGA 4GXZA 1PX6A 1ERUA 2C0GA 4DEJA 1R4WA 4K5SA 5EPFA 3O6TA 3HDCA 3BJ5A 3GKKA 4HSCX 2BTOT 3QAGA 4O5QA 1DSBA 2CVDA 2QA1A 3GUSA 3EU4A 1WWJA 4MJEA 1A2LA 1SJ6A 2H0GA 2OBKA 2XPEA 1OE7A 3M0FA 3G9BA 2L5OA 4E8HA 3J7Yb 4K6XA 1UVZA 3LXTA 1V2AA 3L4NA 4YKFA 2E0QA 3UARA 4BA7A 5JWOB 3FY7A 3O3TA 5C04A 5IMAA 1EEJA 2HLSA 4OWYA 4X4JA 1A24A 2AUVA 3DD3A 2VO4A 1GLPA 3IOSA 3JCML 4OMVA 3FK8A 2ES7A 1Z6MA 1TK0B 4G0LA 1MDKA 3WYWA 4MMMA 4PNGA 1NW2A 4ACSA 3TKSA 2NTOA 4GF0A 1EGRA 3TJBA 5ECNB 17GSA 2DKIA 4KW6A 1THXA 1MD3A 5ECRB 4ML6A 5F0GA 4Z2UA 1T7PB 1TU7A 3GRXA 3PGTA 1GL8A 13GSA 3QOUA 2K6VA 4KB3A 1BG5A 1G0TA 2PMTA 3EC3A 3ED3A 2MMNA 5IIZA 5BMUA 3L9SA 2KLXA 5EY6A 4GQCA 2MZCA 4TR4A 3RBTA 4YAPA 2VAFA 2PVOC 1MEKA 2RM5A 5B7CA 2C80A 3KZQA 4ZILA 2GSQA 2PGTA 3HCZA 5FHIA 5F07A 3A3TA 3LSZA 2A2RA 2F51A 1HNAA 2C3NA 3GH6A 5D93A 2ZNMA 4MP4A 2N5FA 4EO3A 2N5BA 2L57A 1FVJA 2GS3A 2L4QA 3UBKA 1LJRA 2VUPA 2XBIA 5ID2B 1VF3A 3A5IA 3GURA 4G19A 1FB0A 2H01A 1YF0A 1A2JA 1S3AA 3LORA 3QCPA 2VCTA 3GX0A 1GSSA 3IK9A 4KUNA 1X9WB 4MK3A 1YDKA 3GTUA 1M99A 4TR0A 2B5EA 1BYEA 3E3EA 2BJXA 4CDOA 2RLIA 1K3OA 2FLSA 3EU3A 1R7HA 2VCWA 1F6MC 4KNDA 4K1FA 4D73A 1ERWA 2R2JA 1IYHA 2H1AA 3FRCA 3DMLA 3KTLA 2X49A 4MZBA 3WGEA 2H0HA 2CVKA 3ME8A 2YV7A 3G7IA 4FYUA 2IMDA 3TKPA 3D4MA 5CREA 1TI3A 4K7OA 4CW9A 4ECJA 1JHBA 2GLRA 3H79A 1FOHA 3TRPA 4HZ2A 1TTZA 3FR6A 2LQQA 3HVVA 1MD4A 1TKDB 4DSQA 1OC3A 2OA7A 1R5PA 4GRFA 5AISA 3GSTA 1V98A 1ERVA 3M3MA 4PURA 1SD8A 1EGOA 3TRQA 2I4AA 5AGYA 4ISDA 3PH9A 5IMFA 3IAM2 1Y25A 3DVWA 2PUKC 3A2XA 2HRNA 1HD2A 3UAPA 4KSMA 3AY8A 4J56E 4NAXA 5HR0A 2PPTA 2E2GA 2H72A 2DC5A 1C72A 2FWEA 4N0ZA 1UC7A 1A8YA 1IYIA 3P7XA 3CSJA 3ZIJA 4H86A 2PERA 1FVKA 3BCIA 3UIWA 1OYJA 1ZMAA 2X8CA 3D5JA 4K2XA 3W8JA 4BIKA 5IOXA 1FAAA 4HU9A 1USBA 1XWGA 3EVIA 4MLYA 2EIOA 2HRKA 4HOJA 4KAEA 4XIHA 1SD9A 1TRVA 2IN3A 4TRXA 2WZ9A 4MDCA 3NZNA 1SJZA 3H93A 1SL1B 4HUAA 2KUCA 3KJYA 5A4VA 2H6XA 1H4OA 3ZFBA 2LS5A 2H75A 3V1WA 2A2PA 4FIWA 2I81A 2VM2A 3C7MA 2IWTA 4I6XA 1QFNA 4K8MA 5GSTA 5KN3A 4AF2A 3Q74A 5HR2A 5DVBA 1SYXA 2F9SA 2LQOA 3C1RA 2R3XA 4KCEA 4LMVA 3DVXA 2KP1A 2K8VA 4ZIJA 3GTUB 2GSSA 2VCQA 5C00A 4POKA 2K18A 5IQYA 3CQFA 3HA9A 4X43A 1N8JA 3ISOA 1BQ7A 4IVFA 4XS4A 1OKTA 5LNKe 3ZVJA 3A5WA 1EV9A 1I9DA 1J0FA 4IJ3A 5B6NA 3MAKA 4JU5A 4D73B
chains in the Genus database with same CATH topology
4L0UA 4RI6A 1VF1A 1QMVA 2DJ2A 5DCGA 4POMA 1G6WA 5G1KA 3ZMKA 4EDZA 3ZL5A 3WGDA 3LJRA 2DJKA 3GIXA 3UVTA 2C1YA 4GSSA 1PQNA 1TRWA 1WRYA 3I9V2 5J4UA 2IL3A 4V2LA 2C0EA 4PQ1A 3I43A 1M2DA 2HFDA 4DVCA 1FW1A 3ME7A 2R5GA 4CY8A 1ZYPA 3GKNA 4CY6A 1M0UA 2VL9A 4PUAA 3UOMA 2B1LA 2LRTA 1URMA 3FZ9A 4RQRA 4HDEA 3UEMA 2KHPA 1TK5B 3I6AA 2DIZA 2CA8A 2GQMA 5H5RA 3QPMA 4YQUA 4G2EA 3F0IA 3HVXA 2H76A 2WDUA 4NHZA 1XW9A 3VWUA 2M72A 3RHBA 2DMMA 2MBTA 4BVXB 2DBCA 4LL4B 4P3YB 1JFUA 2QGVA 2O8VB 3ZLPA 5DBQA 4MJBA 2L59A 4PGTA 2RIIA 1V9WA 3IXRA 3PINA 1B8XA 2P31A 1HYUA 3F8UA 4MJAA 5F8BA 2IJYA 4G9HA 4IBPA 1M2BA 3J7Yk 3GSSA 4MH3A 1PN9A 3RAZA 1AQXA 2IMEA 2D2ZA 3UL3A 4NXIA 1VF2A 4AJ6A 4AJ7A 1ZYNA 4USSA 1AQVA 2R4VA 2J23A 4L0WA 3ZZXA 2FNOA 4O92A 3HJPA 3GV1A 5ENUA 1KBNA 3EPTA 2YJHA 2DJ0A 5D9TA 1M2AA 2HYXA 3IRAA 3CSHA 4ZL9A 4ZXGA 5CNWA 2LRCA 3K8NA 2VIMA 2VD1A 1O8WA 3WD6A 1TDIA 3C71A 3IK7A 4Q5NA 1ABAA 1PN0A 2AV4A 2FD3A 1FOVA 3QFAC 4ZB9A 3TOUA 3TKSC 3EE2A 3APOA 4EDYA 4GSNA 4JR6A 4TR1B 4BWSA 1TK8B 1JZOA 2H1BA 2HT9A 2V6KA 3H4KA 2HRFA 1K3LA 3WT2A 4K0NA 2FGXA 3C73A 1OC9A 4IKHA 1SKWB 3IDVA 1TJDA 3LFLA 1CQHA 4KX4A 3GX8A 2GGTA 2LKUA 2YCDA 1QUWA 1SENA 4NWYA 5B6MA 4K9ZA 1K0CA 3GMFA 1DUGA 2FCHA 1A0FA 3ZFLA 2LRNA 11GSA 4BVYA 2RM6A 2V2GA 2DJ3A 3O76A 5IMZA 4IW9A 3TKRA 6GSSA 4N10A 4ID0A 1B9YC 5ELGA 2VLUA 2MMOA 3E9JB 2XC2A 2I9HA 1H75A 1PSQA 5JCWA 3QMXA 2O85A 4EC0A 2R6KA 4V2MA 2O89A 1TOFA 2P5QA 1WP0A 2NPBA 2DJ1A 3M9KA 2YZUA 1XBSA 2F3MA 4OO4A 4Q5QA 1GSEA 3APSA 1Z9HA 2OE1A 2H0IA 1WMJA 2LNSA 2VLVA 2WCIA 1TP9A 2WGRA 1Z5YE 1Z7PA 3TUEA 4LA1A 1RK4A 3DKSA 3LYPA 4LL1B 4EF0A 4F9ZA 4YKGA 4IELA 4E8EA 1XVWA 4YAVA 1U6TA 4KH7A 3IPZA 2X99A 2DMLA 1S3CA 1F3BA 3CMIA 5JWQB 3KXOA 4FQUA 1O81A 5J9CA 1W89A 1QQ2A 1PD21 5JCGA 4F0BA 2UZ8A 4PQHA 3A2WA 3VPTA 1HQOA 4BL7B 1HNBA 5DCHA 6GSVA 3A2VA 3PR8A 2O7KA 3VURA 4KSOA 5DALA 2GQKA 3BD2A 1B9XC 1GNEA 4K2DA 1B4PA 2G2QA 2GZYA 1XW5A 2HZEA 2YANA 2JL4A 10GSA 2NBSA 3FMWA 2YWOA 4WF5A 2KOKA 2CZ3A 3GHAA 2B5YA 4HS1A 1SK1A 3IHGA 3FR9A 3KEBA 1OC9B 1XOAA 2B7KA 3DXBA 3CRTA 1DE1A 2B6MA 3G7YA 1XWKA 5HFGA 1RQMA 4XS6A 1NHOA 2CVBA 3CRUA 4YQMA 1U3AA 1AAZA 5IO0A 5ECOB 4ZBAA 5DAKA 5IMCA 3RHCA 3F3QA 2JSZA 4BVYB 1Q4JA 1ZGNA 5EVOA 3VFIA 1AW9A 3D22A 2VD0A 3QD9A 4G0KA 4EKZA 2FWGA 2X8GA 4JRRA 2V1MA 2HSYA 2WJUA 1V40A 2GZZA 1F2EA 5CYYA 1SYRA 3MNGA 3Q6OA 3VWVA 1GUMA 4O5RA 4MH2A 2C8UA 3VWWA 1T00A 2GT5A 3R2QA 4EXJA 3VPQA 1JZRA 2QKEA 3EYTA 5IM9A 3H8QA 4DSSA 3E0UA 5D73A 3M9JA 2FWHA 5KN1A 1U88A 4MF6A 5IPGA 5ECQB 3IV4A 4MPFA 3KP9A 1J9BA 1XWAA 1OKDA 4I2UA 1J08A 3FEUA 1M9AA 2EIRA 1E6BA 1ZL9A 4IS0A 4KA0A 4NHWA 1AQWA 4WR4A 1UA5A 5D9VA 1DBYA 2XBQA 4N30A 2EIQA 4GQFA 5D8IA 14GSA 1PKWA 3HVSA 1X9SB 5ELAA 2M46A 3MWHA 2YWIA 5AIVA 2A4VA 3IR4A 1PL2A 2PN8A 5G5FA 1B48A 1ACVA 1O8XA 3F9UA 1ERTA 3LG6A 4V1Ap 1PRXA 5A4UA 5ECHB 5KOWA 2C4JA 2DLXA 3U5RE 2ON7A 3KM6A 2G0FA 1KTEA 1ZYQB 4ZBBA 3ZMLA 20GSA 6GSUA 5G30A 5DJLA 1GSQA 4HQZA 1NHYA 1YKAA 3IBHA 2VM1A 4OFMA 5J3RA 3KGKA 2RUEA 1A0RP 4NV5A 5G5EA 4KDXA 3R3EA 5G1LA 3ZRDA 4IJIA 5DALB 2IFQA 1ZZYA 5HFKA 4IGJA 1EP8A 3Q18A 2C3QA 1XIYA 2JZTA 3CTFA 5JCUA 4POLA 1UN2A 4FH8A 5HR3A 2HZEB 1B4QA 2F8AA 3SBCA 3TB2A 1PL1A 2VLTA 2YWMA 4HJ2A 2HSHA 4KF9A 2R0GA 5ECMB 4Q5FA 3UBLA 1G7EA 6GSYA 2V41A 1YEPA 1GTAA 5CO3A 5IOWA 3GL3A 4OO5A 3IA1A 18GSA 1V57A 3BCKA 4ECCA 3HD5A 4KCAA 5ECSA 2JADA 4L5LA 1GLQA 2HSMA 2QA2A 5EL8A 2L4CA 2JZSA 4ICYA 2FA4A 3KCMA 1O73A 2O87A 4XCSA 2GVPA 1DE2A 5IMVA 1F37A 4RQXA 2PVQA 3G7JA 3HXSA 2NDOA 3CYNA 1ST9A 4DSRA 1X9MB 2H6ZA 4V2NA 1A8LA 4EL1A 2JZRA 3D6IA 4JR4A 2HRAA 3HJOA 2OE0A 3D21A 2PU9C 3GA4A 4ECIA 3DEXA 2HI7A 1I5GA 4KE3A 19GSA 4F2IA 3DRNA 1PA3A 2DSAA 3KH7A 1FO5A 1GRXA 4KGIA 4OFTA 1BEDA 4IP1A 3F4SA 1M9BA 2C3TA 1PKZA 4TR3A 2CQ9A 2WFCA 1R5AA 2TIRA 1GNWA 4CHSA 1GH2A 3N9JA 2GDRA 1SJIA 2OADA 4WF4A 4YH2A 4WBRD 1GSDA 2K9FA 3MSZA 1XW6A 3DYRA 4OCFA 3ZIVA 4HEA2 4TXOA 2AB6A 1TRUA 3L78A 3QR6A 2YP6A 1EV4A 2YPMA 3UMAA 3FZ5A 2H66A 9GSSA 2VL2A 3VLNA 4QQ7A 2DIYA 2ZUPA 2E2MA 4GSTA 1X0RA 3TJGA 6GSXA 3LQ7A 1GTIA 2GQLA 2YN1A 2DJJA 3U6VA 3TJKA 3C1SA 1FG4A 1Z3EA 2GT6A 4NMUA 4MZCA 3US3A 1T8EB 3TKSE 4NV2A 5BRTA 2WS2A 2K8SA 3LGCA 2CX3A 1OVNA 1K0AA 1AC1A 1O7UA 4QL9A 5F06A 5ID2A 3QFBC 2LNTA 5LCZA 2ZCTA 5CRGA 1TI1A 1SL2B 3TOTA 2CAQA 3UJ1A 4G0IA 4WXTA 1JLVA 8GSSA 5H5SA 22GSA 4KDYA 3MYDA 2CZ2A 4EIQA 1R26A 4RI7A 5DDLA 1XOBA 1K0MA 1Y6EA 5INYA 4TXVA 2IPAA 2WULA 4MPGA 5ABRA 2LUSA 4ULXA 2H19A 4O5UA 1JLWA 4XS4B 4EUYA 1Q98A 5IMDA 1SKSB 1BX9A 4WBJA 5G31A 3BOAA 2AJQB 2B3SA 2H71A 4FYCA 5ECPB 5COHA 2HZFA 1T4YA 2VOCA 1YQ1A 3F4RA 1SKRB 2Z9SA 1T1VA 2H30A 3M1GA 1N2AA 2OKAA 1T4ZA 3KTBA 4BWQA 4MZWA 1LBKA 2V6OA 1EOGA 5GSSA 2PBJA 2OE3A 1TU8A 5F05A 4G10A 3SWLA 3TGZA 4ML1A 1ON4A 2MYGA 3DIEA 1YJ6A 2H1DA 1XWBA 1Z6NA 4A5PA 5D9WA 1VRSD 2L6CA 1HNCA 3MIXA 2B5XA 1XZOA 4MCUA 4TKYA 4FYBA 3CSIA 5KN0A 1XPVA 3LXZA 4AJ8A 3UVHA 2CX4A 1EP7A 2B7JA 2GSTA 2PWJA 2H70A 2QSIA 2R37A 4IQ1A 3H1NA 4PUFC 2FA8A 4WETA 1SK0A 1OE8A 2BMXA 3FZ4A 2C0FA 5DQYA 2FY6A 2V32A 1GUHA 2CT6A 3TJFA 4HJMA 2GTUA 4TXOB 5KEJA 4N0VA 1F9MA 3F3RA 4MJCA 3NIVA 1O6JA 2YOIA 5AIXA 2YWNA 4ZL8A 5FWGA 3TRXA 2YJ7A 4XHMA 3IC4A 3HHVA 1F3AA 1NM3A 2A2SA 4JE1A 2I1UA 4ZBDA 5GZZB 3WGXA 4EE0A 3PPUA 5E59A 2HXKA 2P0GA 4JEDA 7GSSA 4IN0A 5D96A 1VF4A 3P2AA 4I8BA 1GP1A 1PGTA 3GN3A 4MA9A 1GSUA 4HZ4A 5CRWA 2I3YA 3N5OA 1YKCA 2LTKA 1G6YA 2R0PA 3I69A 2L5LA 4XRDA 2IMFA 2J9HA 3L0HA 2XPDA 5ECKB 4WKWA 1XFLA 4IHUA 3HZ4A 5DQSA 1WE0A 3HKRA 4HU7A 2MMZA 1TW9A 2TRXA 3FYGA 4YQVA 4ZL7A 5FT3A 1JZWA 2E7PA 6GSWA 1WOUA 4TVEA 1SU9A 1EWXA 4EVMA 4F0CA 1T3BA 5GAPD 1QGVA 3GKXA 4QL7A 1PX7A 5DJMA 4Q5RA 1XCCA 2AAWA 4PX1A 3ZTLA 4BPYA 1GTUA 3W6GA 5KN2A 5L71A 3VI5A 3D4TA 4Z7XA 3BBYA 3TCOA 3NOFA 5HFIA 5HQPA 5J9BA 1LU4A 1U87A 4K5RA 3EWLA 3CTGA 3RPPA 4V1Ag 2N5AA 3F4TA 3QAVA 4GCIA 3LEFA 3KD0A 1MDJA 1ILOA 3S9FA 2X64A 5IO2A 1TRSA 2REMA 4XS1A 1WJKA 3RDWA 3IC8A 2VL3A 4JBBA 4PNFA 3VK9A 1WIKA 2H1GA 1ZOFA 2ALBA 4X1UA 3ERWA 5A5KA 2WB9A 1K0DA 2OBIA 3EMPA 3MDKA 1GUKA 5AN1A 5HR1A 4BVXA 1G7OA 2CAIA 3TJJA 4L5OA 2R0CA 1FHEA 3IAS2 2QC7A 2IMIA 3ERGA 1GWCA 3FZAA 3GNJA 2C0DA 5CP1A 2IIYA 3W8SA 2AHEA 4MF5A 2GSRA 1ZYEA 3F6FA 2YV9A 4WEYA 2WRTA 2A4HA 5J5NA 4PTSA 5B8BA 3HZ8A 2HE3A 4ILFA 2VCVA 2LEGA 1M7TA 1MTCA 3KH9A 4OD7A 3LYKA 4GWRA 4AGSA 2LSTA 3TKQA 2B1KA 4IQAA 1YY7A 3KP8A 1AIUA 4Z2RA 4GTUA 2H74A 3ZITA 1GULA 3VWXA 1V58A 4ZB8A 3L9VA 4MF7A 2FHEA 4I2TA 2EC4A 3ZVJD 2ON5A 4MABA 3FKFA 1XXUA 3ZREA 3IHQA 2L6DA 1W4VA 3EMXA 3EINA 3VI7A 5ECIB 1K0OA 2JSYA 3HYPA 4OCEA 1EEMA 2TRCP 1VGLA 2H73A 4I5QA 4HQSA 2OJLA 3F63A 4TR1A 1ZCPA 4F82A 4J57E 2MMAA 2MBSA 4LMWA 2GZPA 2X4AA 1GSYA 1X5EA 3QAWA 4O32A 1XWCA 1K3YA 3GL5A 4J2FA 3HJMA 5JWRB 4O7HA 1SL0B 4X0XA 2HNLA 2VL2C 2YZHA 4FO5A 1BAYA 2LJRA 2LJAA 1U3IA 5LD0A 1GSFA 3F6DA 1QK8A 4N11A 4RUVA 4MNNA 4XRAA 5DAKB 1OAZA 1FB6A 4XTSA 4L8EA 5B8AA 1O85A 3Q19A 2H8LA 3ZYWA 1RW1A 3KIJA 5G2ZA 1THOA 3GH9A 3HY2A 1GTBA 3LW9A 3M8NA 5CAXA 5J41A 4PXOA 3L9UA 5H5QA 1EZKA 3ERFA 1QXHA 4HI7A 1X5CA 4I97A 4TN8A 4K7NA 5GAND 2FUG2 2IMKA 4IP6A 2YNXA 6GSTA 5KOXA 5E4WA 4DSSB 3KMOA 5D9XA 2AYTA 3GKMA 1TXXA 2P5RA 3LWAA 2LV3A 4Z2TA 16GSA 3CXGA 5CRHA 4POBA 3FW2A 3GYKA 1KEBA 1X5DA 2M80A 2XHFA 3TDGA 1SK2A 4PQIA 1OC8A 3KMNA 3CBUA 4TOPA 4EIPA 3APQA 2KP2A 1CQGA 3GFKA 3P90A 2LJKA 5A4WA 1S3DA 2OACA 1E2YA 1MDIA 3OR5A 1BJXA 2JACA 1NSWA 1A2MA 2CV4A 2X8HA 4K0GA 1ML6A 4WR5A 1XVQA 4LLRA 1PMTA 3D0ZA 1YF1A 2VCXA 3FHKA 3WT1A 5IPHA 1A23A 1AUCA 1AXDA 4NPBA 4ECBA 1WPIA 3C8EA 1K0NA 4JZQA 4OFNA 3EURA 1EOHA 12GSA 4ZB6A 3RPNA 1YZXA 3DWVA 2FWFA 2VCZA 1Z7RA 3P8WA 5CRDA 4F03A 2JU5A 4BL7A 2IFQB 2RUFA 5ECLB 4TW5A 3IE3A 4K7IA 1K0BA 2NVLA 1YEXA 4KDUA 3DGQA 1JZDA 3QDNA 3FR3A 2F8FA 2H6YA 4GLTA 2DKHA 1KNGA 4GXZA 1PX6A 1ERUA 2C0GA 4DEJA 1R4WA 4K5SA 5EPFA 3O6TA 3HDCA 3BJ5A 3GKKA 2BTOT 3QAGA 4O5QA 1DSBA 2CVDA 2QA1A 3GUSA 3EU4A 1WWJA 4MJEA 1A2LA 1SJ6A 2H0GA 2OBKA 2XPEA 1OE7A 3M0FA 3G9BA 2L5OA 4E8HA 3J7Yb 4K6XA 1UVZA 3LXTA 1V2AA 3L4NA 4YKFA 2E0QA 3UARA 4BA7A 5JWOB 3FY7A 3O3TA 5C04A 5IMAA 1EEJA 2HLSA 4OWYA 4X4JA 1A24A 2AUVA 3DD3A 2VO4A 1GLPA 3IOSA 3JCML 4OMVA 3FK8A 2ES7A 1Z6MA 1TK0B 4G0LA 1MDKA 3WYWA 4MMMA 4PNGA 1NW2A 4ACSA 3TKSA 2NTOA 4GF0A 1EGRA 3TJBA 5ECNB 17GSA 2DKIA 4KW6A 1THXA 1MD3A 5ECRB 4ML6A 5F0GA 4Z2UA 1T7PB 1TU7A 3GRXA 3PGTA 1GL8A 13GSA 3QOUA 2K6VA 4KB3A 1BG5A 1G0TA 2PMTA 3EC3A 3ED3A 2MMNA 5IIZA 5BMUA 3L9SA 2KLXA 5EY6A 4GQCA 2MZCA 4TR4A 3RBTA 4YAPA 2VAFA 2PVOC 1MEKA 2RM5A 5B7CA 2C80A 3KZQA 4ZILA 2GSQA 2PGTA 3HCZA 5FHIA 5F07A 3A3TA 3LSZA 2A2RA 2F51A 1HNAA 2C3NA 3GH6A 5D93A 2ZNMA 4MP4A 2N5FA 4EO3A 2N5BA 2L57A 1FVJA 2GS3A 2L4QA 3UBKA 1LJRA 2VUPA 2XBIA 5ID2B 1VF3A 3A5IA 3GURA 4G19A 1FB0A 2H01A 1YF0A 1A2JA 1S3AA 3LORA 3QCPA 2VCTA 3GX0A 1GSSA 3IK9A 4KUNA 1X9WB 4MK3A 1YDKA 3GTUA 1M99A 4TR0A 2B5EA 1BYEA 3E3EA 2BJXA 4CDOA 2RLIA 1K3OA 2FLSA 3EU3A 1R7HA 2VCWA 1F6MC 4KNDA 4K1FA 4D73A 1ERWA 2R2JA 1IYHA 2H1AA 3FRCA 3DMLA 3KTLA 2X49A 4MZBA 3WGEA 2H0HA 2CVKA 3ME8A 2YV7A 3G7IA 4FYUA 2IMDA 3TKPA 3D4MA 5CREA 1TI3A 4K7OA 4CW9A 4ECJA 1JHBA 2GLRA 3H79A 1FOHA 3TRPA 4HZ2A 1TTZA 3FR6A 2LQQA 3HVVA 1MD4A 1TKDB 4DSQA 1OC3A 2OA7A 1R5PA 4GRFA 5AISA 3GSTA 1V98A 1ERVA 3M3MA 4PURA 1SD8A 1EGOA 3TRQA 2I4AA 5AGYA 4ISDA 3PH9A 5IMFA 3IAM2 1Y25A 3DVWA 2PUKC 3A2XA 2HRNA 1HD2A 3UAPA 4KSMA 3AY8A 4J56E 4NAXA 5HR0A 2PPTA 2E2GA 2H72A 2DC5A 1C72A 2FWEA 4N0ZA 1UC7A 1A8YA 1IYIA 3P7XA 3CSJA 3ZIJA 4H86A 2PERA 1FVKA 3BCIA 3UIWA 1OYJA 1ZMAA 2X8CA 3D5JA 4K2XA 3W8JA 5IOXA 1FAAA 4HU9A 1USBA 1XWGA 3EVIA 4MLYA 2EIOA 2HRKA 4HOJA 4KAEA 4XIHA 1SD9A 1TRVA 2IN3A 4TRXA 2WZ9A 4MDCA 3NZNA 1SJZA 3H93A 1SL1B 4HUAA 2KUCA 3KJYA 5A4VA 2H6XA 1H4OA 3ZFBA 2LS5A 2H75A 3V1WA 2A2PA 4FIWA 2I81A 2VM2A 3C7MA 2IWTA 4I6XA 1QFNA 4K8MA 5GSTA 5KN3A 4AF2A 3Q74A 5HR2A 5DVBA 1SYXA 2F9SA 2LQOA 3C1RA 2R3XA 4KCEA 4LMVA 3DVXA 2KP1A 2K8VA 4ZIJA 3GTUB 2GSSA 2VCQA 5C00A 4POKA 2K18A 5IQYA 3HA9A 4X43A 1N8JA 3ISOA 1BQ7A 4IVFA 4XS4A 1OKTA 5LNKe 3ZVJA 3A5WA 1EV9A 1I9DA 1J0FA 4IJ3A 5B6NA 3MAKA 4JU5A 4D73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L0U A;  4RI6 A;  1VF1 A;  1QMV A;  2DJ2 A;  5DCG A;  4POM A;  1G6W A;  5G1K A;  3ZMK A;  4EDZ A;  3ZL5 A;  3WGD A;  3LJR A;  2DJK A;  3GIX A;  3UVT A;  2C1Y A;  4GSS A;  1PQN A;  1TRW A;  1WRY A;  3I9V 2;  5J4U A;  2IL3 A;  4V2L A;  2C0E A;  4PQ1 A;  3I43 A;  1M2D A;  2HFD A;  4DVC A;  1FW1 A;  3ME7 A;  2R5G A;  3GKN A;  1M0U A;  2VL9 A;  4PUA A;  3UOM A;  2B1L A;  2LRT A;  1URM A;  3FZ9 A;  4RQR A;  4HDE A;  3UEM A;  2KHP A;  1TK5 B;  3I6A A;  2DIZ A;  2CA8 A;  2GQM A;  5H5R A;  3QPM A;  4YQU A;  4G2E A;  3F0I A;  3HVX A;  2H76 A;  2WDU A;  4NHZ A;  1XW9 A;  3VWU A;  2M72 A;  3RHB A;  2DMM A;  2MBT A;  2DBC A;  4LL4 B;  4P3Y B;  1JFU A;  2QGV A;  2O8V B;  3ZLP A;  5DBQ A;  4MJB A;  2L59 A;  4PGT A;  2RII A;  1V9W A;  3IXR A;  3PIN A;  1B8X A;  2P31 A;  1HYU A;  3F8U A;  4MJA A;  5F8B A;  2IJY A;  4G9H A;  4IBP A;  1M2B A;  3J7Y k;  3GSS A;  4MH3 A;  1PN9 A;  3RAZ A;  1AQX A;  2IME A;  2D2Z A;  3UL3 A;  4NXI A;  1VF2 A;  4AJ6 A;  4AJ7 A;  1AQV A;  2R4V A;  2J23 A;  4L0W A;  3ZZX A;  2FNO A;  4O92 A;  3HJP A;  3GV1 A;  5ENU A;  1KBN A;  2YJH A;  2DJ0 A;  5D9T A;  1M2A A;  2HYX A;  3IRA A;  3CSH A;  4ZL9 A;  4ZXG A;  5CNW A;  2LRC A;  3K8N A;  2VIM A;  2VD1 A;  1O8W A;  3WD6 A;  1TDI A;  3C71 A;  3IK7 A;  4Q5N A;  1ABA A;  2AV4 A;  2FD3 A;  1FOV A;  3QFA C;  4ZB9 A;  3TOU A;  3TKS C;  3EE2 A;  3APO A;  4EDY A;  4GSN A;  4JR6 A;  4TR1 B;  4BWS A;  1TK8 B;  1JZO A;  2H1B A;  2HT9 A;  2V6K A;  3H4K A;  2HRF A;  1K3L A;  3WT2 A;  4K0N A;  2FGX A;  3C73 A;  1OC9 A;  4IKH A;  1SKW B;  3IDV A;  1TJD A;  3LFL A;  1CQH A;  4KX4 A;  3GX8 A;  2GGT A;  2LKU A;  2YCD A;  1QUW A;  1SEN A;  4NWY A;  5B6M A;  4K9Z A;  1K0C A;  3GMF A;  1DUG A;  2FCH A;  1A0F A;  3ZFL A;  2LRN A;  11GS A;  4BVY A;  2RM6 A;  2V2G A;  2DJ3 A;  3O76 A;  5IMZ A;  4IW9 A;  3TKR A;  6GSS A;  4N10 A;  4ID0 A;  1B9Y C;  5ELG A;  2VLU A;  2MMO A;  3E9J B;  2XC2 A;  2I9H A;  1H75 A;  1PSQ A;  5JCW A;  3QMX A;  2O85 A;  4EC0 A;  2R6K A;  4V2M A;  2O89 A;  1TOF A;  2P5Q A;  1WP0 A;  2NPB A;  2DJ1 A;  3M9K A;  2YZU A;  1XBS A;  2F3M A;  4OO4 A;  4Q5Q A;  1GSE A;  3APS A;  1Z9H A;  2OE1 A;  2H0I A;  1WMJ A;  2LNS A;  2VLV A;  2WCI A;  1TP9 A;  2WGR A;  1Z5Y E;  1Z7P A;  3TUE A;  4LA1 A;  1RK4 A;  3DKS A;  3LYP A;  4LL1 B;  4EF0 A;  4F9Z A;  4IEL A;  4E8E A;  1XVW A;  4YAV A;  1U6T A;  4KH7 A;  3IPZ A;  2X99 A;  2DML A;  1S3C A;  1F3B A;  3CMI A;  5JWQ B;  3KXO A;  1O81 A;  5J9C A;  1W89 A;  1QQ2 A;  1PD2 1;  5JCG A;  4F0B A;  4PQH A;  3A2W A;  3VPT A;  1HQO A;  1HNB A;  5DCH A;  6GSV A;  3A2V A;  3PR8 A;  2O7K A;  3VUR A;  4KSO A;  5DAL A;  2GQK A;  3BD2 A;  1B9X C;  1GNE A;  4K2D A;  1B4P A;  2G2Q A;  2GZY A;  1XW5 A;  2HZE A;  2YAN A;  2JL4 A;  10GS A;  2NBS A;  2YWO A;  4WF5 A;  2KOK A;  2CZ3 A;  3GHA A;  2B5Y A;  4HS1 A;  1SK1 A;  3FR9 A;  3KEB A;  1OC9 B;  1XOA A;  2B7K A;  3DXB A;  3CRT A;  1DE1 A;  2B6M A;  3G7Y A;  1XWK A;  5HFG A;  1RQM A;  4XS6 A;  1NHO A;  2CVB A;  3CRU A;  4YQM A;  1U3A A;  1AAZ A;  5IO0 A;  5ECO B;  4ZBA A;  5DAK A;  5IMC A;  3RHC A;  3F3Q A;  2JSZ A;  1Q4J A;  5EVO A;  1ZGN A;  3VFI A;  1AW9 A;  3D22 A;  2VD0 A;  3QD9 A;  4EKZ A;  2FWG A;  2X8G A;  4JRR A;  2V1M A;  2HSY A;  2WJU A;  1V40 A;  2GZZ A;  1F2E A;  5CYY A;  1SYR A;  3MNG A;  3Q6O A;  3VWV A;  1GUM A;  4O5R A;  4MH2 A;  2C8U A;  3VWW A;  1T00 A;  2GT5 A;  3R2Q A;  4EXJ A;  3VPQ A;  1JZR A;  2QKE A;  3EYT A;  5IM9 A;  3H8Q A;  4DSS A;  3E0U A;  5D73 A;  3M9J A;  2FWH A;  5KN1 A;  1U88 A;  4MF6 A;  5IPG A;  5ECQ B;  3IV4 A;  4MPF A;  3KP9 A;  1J9B A;  1XWA A;  1OKD A;  4I2U A;  1J08 A;  3FEU A;  1M9A A;  2EIR A;  1E6B A;  1ZL9 A;  4IS0 A;  4KA0 A;  4NHW A;  1AQW A;  4WR4 A;  1UA5 A;  5D9V A;  1DBY A;  2XBQ A;  4N30 A;  2EIQ A;  4GQF A;  5D8I A;  14GS A;  1PKW A;  3HVS A;  1X9S B;  5ELA A;  2M46 A;  3MWH A;  2YWI A;  5AIV A;  2A4V A;  3IR4 A;  1PL2 A;  2PN8 A;  5G5F A;  1B48 A;  1ACV A;  1O8X A;  3F9U A;  1ERT A;  3LG6 A;  4V1A p;  1PRX A;  5A4U A;  5ECH B;  2C4J A;  2DLX A;  3U5R E;  2ON7 A;  3KM6 A;  2G0F A;  1KTE A;  1ZYQ B;  4ZBB A;  3ZML A;  20GS A;  6GSU A;  5G30 A;  5DJL A;  1GSQ A;  4HQZ A;  1NHY A;  1YKA A;  3IBH A;  2VM1 A;  4OFM A;  5J3R A;  3KGK A;  2RUE A;  1A0R P;  4NV5 A;  5G5E A;  4KDX A;  5G1L A;  3ZRD A;  4IJI A;  5DAL B;  2IFQ A;  1ZZY A;  5HFK A;  4IGJ A;  1EP8 A;  3Q18 A;  2C3Q A;  1XIY A;  2JZT A;  3CTF A;  5JCU A;  4POL A;  1UN2 A;  4FH8 A;  5HR3 A;  2HZE B;  1B4Q A;  2F8A A;  3SBC A;  3TB2 A;  1PL1 A;  2VLT A;  2YWM A;  4HJ2 A;  2HSH A;  5ECM B;  4Q5F A;  3UBL A;  1G7E A;  6GSY A;  2V41 A;  1YEP A;  1GTA A;  5CO3 A;  5IOW A;  3GL3 A;  4OO5 A;  3IA1 A;  18GS A;  1V57 A;  3BCK A;  4ECC A;  3HD5 A;  4KCA A;  5ECS A;  2JAD A;  4L5L A;  1GLQ A;  5EL8 A;  2L4C A;  2JZS A;  2FA4 A;  3KCM A;  1O73 A;  2O87 A;  4XCS A;  2GVP A;  1DE2 A;  5IMV A;  1F37 A;  4RQX A;  2PVQ A;  3G7J A;  3HXS A;  2NDO A;  3CYN A;  1ST9 A;  4DSR A;  1X9M B;  2H6Z A;  4V2N A;  1A8L A;  4EL1 A;  2JZR A;  3D6I A;  4JR4 A;  3HJO A;  2OE0 A;  3D21 A;  2PU9 C;  3GA4 A;  4ECI A;  3DEX A;  2HI7 A;  1I5G A;  4KE3 A;  19GS A;  4F2I A;  3DRN A;  1PA3 A;  2DSA A;  3KH7 A;  1FO5 A;  1GRX A;  4KGI A;  4OFT A;  1BED A;  4IP1 A;  3F4S A;  1M9B A;  2C3T A;  1PKZ A;  4TR3 A;  2CQ9 A;  2WFC A;  1R5A A;  2TIR A;  1GNW A;  4CHS A;  1GH2 A;  3N9J A;  2GDR A;  1SJI A;  2OAD A;  4WF4 A;  4YH2 A;  4WBR D;  1GSD A;  2K9F A;  3MSZ A;  1XW6 A;  3DYR A;  4OCF A;  3ZIV A;  4HEA 2;  4TXO A;  2AB6 A;  1TRU A;  3L78 A;  3QR6 A;  2YP6 A;  1EV4 A;  2YPM A;  3UMA A;  3FZ5 A;  2H66 A;  9GSS A;  2VL2 A;  3VLN A;  4QQ7 A;  2DIY A;  2ZUP A;  2E2M A;  4GST A;  1X0R A;  3TJG A;  6GSX A;  3LQ7 A;  1GTI A;  2GQL A;  2YN1 A;  2DJJ A;  3U6V A;  3TJK A;  3C1S A;  1FG4 A;  1Z3E A;  2GT6 A;  4NMU A;  4MZC A;  3US3 A;  1T8E B;  3TKS E;  4NV2 A;  2WS2 A;  2K8S A;  3LGC A;  2CX3 A;  1OVN A;  1K0A A;  1AC1 A;  1O7U A;  4QL9 A;  5F06 A;  5ID2 A;  3QFB C;  2LNT A;  5LCZ A;  2ZCT A;  5CRG A;  1TI1 A;  1SL2 B;  3TOT A;  2CAQ A;  3UJ1 A;  4WXT A;  1JLV A;  8GSS A;  5H5S A;  22GS A;  4KDY A;  2CZ2 A;  1R26 A;  4RI7 A;  5DDL A;  1XOB A;  1K0M A;  1Y6E A;  5INY A;  4TXV A;  2IPA A;  2WUL A;  4MPG A;  5ABR A;  2LUS A;  4ULX A;  2H19 A;  4EUY A;  1JLW A;  4XS4 B;  1Q98 A;  5IMD A;  1SKS B;  1BX9 A;  4WBJ A;  5G31 A;  3BOA A;  2AJQ B;  2B3S A;  2H71 A;  4FYC A;  5ECP B;  5COH A;  2HZF A;  1T4Y A;  2VOC A;  1YQ1 A;  3F4R A;  1SKR B;  2Z9S A;  1T1V A;  2H30 A;  3M1G A;  1N2A A;  2OKA A;  1T4Z A;  3KTB A;  4BWQ A;  4MZW A;  1LBK A;  2V6O A;  1EOG A;  5GSS A;  2PBJ A;  2OE3 A;  1TU8 A;  5F05 A;  4G10 A;  3SWL A;  3TGZ A;  4ML1 A;  1ON4 A;  2MYG A;  3DIE A;  1YJ6 A;  2H1D A;  1XWB A;  1Z6N A;  5D9W A;  1VRS D;  2L6C A;  1HNC A;  2B5X A;  1XZO A;  4MCU A;  4TKY A;  4FYB A;  3CSI A;  5KN0 A;  1XPV A;  3LXZ A;  4AJ8 A;  3UVH A;  2CX4 A;  1EP7 A;  2B7J A;  2GST A;  2PWJ A;  2H70 A;  2QSI A;  2R37 A;  4IQ1 A;  3H1N A;  4PUF C;  2FA8 A;  4WET A;  1SK0 A;  1OE8 A;  2BMX A;  3FZ4 A;  2C0F A;  5DQY A;  2FY6 A;  2V32 A;  1GUH A;  2CT6 A;  3TJF A;  4HJM A;  2GTU A;  4TXO B;  5KEJ A;  4N0V A;  1F9M A;  3F3R A;  4MJC A;  3NIV A;  1O6J A;  2YOI A;  5AIX A;  2YWN A;  4ZL8 A;  5FWG A;  3TRX A;  2YJ7 A;  4XHM A;  3IC4 A;  3HHV A;  1F3A A;  1NM3 A;  2A2S A;  4JE1 A;  2I1U A;  4ZBD A;  5GZZ B;  3WGX A;  4EE0 A;  5E59 A;  2HXK A;  2P0G A;  4JED A;  7GSS A;  4IN0 A;  5D96 A;  1VF4 A;  3P2A A;  4I8B A;  1GP1 A;  1PGT A;  3GN3 A;  4MA9 A;  1GSU A;  4HZ4 A;  5CRW A;  2I3Y A;  3N5O A;  1YKC A;  2LTK A;  1G6Y A;  3I69 A;  2L5L A;  4XRD A;  2IMF A;  2J9H A;  3L0H A;  2XPD A;  5ECK B;  4WKW A;  1XFL A;  4IHU A;  3HZ4 A;  5DQS A;  1WE0 A;  3HKR A;  4HU7 A;  2MMZ A;  1TW9 A;  2TRX A;  3FYG A;  4YQV A;  4ZL7 A;  5FT3 A;  1JZW A;  2E7P A;  6GSW A;  1WOU A;  4TVE A;  1SU9 A;  1EWX A;  4EVM A;  4F0C A;  1T3B A;  5GAP D;  1QGV A;  3GKX A;  4QL7 A;  1PX7 A;  5DJM A;  4Q5R A;  1XCC A;  2AAW A;  4PX1 A;  3ZTL A;  4BPY A;  1GTU A;  3W6G A;  5KN2 A;  5L71 A;  3VI5 A;  3D4T A;  4Z7X A;  3BBY A;  3TCO A;  3NOF A;  5HFI A;  5HQP A;  5J9B A;  1LU4 A;  1U87 A;  3EWL A;  3CTG A;  3RPP A;  4V1A g;  2N5A A;  3F4T A;  3QAV A;  4GCI A;  3LEF A;  3KD0 A;  1MDJ A;  1ILO A;  3S9F A;  2X64 A;  5IO2 A;  1TRS A;  2REM A;  4XS1 A;  1WJK A;  3RDW A;  2VL3 A;  4JBB A;  4PNF A;  3VK9 A;  1WIK A;  2H1G A;  1ZOF A;  2ALB A;  4X1U A;  3ERW A;  5A5K A;  2WB9 A;  1K0D A;  2OBI A;  3EMP A;  3MDK A;  1GUK A;  5AN1 A;  5HR1 A;  4BVX A;  1G7O A;  2CAI A;  3TJJ A;  4L5O A;  1FHE A;  3IAS 2;  2QC7 A;  2IMI A;  3ERG A;  1GWC A;  3FZA A;  3GNJ A;  2C0D A;  5CP1 A;  2IIY A;  3W8S A;  2AHE A;  4MF5 A;  2GSR A;  1ZYE A;  3F6F A;  2YV9 A;  4WEY A;  2WRT A;  5J5N A;  5B8B A;  3HZ8 A;  2HE3 A;  4ILF A;  2VCV A;  2LEG A;  1M7T A;  1MTC A;  3KH9 A;  4OD7 A;  3LYK A;  4GWR A;  4AGS A;  2LST A;  3TKQ A;  2B1K A;  4IQA A;  1YY7 A;  3KP8 A;  1AIU A;  4GTU A;  2H74 A;  3ZIT A;  1GUL A;  3VWX A;  1V58 A;  4ZB8 A;  3L9V A;  4MF7 A;  2FHE A;  4I2T A;  2EC4 A;  3ZVJ D;  2ON5 A;  4MAB A;  3FKF A;  1XXU A;  3ZRE A;  3IHQ A;  2L6D A;  1W4V A;  3EMX A;  3EIN A;  3VI7 A;  5ECI B;  1K0O A;  2JSY A;  3HYP A;  4OCE A;  1EEM A;  2TRC P;  1VGL A;  2H73 A;  4I5Q A;  4HQS A;  2OJL A;  3F63 A;  4TR1 A;  1ZCP A;  4F82 A;  4J57 E;  2MMA A;  2MBS A;  4LMW A;  2GZP A;  1GSY A;  1X5E A;  3QAW A;  4O32 A;  1XWC A;  1K3Y A;  3GL5 A;  4J2F A;  3HJM A;  5JWR B;  4O7H A;  1SL0 B;  4X0X A;  2HNL A;  2VL2 C;  2YZH A;  4FO5 A;  1BAY A;  2LJR A;  2LJA A;  1U3I A;  5LD0 A;  1GSF A;  3F6D A;  1QK8 A;  4N11 A;  4RUV A;  4XRA A;  5DAK B;  1OAZ A;  1FB6 A;  4XTS A;  4L8E A;  5B8A A;  1O85 A;  3Q19 A;  2H8L A;  3ZYW A;  1RW1 A;  3KIJ A;  5G2Z A;  1THO A;  3GH9 A;  3HY2 A;  1GTB A;  3M8N A;  5CAX A;  5J41 A;  4PXO A;  3L9U A;  5H5Q A;  1EZK A;  3ERF A;  1QXH A;  4HI7 A;  1X5C A;  4I97 A;  4TN8 A;  4K7N A;  5GAN D;  2FUG 2;  2IMK A;  4IP6 A;  2YNX A;  6GST A;  5E4W A;  4DSS B;  3KMO A;  5D9X A;  2AYT A;  3GKM A;  1TXX A;  2P5R A;  3LWA A;  2LV3 A;  16GS A;  3CXG A;  5CRH A;  4POB A;  3FW2 A;  3GYK A;  1KEB A;  1X5D A;  2M80 A;  2XHF A;  3TDG A;  1SK2 A;  4PQI A;  1OC8 A;  3KMN A;  3CBU A;  4TOP A;  3APQ A;  2KP2 A;  1CQG A;  3GFK A;  3P90 A;  2LJK A;  5A4W A;  1S3D A;  2OAC A;  1E2Y A;  1MDI A;  3OR5 A;  1BJX A;  2JAC A;  1NSW A;  1A2M A;  2CV4 A;  2X8H A;  4K0G A;  1ML6 A;  4WR5 A;  1XVQ A;  4LLR A;  1PMT A;  3D0Z A;  1YF1 A;  2VCX A;  3FHK A;  3WT1 A;  5IPH A;  1A23 A;  1AUC A;  1AXD A;  4NPB A;  4ECB A;  1WPI A;  3C8E A;  1K0N A;  4JZQ A;  4OFN A;  3EUR A;  1EOH A;  12GS A;  4ZB6 A;  3RPN A;  1YZX A;  3DWV A;  2FWF A;  2VCZ A;  1Z7R A;  3P8W A;  5CRD A;  4F03 A;  2JU5 A;  4BL7 A;  2IFQ B;  2RUF A;  5ECL B;  4TW5 A;  3IE3 A;  4K7I A;  1K0B A;  2NVL A;  1YEX A;  4KDU A;  3DGQ A;  1JZD A;  3QDN A;  3FR3 A;  2F8F A;  2H6Y A;  4GLT A;  1KNG A;  4GXZ A;  1PX6 A;  1ERU A;  2C0G A;  4DEJ A;  1R4W A;  5EPF A;  3O6T A;  3HDC A;  3BJ5 A;  3GKK A;  2BTO T;  3QAG A;  1DSB A;  2CVD A;  3GUS A;  3EU4 A;  1WWJ A;  4MJE A;  1A2L A;  1SJ6 A;  2H0G A;  2OBK A;  2XPE A;  1OE7 A;  3M0F A;  3G9B A;  2L5O A;  4E8H A;  3J7Y b;  4K6X A;  1UVZ A;  3LXT A;  1V2A A;  3L4N A;  2E0Q A;  3UAR A;  4BA7 A;  5JWO B;  3FY7 A;  3O3T A;  5C04 A;  5IMA A;  1EEJ A;  2HLS A;  4OWY A;  1A24 A;  2AUV A;  3DD3 A;  2VO4 A;  1GLP A;  3IOS A;  3JCM L;  4OMV A;  3FK8 A;  2ES7 A;  1Z6M A;  1TK0 B;  1MDK A;  3WYW A;  4MMM A;  4PNG A;  1NW2 A;  4ACS A;  3TKS A;  2NTO A;  4GF0 A;  1EGR A;  3TJB A;  5ECN B;  17GS A;  4KW6 A;  1THX A;  1MD3 A;  5ECR B;  4ML6 A;  5F0G A;  1T7P B;  1TU7 A;  3GRX A;  3PGT A;  1GL8 A;  13GS A;  3QOU A;  2K6V A;  4KB3 A;  1BG5 A;  1G0T A;  2PMT A;  3EC3 A;  3ED3 A;  2MMN A;  5IIZ A;  3L9S A;  2KLX A;  5EY6 A;  4GQC A;  2MZC A;  4TR4 A;  3RBT A;  4YAP A;  2PVO C;  2VAF A;  1MEK A;  2RM5 A;  5B7C A;  2C80 A;  3KZQ A;  4ZIL A;  2GSQ A;  2PGT A;  3HCZ A;  5FHI A;  5F07 A;  3A3T A;  3LSZ A;  2A2R A;  2F51 A;  1HNA A;  2C3N A;  3GH6 A;  5D93 A;  2ZNM A;  4MP4 A;  2N5F A;  4EO3 A;  2N5B A;  2L57 A;  1FVJ A;  2GS3 A;  2L4Q A;  3UBK A;  1LJR A;  2VUP A;  2XBI A;  5ID2 B;  1VF3 A;  3GUR A;  4G19 A;  1FB0 A;  2H01 A;  1YF0 A;  1A2J A;  1S3A A;  3LOR A;  3QCP A;  2VCT A;  3GX0 A;  1GSS A;  3IK9 A;  4KUN A;  1X9W B;  4MK3 A;  1YDK A;  3GTU A;  1M99 A;  4TR0 A;  2B5E A;  1BYE A;  3E3E A;  2BJX A;  4CDO A;  2RLI A;  1K3O A;  2FLS A;  3EU3 A;  1R7H A;  2VCW A;  1F6M C;  4KND A;  4K1F A;  4D73 A;  1ERW A;  2R2J A;  1IYH A;  2H1A A;  3FRC A;  3DML A;  3KTL A;  4MZB A;  3WGE A;  2H0H A;  2CVK A;  3ME8 A;  2YV7 A;  3G7I A;  4FYU A;  2IMD A;  3TKP A;  3D4M A;  5CRE A;  1TI3 A;  4K7O A;  4CW9 A;  4ECJ A;  1JHB A;  2GLR A;  3H79 A;  3TRP A;  4HZ2 A;  1TTZ A;  3FR6 A;  2LQQ A;  3HVV A;  1MD4 A;  1TKD B;  4DSQ A;  1OC3 A;  2OA7 A;  1R5P A;  4GRF A;  5AIS A;  3GST A;  1V98 A;  1ERV A;  3M3M A;  4PUR A;  1SD8 A;  1EGO A;  3TRQ A;  2I4A A;  5AGY A;  4ISD A;  3PH9 A;  5IMF A;  3IAM 2;  1Y25 A;  3DVW A;  2PUK C;  3A2X A;  2HRN A;  1HD2 A;  3UAP A;  4KSM A;  3AY8 A;  4J56 E;  4NAX A;  5HR0 A;  2PPT A;  2E2G A;  2H72 A;  2DC5 A;  1C72 A;  2FWE A;  4N0Z A;  1UC7 A;  1A8Y A;  1IYI A;  3P7X A;  3CSJ A;  3ZIJ A;  4H86 A;  2PER A;  1FVK A;  3BCI A;  3UIW A;  1OYJ A;  1ZMA A;  2X8C A;  3D5J A;  3W8J A;  5IOX A;  1FAA A;  4HU9 A;  1USB A;  1XWG A;  3EVI A;  4MLY A;  2EIO A;  4HOJ A;  4KAE A;  4XIH A;  1SD9 A;  1TRV A;  2IN3 A;  4TRX A;  2WZ9 A;  4MDC A;  3NZN A;  1SJZ A;  3H93 A;  1SL1 B;  4HUA A;  2KUC A;  3KJY A;  5A4V A;  2H6X A;  1H4O A;  3ZFB A;  2LS5 A;  2H75 A;  3V1W A;  4FIW A;  2I81 A;  2VM2 A;  3C7M A;  2IWT A;  4I6X A;  1QFN A;  4K8M A;  5GST A;  5KN3 A;  4AF2 A;  3Q74 A;  5HR2 A;  5DVB A;  1SYX A;  2F9S A;  2LQO A;  3C1R A;  2R3X A;  4KCE A;  4LMV A;  3DVX A;  2KP1 A;  2K8V A;  4ZIJ A;  3GTU B;  2GSS A;  2VCQ A;  5C00 A;  4POK A;  2K18 A;  5IQY A;  3HA9 A;  4X43 A;  1N8J A;  3ISO A;  1BQ7 A;  4IVF A;  4XS4 A;  1OKT A;  5LNK e;  3ZVJ A;  3A5W A;  1EV9 A;  1I9D A;  1J0F A;  4IJ3 A;  5B6N A;  3MAK A;  4JU5 A;  4D73 B; 
#chains in the Genus database with same CATH topology
 4L0U A;  4RI6 A;  1VF1 A;  1QMV A;  2DJ2 A;  5DCG A;  4POM A;  1G6W A;  5G1K A;  3ZMK A;  4EDZ A;  3ZL5 A;  3WGD A;  3LJR A;  2DJK A;  3GIX A;  3UVT A;  2C1Y A;  4GSS A;  1PQN A;  1TRW A;  1WRY A;  3I9V 2;  5J4U A;  2IL3 A;  4V2L A;  2C0E A;  4PQ1 A;  3I43 A;  1M2D A;  2HFD A;  4DVC A;  1FW1 A;  3ME7 A;  2R5G A;  4CY8 A;  1ZYP A;  3GKN A;  4CY6 A;  1M0U A;  2VL9 A;  4PUA A;  3UOM A;  2B1L A;  2LRT A;  1URM A;  3FZ9 A;  4RQR A;  4HDE A;  3UEM A;  2KHP A;  1TK5 B;  3I6A A;  2DIZ A;  2CA8 A;  2GQM A;  5H5R A;  3QPM A;  4YQU A;  4G2E A;  3F0I A;  3HVX A;  2H76 A;  2WDU A;  4NHZ A;  1XW9 A;  3VWU A;  2M72 A;  3RHB A;  2DMM A;  2MBT A;  4BVX B;  2DBC A;  4LL4 B;  4P3Y B;  1JFU A;  2QGV A;  2O8V B;  3ZLP A;  5DBQ A;  4MJB A;  2L59 A;  4PGT A;  2RII A;  1V9W A;  3IXR A;  3PIN A;  1B8X A;  2P31 A;  1HYU A;  3F8U A;  4MJA A;  5F8B A;  2IJY A;  4G9H A;  4IBP A;  1M2B A;  3J7Y k;  1M3I A;  3GSS A;  4MH3 A;  1PN9 A;  3RAZ A;  1AQX A;  2IME A;  2D2Z A;  3UL3 A;  4NXI A;  1VF2 A;  4AJ6 A;  4AJ7 A;  1ZYN A;  4USS A;  1AQV A;  2R4V A;  2J23 A;  4L0W A;  3ZZX A;  2FNO A;  4O92 A;  3HJP A;  3GV1 A;  5ENU A;  1KBN A;  3EPT A;  2YJH A;  2DJ0 A;  5D9T A;  1M2A A;  2HYX A;  3IRA A;  3CSH A;  3HVN A;  4ZL9 A;  4ZXG A;  5CNW A;  2LRC A;  3K8N A;  2VIM A;  2VD1 A;  1O8W A;  3WD6 A;  1TDI A;  3C71 A;  3IK7 A;  4Q5N A;  1ABA A;  1PN0 A;  2AV4 A;  2FD3 A;  1FOV A;  3QFA C;  4ZB9 A;  3TOU A;  3TKS C;  3EE2 A;  3APO A;  4EDY A;  4GSN A;  4JR6 A;  4TR1 B;  4BWS A;  1TK8 B;  1JZO A;  2H1B A;  2HT9 A;  2V6K A;  3H4K A;  2HRF A;  1K3L A;  3WT2 A;  4K0N A;  2FGX A;  3C73 A;  1OC9 A;  4IKH A;  1SKW B;  3IDV A;  1TJD A;  3LFL A;  1CQH A;  4KX4 A;  3GX8 A;  2GGT A;  2LKU A;  2YCD A;  1QUW A;  1SEN A;  4NWY A;  5B6M A;  4K9Z A;  1K0C A;  3GMF A;  1DUG A;  2FCH A;  1A0F A;  3ZFL A;  2LRN A;  11GS A;  4BVY A;  2RM6 A;  2V2G A;  2DJ3 A;  3O76 A;  5IMZ A;  4IW9 A;  3TKR A;  6GSS A;  4N10 A;  4ID0 A;  1B9Y C;  5ELG A;  2VLU A;  2MMO A;  3E9J B;  2XC2 A;  2I9H A;  1H75 A;  1PSQ A;  5JCW A;  3QMX A;  2O85 A;  4EC0 A;  2R6K A;  4V2M A;  2O89 A;  1TOF A;  2P5Q A;  1WP0 A;  2NPB A;  2DJ1 A;  3M9K A;  2YZU A;  1XBS A;  2F3M A;  4OO4 A;  4Q5Q A;  1GSE A;  3APS A;  1Z9H A;  2OE1 A;  2H0I A;  1WMJ A;  2LNS A;  2VLV A;  2WCI A;  1TP9 A;  2WGR A;  1Z5Y E;  1Z7P A;  3TUE A;  4LA1 A;  1RK4 A;  3DKS A;  3LYP A;  4LL1 B;  4EF0 A;  4F9Z A;  4YKG A;  4IEL A;  4E8E A;  1XVW A;  4YAV A;  1U6T A;  4KH7 A;  3IPZ A;  2X99 A;  2DML A;  1S3C A;  1F3B A;  3CMI A;  5JWQ B;  3KXO A;  4FQU A;  1O81 A;  5J9C A;  1W89 A;  1QQ2 A;  1PD2 1;  5JCG A;  4F0B A;  2UZ8 A;  4PQH A;  3A2W A;  3VPT A;  1HQO A;  4BL7 B;  1HNB A;  5DCH A;  6GSV A;  3A2V A;  3PR8 A;  2O7K A;  3VUR A;  4KSO A;  5DAL A;  2GQK A;  3BD2 A;  1B9X C;  1GNE A;  4K2D A;  1B4P A;  2G2Q A;  2GZY A;  1XW5 A;  2HZE A;  2YAN A;  2JL4 A;  10GS A;  2NBS A;  3FMW A;  2YWO A;  4WF5 A;  2KOK A;  2CZ3 A;  3GHA A;  2B5Y A;  4HS1 A;  1SK1 A;  3IHG A;  3FR9 A;  3KEB A;  1OC9 B;  1XOA A;  2B7K A;  3DXB A;  3CRT A;  1DE1 A;  2B6M A;  3G7Y A;  1XWK A;  5HFG A;  1RQM A;  4XS6 A;  1NHO A;  2CVB A;  3CRU A;  1U3A A;  4YQM A;  1AAZ A;  5IO0 A;  5ECO B;  4ZBA A;  5DAK A;  5IMC A;  3RHC A;  3F3Q A;  2JSZ A;  4BVY B;  1Q4J A;  1ZGN A;  5EVO A;  3VFI A;  1AW9 A;  3D22 A;  2VD0 A;  3QD9 A;  4G0K A;  4EKZ A;  2FWG A;  2X8G A;  4JRR A;  2V1M A;  2HSY A;  1XG8 A;  2WJU A;  1V40 A;  2GZZ A;  1F2E A;  5CYY A;  1SYR A;  3MNG A;  3Q6O A;  3VWV A;  1GUM A;  4O5R A;  4MH2 A;  2C8U A;  3VWW A;  1T00 A;  2GT5 A;  3R2Q A;  4EXJ A;  3VPQ A;  1JZR A;  2QKE A;  3EYT A;  5IM9 A;  3H8Q A;  4DSS A;  3E0U A;  5D73 A;  3M9J A;  2FWH A;  5KN1 A;  1U88 A;  4MF6 A;  5IPG A;  5ECQ B;  3IV4 A;  4MPF A;  3KP9 A;  1J9B A;  1XWA A;  1OKD A;  4I2U A;  1J08 A;  3FEU A;  1M9A A;  2EIR A;  1E6B A;  1ZL9 A;  4IS0 A;  4KA0 A;  4NHW A;  1AQW A;  4WR4 A;  1UA5 A;  5D9V A;  1DBY A;  2XBQ A;  4N30 A;  2EIQ A;  4GQF A;  5D8I A;  14GS A;  1PKW A;  3HVS A;  1X9S B;  5ELA A;  2M46 A;  3MWH A;  2YWI A;  5AIV A;  2A4V A;  3IR4 A;  1PL2 A;  2PN8 A;  5G5F A;  1B48 A;  1ACV A;  1O8X A;  3F9U A;  1ERT A;  3LG6 A;  4V1A p;  1PRX A;  5A4U A;  5ECH B;  5KOW A;  2C4J A;  2DLX A;  3U5R E;  2ON7 A;  3KM6 A;  2G0F A;  1KTE A;  1ZYQ B;  4ZBB A;  3ZML A;  20GS A;  6GSU A;  5G30 A;  5DJL A;  1GSQ A;  4HQZ A;  1NHY A;  1YKA A;  3IBH A;  2VM1 A;  4OFM A;  5J3R A;  3KGK A;  2RUE A;  1A0R P;  4NV5 A;  5G5E A;  4KDX A;  3R3E A;  5G1L A;  3ZRD A;  4IJI A;  5DAL B;  2IFQ A;  1ZZY A;  5HFK A;  4IGJ A;  1EP8 A;  3Q18 A;  2C3Q A;  1XIY A;  2JZT A;  3CTF A;  5JCU A;  4POL A;  1UN2 A;  4FH8 A;  5HR3 A;  2HZE B;  1B4Q A;  2F8A A;  3SBC A;  3TB2 A;  1PL1 A;  2VLT A;  2YWM A;  4HJ2 A;  2HSH A;  4KF9 A;  2R0G A;  5ECM B;  4Q5F A;  3UBL A;  1G7E A;  6GSY A;  2V41 A;  1YEP A;  1GTA A;  5CO3 A;  5IOW A;  3GL3 A;  4OO5 A;  3IA1 A;  18GS A;  1V57 A;  3BCK A;  4ECC A;  3HD5 A;  4KCA A;  5ECS A;  2JAD A;  4L5L A;  1GLQ A;  2HSM A;  2QA2 A;  5EL8 A;  2L4C A;  2JZS A;  4ICY A;  2FA4 A;  3KCM A;  1O73 A;  2O87 A;  4XCS A;  2GVP A;  1DE2 A;  5IMV A;  1F37 A;  4RQX A;  2PVQ A;  3G7J A;  3HXS A;  2NDO A;  3CYN A;  1ST9 A;  4DSR A;  1X9M B;  2H6Z A;  4V2N A;  1A8L A;  4EL1 A;  2JZR A;  3D6I A;  4JR4 A;  2HRA A;  3HJO A;  2OE0 A;  3D21 A;  2PU9 C;  3GA4 A;  4ECI A;  3DEX A;  2HI7 A;  1I5G A;  4KE3 A;  19GS A;  4F2I A;  3DRN A;  1PA3 A;  2DSA A;  3KH7 A;  1FO5 A;  1GRX A;  4KGI A;  4OFT A;  1BED A;  4IP1 A;  3F4S A;  1M9B A;  2C3T A;  1PKZ A;  4TR3 A;  2CQ9 A;  2WFC A;  1R5A A;  2TIR A;  1GNW A;  4CHS A;  1GH2 A;  3N9J A;  2GDR A;  1SJI A;  2OAD A;  4WF4 A;  4YH2 A;  4WBR D;  1GSD A;  2K9F A;  3MSZ A;  1XW6 A;  3DYR A;  4OCF A;  3ZIV A;  4HEA 2;  4TXO A;  2AB6 A;  1TRU A;  3L78 A;  3QR6 A;  2YP6 A;  1EV4 A;  2YPM A;  3UMA A;  3FZ5 A;  2H66 A;  9GSS A;  2VL2 A;  3VLN A;  4QQ7 A;  2DIY A;  2ZUP A;  2E2M A;  4GST A;  1X0R A;  3TJG A;  6GSX A;  3LQ7 A;  1GTI A;  2GQL A;  2YN1 A;  2DJJ A;  3U6V A;  3TJK A;  3C1S A;  1FG4 A;  1Z3E A;  2GT6 A;  4NMU A;  4MZC A;  3US3 A;  1T8E B;  3TKS E;  4NV2 A;  5BRT A;  2WS2 A;  2K8S A;  3LGC A;  2CX3 A;  1OVN A;  1K0A A;  1AC1 A;  1O7U A;  4QL9 A;  5F06 A;  5ID2 A;  3QFB C;  2LNT A;  5LCZ A;  2ZCT A;  5CRG A;  1TI1 A;  1SL2 B;  3TOT A;  2CAQ A;  3UJ1 A;  4G0I A;  4WXT A;  1JLV A;  8GSS A;  5H5S A;  22GS A;  4KDY A;  3MYD A;  2CZ2 A;  4EIQ A;  1R26 A;  4RI7 A;  5DDL A;  1XOB A;  1K0M A;  1Y6E A;  5INY A;  4TXV A;  2IPA A;  2WUL A;  4MPG A;  5ABR A;  2LUS A;  4ULX A;  2H19 A;  4O5U A;  1JLW A;  4XS4 B;  4EUY A;  1Q98 A;  5IMD A;  1SKS B;  1BX9 A;  4WBJ A;  5G31 A;  3BOA A;  2AJQ B;  2B3S A;  2H71 A;  4FYC A;  5ECP B;  5COH A;  2HZF A;  1T4Y A;  2VOC A;  1YQ1 A;  3F4R A;  1SKR B;  2Z9S A;  1T1V A;  2H30 A;  3M1G A;  1N2A A;  2OKA A;  1T4Z A;  3KTB A;  4BWQ A;  4MZW A;  1LBK A;  2V6O A;  1EOG A;  5GSS A;  2PBJ A;  2OE3 A;  1TU8 A;  5F05 A;  4G10 A;  3SWL A;  3TGZ A;  4ML1 A;  1ON4 A;  2MYG A;  3DIE A;  1PFO A;  1YJ6 A;  2H1D A;  1XWB A;  1Z6N A;  4A5P A;  5D9W A;  1VRS D;  2L6C A;  1HNC A;  3MIX A;  2B5X A;  1XZO A;  4MCU A;  4TKY A;  4FYB A;  3CSI A;  5KN0 A;  1XPV A;  3LXZ A;  4AJ8 A;  3UVH A;  2CX4 A;  1EP7 A;  2B7J A;  2GST A;  2PWJ A;  2H70 A;  2QSI A;  2R37 A;  4IQ1 A;  3H1N A;  4PUF C;  2FA8 A;  4WET A;  1SK0 A;  1OE8 A;  2BMX A;  3FZ4 A;  2C0F A;  5DQY A;  2FY6 A;  2V32 A;  1GUH A;  2CT6 A;  3TJF A;  4HJM A;  2GTU A;  4TXO B;  5KEJ A;  4N0V A;  1F9M A;  3F3R A;  4MJC A;  3NIV A;  1O6J A;  2YOI A;  5AIX A;  2YWN A;  4ZL8 A;  5FWG A;  3TRX A;  2YJ7 A;  4XHM A;  3IC4 A;  3HHV A;  1F3A A;  1NM3 A;  2A2S A;  4JE1 A;  2I1U A;  4ZBD A;  5GZZ B;  3WGX A;  4EE0 A;  3PPU A;  5E59 A;  2HXK A;  2P0G A;  4JED A;  7GSS A;  4IN0 A;  5D96 A;  1VF4 A;  3P2A A;  4I8B A;  1GP1 A;  1PGT A;  3GN3 A;  4MA9 A;  1GSU A;  4HZ4 A;  5CRW A;  2I3Y A;  3N5O A;  1YKC A;  2LTK A;  1G6Y A;  2R0P A;  3I69 A;  2L5L A;  4XRD A;  2IMF A;  2J9H A;  3L0H A;  2XPD A;  5ECK B;  4WKW A;  1XFL A;  4IHU A;  3HZ4 A;  5DQS A;  1WE0 A;  3HKR A;  4HU7 A;  2MMZ A;  1TW9 A;  2TRX A;  3FYG A;  4YQV A;  4ZL7 A;  5FT3 A;  1JZW A;  2E7P A;  6GSW A;  1WOU A;  4TVE A;  1SU9 A;  1EWX A;  4EVM A;  4F0C A;  1T3B A;  5GAP D;  1QGV A;  3GKX A;  4QL7 A;  1PX7 A;  5DJM A;  4Q5R A;  1XCC A;  2AAW A;  4PX1 A;  3ZTL A;  4BPY A;  1GTU A;  3W6G A;  5KN2 A;  5L71 A;  3VI5 A;  3D4T A;  4Z7X A;  3BBY A;  3TCO A;  3NOF A;  5HFI A;  5HQP A;  5J9B A;  1LU4 A;  1U87 A;  4K5R A;  3EWL A;  3CTG A;  3RPP A;  4V1A g;  2N5A A;  3F4T A;  3QAV A;  4GCI A;  3LEF A;  3KD0 A;  1MDJ A;  1ILO A;  3S9F A;  2X64 A;  5IO2 A;  1TRS A;  2REM A;  4XS1 A;  1WJK A;  3RDW A;  3IC8 A;  2VL3 A;  4JBB A;  4PNF A;  3VK9 A;  1WIK A;  2H1G A;  1ZOF A;  2ALB A;  4X1U A;  3ERW A;  5A5K A;  2WB9 A;  1K0D A;  2OBI A;  3EMP A;  3MDK A;  1GUK A;  5AN1 A;  5HR1 A;  4BVX A;  1G7O A;  2CAI A;  3TJJ A;  4L5O A;  2R0C A;  1FHE A;  3IAS 2;  2QC7 A;  2IMI A;  3ERG A;  1GWC A;  3FZA A;  3GNJ A;  2C0D A;  5CP1 A;  2IIY A;  3W8S A;  2AHE A;  4MF5 A;  2GSR A;  1ZYE A;  3F6F A;  2YV9 A;  4WEY A;  2WRT A;  2A4H A;  5J5N A;  4PTS A;  5B8B A;  3HZ8 A;  2HE3 A;  4ILF A;  2VCV A;  2LEG A;  1M7T A;  1MTC A;  3KH9 A;  4OD7 A;  3LYK A;  4GWR A;  4AGS A;  2LST A;  3TKQ A;  2B1K A;  4IQA A;  1YY7 A;  3KP8 A;  1AIU A;  4Z2R A;  4GTU A;  2H74 A;  3ZIT A;  1GUL A;  3VWX A;  1V58 A;  4ZB8 A;  3L9V A;  4MF7 A;  2FHE A;  4I2T A;  2EC4 A;  3ZVJ D;  2ON5 A;  4MAB A;  3FKF A;  1XXU A;  3ZRE A;  3IHQ A;  2L6D A;  1W4V A;  3EMX A;  3EIN A;  3VI7 A;  5ECI B;  1K0O A;  2JSY A;  3HYP A;  4OCE A;  1EEM A;  2TRC P;  1VGL A;  2H73 A;  4I5Q A;  4HQS A;  2OJL A;  3F63 A;  4TR1 A;  1ZCP A;  4F82 A;  4J57 E;  2MMA A;  2MBS A;  4LMW A;  2GZP A;  2X4A A;  1GSY A;  1X5E A;  3QAW A;  4O32 A;  1XWC A;  1K3Y A;  3GL5 A;  4J2F A;  3HJM A;  5JWR B;  4O7H A;  1SL0 B;  4X0X A;  2HNL A;  2VL2 C;  2YZH A;  4FO5 A;  1BAY A;  2LJR A;  2LJA A;  1U3I A;  5LD0 A;  1GSF A;  3F6D A;  1QK8 A;  4N11 A;  4RUV A;  4MNN A;  4XRA A;  5DAK B;  1OAZ A;  1FB6 A;  4XTS A;  4L8E A;  5B8A A;  1O85 A;  3Q19 A;  2H8L A;  3ZYW A;  1RW1 A;  3KIJ A;  5G2Z A;  1THO A;  3GH9 A;  3HY2 A;  1GTB A;  3LW9 A;  3M8N A;  5CAX A;  5J41 A;  4PXO A;  3L9U A;  5H5Q A;  1EZK A;  3ERF A;  1QXH A;  4HI7 A;  1X5C A;  4I97 A;  4TN8 A;  4K7N A;  5GAN D;  2FUG 2;  2IMK A;  4IP6 A;  2YNX A;  6GST A;  5KOX A;  5E4W A;  4DSS B;  3KMO A;  5D9X A;  2AYT A;  3GKM A;  1TXX A;  2P5R A;  3LWA A;  2LV3 A;  4Z2T A;  16GS A;  3CXG A;  5CRH A;  4POB A;  3FW2 A;  3GYK A;  1KEB A;  1X5D A;  2M80 A;  2XHF A;  3TDG A;  1SK2 A;  4PQI A;  1OC8 A;  3KMN A;  3CBU A;  4TOP A;  4EIP A;  3APQ A;  2KP2 A;  1CQG A;  3GFK A;  3P90 A;  2LJK A;  5A4W A;  1S3D A;  2OAC A;  1E2Y A;  1MDI A;  3OR5 A;  1BJX A;  2JAC A;  1NSW A;  1A2M A;  2CV4 A;  2X8H A;  4K0G A;  1ML6 A;  4WR5 A;  1XVQ A;  4LLR A;  1PMT A;  3D0Z A;  1YF1 A;  2VCX A;  3FHK A;  3WT1 A;  5IPH A;  1A23 A;  1AUC A;  1AXD A;  4NPB A;  4ECB A;  1WPI A;  3C8E A;  1K0N A;  4JZQ A;  4OFN A;  3EUR A;  1S3R A;  1EOH A;  12GS A;  4ZB6 A;  3RPN A;  1YZX A;  3DWV A;  2FWF A;  2VCZ A;  1Z7R A;  3P8W A;  5CRD A;  4F03 A;  2JU5 A;  4BL7 A;  2IFQ B;  2RUF A;  5ECL B;  4TW5 A;  3IE3 A;  1M3J A;  4K7I A;  1K0B A;  2NVL A;  1YEX A;  4KDU A;  3DGQ A;  1JZD A;  3QDN A;  3FR3 A;  2F8F A;  2H6Y A;  4GLT A;  2DKH A;  1KNG A;  4GXZ A;  1PX6 A;  1ERU A;  2C0G A;  4DEJ A;  1R4W A;  4K5S A;  5EPF A;  3O6T A;  3HDC A;  3BJ5 A;  3GKK A;  4HSC X;  2BTO T;  3QAG A;  4O5Q A;  1DSB A;  2CVD A;  2QA1 A;  3GUS A;  3EU4 A;  1WWJ A;  4MJE A;  1A2L A;  1SJ6 A;  2H0G A;  2OBK A;  2XPE A;  1OE7 A;  3M0F A;  3G9B A;  2L5O A;  4E8H A;  3J7Y b;  4K6X A;  1UVZ A;  3LXT A;  1V2A A;  3L4N A;  4YKF A;  2E0Q A;  3UAR A;  4BA7 A;  5JWO B;  3FY7 A;  3O3T A;  5C04 A;  5IMA A;  1EEJ A;  2HLS A;  4OWY A;  4X4J A;  1A24 A;  2AUV A;  3DD3 A;  2VO4 A;  1GLP A;  3IOS A;  3JCM L;  4OMV A;  3FK8 A;  2ES7 A;  1Z6M A;  1TK0 B;  4G0L A;  1MDK A;  3WYW A;  4MMM A;  4PNG A;  1NW2 A;  4ACS A;  3TKS A;  2NTO A;  4GF0 A;  1EGR A;  3TJB A;  5ECN B;  17GS A;  2DKI A;  4KW6 A;  1THX A;  1MD3 A;  5ECR B;  4ML6 A;  5F0G A;  4Z2U A;  1T7P B;  1TU7 A;  3GRX A;  3PGT A;  1GL8 A;  13GS A;  3QOU A;  2K6V A;  4KB3 A;  1BG5 A;  1G0T A;  2PMT A;  3EC3 A;  3ED3 A;  2MMN A;  5IIZ A;  5BMU A;  3L9S A;  2KLX A;  5EY6 A;  4GQC A;  2MZC A;  4TR4 A;  3RBT A;  4YAP A;  2VAF A;  2PVO C;  1MEK A;  2RM5 A;  5B7C A;  2C80 A;  3KZQ A;  4ZIL A;  2GSQ A;  2PGT A;  3HCZ A;  5FHI A;  5F07 A;  3A3T A;  3LSZ A;  2A2R A;  2F51 A;  1HNA A;  2C3N A;  3GH6 A;  5D93 A;  2ZNM A;  4MP4 A;  2N5F A;  4EO3 A;  2N5B A;  2L57 A;  1FVJ A;  2GS3 A;  2L4Q A;  3UBK A;  1LJR A;  2VUP A;  2XBI A;  5ID2 B;  1VF3 A;  3A5I A;  3GUR A;  4G19 A;  1FB0 A;  2H01 A;  1YF0 A;  1A2J A;  1S3A A;  3LOR A;  3QCP A;  2VCT A;  3GX0 A;  1GSS A;  3IK9 A;  4KUN A;  1X9W B;  4MK3 A;  1YDK A;  3GTU A;  1M99 A;  4TR0 A;  2B5E A;  1BYE A;  3E3E A;  2BJX A;  4CDO A;  2RLI A;  1K3O A;  2FLS A;  3EU3 A;  1R7H A;  2VCW A;  1F6M C;  4KND A;  4K1F A;  4D73 A;  1ERW A;  2R2J A;  1IYH A;  2H1A A;  3FRC A;  3DML A;  3KTL A;  2X49 A;  4MZB A;  3WGE A;  2H0H A;  2CVK A;  3ME8 A;  2YV7 A;  3G7I A;  4FYU A;  2IMD A;  3TKP A;  3D4M A;  5CRE A;  1TI3 A;  4K7O A;  4CW9 A;  4ECJ A;  1JHB A;  2GLR A;  3H79 A;  1FOH A;  3TRP A;  4HZ2 A;  1TTZ A;  3FR6 A;  2LQQ A;  3HVV A;  1MD4 A;  1TKD B;  4DSQ A;  1OC3 A;  2OA7 A;  1R5P A;  4GRF A;  5AIS A;  3GST A;  1V98 A;  1ERV A;  3M3M A;  4PUR A;  1SD8 A;  1EGO A;  3TRQ A;  2I4A A;  5AGY A;  4ISD A;  3PH9 A;  5IMF A;  3IAM 2;  1Y25 A;  3DVW A;  2PUK C;  3A2X A;  2HRN A;  1HD2 A;  3UAP A;  4KSM A;  3AY8 A;  4J56 E;  4NAX A;  5HR0 A;  2PPT A;  2E2G A;  2H72 A;  2DC5 A;  1C72 A;  2FWE A;  4N0Z A;  1UC7 A;  1A8Y A;  1IYI A;  3P7X A;  3CSJ A;  3ZIJ A;  4H86 A;  2PER A;  1FVK A;  3BCI A;  3UIW A;  1OYJ A;  1ZMA A;  2X8C A;  3D5J A;  4K2X A;  3W8J A;  4BIK A;  5IOX A;  1FAA A;  4HU9 A;  1USB A;  1XWG A;  3EVI A;  4MLY A;  2EIO A;  2HRK A;  4HOJ A;  4KAE A;  4XIH A;  1SD9 A;  1TRV A;  2IN3 A;  4TRX A;  2WZ9 A;  4MDC A;  3NZN A;  1SJZ A;  3H93 A;  1SL1 B;  4HUA A;  2KUC A;  3KJY A;  5A4V A;  2H6X A;  1H4O A;  3ZFB A;  2LS5 A;  2H75 A;  3V1W A;  2A2P A;  4FIW A;  2I81 A;  2VM2 A;  3C7M A;  2IWT A;  4I6X A;  1QFN A;  4K8M A;  5GST A;  5KN3 A;  4AF2 A;  3Q74 A;  5HR2 A;  5DVB A;  1SYX A;  2F9S A;  2LQO A;  3C1R A;  2R3X A;  4KCE A;  4LMV A;  3DVX A;  2KP1 A;  2K8V A;  4ZIJ A;  3GTU B;  2GSS A;  2VCQ A;  5C00 A;  4POK A;  2K18 A;  5IQY A;  3CQF A;  3HA9 A;  4X43 A;  1N8J A;  3ISO A;  1BQ7 A;  4IVF A;  4XS4 A;  1OKT A;  5LNK e;  3ZVJ A;  3A5W A;  1EV9 A;  1I9D A;  1J0F A;  4IJ3 A;  5B6N A;  3MAK A;  4JU5 A;  4D73 B; 
#chains in the Genus database with same CATH homology
 4L0U A;  4RI6 A;  1VF1 A;  1QMV A;  2DJ2 A;  5DCG A;  4POM A;  1G6W A;  5G1K A;  3ZMK A;  4EDZ A;  3ZL5 A;  3WGD A;  3LJR A;  2DJK A;  3GIX A;  3UVT A;  2C1Y A;  4GSS A;  1PQN A;  1TRW A;  1WRY A;  3I9V 2;  5J4U A;  2IL3 A;  4V2L A;  2C0E A;  4PQ1 A;  3I43 A;  1M2D A;  2HFD A;  4DVC A;  1FW1 A;  3ME7 A;  2R5G A;  4CY8 A;  1ZYP A;  3GKN A;  4CY6 A;  1M0U A;  2VL9 A;  4PUA A;  3UOM A;  2B1L A;  2LRT A;  1URM A;  3FZ9 A;  4RQR A;  4HDE A;  3UEM A;  2KHP A;  1TK5 B;  3I6A A;  2DIZ A;  2CA8 A;  2GQM A;  5H5R A;  3QPM A;  4YQU A;  4G2E A;  3F0I A;  3HVX A;  2H76 A;  2WDU A;  4NHZ A;  1XW9 A;  3VWU A;  2M72 A;  3RHB A;  2DMM A;  2MBT A;  4BVX B;  2DBC A;  4LL4 B;  4P3Y B;  1JFU A;  2QGV A;  2O8V B;  3ZLP A;  5DBQ A;  4MJB A;  2L59 A;  4PGT A;  2RII A;  1V9W A;  3IXR A;  3PIN A;  1B8X A;  2P31 A;  1HYU A;  3F8U A;  4MJA A;  5F8B A;  2IJY A;  4G9H A;  4IBP A;  1M2B A;  3J7Y k;  3GSS A;  4MH3 A;  1PN9 A;  3RAZ A;  1AQX A;  2IME A;  2D2Z A;  3UL3 A;  4NXI A;  1VF2 A;  4AJ6 A;  4AJ7 A;  1ZYN A;  4USS A;  1AQV A;  2R4V A;  2J23 A;  4L0W A;  3ZZX A;  2FNO A;  4O92 A;  3HJP A;  3GV1 A;  5ENU A;  1KBN A;  3EPT A;  2YJH A;  2DJ0 A;  5D9T A;  1M2A A;  2HYX A;  3IRA A;  3CSH A;  4ZL9 A;  4ZXG A;  5CNW A;  2LRC A;  3K8N A;  2VIM A;  2VD1 A;  1O8W A;  3WD6 A;  1TDI A;  3C71 A;  3IK7 A;  4Q5N A;  1ABA A;  1PN0 A;  2AV4 A;  2FD3 A;  1FOV A;  3QFA C;  4ZB9 A;  3TOU A;  3TKS C;  3EE2 A;  3APO A;  4EDY A;  4GSN A;  4JR6 A;  4TR1 B;  4BWS A;  1TK8 B;  1JZO A;  2H1B A;  2HT9 A;  2V6K A;  3H4K A;  2HRF A;  1K3L A;  3WT2 A;  4K0N A;  2FGX A;  3C73 A;  1OC9 A;  4IKH A;  1SKW B;  3IDV A;  1TJD A;  3LFL A;  1CQH A;  4KX4 A;  3GX8 A;  2GGT A;  2LKU A;  2YCD A;  1QUW A;  1SEN A;  4NWY A;  5B6M A;  4K9Z A;  1K0C A;  3GMF A;  1DUG A;  2FCH A;  1A0F A;  3ZFL A;  2LRN A;  11GS A;  4BVY A;  2RM6 A;  2V2G A;  2DJ3 A;  3O76 A;  5IMZ A;  4IW9 A;  3TKR A;  6GSS A;  4N10 A;  4ID0 A;  1B9Y C;  5ELG A;  2VLU A;  2MMO A;  3E9J B;  2XC2 A;  2I9H A;  1H75 A;  1PSQ A;  5JCW A;  3QMX A;  2O85 A;  4EC0 A;  2R6K A;  4V2M A;  2O89 A;  1TOF A;  2P5Q A;  1WP0 A;  2NPB A;  2DJ1 A;  3M9K A;  2YZU A;  1XBS A;  2F3M A;  4OO4 A;  4Q5Q A;  1GSE A;  3APS A;  1Z9H A;  2OE1 A;  2H0I A;  1WMJ A;  2LNS A;  2VLV A;  2WCI A;  1TP9 A;  2WGR A;  1Z5Y E;  1Z7P A;  3TUE A;  4LA1 A;  1RK4 A;  3DKS A;  3LYP A;  4LL1 B;  4EF0 A;  4F9Z A;  4YKG A;  4IEL A;  4E8E A;  1XVW A;  4YAV A;  1U6T A;  4KH7 A;  3IPZ A;  2X99 A;  2DML A;  1S3C A;  1F3B A;  3CMI A;  5JWQ B;  3KXO A;  4FQU A;  1O81 A;  5J9C A;  1W89 A;  1QQ2 A;  1PD2 1;  5JCG A;  4F0B A;  2UZ8 A;  4PQH A;  3A2W A;  3VPT A;  1HQO A;  4BL7 B;  1HNB A;  5DCH A;  6GSV A;  3A2V A;  3PR8 A;  2O7K A;  3VUR A;  4KSO A;  5DAL A;  2GQK A;  3BD2 A;  1B9X C;  1GNE A;  4K2D A;  1B4P A;  2G2Q A;  2GZY A;  1XW5 A;  2HZE A;  2YAN A;  2JL4 A;  10GS A;  2NBS A;  3FMW A;  2YWO A;  4WF5 A;  2KOK A;  2CZ3 A;  3GHA A;  2B5Y A;  4HS1 A;  1SK1 A;  3IHG A;  3FR9 A;  3KEB A;  1OC9 B;  1XOA A;  2B7K A;  3DXB A;  3CRT A;  1DE1 A;  2B6M A;  3G7Y A;  1XWK A;  5HFG A;  1RQM A;  4XS6 A;  1NHO A;  2CVB A;  3CRU A;  4YQM A;  1U3A A;  1AAZ A;  5IO0 A;  5ECO B;  4ZBA A;  5DAK A;  5IMC A;  3RHC A;  3F3Q A;  2JSZ A;  4BVY B;  1Q4J A;  1ZGN A;  5EVO A;  3VFI A;  1AW9 A;  3D22 A;  2VD0 A;  3QD9 A;  4G0K A;  4EKZ A;  2FWG A;  2X8G A;  4JRR A;  2V1M A;  2HSY A;  2WJU A;  1V40 A;  2GZZ A;  1F2E A;  5CYY A;  1SYR A;  3MNG A;  3Q6O A;  3VWV A;  1GUM A;  4O5R A;  4MH2 A;  2C8U A;  3VWW A;  1T00 A;  2GT5 A;  3R2Q A;  4EXJ A;  3VPQ A;  1JZR A;  2QKE A;  3EYT A;  5IM9 A;  3H8Q A;  4DSS A;  3E0U A;  5D73 A;  3M9J A;  2FWH A;  5KN1 A;  1U88 A;  4MF6 A;  5IPG A;  5ECQ B;  3IV4 A;  4MPF A;  3KP9 A;  1J9B A;  1XWA A;  1OKD A;  4I2U A;  1J08 A;  3FEU A;  1M9A A;  2EIR A;  1E6B A;  1ZL9 A;  4IS0 A;  4KA0 A;  4NHW A;  1AQW A;  4WR4 A;  1UA5 A;  5D9V A;  1DBY A;  2XBQ A;  4N30 A;  2EIQ A;  4GQF A;  5D8I A;  14GS A;  1PKW A;  3HVS A;  1X9S B;  5ELA A;  2M46 A;  3MWH A;  2YWI A;  5AIV A;  2A4V A;  3IR4 A;  1PL2 A;  2PN8 A;  5G5F A;  1B48 A;  1ACV A;  1O8X A;  3F9U A;  1ERT A;  3LG6 A;  4V1A p;  1PRX A;  5A4U A;  5ECH B;  5KOW A;  2C4J A;  2DLX A;  3U5R E;  2ON7 A;  3KM6 A;  2G0F A;  1KTE A;  1ZYQ B;  4ZBB A;  3ZML A;  20GS A;  6GSU A;  5G30 A;  5DJL A;  1GSQ A;  4HQZ A;  1NHY A;  1YKA A;  3IBH A;  2VM1 A;  4OFM A;  5J3R A;  3KGK A;  2RUE A;  1A0R P;  4NV5 A;  5G5E A;  4KDX A;  3R3E A;  5G1L A;  3ZRD A;  4IJI A;  5DAL B;  2IFQ A;  1ZZY A;  5HFK A;  4IGJ A;  1EP8 A;  3Q18 A;  2C3Q A;  1XIY A;  2JZT A;  3CTF A;  5JCU A;  4POL A;  1UN2 A;  4FH8 A;  5HR3 A;  2HZE B;  1B4Q A;  2F8A A;  3SBC A;  3TB2 A;  1PL1 A;  2VLT A;  2YWM A;  4HJ2 A;  2HSH A;  4KF9 A;  2R0G A;  5ECM B;  4Q5F A;  3UBL A;  1G7E A;  6GSY A;  2V41 A;  1YEP A;  1GTA A;  5CO3 A;  5IOW A;  3GL3 A;  4OO5 A;  3IA1 A;  18GS A;  1V57 A;  3BCK A;  4ECC A;  3HD5 A;  4KCA A;  5ECS A;  2JAD A;  4L5L A;  1GLQ A;  2HSM A;  2QA2 A;  5EL8 A;  2L4C A;  2JZS A;  4ICY A;  2FA4 A;  3KCM A;  1O73 A;  2O87 A;  4XCS A;  2GVP A;  1DE2 A;  5IMV A;  1F37 A;  4RQX A;  2PVQ A;  3G7J A;  3HXS A;  2NDO A;  3CYN A;  1ST9 A;  4DSR A;  1X9M B;  2H6Z A;  4V2N A;  1A8L A;  4EL1 A;  2JZR A;  3D6I A;  4JR4 A;  2HRA A;  3HJO A;  2OE0 A;  3D21 A;  2PU9 C;  3GA4 A;  4ECI A;  3DEX A;  2HI7 A;  1I5G A;  4KE3 A;  19GS A;  4F2I A;  3DRN A;  1PA3 A;  2DSA A;  3KH7 A;  1FO5 A;  1GRX A;  4KGI A;  4OFT A;  1BED A;  4IP1 A;  3F4S A;  1M9B A;  2C3T A;  1PKZ A;  4TR3 A;  2CQ9 A;  2WFC A;  1R5A A;  2TIR A;  1GNW A;  4CHS A;  1GH2 A;  3N9J A;  2GDR A;  1SJI A;  2OAD A;  4WF4 A;  4YH2 A;  4WBR D;  1GSD A;  2K9F A;  3MSZ A;  1XW6 A;  3DYR A;  4OCF A;  3ZIV A;  4HEA 2;  4TXO A;  2AB6 A;  1TRU A;  3L78 A;  3QR6 A;  2YP6 A;  1EV4 A;  2YPM A;  3UMA A;  3FZ5 A;  2H66 A;  9GSS A;  2VL2 A;  3VLN A;  4QQ7 A;  2DIY A;  2ZUP A;  2E2M A;  4GST A;  1X0R A;  3TJG A;  6GSX A;  3LQ7 A;  1GTI A;  2GQL A;  2YN1 A;  2DJJ A;  3U6V A;  3TJK A;  3C1S A;  1FG4 A;  1Z3E A;  2GT6 A;  4NMU A;  4MZC A;  3US3 A;  1T8E B;  3TKS E;  4NV2 A;  5BRT A;  2WS2 A;  2K8S A;  3LGC A;  2CX3 A;  1OVN A;  1K0A A;  1AC1 A;  1O7U A;  4QL9 A;  5F06 A;  5ID2 A;  3QFB C;  2LNT A;  5LCZ A;  2ZCT A;  5CRG A;  1TI1 A;  1SL2 B;  3TOT A;  2CAQ A;  3UJ1 A;  4G0I A;  4WXT A;  1JLV A;  8GSS A;  5H5S A;  22GS A;  4KDY A;  3MYD A;  2CZ2 A;  4EIQ A;  1R26 A;  4RI7 A;  5DDL A;  1XOB A;  1K0M A;  1Y6E A;  5INY A;  4TXV A;  2IPA A;  2WUL A;  4MPG A;  5ABR A;  2LUS A;  4ULX A;  2H19 A;  4O5U A;  1JLW A;  4XS4 B;  4EUY A;  1Q98 A;  5IMD A;  1SKS B;  1BX9 A;  4WBJ A;  5G31 A;  3BOA A;  2AJQ B;  2B3S A;  2H71 A;  4FYC A;  5ECP B;  5COH A;  2HZF A;  1T4Y A;  2VOC A;  1YQ1 A;  3F4R A;  1SKR B;  2Z9S A;  1T1V A;  2H30 A;  3M1G A;  1N2A A;  2OKA A;  1T4Z A;  3KTB A;  4BWQ A;  4MZW A;  1LBK A;  2V6O A;  1EOG A;  5GSS A;  2PBJ A;  2OE3 A;  1TU8 A;  5F05 A;  4G10 A;  3SWL A;  3TGZ A;  4ML1 A;  1ON4 A;  2MYG A;  3DIE A;  1YJ6 A;  2H1D A;  1XWB A;  1Z6N A;  4A5P A;  5D9W A;  1VRS D;  2L6C A;  1HNC A;  3MIX A;  2B5X A;  1XZO A;  4MCU A;  4TKY A;  4FYB A;  3CSI A;  5KN0 A;  1XPV A;  3LXZ A;  4AJ8 A;  3UVH A;  2CX4 A;  1EP7 A;  2B7J A;  2GST A;  2PWJ A;  2H70 A;  2QSI A;  2R37 A;  4IQ1 A;  3H1N A;  4PUF C;  2FA8 A;  4WET A;  1SK0 A;  1OE8 A;  2BMX A;  3FZ4 A;  2C0F A;  5DQY A;  2FY6 A;  2V32 A;  1GUH A;  2CT6 A;  3TJF A;  4HJM A;  2GTU A;  4TXO B;  5KEJ A;  4N0V A;  1F9M A;  3F3R A;  4MJC A;  3NIV A;  1O6J A;  2YOI A;  5AIX A;  2YWN A;  4ZL8 A;  5FWG A;  3TRX A;  2YJ7 A;  4XHM A;  3IC4 A;  3HHV A;  1F3A A;  1NM3 A;  2A2S A;  4JE1 A;  2I1U A;  4ZBD A;  5GZZ B;  3WGX A;  4EE0 A;  3PPU A;  5E59 A;  2HXK A;  2P0G A;  4JED A;  7GSS A;  4IN0 A;  5D96 A;  1VF4 A;  3P2A A;  4I8B A;  1GP1 A;  1PGT A;  3GN3 A;  4MA9 A;  1GSU A;  4HZ4 A;  5CRW A;  2I3Y A;  3N5O A;  1YKC A;  2LTK A;  1G6Y A;  2R0P A;  3I69 A;  2L5L A;  4XRD A;  2IMF A;  2J9H A;  3L0H A;  2XPD A;  5ECK B;  4WKW A;  1XFL A;  4IHU A;  3HZ4 A;  5DQS A;  1WE0 A;  3HKR A;  4HU7 A;  2MMZ A;  1TW9 A;  2TRX A;  3FYG A;  4YQV A;  4ZL7 A;  5FT3 A;  1JZW A;  2E7P A;  6GSW A;  1WOU A;  4TVE A;  1SU9 A;  1EWX A;  4EVM A;  4F0C A;  1T3B A;  5GAP D;  1QGV A;  3GKX A;  4QL7 A;  1PX7 A;  5DJM A;  4Q5R A;  1XCC A;  2AAW A;  4PX1 A;  3ZTL A;  4BPY A;  1GTU A;  3W6G A;  5KN2 A;  5L71 A;  3VI5 A;  3D4T A;  4Z7X A;  3BBY A;  3TCO A;  3NOF A;  5HFI A;  5HQP A;  5J9B A;  1LU4 A;  1U87 A;  4K5R A;  3EWL A;  3CTG A;  3RPP A;  4V1A g;  2N5A A;  3F4T A;  3QAV A;  4GCI A;  3LEF A;  3KD0 A;  1MDJ A;  1ILO A;  3S9F A;  2X64 A;  5IO2 A;  1TRS A;  2REM A;  4XS1 A;  1WJK A;  3RDW A;  3IC8 A;  2VL3 A;  4JBB A;  4PNF A;  3VK9 A;  1WIK A;  2H1G A;  1ZOF A;  2ALB A;  4X1U A;  3ERW A;  5A5K A;  2WB9 A;  1K0D A;  2OBI A;  3EMP A;  3MDK A;  1GUK A;  5AN1 A;  5HR1 A;  4BVX A;  1G7O A;  2CAI A;  3TJJ A;  4L5O A;  2R0C A;  1FHE A;  3IAS 2;  2QC7 A;  2IMI A;  3ERG A;  1GWC A;  3FZA A;  3GNJ A;  2C0D A;  5CP1 A;  2IIY A;  3W8S A;  2AHE A;  4MF5 A;  2GSR A;  1ZYE A;  3F6F A;  2YV9 A;  4WEY A;  2WRT A;  2A4H A;  5J5N A;  4PTS A;  5B8B A;  3HZ8 A;  2HE3 A;  4ILF A;  2VCV A;  2LEG A;  1M7T A;  1MTC A;  3KH9 A;  4OD7 A;  3LYK A;  4GWR A;  4AGS A;  2LST A;  3TKQ A;  2B1K A;  4IQA A;  1YY7 A;  3KP8 A;  1AIU A;  4Z2R A;  4GTU A;  2H74 A;  3ZIT A;  1GUL A;  3VWX A;  1V58 A;  4ZB8 A;  3L9V A;  4MF7 A;  2FHE A;  4I2T A;  2EC4 A;  3ZVJ D;  2ON5 A;  4MAB A;  3FKF A;  1XXU A;  3ZRE A;  3IHQ A;  2L6D A;  1W4V A;  3EMX A;  3EIN A;  3VI7 A;  5ECI B;  1K0O A;  2JSY A;  3HYP A;  4OCE A;  1EEM A;  2TRC P;  1VGL A;  2H73 A;  4I5Q A;  4HQS A;  2OJL A;  3F63 A;  4TR1 A;  1ZCP A;  4F82 A;  4J57 E;  2MMA A;  2MBS A;  4LMW A;  2GZP A;  2X4A A;  1GSY A;  1X5E A;  3QAW A;  4O32 A;  1XWC A;  1K3Y A;  3GL5 A;  4J2F A;  3HJM A;  5JWR B;  4O7H A;  1SL0 B;  4X0X A;  2HNL A;  2VL2 C;  2YZH A;  4FO5 A;  1BAY A;  2LJR A;  2LJA A;  1U3I A;  5LD0 A;  1GSF A;  3F6D A;  1QK8 A;  4N11 A;  4RUV A;  4MNN A;  4XRA A;  5DAK B;  1OAZ A;  1FB6 A;  4XTS A;  4L8E A;  5B8A A;  1O85 A;  3Q19 A;  2H8L A;  3ZYW A;  1RW1 A;  3KIJ A;  5G2Z A;  1THO A;  3GH9 A;  3HY2 A;  1GTB A;  3LW9 A;  3M8N A;  5CAX A;  5J41 A;  4PXO A;  3L9U A;  5H5Q A;  1EZK A;  3ERF A;  1QXH A;  4HI7 A;  1X5C A;  4I97 A;  4TN8 A;  4K7N A;  5GAN D;  2FUG 2;  2IMK A;  4IP6 A;  2YNX A;  6GST A;  5KOX A;  5E4W A;  4DSS B;  3KMO A;  5D9X A;  2AYT A;  3GKM A;  1TXX A;  2P5R A;  3LWA A;  2LV3 A;  4Z2T A;  16GS A;  3CXG A;  5CRH A;  4POB A;  3FW2 A;  3GYK A;  1KEB A;  1X5D A;  2M80 A;  2XHF A;  3TDG A;  1SK2 A;  4PQI A;  1OC8 A;  3KMN A;  3CBU A;  4TOP A;  4EIP A;  3APQ A;  2KP2 A;  1CQG A;  3GFK A;  3P90 A;  2LJK A;  5A4W A;  1S3D A;  2OAC A;  1E2Y A;  1MDI A;  3OR5 A;  1BJX A;  2JAC A;  1NSW A;  1A2M A;  2CV4 A;  2X8H A;  4K0G A;  1ML6 A;  4WR5 A;  1XVQ A;  4LLR A;  1PMT A;  3D0Z A;  1YF1 A;  2VCX A;  3FHK A;  3WT1 A;  5IPH A;  1A23 A;  1AUC A;  1AXD A;  4NPB A;  4ECB A;  1WPI A;  3C8E A;  1K0N A;  4JZQ A;  4OFN A;  3EUR A;  1EOH A;  12GS A;  4ZB6 A;  3RPN A;  1YZX A;  3DWV A;  2FWF A;  2VCZ A;  1Z7R A;  3P8W A;  5CRD A;  4F03 A;  2JU5 A;  4BL7 A;  2IFQ B;  2RUF A;  5ECL B;  4TW5 A;  3IE3 A;  4K7I A;  1K0B A;  2NVL A;  1YEX A;  4KDU A;  3DGQ A;  1JZD A;  3QDN A;  3FR3 A;  2F8F A;  2H6Y A;  4GLT A;  2DKH A;  1KNG A;  4GXZ A;  1PX6 A;  1ERU A;  2C0G A;  4DEJ A;  1R4W A;  4K5S A;  5EPF A;  3O6T A;  3HDC A;  3BJ5 A;  3GKK A;  2BTO T;  3QAG A;  4O5Q A;  1DSB A;  2CVD A;  2QA1 A;  3GUS A;  3EU4 A;  1WWJ A;  4MJE A;  1A2L A;  1SJ6 A;  2H0G A;  2OBK A;  2XPE A;  1OE7 A;  3M0F A;  3G9B A;  2L5O A;  4E8H A;  3J7Y b;  4K6X A;  1UVZ A;  3LXT A;  1V2A A;  3L4N A;  4YKF A;  2E0Q A;  3UAR A;  4BA7 A;  5JWO B;  3FY7 A;  3O3T A;  5C04 A;  5IMA A;  1EEJ A;  2HLS A;  4OWY A;  4X4J A;  1A24 A;  2AUV A;  3DD3 A;  2VO4 A;  1GLP A;  3IOS A;  3JCM L;  4OMV A;  3FK8 A;  2ES7 A;  1Z6M A;  1TK0 B;  4G0L A;  1MDK A;  3WYW A;  4MMM A;  4PNG A;  1NW2 A;  4ACS A;  3TKS A;  2NTO A;  4GF0 A;  1EGR A;  3TJB A;  5ECN B;  17GS A;  2DKI A;  4KW6 A;  1THX A;  1MD3 A;  5ECR B;  4ML6 A;  5F0G A;  4Z2U A;  1T7P B;  1TU7 A;  3GRX A;  3PGT A;  1GL8 A;  13GS A;  3QOU A;  2K6V A;  4KB3 A;  1BG5 A;  1G0T A;  2PMT A;  3EC3 A;  3ED3 A;  2MMN A;  5IIZ A;  5BMU A;  3L9S A;  2KLX A;  5EY6 A;  4GQC A;  2MZC A;  4TR4 A;  3RBT A;  4YAP A;  2VAF A;  2PVO C;  1MEK A;  2RM5 A;  5B7C A;  2C80 A;  3KZQ A;  4ZIL A;  2GSQ A;  2PGT A;  3HCZ A;  5FHI A;  5F07 A;  3A3T A;  3LSZ A;  2A2R A;  2F51 A;  1HNA A;  2C3N A;  3GH6 A;  5D93 A;  2ZNM A;  4MP4 A;  2N5F A;  4EO3 A;  2N5B A;  2L57 A;  1FVJ A;  2GS3 A;  2L4Q A;  3UBK A;  1LJR A;  2VUP A;  2XBI A;  5ID2 B;  1VF3 A;  3A5I A;  3GUR A;  4G19 A;  1FB0 A;  2H01 A;  1YF0 A;  1A2J A;  1S3A A;  3LOR A;  3QCP A;  2VCT A;  3GX0 A;  1GSS A;  3IK9 A;  4KUN A;  1X9W B;  4MK3 A;  1YDK A;  3GTU A;  1M99 A;  4TR0 A;  2B5E A;  1BYE A;  3E3E A;  2BJX A;  4CDO A;  2RLI A;  1K3O A;  2FLS A;  3EU3 A;  1R7H A;  2VCW A;  1F6M C;  4KND A;  4K1F A;  4D73 A;  1ERW A;  2R2J A;  1IYH A;  2H1A A;  3FRC A;  3DML A;  3KTL A;  2X49 A;  4MZB A;  3WGE A;  2H0H A;  2CVK A;  3ME8 A;  2YV7 A;  3G7I A;  4FYU A;  2IMD A;  3TKP A;  3D4M A;  5CRE A;  1TI3 A;  4K7O A;  4CW9 A;  4ECJ A;  1JHB A;  2GLR A;  3H79 A;  1FOH A;  3TRP A;  4HZ2 A;  1TTZ A;  3FR6 A;  2LQQ A;  3HVV A;  1MD4 A;  1TKD B;  4DSQ A;  1OC3 A;  2OA7 A;  1R5P A;  4GRF A;  5AIS A;  3GST A;  1V98 A;  1ERV A;  3M3M A;  4PUR A;  1SD8 A;  1EGO A;  3TRQ A;  2I4A A;  5AGY A;  4ISD A;  3PH9 A;  5IMF A;  3IAM 2;  1Y25 A;  3DVW A;  2PUK C;  3A2X A;  2HRN A;  1HD2 A;  3UAP A;  4KSM A;  3AY8 A;  4J56 E;  4NAX A;  5HR0 A;  2PPT A;  2E2G A;  2H72 A;  2DC5 A;  1C72 A;  2FWE A;  4N0Z A;  1UC7 A;  1A8Y A;  1IYI A;  3P7X A;  3CSJ A;  3ZIJ A;  4H86 A;  2PER A;  1FVK A;  3BCI A;  3UIW A;  1OYJ A;  1ZMA A;  2X8C A;  3D5J A;  4K2X A;  3W8J A;  5IOX A;  1FAA A;  4HU9 A;  1USB A;  1XWG A;  3EVI A;  4MLY A;  2EIO A;  2HRK A;  4HOJ A;  4KAE A;  4XIH A;  1SD9 A;  1TRV A;  2IN3 A;  4TRX A;  2WZ9 A;  4MDC A;  3NZN A;  1SJZ A;  3H93 A;  1SL1 B;  4HUA A;  2KUC A;  3KJY A;  5A4V A;  2H6X A;  1H4O A;  3ZFB A;  2LS5 A;  2H75 A;  3V1W A;  2A2P A;  4FIW A;  2I81 A;  2VM2 A;  3C7M A;  2IWT A;  4I6X A;  1QFN A;  4K8M A;  5GST A;  5KN3 A;  4AF2 A;  3Q74 A;  5HR2 A;  5DVB A;  1SYX A;  2F9S A;  2LQO A;  3C1R A;  2R3X A;  4KCE A;  4LMV A;  3DVX A;  2KP1 A;  2K8V A;  4ZIJ A;  3GTU B;  2GSS A;  2VCQ A;  5C00 A;  4POK A;  2K18 A;  5IQY A;  3HA9 A;  4X43 A;  1N8J A;  3ISO A;  1BQ7 A;  4IVF A;  4XS4 A;  1OKT A;  5LNK e;  3ZVJ A;  3A5W A;  1EV9 A;  1I9D A;  1J0F A;  4IJ3 A;  5B6N A;  3MAK A;  4JU5 A;  4D73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...